>gi|26553621|ref|NP_757555.1| hypothetical protein MYPE1680 [Mycoplasma penetrans HF-2] >gi|26453627|dbj|BAC43959.1| hypothetical protein [Mycoplasma penetrans HF-2] (166 aa)
Score = 449, Expect = 2.2e-43, Identities = 166/166 (100%), Positives = 166/166 (100%)
  Q:     1 MNKYLSLIPTLGLGLLAFGCSSNSNSNNDNSNSIDSNNSDSNNNWNNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN 166
           MNKYLSLIPTLGLGLLAFGCSSNSNSNNDNSNSIDSNNSDSNNNWNNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN
  S:     1 MNKYLSLIPTLGLGLLAFGCSSNSNSNNDNSNSIDSNNSDSNNNWNNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN 166
>gi|189460774|ref|ZP_03009559.1| hypothetical protein BACCOP_01421 [Bacteroides coprocola DSM 17136] >gi|189432493|gb|EDV01478.1| hypothetical protein BACCOP_01421 [Bacteroides coprocola DSM 17136] (168 aa)
Score = 263, Expect = 8.6e-22, Identities = 68/164 (41%), Positives = 108/164 (65%)
  Q:     3 KYLSLIPTLGLGLLAF-GCSSNSNSNNDNSNSIDSNN--SDSNNNWNNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN 166
           K +S    L  GLL F  CS +   + D + S  S+N   D+++   + VK +V+ IN  PF   LE+N TV  FL+LLPL+ ++M +LN NEKY YL ++L  ++ +  +I  GD+MLYG+NC+V+FY+TF+S+YSY+++G I++   L D+L      NV+++F+
  S:     2 KIVSFKYCLIAGLLFFTACSPDDIPDIDETISPPSSNVPEDNDDGDCSPVKQIVVTINKTPFTATLENNETVREFLDLLPLT-VDMTELNGNEKYCYLPQSLPVDSRQIDVIQTGDLMLYGSNCIVLFYQTFSSSYSYTRLGRIDHTTGLKDIL---GQGNVTVNFH 164
>gi|171057412|ref|YP_001789761.1| hypothetical protein Lcho_0721 [Leptothrix cholodnii SP-6] >gi|170774857|gb|ACB32996.1| conserved hypothetical protein [Leptothrix cholodnii SP-6] (170 aa)
Score = 253, Expect = 1.4e-20, Identities = 49/95 (51%), Positives = 66/95 (69%)
  Q:    61 FNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDT 155
           F   LE+N T  +F  +LPL+ L+M DLN NEK++ L  +L T+  +PG I  GDVMLYG++ LV+FYKTF S+YSY++IG +  VD LV  L T
  S:    67 FAVTLENNPTARAFAQMLPLT-LDMPDLNDNEKHVRLPHSLPTHAQRPGTIRTGDVMLYGSDTLVVFYKTFPSSYSYTRIGRVTPVDGLVQALGT 160
>gi|170721773|ref|YP_001749461.1| hypothetical protein PputW619_2598 [Pseudomonas putida W619] >gi|169759776|gb|ACA73092.1| conserved hypothetical protein [Pseudomonas putida W619] (113 aa)
Score = 224, Expect = 3.1e-17, Identities = 51/106 (48%), Positives = 68/106 (64%)
  Q:    61 FNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN 166
           +   L+   T  +F +L PL+ L M DLNSNEK+  L  +L  N   PG+I AGD+MLYG+  LV+FYKTF + YSY++IG IEN D LV +L      NV I+F+
  S:    10 YTITLDDTETARAFASLAPLT-LTMADLNSNEKHADLMVSLPGNPKAPGMITAGDLMLYGSKTLVVFYKTFQTPYSYTRIGKIENPDGLVQVL---GHGNVKIEFS 111
>gi|152995968|ref|YP_001340803.1| hypothetical protein Mmwyl1_1944 [Marinomonas sp. MWYL1] >gi|150836892|gb|ABR70868.1| conserved hypothetical protein [Marinomonas sp. MWYL1] (179 aa)
Score = 220, Expect = 8.9e-17, Identities = 50/112 (44%), Positives = 69/112 (61%)
  Q:    46 NNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRN 157
           N+    + I I    F   L        F  +LPL+ L+M+DLNSNEK   L + L+T+TY+PG IN GD+ML+G+  +VIFYKTF ++YSY++IG IE   +L   L  RN
  S:    61 NSEESRIWITIGEHRFAATLADTDAAREFAAMLPLT-LDMDDLNSNEKEADLPKALSTDTYRPGTINNGDLMLWGSRTMVIFYKTFNTSYSYTRIGHIEEAADLPQELGWRN 171
>gi|160882843|ref|ZP_02063846.1| hypothetical protein BACOVA_00805 [Bacteroides ovatus ATCC 8483] >gi|156111707|gb|EDO13452.1| hypothetical protein BACOVA_00805 [Bacteroides ovatus ATCC 8483] (183 aa)
Score = 210, Expect = 1.1e-15, Identities = 50/119 (42%), Positives = 79/119 (66%)
  Q:    46 NNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSID 164
           +NN+K   I I    FN  L++N T  +F  LLP++ ++M++L+ NEKY YLS+ L T +  PG I  GD+MLYG+ C+V+FY+TF+++Y+Y+++G I N   L   L +   VNV+ +
  S:    67 SNNLK---ITIGPVSFNATLDNNETAKAFKRLLPMT-VDMSELHGNEKYYYLSKGLPTASSNPGTIRTGDLMLYGSTCVVLFYETFSTSYTYTRLGRITNPSGLASALGS-GGVNVTFE 180
>gi|109644851|ref|ZP_01368771.1| conserved hypothetical protein [Desulfitobacterium hafniense DCB-2] >gi|109642800|gb|EAT52353.1| conserved hypothetical protein [Desulfitobacterium hafniense DCB-2] (168 aa)
Score = 195, Expect = 6.7e-14, Identities = 45/121 (37%), Positives = 74/121 (61%)
  Q:    46 NNNVKSLVININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN 166
           +N + SL + I  + F   L  N +  S L       L M++LN NEK+ + SE L + + + G I  GD+MLYG++CLV+FY++F ++YSY+++GT+++V  L + L +  SV V+   N
  S:    50 SNAMPSLALRIGDKNFRATLYDNDSTRS-LLKKLPLTLTMDELNGNEKFYFFSEKLPSASERVGSIKTGDLMLYGSDCLVLFYESFPTSYSYTRLGTVDDVTGLANALGS-GSVEVTFSIN 168
>gi|77972567|ref|ZP_00828130.1| COG4925: Uncharacterized conserved protein [Yersinia frederiksenii ATCC 33641] (164 aa)
Score = 190, Expect = 2.7e-13, Identities = 40/104 (38%), Positives = 62/104 (59%)
  Q:    54 ININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRN 157
           + I+ Q +  +L  N T  SF+  LPL+ L M +LN NEK+  L   L     KPGI+  G++MLYG   LV+FY+ F ++YSY+ IG +   + L+ ++  +N
  S:    55 MTIHQQTYEILLADNPTAKSFVEQLPLT-LIMKELNGNEKFADLPHALPARQIKPGILQEGELMLYGRQTLVLFYEAFQTSYSYTSIGKVIAPENLIRVVGDKN 157
>gi|172057663|ref|YP_001814123.1| hypothetical protein Exig_1651 [Exiguobacterium sibiricum 255-15] >gi|171990184|gb|ACB61106.1| hypothetical protein Exig_1651 [Exiguobacterium sibiricum 255-15] (156 aa)
Score = 185, Expect = 1.1e-12, Identities = 39/90 (43%), Positives = 53/90 (58%)
  Q:    54 ININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTI 143
           I INGQ  +  LE N+T  + L  +P + + M+DL+ NEKY Y  ++  T       I AGDV+LY NNCLVIFY+       Y++IG I
  S:    41 ITINGQVASVQLEDNATTKAILAEMPFT-IQMDDLHQNEKYYYFDKSFPTQPQAIQSIEAGDVLLYQNNCLVIFYQAVEPVVPYTRIGKI 129
>gi|187922069|ref|YP_001893711.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] >gi|187713263|gb|ACD14487.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] (172 aa)
Score = 181, Expect = 2.6e-12, Identities = 35/75 (46%), Positives = 52/75 (69%)
  Q:    83 LNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRN 157
           L+M +LN NEK+  +S++L  N  +PG I  GD+MLYG+  LV+FY+TF S+YSY++IG +++   L   L  RN
  S:    90 LDMAELNGNEKHGEVSKSLPINASRPGTIRNGDLMLYGSRTLVVFYQTFDSSYSYTRIGRVDDPTSLAQTLGDRN 164
>gi|167756301|ref|ZP_02428428.1| hypothetical protein CLORAM_01834 [Clostridium ramosum DSM 1402] >gi|167703709|gb|EDS18288.1| hypothetical protein CLORAM_01834 [Clostridium ramosum DSM 1402] (145 aa)
Score = 160, Expect = 7.8e-10, Identities = 41/97 (42%), Positives = 60/97 (61%)
  Q:    54 ININGQPFNTILESNSTVNSFLNLLPLSNLNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIE---NVDELV 150
           I INGQ F   L+   T  + L  LP+  L M +LN NEK+  L  +L   +     IN GD+ML+ +NCLV+FY+ F S Y Y++IG I+   N++++V
  S:    26 IEINGQMFLATLDDTPTSQALLEKLPMV-LTMKELNGNEKFYNLEYSLPVTSQSVNQINKGDLMLFHDNCLVLFYQDFLSKYQYTRIGQIDDAGNINQIV 124
>gi|190150233|ref|YP_001968758.1| hypothetical protein APP7_0964 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915364|gb|ACE61616.1| hypothetical protein APP7_0964 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (135 aa)
Score = 132, Expect = 1.2e-06, Identities = 31/80 (38%), Positives = 43/80 (53%)
  Q:    85 MNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSID 164
           M D   NEK+  L + L       G I  GD++L+  N LVIFY+ F + Y Y+ IG I NV  L + L  + S+ VS +
  S:    56 MQDHLRNEKFAELPQNLTAYDQAVGSIQTGDILLWQGNTLVIFYERFDTPYHYTNIGKIHNVKGLKEALG-KGSIKVSFE 134
>gi|46143882|ref|ZP_00204589.1| hypothetical protein Aple02000164 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (135 aa)
Score = 132, Expect = 1.5e-06, Identities = 31/80 (38%), Positives = 43/80 (53%)
  Q:    85 MNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSID 164
           M D   NEK+  L + L       G I  GD++L+  N LVIFY+ F + Y Y+ IG I NV  L + L  + S+ VS +
  S:    56 MQDHLRNEKFAELPQNLTAYDQAVGSIQTGDILLWQGNTLVIFYERFDTPYRYTNIGKIHNVSGLKEALG-KGSIKVSFE 134
>gi|126208381|ref|YP_001053606.1| hypothetical protein APL_0905 [Actinobacillus pleuropneumoniae L20] >gi|126097173|gb|ABN74001.1| hypothetical protein APL_0905 [Actinobacillus pleuropneumoniae L20] (112 aa)
Score = 129, Expect = 2.6e-06, Identities = 31/80 (38%), Positives = 43/80 (53%)
  Q:    85 MNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSID 164
           M D   NEK+  L + L       G I  GD++L+  N LVIFY+ F + Y Y+ IG I NV  L + L  + S+ VS +
  S:    33 MQDHLRNEKFAELPQNLTAYDQAVGSIQTGDILLWQGNTLVIFYERFDTPYRYTNIGKIHNVSGLKEALG-KGSIKVSFE 111
>gi|165976326|ref|YP_001651919.1| hypothetical protein APJL_0917 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876427|gb|ABY69475.1| hypothetical protein APJL_0917 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (112 aa)
Score = 128, Expect = 3.7e-06, Identities = 31/80 (38%), Positives = 43/80 (53%)
  Q:    85 MNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSID 164
           M D   NEK+  L + L       G I  GD++L+  N LVIFY+ F + Y Y+ IG I NV  L + L  + S+ VS +
  S:    33 MQDHLRNEKFAELPQNLTAYDQPVGSIQTGDILLWQGNTLVIFYERFDTPYRYTNIGKIHNVSGLKEALG-KGSIKVSFE 111
>gi|160936707|ref|ZP_02084074.1| hypothetical protein CLOBOL_01598 [Clostridium bolteae ATCC BAA-613] >gi|158440498|gb|EDP18243.1| hypothetical protein CLOBOL_01598 [Clostridium bolteae ATCC BAA-613] (172 aa)
Score = 102, Expect = 4.3e-03, Identities = 32/116 (27%), Positives = 64/116 (55%)
  Q:    51 SLVININGQPFNTILESNSTVNSFLNLLPLSN--LNMNDLNSNEKYIYLSETLNTNTYKPGIINAGDVMLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVSIDFN 166
           ++ + I    F   LE N+ V+SF+ ++  +   + MND +  EK   +  +L  +  +     +GD++LY  N +VIFY   ++++SY+++G I   D+L    +   S +V++ F+
  S:    59 TMNVQIGSSTFTATLEDNTAVDSFVRMMQTAPVVIQMNDYSGFEKVGSIGTSLPASNSQT-TTQSGDIVLYNGNQIVIFYG--SNSWSYTRLGKI---DDLSGWTEALGSGDVTVTFS 170
>gi|169335735|ref|ZP_02862928.1| hypothetical protein ANASTE_02155 [Anaerofustis stercorihominis DSM 17244] >gi|169258473|gb|EDS72439.1| hypothetical protein ANASTE_02155 [Anaerofustis stercorihominis DSM 17244] (53 aa)
Score = 99, Expect = 7.9e-03, Identities = 20/46 (43%), Positives = 33/46 (71%)
  Q:   117 MLYGNNCLVIFYKTFTSNYSYSKIGTIENVDELVDLLDTRNSVNVS 162
           MLYG++C+VIFYK F +   Y+++G IE+ ++L D+L   N V ++
  S:     1 MLYGSDCIVIFYKDFETFNKYTRLGYIEDKEKLSDILKNNNDVKIT 46