List of the P35 lipoprotein homologues.

Number of CDSsMYPE No.PositionLength (amino acid)Deduced M.W.(dalton)Description and it's productIdentity with the p35Mutation with a frrameshift (MYPE No.)Amino acid sequence at the N-terminal (Bold is Cys residue)
42620335914..33747351957090p35 gene homologue38%
MKTKKIKLLKTLALTGAFGIIATVPVIVSSCSTTSDN
2630337750..33930651856980p35 gene homologue34%
MKTAKKKVLKTLAITGAFGIIATVPVIISACSSASNN
2690352719..35382536840480p35 gene homologue60%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTDNN
2700354128..35527938342130p35 gene homologue49%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTDNG
306490complement(831015..832199)39443340p35 gene homologue46%
MKIKKIKLLKALALTGAFGIVATVPIIVSSCSSTGDN
6500complement(832669..833658)32936190p35 gene homologue fragment 50%6495-6500MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6510complement(833955..835139)39443340p35 gene homologue43%
MKIKKIKLLKALAMTGAFGIVATVPVIVSACSSTSDN
6520complement(836106..836645)17919690p35 gene homologue fragment51%6520-6525MKIKKIKLLKALAMTGAFGIIATVPVIVSSCSSTSDN
6530complement(836957..838117)38642460p35 gene homologue43%
MKIKKIKLLKALAMTGAFGIIATVPVIVSSCSSTSDN
6540complement(838407..839543)37841580p35 gene homologue43%
MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6550complement(839924..840985)35338830p35 gene homologue45%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN
6560complement(841270..842445)39143010p35 gene homologue42%
MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6570complement(842735..843859)37441140p35 gene homologue53%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTDN
6580complement(844164..845363)39943890p35 gene homologue42%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTDN
6590complement(845665..846762)36540150p35 gene homologue43%
MKNKKIKLLKTLATVGSFVIVSTVPAIISACSSTADQ
6630complement(850970..852142)39042900p35 gene homologue reported as imp13 (P46)42%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN
6640complement(852586..853752)38842680p35 gene homologue43%
MKIKKIKLLKALALTGAFGIVATVPVIVSACSSTN
6650complement(854049..855209)38642460p35 gene homologue45%
MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6660complement(855889..857058)38942790p35 gene homologue41%
MKIKKIKLLKALAITGAFGIVATVPVIVSSCSSTSDN
6670complement(857352..858488)37841580p35 gene homologue51%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN
6680complement(858786..859937)38342130p35 gene homologue48%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN
6690complement(860232..861398)38842680p35 gene homologue47%
MKIKKIKLLKALALTGAFGIVATVPIIVSSCSSTSDN
6710complement(862483..863619)37841580p35 gene homologue47%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN
6720complement(863908..865074)38842680p35 gene homologue46%
MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6730complement(865362..866516)38442240p35 gene homologue45%
MKIKKIKLLKALAMTGAFGIVATVPVIVSACSSTSDN
6740complement(866864..867925)35338830p35 gene homologue47%
MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6750complement(868230..869384)38442240p35 gene homologue43%
MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN
6780complement(871412..872563)38342130p35 gene homologue reported as p38 (P38)51%
MKIKKIKLLKALALTGAFGIVATVPIIVSSCSSTDNG
6790complement(872868..874187)43948290p35 gene homologue39%
MKIKKIKLLKALALTSTLGIVSIVPIIISSCSVADN
6800complement(874612..875742)37641360p35 gene homologue reported as p33 (P30)55%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTDN
6810complement(876041..877129)36239820p35 gene (P35)
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSEN
6820complement(877416..878543)37541250p35 gene homologue reported as imp14 (P34A)57%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN
6830complement(878839..879924)36139710p35 gene homologue67%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNN
6840complement(880225..881313)36239820p35 gene homologue70%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNN
47330complement(966342..967895)51756870p35 gene homologue 35%
MKIKKNKLLKSLLLTGTFGIVITIPAIVSACSSIKEKND
7370complement(970527..971624)36540150p35 gene homologue46%
MKIKKIKLLKALALTGAFGIVSAVPLIVSSCSSTDN
7380complement(973092..973526)15216720p35 gene homologue fragment 52%7375-7380MKIKKIKLLKALALTGAFGIIATVPVIVSSCSSTSEN
7400complement(973865..975013)38242020p35 gene homologue46%
MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSEN
67020complement(918826..920919)69776670signal-peptide-less P35 gene homologue45%
MKSQRKKLLKILSITGIFVATAAVPITLLSKYVISASLTNSKNQN
7030complement(922739..923353)20422440signal-peptide-less P35 gene homologue32%7030-7035MKSNVAKLLKISSVVGIFAASTAAPISLVSMYVFSNKSLSDSNG
7040complement(923612..925753)71378430signal-peptide-less P35 gene homologue35%
MKSKRSKLLKILSVIGIFAVSAAVPITLVSKYVIFTKTSSSNGNV
7050complement(925987..928065)69276120signal-peptide-less P35 gene homologue 43%
MKSKKDTKSKKGKFWKILAITGIFTVSAATPIALVSKYVIFKNS
7060complement(928473..929957)49454340signal-peptide-less P35 gene homologue 29%
MKTQRSKIGKVIALSGIFTVTAAVPAAVLSSAALNGNFANNQSG
7070complement(930370..932427)68575350signal-peptide-less P35 gene homologue38%
MNSSRKKIKTWGLTGIFAASAAIPVVLISRYVLFRNSSSINNQNS