>gi|13507961|ref|NP_109910.1| PP-loop superfamily protein ATPase [Mycoplasma pneumoniae M129] >gi|2496288|sp|P75549|TILS_MYCPN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|1674311|gb|AAB96257.1| PP-loop superfamily ATPase/cell cycle protein MESJ-like protein [Mycoplasma pneumoniae M129] (289 aa)
Score = 1548, Expect = 3.2e-170, Identities = 289/289 (100%), Positives = 289/289 (100%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLLYKS 289
           MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLLYKS
  S:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLLYKS 289
>gi|12044936|ref|NP_072746.1| tRNA(Ile)-lysidine synthetase [Mycoplasma genitalium G37] >gi|1351480|sp|P47330|TILS_MYCGE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3844671|gb|AAC71302.1| tRNA(Ile)-lysidine synthetase [Mycoplasma genitalium G37] >gi|166078989|gb|ABY79607.1| tRNA(Ile)-lysidine synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (290 aa)
Score = 1144, Expect = 2.3e-123, Identities = 205/285 (71%), Positives = 246/285 (86%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLLYKS 289
           QYIAGVSGG DSML+LKLY KKIACVVHVNYN R+T+LRDQK+VE+YC++L +PL+VHTV  D VWKKNFQ QARKIRF+QF+K A LY+ +KLLLAHHRDDFIEQAKMQLDA+KRA+YYGIKTR ELYG+K+YRP +KYWK+EI+ALC +  +PY IDETN  PIYKRN+VR EI  WSK EKE+FYI +CAMN+ I QKLF LMK+AK+WL  PDVRELKR+ + DQ+QL+YS+LI H I+V G+KIDAILDFIQP QQK YRL+++IFL +K++ L LLYKS
  S:     6 QYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVEQYCQKLNIPLVVHTVDPDLVWKKNFQNQARKIRFDQFKKTAKLYQTNKLLLAHHRDDFIEQAKMQLDAKKRAVYYGIKTRCELYGLKIYRPLMKYWKDEIIALCRQDHIPYEIDETNKLPIYKRNEVRLEIEKWSKIEKEQFYIAICAMNKTIAQKLFVLMKKAKKWLLQPDVRELKRFSIIDQKQLIYSYLIYHKINVNGEKIDAILDFIQPSQQKQYRLQNDIFLMVKNQCLALLYKS 290
>gi|31544871|ref|NP_853449.1| hypothetical protein MGA_0507 [Mycoplasma gallisepticum R] >gi|61216586|sp|Q7NAI9|TILS_MYCGA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|31541717|gb|AAP57017.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (287 aa)
Score = 508, Expect = 1.3e-49, Identities = 104/274 (37%), Positives = 163/274 (59%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKE---EFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFL 276
           K QY+ GVSGGPDS+ LL  Y  +I    H+NYNKR TALRDQ +V +YC + K+PL + +V     + KNFQ QARKIR++ F      Y+VD+ L+AHH+DDF+E A MQ D  +  ++YG+        +K++RP +  WK+EIL+  E+ K+ YG+DE+N    Y+RN++R  ++  S+E+K+   +F++ +   N+V  Q +       K + +  D   L      +   L+Y +   ++I  +  K + IL F+Q    K +RLK  ++L
  S:     6 KKQYLIGVSGGPDSIYLLDRYQDQIKVACHINYNKRPTALRDQLIVSDYCLKNKIPLEILSVSPSYQYHKNFQDQARKIRYDFFLSTGLKYQVDQCLIAHHKDDFLETAIMQYDKNQELLFYGLHQESSYQSLKIFRPLLNLWKDEILSYLEQDKIVYGVDESNFLSTYQRNKIRTNLSKLSQEQKQARLDFFLELNKKNQVRYQSV-------KDFFSSWDCNYLDLINSLEYYNLLYLWFSKNNIKYSKQKAENILSFLQKKNNKRFRLKAGVYL 275
>gi|188530709|ref|ZP_03005041.1| hypothetical protein Uurese_01000002_0200000853 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] (326 aa)
Score = 436, Expect = 3.0e-41, Identities = 107/286 (37%), Positives = 172/286 (60%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELK-RYPL------PDQRQLVYSFLITHHI-DVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I+ V HVNY+KR +A RDQ++V ++CK+  +P+ +  V E    K     NFQA+AR IR++ F++    Y +  L +AH+ DDF+E A MQ   + +A++YGIK    + GM V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I+NWS  E  +F   V   N+      F+        L++ + ++ K RY          Q  L+Y FLI   I +   +KI +++ F   Q  ++K YR+++ +++ + ++ L  L
  S:    12 ITNKKYLAAVSGGPDSMAMLNMYKRNISVVCHVNYHKRESADRDQEIVVDFCKKNNLPIEILDVDEKVYEKYAHIDNFQAKARLIRYDFFKEIGKKYNIQHLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVVNGMIVKRPVLFICKQTLQRYCDENKIKYGIDETNELDIYERNRVRKTISNWSLNEVYDFKKAVLKYNK--EHSSFANFVE----LSYIEFKKNKYRYDYFVRQDDGVQYYLIYYFLIDQKISNPNENKIISLIKFFGKQINKEKAYRVQENLYIHVNEDDLISL 305
>gi|188592576|ref|ZP_03005890.1| hypothetical protein Uureaserovar_01485 [Ureaplasma urealyticum serovar 10] >gi|195867457|ref|ZP_03079461.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660933|gb|EDX54186.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (326 aa)
Score = 434, Expect = 4.1e-41, Identities = 107/286 (37%), Positives = 172/286 (60%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELK-RYPL------PDQRQLVYSFLITHHI-DVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I+ V HVNY+KR +A RDQ++V ++CK+  +P+ +  V E    K     NFQA+AR IR++ F++    Y +  L +AH+ DDF+E A MQ   + +A++YGIK    + GM V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I+NWS  E  +F   V   N+      F+        L++ + ++ K RY          Q  L+Y FLI   I +   +KI +++ F   Q  ++K YR+++ +++ + ++ L  L
  S:    12 ITNKKYLAAVSGGPDSMAMLNMYKRNISVVCHVNYHKRESADRDQEIVVDFCKKNNLPIEILDVDEKVYEKYAHIDNFQAKARLIRYDFFKEIGKKYNIQHLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVVNGMIVKRPVLFIRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKTISNWSLNEVYDFKKAVLKYNK--EHSSFANFVE----LSYIEFKKNKYRYDYFVRQDDGVQYYLIYYFLIDQKISNPNENKIISLIKFFGKQINKEKAYRVQENLYMHVNEDDLISL 305
>gi|171920688|ref|ZP_02931912.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903424|gb|EDT49713.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (326 aa)
Score = 434, Expect = 4.2e-41, Identities = 107/286 (37%), Positives = 172/286 (60%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELK-RYPL------PDQRQLVYSFLITHHI-DVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I+ V HVNY+KR +A RDQ++V ++CK+  +P+ +  V E    K     NFQA+AR IR++ F++    Y +  L +AH+ DDF+E A MQ   + +A++YGIK    + GM V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I+NWS  E  +F   V   N+      F+        L++ + ++ K RY          Q  L+Y FLI   I +   +KI +++ F   Q  ++K YR+++ +++ + ++ L  L
  S:    12 ITNKKYLAAVSGGPDSMAMLNMYKRNISVVCHVNYHKRESADRDQEIVVDFCKKNNLPIEILDVDEKVYEKYAHIDNFQAKARLIRYDFFKEIGKKYNIQHLYIAHNFDDFLETAYMQRARQSKALFYGIKESNFVNGMIVKRPVLFIRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKTISNWSLNEVYDFKKAVLKYNK--EHSSFANFVE----LSYIEFKKSKYRYDYFVRQDDGVQYYLIYYFLIDQKISNPNENKIISLIKFFGKQINKEKAYRVQENLYMHVNEDDLISL 305
>gi|185178872|ref|ZP_02964645.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024358|ref|ZP_02997027.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039329|ref|ZP_02998111.1| hypothetical protein Uures_01100 [Ureaplasma urealyticum serovar 8] >gi|188518716|ref|ZP_03004137.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524149|ref|ZP_03004218.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188568762|ref|ZP_03005505.1| hypothetical protein Uurealyserovar_01475 [Ureaplasma urealyticum serovar 2] >gi|184209509|gb|EDU06552.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018624|gb|EDU56664.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997679|gb|EDU66776.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659937|gb|EDX53317.1| tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (326 aa)
Score = 434, Expect = 4.6e-41, Identities = 107/286 (37%), Positives = 172/286 (60%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELK-RYPL------PDQRQLVYSFLITHHI-DVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I+ V HVNY+KR +A RDQ++V ++CK+  +P+ +  V E    K     NFQA+AR IR++ F++    Y +  L +AH+ DDF+E A MQ   + +A++YGIK    + GM V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I+NWS  E  +F   V   N+      F+        L++ + ++ K RY          Q  L+Y FLI   I +   +KI +++ F   Q  ++K YR+++ +++ + ++ L  L
  S:    12 ITNKKYLAAVSGGPDSMAMLNMYKRNISVVCHVNYHKRESADRDQEIVVDFCKKNNLPIEILDVDEKVYEKYAHIDNFQAKARLIRYDFFKEIGKKYNIQHLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVVNGMIVKRPVLFIRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKTISNWSLNEVYDFKKAVLKYNK--EHSSFANFVE----LSYIEFKKNKYRYDYFVRQDDGVQYYLIYYFLIDQKISNPNENKIISLIKFFGKQINKEKAYRVQENLYIHVNEDDLISL 305
>gi|193217036|ref|YP_002000278.1| PP-loop superfamily ATPase/cell cycle protein [Mycoplasma arthritidis 158L3-1] >gi|193002359|gb|ACF07574.1| PP-loop superfamily ATPase/cell cycle protein [Mycoplasma arthritidis 158L3-1] (307 aa)
Score = 420, Expect = 1.7e-39, Identities = 98/284 (34%), Positives = 165/284 (58%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFI-KYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKR-----AKQWLAHPDVRELKRYPLPDQRQLVYSFLITH--HIDVTGDKIDAILDFIQP-FQQKHYRLKDEIFLSIKDERLTLL 286
           K++ +  VSGGPDSM LL L+ +    V HVNYNKR  +  D+ +V  YCK   +P  ++++ + T  K NFQ  ARK R+  F++    Y+ D LLLAHH+DDF+E A MQ +A+++  Y+GI+      GM++ RP I  +WK+EI   C   K+ + ID TN + +Y RN +RQ++  +S+++KE+ +  +   N+   QK+ +++        KQ  A   +R         + +LVY  +  +  ++ ++   +  I+ FI+       Y++KD +F+  K ++L  L
  S:    16 KSKKLIAVSGGPDSMFLLNLFKEHNVVVAHVNYNKREDSNIDETIVRSYCKSHSIPYEIYSIKKGTNIKGNFQDWARKERYHFFKQIYDKYQCDYLLLAHHKDDFLETAIMQKEAKRKPEYFGIRPVNSFDGMQIIRPLIFTFWKDEIQKECIRLKIKFAIDSTNDKGVYARNIIRQKLKKFSRDDKEKLFSNILIENQN-HQKIVNVINTQYELWKKQNFACDFIRS--NCVTHIEVELVYKLIHENFANVKISTANLLNIVKFIKSTTSNSKYKIKDNVFIVKKKDKLLFL 305
>gi|171920332|ref|ZP_02931673.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902755|gb|EDT49044.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] (330 aa)
Score = 420, Expect = 2.0e-39, Identities = 102/286 (35%), Positives = 171/286 (59%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNR-------VIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH-IDVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I  V HVNY+KR ++ RDQ++V ++CK+  + + +  V E  V+++     NFQ +AR IR++ F++    Y ++ L +AH+ DDF+E A MQ   + +A++YGIK    + G+ V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I++WS  E  +F   V   N+        I        K   ++       ++ +Y       L+Y FLI H  I+ + +KI +++ F   Q  ++K YR+++ I++ + D+ L  L
  S:    12 ISNKKYLAAVSGGPDSMAMLNMYKRNIRVVCHVNYHKRESSDRDQQIVVDFCKKNNLIIEILDVDE-KVYERYGHIDNFQTKARLIRYDFFKEIGKKYNIENLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVINGIIVKRPVLFVRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKIISSWSLNEVYDFKKFVIKYNKEHSSFANFIDLSYIEFKKNKYKYDYFIRQDDMVQY------YLIYYFLIDHKIINPSENKIISLIKFFGKQINKEKAYRVQENIYMHVNDDELISL 305
>gi|170761927|ref|YP_001752156.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508435|ref|ZP_02957979.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701596|ref|ZP_02971305.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168827504|gb|ACA32766.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675843|gb|EDT87748.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700826|gb|EDU19108.1| tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] (330 aa)
Score = 417, Expect = 3.8e-39, Identities = 101/286 (35%), Positives = 171/286 (59%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNR-------VIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH-IDVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I  V HVNY+KR ++ RDQ++V ++C++  + + +  V E  V+++     NFQ +AR IR++ F++    Y ++ L +AH+ DDF+E A MQ   + +A++YGIK    + G+ V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I++WS  E  +F   V   N+        I        K   ++       ++ +Y       L+Y FLI H  I+ + +KI +++ F   Q  ++K YR+++ I++ + D+ L  L
  S:    12 ISNKKYLAAVSGGPDSMAMLNMYKRNIRVVCHVNYHKRESSDRDQQIVVDFCRKNNLIIEILDVDE-KVYERYGHIDNFQTKARLIRYDFFKEIGKKYNIENLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVINGIIVKRPVLFVRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKIISSWSLNEVYDFKKFVIKYNKEHSSFANFIDLSYIEFKKNKYKYDYFIRQDDMVQY------YLIYYFLIDHKIINPSENKIISLIKFFGKQINKEKAYRVQENIYMHVNDDELISL 305
>gi|13357633|ref|NP_077907.1| hypothetical protein UU077 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|61217428|sp|Q9PR68|TILS_UREPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|11356774|pir||A82937 conserved hypothetical UU077 [imported] - Ureaplasma urealyticum >gi|6899028|gb|AAF30482.1|AE002107_6 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (333 aa)
Score = 417, Expect = 4.3e-39, Identities = 101/286 (35%), Positives = 171/286 (59%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNR-------VIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH-IDVTGDKIDAILDFI--QPFQQKHYRLKDEIFLSIKDERLTLL 286
           +   +Y+A VSGGPDSM +L +Y + I  V HVNY+KR ++ RDQ++V ++C++  + + +  V E  V+++     NFQ +AR IR++ F++    Y ++ L +AH+ DDF+E A MQ   + +A++YGIK    + G+ V RP +   K  +   C+E+K+ YGIDETN   IY+RN+VR+ I++WS  E  +F   V   N+        I        K   ++       ++ +Y       L+Y FLI H  I+ + +KI +++ F   Q  ++K YR+++ I++ + D+ L  L
  S:    15 ISNKKYLAAVSGGPDSMAMLNMYKRNIRVVCHVNYHKRESSDRDQQIVVDFCRKNNLIIEILDVDE-KVYERYGHIDNFQTKARLIRYDFFKEIGKKYNIENLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVINGIIVKRPVLFVRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKIISSWSLNEVYDFKKFVIKYNKEHSSFANFIDLSYIEFKKNKYKYDYFIRQDDMVQY------YLIYYFLIDHKIINPSENKIISLIKFFGKQINKEKAYRVQENIYMHVNDDELISL 308
>gi|15829251|ref|NP_326611.1| hypothetical protein MYPU_7800 [Mycoplasma pulmonis UAB CTIP] >gi|61216719|sp|Q98PE3|TILS_MYCPU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|14090195|emb|CAC13953.1| conserved hypothetical protein [Mycoplasma pulmonis] (286 aa)
Score = 404, Expect = 1.3e-37, Identities = 97/270 (35%), Positives = 157/270 (58%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFI-KYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHP-DVRELKRYPLPDQRQLVYSFL---ITHHIDVTGDKIDAILDFIQPFQ-QKHYRLKDEIFL 276
           +  VSGGPDSMLLL ++      V HVNYNKR ++ RDQK+VE+YC +  + L +  + +  V K NF   ARK RF+ F+     Y  D++LLAHH+DDF+E   +Q + +++ +Y+ IK++   +GM + RPFI KYWKN+IL + +  ++ +G DETN + IY RN++R  + N  +  K   YI +  +N    +K+  + +   +W     D +   +     Q  L+  F+     + I+++  KI  I+ FI   + +K + L  E +L
  S:     3 LIAVSGGPDSMLLLDVFKHHDIVVAHVNYNKRNSSKRDQKIVEDYCFKNNIKLEILNLTDYEV-KGNFHDWARKKRFDFFKLVYEKYNCDEILLAHHKDDFVETFLIQKNQKRKPLYWSIKSKNFNFGMNINRPFIHKYWKNQILKILDNKQIFFGQDETNKENIYLRNKIRNNLLN-KEFLKRLIYIKILFLNFFKLRKIKKIEQDFNKWKEQNFDKQNFLKSKF--QENLITIFISEKTNNSINLSRGKIQQIIKFINSEKNEKKFILNKEFYL 274
>gi|144575199|gb|AAZ44022.2| conserved hypothetical protein [Mycoplasma synoviae 53] (291 aa)
Score = 366, Expect = 3.1e-33, Identities = 97/285 (34%), Positives = 157/285 (55%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFI-KYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQW--LAHPDVRELKRYPLPDQRQLVYSFLITHHID--VTGDKIDAILDFIQPFQ-QKHYRLKDEIFLSIKDERLTLLYK 288
           T+Y+  VSGG DSM LL  Y  K   V HVNYN+R  +  D+++V  YC++  + L + ++ +    K NFQ  ARK R+  F+K    +  +KLL+AHH+ DF+E   MQ ++ K   +YGIK R  ++ M VYRPF+ KY K +I   C ++K+PY  D +N +  Y RN VR+ +   +       ++ V  +N     KLF   K  K++  L   +  ++K +      +L+Y +L   ++D  +   KI ++  FI   +  K Y L+ + +L  K  ++ L+ K
  S:     3 TKYLIAVSGGADSMFLLDKYKHKNIIVAHVNYNQRNDSNFDEELVRNYCEKNNIKLEILSLNKQDFLKGNFQDWARKARYSFFEKVYKKHNCNKLLIAHHKLDFLETYYMQKESNKMNFFYGIKKRSFIFDMHVYRPFLYKYTKKQICKFCRKNKIPYRDDYSNFESKYTRNIVRKSLLQKNLFLLNLTFLKVVLINFF---KLFKYKKVTKKFENLKQHNF-QIKDFKGRYLNELIYLYLSELNLDLNINKHKILSVKSFILSDKTNKEYLLEKKYYLQKKQNKIALINK 289
>gi|26553599|ref|NP_757533.1| cell cycle protein MesJ [Mycoplasma penetrans HF-2] >gi|61216654|sp|Q8EWQ7|TILS_MYCPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|26453605|dbj|BAC43937.1| predicted cell cycle protein MesJ [Mycoplasma penetrans HF-2] (295 aa)
Score = 364, Expect = 5.9e-33, Identities = 92/281 (32%), Positives = 151/281 (53%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMN--RVIGQKLFSLMKRAKQWLAHP-DVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQ---KHYRLKDEIFLSIKDERL 283
           K +Y+  VSGGPDSM LL      +  V HVNY+ R  +  D+K+V +YCK+  + L V    +D V K     N Q   R+IR++ F+K +    + K+L+AH ++DF+E A M L+  K+ ++ GI+ + +   + + RP +   K  +   C    + + ID TN    Y RN VR+ +A W K+  ++FY+ V   N   +   KL  L  +   W+    D+    +     +  L+Y FL    I    +KI+ I++FI   +    K YRLK+  F+ IK++++
  S:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKL--LDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKI 290
>gi|148378008|ref|YP_001256884.1| hypothetical protein MAG7460 [Mycoplasma agalactiae PG2] >gi|148292054|emb|CAL59446.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] (286 aa)
Score = 362, Expect = 9.6e-33, Identities = 90/279 (32%), Positives = 152/279 (54%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACVV--HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFI-KYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDV--TGDKIDAILDFI-QPFQQKHYRLKDEIFLSIKDERLTL 285
           + G+SGGPDSM LL L   + + +V   VNYN R  +  D ++V ++C+   +      + +   +K NF+  AR+ RF  F+K    Y  + L LAHH+DDF+E   MQ +++++  ++GIKT   +YGMKV RP + K +KNEIL      K+ Y  D TN  PIY RN++R  + + S  +K + +  V   N  + +     +   +QW       + +   L ++ +L Y F+  +++D+  +  KI +I+ FI    +   Y +K+ +F+  K  +L  
  S:     3 LLGISGGPDSMYLLDLISSQRSDIVVATVNYNVRQDSAYDVEIVRKFCEDKGIIFECLEIDQKACFKGNFEKWAREQRFAFFKKIYEKYNCEALYLAHHKDDFLESYFMQKESKRQPDFFGIKTENYIYGMKVVRPLVGKVFKNEILEALHNKKIKYANDYTNDLPIYTRNRIRIWLKSLSNSQKSKIFDDVQKENNELAELEKETVLEYEQW-KKTQFSQDEFLNLNNKERLAYKFVHENYVDIKLSNGKIKSIIGFILSKNRTGQYLIKNNVFIQKKHGKLVF 286
>gi|160916165|ref|ZP_02078372.1| hypothetical protein EUBDOL_02192 [Eubacterium dolichum DSM 3991] >gi|158431889|gb|EDP10178.1| hypothetical protein EUBDOL_02192 [Eubacterium dolichum DSM 3991] (404 aa)
Score = 359, Expect = 2.2e-32, Identities = 73/177 (41%), Positives = 105/177 (59%)
  Q:     6 YIAGVSGGPDSMLLLKLY--HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           YI GVSGGPDSM LL +   H     V HVNY KR +A RD ++V++YCKQ  +   V+   +   +  NFQA AR +R+  ++    +Y    +LLAH  DD IE   MQ + ++   YYGI+ +G + G+KVYRP +   K ++   C +H V YGIDE+N    Y RN++R  + +
  S:    10 YIIGVSGGPDSMALLDMCRRHGVSMVVAHVNYQKRESAARDMQIVQDYCKQYGIACEVYMQNKQCTY--NFQAFARDVRYAFYRSLCEIYHAQGVLLAHQMDDHIETYLMQKETKRLGSYYGIRKKGIVLGVKVYRPLLTKSKKQLEEYCAQHGVEYGIDESNLSDDYARNRMRHHVVD 186
>gi|71894625|ref|YP_278733.1| hypothetical protein MS53_0615 [Mycoplasma synoviae 53] (286 aa)
Score = 354, Expect = 9.1e-32, Identities = 95/282 (33%), Positives = 154/282 (54%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFI-KYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQW--LAHPDVRELKRYPLPDQRQLVYSFLITHHID--VTGDKIDAILDFIQPFQ-QKHYRLKDEIFLSIKDERLTLLYK 288
           +  VSGG DSM LL  Y  K   V HVNYN+R  +  D+++V  YC++  + L + ++ +    K NFQ  ARK R+  F+K    +  +KLL+AHH+ DF+E   MQ ++ K   +YGIK R  ++ M VYRPF+ KY K +I   C ++K+PY  D +N +  Y RN VR+ +   +       ++ V  +N     KLF   K  K++  L   +  ++K +      +L+Y +L   ++D  +   KI ++  FI   +  K Y L+ + +L  K  ++ L+ K
  S:     1 MIAVSGGADSMFLLDKYKHKNIIVAHVNYNQRNDSNFDEELVRNYCEKNNIKLEILSLNKQDFLKGNFQDWARKARYSFFEKVYKKHNCNKLLIAHHKLDFLETYYMQKESNKMNFFYGIKKRSFIFDMHVYRPFLYKYTKKQICKFCRKNKIPYRDDYSNFESKYTRNIVRKSLLQKNLFLLNLTFLKVVLINFF---KLFKYKKVTKKFENLKQHNF-QIKDFKGRYLNELIYLYLSELNLDLNINKHKILSVKSFILSDKTNKEYLLEKKYYLQKKQNKIALINK 284
>gi|144227507|gb|AAZ44292.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (297 aa)
Score = 327, Expect = 1.0e-28, Identities = 65/176 (36%), Positives = 106/176 (60%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYW--KNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
            K +Y+ GVSGG DSM LL  Y  +   V H+NYN R  A+ +  +V ++C++  + L + +     + KKN Q+  R  R++ F+K    +   KLL+ HHRDDF+E   +Q   +K   ++GI  +  L+ M++ RPF+ YW  K +I+ +C++ K+PY  D++N    Y+RNQ+R
  S:     7 SKEKYLIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILSFDSFKI-KKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFL-YWRTKKQIIQICQQKKIPYLDDQSNFTGKYQRNQIR 182
>gi|54020383|ref|YP_115689.1| hypothetical protein mhp176 [Mycoplasma hyopneumoniae 232] >gi|61216451|sp|Q601M6|TILS_MYCH2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|53987556|gb|AAV27757.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (297 aa)
Score = 327, Expect = 1.3e-28, Identities = 65/176 (36%), Positives = 106/176 (60%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYW--KNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
            K +Y+ GVSGG DSM LL  Y  +   V H+NYN R  A+ +  +V ++C++  + L + +     + KKN Q+  R  R++ F+K    +   KLL+ HHRDDF+E   +Q   +K   ++GI  +  L+ M++ RPF+ YW  K +I+ +C++ K+PY  D++N    Y+RNQ+R
  S:     7 SKEKYLIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILSFDSFKI-KKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFL-YWRTKKQIIRICQQKKIPYLDDQSNFTGKYQRNQIR 182
>gi|83319710|ref|YP_424013.1| hypothetical protein MCAP_0014 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283596|gb|ABC01528.1| conserved hypothetical protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (401 aa)
Score = 325, Expect = 1.8e-28, Identities = 75/215 (34%), Positives = 120/215 (55%)
  Q:     5 QYIAGVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED-TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH 219
           +Y+  +SGGPDS+ LL    K+   K   V HVNYN R+ ++ DQK+V   CK+  + L +  + +D ++ K+NF++ AR  R++ F K A  Y++  LL+AH+ +D IE   +QL       YYG+KT      + VYRP +   K+EIL   + +++ Y ID TN    Y+RN++R  I        E  +I +     +  +KL ++ K    +L H
  S:    11 KYLLAISGGPDSVFLLCNIVKIIDSKNLVVCHVNYNFRSDSINDQKIVINLCKKFDLKLEILNINKDYSLLKENFESWARFQRYDFFNKIAKKYQIYNLLVAHNFNDLIETYLLQLQRNNLVDYYGLKTVSHYKDLVVYRPLLDIKKSEILDYLKTNQISYAIDSTNTDIKYQRNKIRSIID-------ESIFIDIKNQIDIDNKKLETIKKIVNNYLEH 223
>gi|144575318|gb|AAZ53579.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (297 aa)
Score = 324, Expect = 2.5e-28, Identities = 64/176 (36%), Positives = 106/176 (60%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYW--KNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
            K +Y+ GVSGG DSM LL  Y  +   V H+NYN R  A+ +  +V ++C++  + L + +     + KKN Q+  R  R++ F+K    +   KLL+ HHRDDF+E   +Q   +K   ++GI  +  L+ M++ RPF+ YW  K +I+ +C++ ++PY  D++N    Y+RNQ+R
  S:     7 SKEKYLIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILSFDSFKI-KKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFL-YWRTKKQIIRICQQKRIPYLDDQSNFTGKYQRNQIR 182
>gi|169351463|ref|ZP_02868401.1| hypothetical protein CLOSPI_02243 [Clostridium spiroforme DSM 1552] >gi|169291685|gb|EDS73818.1| hypothetical protein CLOSPI_02243 [Clostridium spiroforme DSM 1552] (414 aa)
Score = 321, Expect = 6.0e-28, Identities = 72/188 (38%), Positives = 109/188 (57%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKKI--ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ-EIANWSKEEKEEFYI 193
           Y+ GVSGG DSM LL +  KK     V HVNY+ R  +  DQK VE+YCK   +   V  +      K+NFQ QAR++R++ +++ A+ Y  ++++LAHH DD IE   MQL       Y GIK   +++G+ V RPF++  K  +   C ++ V Y  D TN +  + R+ VR   +  +S+++ EE  I
  S:    14 YVVGVSGGCDSMALLDIMQKKGYRMVVCHVNYHLRNDSDLDQKTVEDYCKMHDIACFVKEIDSKLYSKENFQMQARELRYQFYREIANKYNTNEVVLAHHLDDVIENIVMQLQRNNTKGYLGIKDVSDVFGVVVIRPFLEVRKQALRNYCHDYNVFYRDDYTNFETDFTRDFVRNVTLKKYSEKQIEELLI 204
>gi|71893557|ref|YP_279003.1| hypothetical protein MHJ_0201 [Mycoplasma hyopneumoniae J] (286 aa)
Score = 317, Expect = 1.7e-27, Identities = 63/171 (36%), Positives = 103/171 (60%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYW--KNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + GVSGG DSM LL  Y  +   V H+NYN R  A+ +  +V ++C++  + L + +     + KKN Q+  R  R++ F+K    +   KLL+ HHRDDF+E   +Q   +K   ++GI  +  L+ M++ RPF+ YW  K +I+ +C++ K+PY  D++N    Y+RNQ+R
  S:     1 MIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILSFDSFKI-KKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFL-YWRTKKQIIQICQQKKIPYLDDQSNFTGKYQRNQIR 171
>gi|72080544|ref|YP_287602.1| hypothetical protein MHP7448_0205 [Mycoplasma hyopneumoniae 7448] (286 aa)
Score = 314, Expect = 4.2e-27, Identities = 62/171 (36%), Positives = 103/171 (60%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYW--KNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + GVSGG DSM LL  Y  +   V H+NYN R  A+ +  +V ++C++  + L + +     + KKN Q+  R  R++ F+K    +   KLL+ HHRDDF+E   +Q   +K   ++GI  +  L+ M++ RPF+ YW  K +I+ +C++ ++PY  D++N    Y+RNQ+R
  S:     1 MIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILSFDSFKI-KKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFL-YWRTKKQIIRICQQKRIPYLDDQSNFTGKYQRNQIR 171
>gi|42560602|ref|NP_975053.1| hypothetical protein MSC_0042 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61216536|sp|Q6MUI9|TILS_MYCMS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|42492098|emb|CAE76695.1| Conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (401 aa)
Score = 310, Expect = 9.9e-27, Identities = 67/176 (38%), Positives = 103/176 (58%)
  Q:     5 QYIAGVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED-TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +Y+  VSGGPDS+ LL    KL       V HVNYN R+ +  DQ +V   CKQL + L +  + +D ++ K+NF++ AR  R++ F   AS Y++  LL+AH+ +D IE   +QL       YYG+K       + VYRP +   K++IL     +K+ Y +D TN+   Y+RN++R  +
  S:    11 KYLIAVSGGPDSVFLLCNIVKLVDPNDLVVCHVNYNFRSDSNNDQMIVTNLCKQLNLKLEILNINKDYSLLKQNFESWARAQRYDFFNMIASKYQIYNLLVAHNLNDLIETYLLQLQRNNLVDYYGLKPVSHYKDLVVYRPLLDIKKSQILNYLNTNKISYAVDSTNSDIKYQRNKIRATL 191
>gi|188159701|ref|ZP_02998824.1| hypothetical protein Mmycm_03620 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (401 aa)
Score = 309, Expect = 1.5e-26, Identities = 67/176 (38%), Positives = 102/176 (57%)
  Q:     5 QYIAGVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED-TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +Y+  VSGGPDS+ LL    KL       V HVNYN R+ +  DQ +V   CKQ  + L +  + +D ++ K+NF++ AR  R++ F   AS Y++  LL+AH+ +D IE   +QL       YYG+K       + VYRP +   K++IL     +K+ Y ID TN+   Y+RN++R  +
  S:    11 KYLIAVSGGPDSVFLLCNVVKLVDPNNLVVCHVNYNFRSDSNNDQMIVTNLCKQFNLKLEILNINKDYSLLKQNFESWARVQRYDFFNMIASKYQIYNLLVAHNFNDLIETYLLQLQRNNLVDYYGLKPVSHYKDLVVYRPLLDIKKSQILNYLNTNKISYAIDSTNSDTKYQRNKIRTTL 191
>gi|50365488|ref|YP_053913.1| lysidine synthetase [Mesoplasma florum L1] >gi|61216500|sp|Q6F0E4|TILS_MESFL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|50364044|gb|AAT76029.1| lysidine synthetase [Mesoplasma florum L1] (398 aa)
Score = 296, Expect = 4.1e-25, Identities = 68/196 (34%), Positives = 113/196 (57%)
  Q:     5 QYIAGVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED-TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNR 200
            Y+  VSGGPDSM +L    K+  K+I  V HVNYN R  + +DQK+VE++C +  + L    + +D +  K+NF++ AR IR++ F + +  Y +  +L+AH+R+D +E   +Q D +    +YG+        + + RP +   K+EIL   +E  + + ID TN    YKRN++R   AN S+    +F   +  +N+
  S:    11 SYLVAVSGGPDSMFMLNELIKMNIKEI-VVCHVNYNFREDSWKDQKLVEDFCLKNNLKLEKLIINQDYSKLKENFESWARNIRYDFFVEISKKYNIQNVLIAHNRNDLVETFLLQQDRKGYVKHYGLNKTSTYKEITIVRPMLNILKSEILKSLKEENIAFVIDSTNEDKKYKRNKIR---ANLSESTFNDFEETIKKLNK 207
>gi|167754850|ref|ZP_02426977.1| hypothetical protein CLORAM_00354 [Clostridium ramosum DSM 1402] >gi|167704900|gb|EDS19479.1| hypothetical protein CLORAM_00354 [Clostridium ramosum DSM 1402] (599 aa)
Score = 291, Expect = 1.5e-24, Identities = 70/185 (37%), Positives = 99/185 (53%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEE 190
           YI GVSGG DSM LL + ++     I C  HVNY+ R  +  DQ+ VE YC +  +P  V  + +      NFQ QAR++R++ + +    Y+  K++LAHH++D IE   MQL       Y GI+   E++G+ V RP +   K  +   C  H V Y  D TN Q  + R+ VR        EEK E
  S:    14 YILGVSGGCDSMALLDMMNQAGYQIIVC--HVNYHLREDSDLDQQTVEAYCHRYDLPCYVREIDKQVYGPDNFQDQARRLRYQFYLEIGMKYQTQKVVLAHHQNDVIENIVMQLQRHNTKGYLGIQEISEVFGVTVIRPCLAVRKQFLRDYCHGHNVEYRDDYTNFQTEFTRDYVRNVTLKDYDEEKIE 200
>gi|66880311|ref|ZP_00405293.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Mycoplasma genitalium G-37] (71 aa)
Score = 279, Expect = 4.3e-23, Identities = 50/68 (73%), Positives = 60/68 (88%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW 70
           + QYIAGVSGG DSML+LKLY KKIACVVHVNYN R+T+LRDQK+VE+YC++L +PL+VHTV  D VW
  S:     4 EKQYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVEQYCQKLNIPLVVHTVDPDLVW 71
>gi|167211256|ref|ZP_02281563.1| hypothetical protein LmonL_01842 [Listeria monocytogenes LO28] (640 aa)
Score = 276, Expect = 8.2e-23, Identities = 66/186 (35%), Positives = 107/186 (57%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N+  R  A ++Q++VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|153172864|ref|ZP_01928838.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N3-165] >gi|133731388|gb|EBA33086.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N3-165] (648 aa)
Score = 276, Expect = 8.4e-23, Identities = 66/186 (35%), Positives = 107/186 (57%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N+  R  A ++Q++VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|47093161|ref|ZP_00230936.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b H7858] >gi|153200654|ref|ZP_01942761.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes HPB2262] >gi|21667249|gb|AAM74001.1|AF467001_2 YacA/HprT-like protein [Listeria monocytogenes] >gi|47018468|gb|EAL09226.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b H7858] >gi|133736602|gb|EBA38300.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes HPB2262] (648 aa)
Score = 276, Expect = 8.9e-23, Identities = 67/186 (36%), Positives = 106/186 (56%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDT---VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N++ R  A  +Q +VE +C+   +P  +  V   +     +K  +  AR +R++ F+K  +  K++KL LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHINHHLRENAANEQNVVEAFCESQGIPFYIEEVDVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|16802265|ref|NP_463750.1| hypothetical protein lmo0219 [Listeria monocytogenes EGD-e] >gi|47097258|ref|ZP_00234818.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 1/2a F6854] >gi|153177873|ref|ZP_01931638.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes F6900] >gi|153186159|ref|ZP_01936543.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J0161] >gi|153189386|ref|ZP_01937061.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J2818] >gi|61216688|sp|Q8YAC7|TILS_LISMO Bifunctional protein tilS/hprT [Includes: tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase); Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase)] >gi|16409584|emb|CAD00746.1| fusion protein, N-terminal part similar to B. subtilis YacA protein, C-terminal part similar to hypoxanthine-guanine phosphoribosyltransferase [Listeria monocytogenes] >gi|47014358|gb|EAL05331.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 1/2a F6854] >gi|126941298|gb|EBA19187.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J0161] >gi|127766822|gb|EBA27147.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J2818] >gi|133733948|gb|EBA35646.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes F6900] (648 aa)
Score = 276, Expect = 9.1e-23, Identities = 66/186 (35%), Positives = 107/186 (57%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N+  R  A ++Q++VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|153198228|ref|ZP_01942347.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes 10403S] >gi|127632140|gb|EBA21850.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes 10403S] (648 aa)
Score = 276, Expect = 9.2e-23, Identities = 66/186 (35%), Positives = 107/186 (57%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N+  R  A ++Q++VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSDLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEETARIVRYDFFEKVMTEKNINKLVLAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|46906451|ref|YP_012840.1| hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b F2365] >gi|61216556|sp|Q724J4|TILS_LISMF Bifunctional protein tilS/hprT [Includes: tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase); Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase)] >gi|46879715|gb|AAT03017.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b F2365] (648 aa)
Score = 274, Expect = 1.4e-22, Identities = 67/186 (36%), Positives = 106/186 (56%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDT---VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N++ R  A  +Q +VE +C+   +P  +  V   +     +K  +  AR +R++ F+K  +  K++KL LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHHLRENAANEQNVVETFCESQGIPFYIEEVDVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|167013674|ref|ZP_02276207.1| hypothetical protein LmonFS_00952 [Listeria monocytogenes FSL J1-194] (648 aa)
Score = 274, Expect = 1.4e-22, Identities = 67/186 (36%), Positives = 105/186 (56%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDT---VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N++ R  A   Q +VE +C+   +P  +  V   +     +K  +  AR +R++ F+K  +  K++KL LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHINHHLRENAANGQNVVEAFCESQGIPFYIEEVDVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|153165181|ref|ZP_01926199.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N1-017] >gi|133728500|gb|EBA30198.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N1-017] (648 aa)
Score = 274, Expect = 1.5e-22, Identities = 67/186 (36%), Positives = 106/186 (56%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDT---VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N++ R  A  +Q +VE +C+   +P  +  V   +     +K  +  AR +R++ F+K  +  K++KL LAHH DD IE   M+L  R  A   + GI+ + EL G +  RPF+   K EI+   ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHHLRENAANEQNVVEAFCESQGIPFYIEEVDVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVY 220
>gi|194246666|ref|YP_002004305.1| tRNA(Ile)-lysidine synthase [Candidatus Phytoplasma mali] >gi|193807023|emb|CAP18459.1| tRNA(Ile)-lysidine synthase [Candidatus Phytoplasma mali] (415 aa)
Score = 273, Expect = 2.1e-22, Identities = 65/185 (35%), Positives = 102/185 (55%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKI-ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY--GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           K  YI  VSGG DSM+LL  L+HK I   VVH N+ KR  + +D+ +VE YC +  +P     +   +    NFQ ++R +R +  Q  A LY+   ++ AHH DD  E   M++      + Y  G++ + ++      +PF+   K EIL   +++ + Y  D TN   IYKRN++R +I  W K++
  S:    12 KLFYIISVSGGVDSMVLLNVLFHKNIRLAVVHFNHLKRKESFKDKILVENYCLKNNIPFFYFEIKPLS---NNFQNESRLLRQKNLQSVALLYRTYYIITAHHLDDLAENIFMKISRGSSLLGYSGGMQVKQKISDFYFLKPFLYVNKKEILNYAKKNNIHYLDDITNTLDIYKRNEIRNQIIPWFKKD 197
>gi|168264858|ref|ZP_02686823.1| hypothetical protein LmonFSL_00295 [Listeria monocytogenes FSL J2-071] (648 aa)
Score = 272, Expect = 2.8e-22, Identities = 66/186 (35%), Positives = 105/186 (56%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS+ LL       L  K+   V H+N++ R  A  +Q +VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL LAHH DD IE   M+L  R  A   + GI+ + E+ G    RPF+   K EI+A  ++H++ Y IDE+N    Y RN+ R ++  + K+E    Y
  S:    25 LVAVSGGPDSLALLHFLWNSDLVSKEAISVAHLNHHLRENAANEQNVVETFCERHGIPFYIEEVDIKSRAESLQKGIEETARIVRYDFFEKVMAEKNINKLALAHHADDQIETILMRL-VRGSASIGWSGIQPKREVRGGYAIRPFLPITKAEIIAYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPSVY 220
>gi|16799328|ref|NP_469596.1| hypothetical protein lin0251 [Listeria innocua Clip11262] >gi|61216704|sp|Q92F56|TILS_LISIN Bifunctional protein tilS/hprT [Includes: tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase); Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase)] >gi|16412680|emb|CAC95484.1| fusion protein, N-terminal part similar to B. subtilis YacA protein, C-terminal part similar to hypoxanthine-guanine phosphoribosyltransferase [Listeria innocua] (648 aa)
Score = 259, Expect = 7.7e-21, Identities = 62/186 (33%), Positives = 102/186 (54%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP---EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS  LL       L  K+   V H+N++ R  A ++Q  V+ +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L     ++ + GI+ + E+ G    RPF+   K EI+    +H +PY IDE+N    Y RN+ R ++  +  +E    Y
  S:    25 LVAVSGGPDSFALLHFLWSANLVPKEAIAVAHLNHHLRENAEKEQLAVQTFCEERDIPFFIEEVDVKKRAEKLQKGIEETARIVRYDFFEKVMAENNINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKREVRGGYAIRPFLPITKAEIIEYATKHALPYEIDESNTSQEYTRNRYRTQLLPFLSKENPAVY 220
>gi|110003919|emb|CAK98259.1| hypothetical protein mesj of the pp-loop superfamily [Spiroplasma citri] (434 aa)
Score = 258, Expect = 1.1e-20, Identities = 66/178 (37%), Positives = 100/178 (56%)
  Q:     3 KTQYIAGVSGGPDSMLLL-KLYHKK------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDT-----VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYG------MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
            T+Y+ GVSGGPDSM LL  +Y+ +      I C+V  NY KR  +  D+++V EYC++  + + V  V         V   NFQA AR++R++ F + +  Y    +L+AH+  D IE   +Q        YYG+      Y       +K++R  +K  + EI+      ++ Y ID TN   IY RN +R EI
  S:     9 NTKYVIGVSGGPDSMFLLDNIYNSELDINNFIVCLV--NYQKRKDSDYDEEIVVEYCQKRNIKICVKKVTASDYEQYQVNSHNFQAVARELRYDFFLQISEKYHCQGVLIAHNLTDHIETYILQKQRNGIVEYYGLNKTSYYYSQLLDKKLKIFRIMLKISREEIIEYLFHKQINYAIDSTNILAIYNRNIIRNEI 202
>gi|171853859|emb|CAM11821.1| Cell cycle protein [Candidatus Phytoplasma australiense] (435 aa)
Score = 252, Expect = 6.5e-20, Identities = 64/182 (35%), Positives = 104/182 (57%)
  Q:     6 YIAGVSGGPDSMLLLK-LYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           YI  VSGG DSM+LL  L+ +K    VVH N+ KR  A++D+ +++ YC Q K+P     +  +    +NFQ +AR +R E+ ++ A  Y+   ++ AHH DD  E   +Q  +R   +  Y G++ +         +PF+   K EI+A  +++K+ Y  D TN   IY+RNQ+R  +  + KE+
  S:    13 YIIAVSGGVDSMVLLDFLWSQKYKLKVVHFNHLKRLNAIKDKNLIQSYCDQRKIPFYYFELQLNP---QNFQTEARLLRQEKLKQIAKKYQTPYVITAHHLDDLAETI-LQKISRGSTLLGYSGMQPKLFFEEFIFLKPFLYLAKAEIIAYAQKNKIAYLSDYTNQLDIYQRNQIRNHVIPYLKEK 194
>gi|116871602|ref|YP_848383.1| hypothetical protein lwe0182 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740480|emb|CAK19600.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (648 aa)
Score = 249, Expect = 1.4e-19, Identities = 63/186 (33%), Positives = 105/186 (56%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP----EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  VSGGPDS  LL      KL  K+   V H+N+  R  A ++Q +V+ +C++  +P  V  V      +T+ +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L     ++ + GI+ + ++      RPF+   K EI+    +H +PY IDE+N    Y RN+ R ++  +  +E    Y
  S:    25 LVAVSGGPDSFALLHFLWSSKLVPKESISVAHLNHCLREGAEKEQLVVQTFCEEHHIPFFVEAVDIKKHAETI-QKGIEETARIVRYKFFEKVMTENDINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKRKVTKGYAIRPFLPITKAEIIQYASKHDLPYEIDESNVSQEYTRNRYRTQLLPFLSKENPAVY 220
>gi|163764860|ref|ZP_02171912.1| ATPase of the PP-loop superfamily implicated in cell cycle control-like protein [Bacillus selenitireducens MLS10] >gi|160354637|gb|EDP81298.1| ATPase of the PP-loop superfamily implicated in cell cycle control-like protein [Bacillus selenitireducens MLS10] (475 aa)
Score = 243, Expect = 6.0e-19, Identities = 60/181 (33%), Positives = 101/181 (55%)
  Q:     7 IAGVSGGPDSMLLLKLYHKK------IACVVHVNYN-KRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKN--FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           +  VSGG DSM+LL L H++          VH +++ +R +A RD ++V  +C++L +P  +VH   E+    +N   QA AR +R+E F+   +    ++L+ AHH DD IE   +QL         G++    + G  + RP +   K  +    ++  +P+  DE+N    Y+RN++RQ+I    KEE
  S:    22 LVAVSGGVDSMVLLHLLHERRTRLSITLSAVHAHHHLRRESADRDAELVASFCRELAIPFHLVHLSVEEERKLRNGSVQAVARDLRYEAFRHVMTETGANRLVTAHHGDDQIETVLLQLLRNTAQGGSGMRALRPIEGGTLIRPLLDTEKASLYRYAKDSGIPFREDESNDSRHYRRNRIRQDILPVLKEE 212
>gi|52078562|ref|YP_077353.1| tRNA(Ile)-lysidine synthetase [Bacillus licheniformis ATCC 14580] >gi|52783924|ref|YP_089753.1| YacA [Bacillus licheniformis ATCC 14580] >gi|61216472|sp|Q65PF4|TILS_BACLD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|52001773|gb|AAU21715.1| tRNA(Ile)-lysidine synthetase [Bacillus licheniformis ATCC 14580] >gi|52346426|gb|AAU39060.1| YacA [Bacillus licheniformis DSM 13] (476 aa)
Score = 243, Expect = 6.1e-19, Identities = 76/253 (30%), Positives = 135/253 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-----VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPL------IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQ-----------KLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVY-----------SFLITHHIDV-----TGDKIDAILDF 259
           IAGVSGGPDSM LL   H  +         HV++  R   + RD + V++YC+   +        ++    E+ +   N QA AR+ R+  FQ+    ++ + L+L HH DD +E   M++      +   GI+ +       + RPF+K  K+++LA C+E+++P+  D +N++  Y RN+ R  +  + K+E E+ +    +++  + +           K+ +++           +  L   P+P QR+ V+           S    HHI V     + D     LDF
  S:    21 IAGVSGGPDSMALLHALHHTVPASATLIAAHVDHMFRGEESERDMRFVQDYCEAEGIQCEAVQIDVLAFAAENNL---NKQAAARECRYAFFQELMKRHRAEYLVLGHHGDDQVETMLMKMAKGTVGIGLAGIQPKRRFDSGWLLRPFLKLSKDDLLAYCKENRIPFRTDPSNSEDDYTRNRFRHHVLPFLKKESEDVHKRFQSVSEFLTEDELYLQALTKDKMNTVITSKSSSGVEISIERLLALPMPLQRRGVHLILNYLYENVPSAFSAHHIQVFLDWISQDGPSGSLDF 310
>gi|157690849|ref|YP_001485311.1| tRNA(Ile)-lysidine synthase [Bacillus pumilus SAFR-032] >gi|157679607|gb|ABV60751.1| tRNA(Ile)-lysidine synthase [Bacillus pumilus SAFR-032] (467 aa)
Score = 242, Expect = 8.9e-19, Identities = 67/187 (35%), Positives = 98/187 (52%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNF---QAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           +  T  I GVSGGPDSMLLL   +K+          HV++  R   +  D   VE YCK+  +P     +      K+N    QA AR+ R+  F++    YK   + LAHH DD +E   M+L      +   GI+ +       + RP I Y K+++L  CE+  +PY ID++N    Y RN++R+ I    KEE
  S:    15 LENTTVIVGVSGGPDSMLLLHELNKRRKGSFQLIAAHVDHMFRGEESFVDLAFVEAYCKEQGIPFESARIQVTQYAKENHLNKQAAARECRYAFFRQLMERYKAQFIALAHHGDDQVETMMMRLARGTVGIGLAGIQAKRPYQDGWLIRPLIGYSKDDVLTACEQAHIPYVIDQSNHTDDYLRNRIRRHILPVLKEE 211
>gi|56961886|ref|YP_173608.1| cell-cycle protein [Bacillus clausii KSM-K16] >gi|61216430|sp|Q5WAE0|TILS_BACSK tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56908120|dbj|BAD62647.1| cell-cycle protein [Bacillus clausii KSM-K16] (469 aa)
Score = 238, Expect = 2.4e-18, Identities = 85/259 (32%), Positives = 130/259 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMY-YGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPD--------------VRELKRYPLPDQRQLVYSFLITHHIDVTG--------DKIDAILDFIQ 261
           +T  +  VSGGPDSM LL +        K     VHVN+  R   + +D ++V+ +  +L VP  V  V +   +K       Q  AR +R++ FQ          LL AHH DD +E A M+L      +   GI          + RP ++  K  I+A C E  +PY ID++N    Y RN+ R  +A +  EE    +  +   +R   +    LM++AK   AH D              ++ L   P P QR++++  L   H++V G        D I+ I  F+Q
  S:    18 ETNVLVAVSGGPDSMALLAIMANLREKWKLNLFGVHVNHRLRGEESNKDAELVQSFSARLGVPCNVKDV-DVAAFKAEHHVGTQQAARALRYQVFQGEMERVHATVLLTAHHGDDEVETAFMKLTRGTTPLTKLGIAATRPFANGVLARPLLEETKRSIVAYCHEKAIPYRIDQSNFSDAYTRNRFRMNMAPYLVEENPHIHKHIGRFDRWQEEDNHYLMEQAK---AHLDQILTKKSEKSIELEIQALCLAPFPLQRRMIHLILNYLHLNVYGVNDMRVFPDAIEQIQAFLQ 306
>gi|189220437|ref|YP_001941077.1| tRNA(Ile)-lysidine synthase MesJ [Methylokorus infernorum V4] >gi|189187295|gb|ACD84480.1| tRNA(Ile)-lysidine synthase MesJ [Methylacidiphilum infernorum V4] (307 aa)
Score = 233, Expect = 9.3e-18, Identities = 76/255 (29%), Positives = 129/255 (50%)
  Q:     7 IAGVSGGPDSMLLLK--LYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI-----ANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLA--------HPDVR--ELKRYPLPDQRQLVYSFLITHHI-DVTGDKIDAILDFIQ 261
           + G+SGG DS++LL   +   K   V+H  +  R     D K+VEE  K+L V  +    P      KN +A AR  R+  FQ AA       L+LAHH DD +E   MQL     +  +G+     L  + VYRP + +WK++I+   ++    +  DETN      RN++R+E+     + +S+  K   +            K   +++  K+WLA         P +R  +L+  P+  QR ++  +L    + D++ + I++I   ++
  S:    23 LCGISGGVDSIVLLHSLVETGKRPIVLHFQHGWRQDEESDAKLVEETAKELGVEFLKGKSPR--ALPKN-EAMARMQRYRFFQSAAENKNCFNLVLAHHADDQVETFLMQLIRGTGSRGWGMDRITTLGKLVVYRPLLDFWKSDIIRFAQQRNFRWREDETNENTHLLRNRIRKELIPFLESRFSRSIKRSLW------------KCCEVLREEKKWLATLVQEFSCSPSLRLADLENTPIGKQRLIISLWLKKRGVADISFEDIESIRSLLE 280
>gi|154684586|ref|YP_001419747.1| YacA [Bacillus amyloliquefaciens FZB42] >gi|154350437|gb|ABS72516.1| YacA [Bacillus amyloliquefaciens FZB42] (472 aa)
Score = 227, Expect = 4.8e-17, Identities = 65/186 (34%), Positives = 97/186 (52%)
  Q:     7 IAGVSGGPDSMLLLKLY-----HKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           IAGVSGGPDSM LL +      H  +    HV++  R   +  D K V+ YC+   +  +  TV  D        K N QA AR  R++ F+   + ++   L LAHH DD +E   M+L      A   G++   E     + RPF+   K+EIL  C +  + Y  DE+NA+  Y RN+ R+ +  + K E  + +
  S:    21 IAGVSGGPDSMALLSMLNKHFGHSSVIIAAHVDHQFRGPESEEDMKFVQSYCEAEHI--LCETVQIDVSAYAKKNKLNKQAAARDCRYQFFEDLMTKHQAKFLALAHHGDDQVETMLMRLAKGTLGAGLAGMQPVREFASGWLIRPFLYAAKDEILEYCRQEGLSYRTDESNAKDDYTRNRFRKTVLPFLKHESPDVH 216
>gi|467456|dbj|BAA05302.1| unknown [Bacillus subtilis] (486 aa)
Score = 225, Expect = 7.9e-17, Identities = 66/186 (35%), Positives = 102/186 (54%)
  Q:     7 IAGVSGGPDSMLLLKLYHK---KIACVV--HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPED-TVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           I GVSGGPDSM LL   H    + A V+  HV++  R   +  D + V+ YCK  +  L+  T   + T + +    N QA AR  R++ F++  S ++ D L LAHH DD +E   M+L          G++        ++ RPF+   K EIL  C E+ + Y  DE+NA+  Y RN+ R+ +  + K+E  + +
  S:    35 IVGVSGGPDSMALLHALHTLCGRSANVIAAHVDHRFRGAESEEDMRFVQAYCKAEQ--LVCETAQINVTAYAQEKGLNKQAAARDCRYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIRPFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVH 230
>gi|16077135|ref|NP_387948.1| hypothetical protein BSU00670 [Bacillus subtilis subsp. subtilis str. 168] >gi|8039814|sp|P37563|TILS_BACSU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|2632334|emb|CAB11843.1| yacA [Bacillus subtilis subsp. subtilis str. 168] (472 aa)
Score = 225, Expect = 8.2e-17, Identities = 66/186 (35%), Positives = 102/186 (54%)
  Q:     7 IAGVSGGPDSMLLLKLYHK---KIACVV--HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPED-TVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           I GVSGGPDSM LL   H    + A V+  HV++  R   +  D + V+ YCK  +  L+  T   + T + +    N QA AR  R++ F++  S ++ D L LAHH DD +E   M+L          G++        ++ RPF+   K EIL  C E+ + Y  DE+NA+  Y RN+ R+ +  + K+E  + +
  S:    21 IVGVSGGPDSMALLHALHTLCGRSANVIAAHVDHRFRGAESEEDMRFVQAYCKAEQ--LVCETAQINVTAYAQEKGLNKQAAARDCRYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIRPFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVH 216
>gi|66880312|ref|ZP_00405294.1| hypothetical protein MgenG_01000181 [Mycoplasma genitalium G-37] (65 aa)
Score = 221, Expect = 2.1e-16, Identities = 41/65 (63%), Positives = 55/65 (84%)
  Q:   225 LKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLLYKS 289
           +KR+ + DQ+QL+YS+LI H I+V G+KIDAILDFIQP QQK YRL+++IFL +K++ L LLYKS
  S:     1 MKRFSIIDQKQLIYSYLIYHKINVNGEKIDAILDFIQPSQQKQYRLQNDIFLMVKNQCLALLYKS 65
>gi|39938615|ref|NP_950381.1| hypothetical protein PAM129 [Onion yellows phytoplasma OY-M] >gi|61216552|sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39721724|dbj|BAD04214.1| conserved hypothetical protein [Onion yellows phytoplasma OY-M] (436 aa)
Score = 220, Expect = 2.9e-16, Identities = 62/184 (33%), Positives = 99/184 (53%)
  Q:     6 YIAGVSGGPDSMLLLK-LYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKE 189
           YI  VSGG DSM LL  L  +KI   VVH N+  R    +D+++V+ YC  L+  L  H   E    +KNFQAQAR +R ++  + A+ ++   +L AHH DD  E   +Q   R   +  Y G++ +         +PF+   K +I++    +++P+  D TN    Y+RNQ+R ++  + K +  
  S:    16 YIIAVSGGVDSMALLHCLVAQKIKLQVVHFNHLARPNVWKDKELVQSYC--LQNSLCFHYF-ELNCPQKNFQAQARLLRQQKLMQIATKHQTPFILTAHHLDDLAETI-LQKITRSSTLLGYSGMQIQTSWQDFIFLKPFLYVPKAKIISYAAFYQIPFLEDYTNQNFTYQRNQIRHQVIPYLKTQTS 199
>gi|149183227|ref|ZP_01861672.1| hypothetical protein BSG1_17246 [Bacillus sp. SG-1] >gi|148849060|gb|EDL63265.1| hypothetical protein BSG1_17246 [Bacillus sp. SG-1] (467 aa)
Score = 216, Expect = 7.6e-16, Identities = 74/235 (31%), Positives = 118/235 (50%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVP-----LIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-----------KEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +A VSGGPDS+ LL        L++ K+A V   +  +   +  +   V++ C+++ +P     L V  + +D   K   Q  AR  R+  F +        KL   HH DD +E   MQL   +  RA   GI  + + YG ++ RP +   K EIL  C E  +    D +N +  Y RN+ RQE+  + K E            EE       +  +  +KL S++ + K   A  D+   +  PLP QR++++  L
  S:    25 LAAVSGGPDSLSLLHFLNKYRNLWNVKVAAVCVDHMFRGEQSYEELLFVKKTCEEMDIPFFGERLNVQGMLDDQ--KAGLQEGARNARYHLFARLIKDEGFTKLAFGHHGDDQVETILMQLTRGSSGRAKI-GIPVQRDFYGARIIRPLLCLSKEEILKYCSETGLQPKFDPSNEKKDYTRNRFRQEVLPFLKGENPLVHLKFQQFSEEAAEDESFLRSLAEEKLESILTKTKDE-AVVDIEAFRLMPLPLQRRVIHLIL 280
>gi|28209970|ref|NP_780914.1| cell cycle protein mesJ [Clostridium tetani E88] >gi|61216641|sp|Q899H5|TILS_CLOTE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|28202405|gb|AAO34851.1| cell cycle protein mesJ [Clostridium tetani E88] (467 aa)
Score = 216, Expect = 8.2e-16, Identities = 69/195 (35%), Positives = 106/195 (54%)
  Q:     7 IAGVSGGPDSMLLLKL-------YHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKT-RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRV 201
           I GVSGGPDSM LL +       Y+  I    H+N+  R   A  D+K VE +CK+  +      +    + KK   +F+   R+ R++ F K    +  DK+ LAH+ +D  E   M++  R   +    GIK  R  +Y     RP I+  + +I   CEEH++   ID+TN + IY RN+VR E+  + +E   +  I V  +NR+
  S:    22 IVGVSGGPDSMCLLHILYRLRDEYNLNII-AAHINHCLRGKDADNDEKYVENFCKKYDIDFYSTKIDVGKLAKKENISFEVAGRECRYDFFNKLKLKFNCDKIALAHNSNDQCETILMRI-MRGTGIEGLAGIKAIRDNIY----IRPIIEASRKQIEDYCEEHELEARIDKTNLESIYARNKVRLELIPYIQENFNQDIIAV--INRM 222
>gi|162448219|ref|YP_001621351.1| PP family ATPase [Acholeplasma laidlawii PG-8A] >gi|161986326|gb|ABX81975.1| ATPase of the PP-loop superfamily [Acholeplasma laidlawii PG-8A] (406 aa)
Score = 216, Expect = 8.5e-16, Identities = 58/184 (31%), Positives = 88/184 (47%)
  Q:     6 YIAGVSGGPDSMLLLKLY--HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVY-RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKE 189
           Y+  VSGG DSM+L  L+  H     VVH N+ KR  ++ D ++VE  C        +H +P   +  K    NFQ  +R  R++  +  A  Y    ++ AHH DD  E   M+L      + Y            +Y +P + Y K EI    + H++ +  D TN +  Y RN+VR  +    KEE +
  S:    13 YVLAVSGGVDSMVLFDLFVKHNLNFVVVHFNHQKRAESILDHELVESMCT-------LHHIPYHYIKLKIKNGNFQEVSRNARYKNLEFIAEQYHTPYIVTAHHLDDLAETIMMKLIRGSNLLGYAAMQEVTHIDKFIYLKPLLNYSKEEISLYQQTHQIKFYEDHTNLEDTYSRNRVRHHLIPLLKEEND 196
>gi|58336616|ref|YP_193201.1| putative cell cycle [Lactobacillus acidophilus NCFM] >gi|58253933|gb|AAV42170.1| putative cell cycle [Lactobacillus acidophilus NCFM] (423 aa)
Score = 216, Expect = 9.4e-16, Identities = 53/181 (29%), Positives = 94/181 (51%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           +   SGGPDSM LL +        K      H N+  R+ +  + +++++YC++ ++PL V    ++   K   +A AR++R+    K A     D LL AHH DD IE   ++ + +        ++  G ++G+ + RP +   K EILA  +E  + + +D TN +    RN++R  +    K+E
  S:    25 LVAASGGPDSMALLDMLKDLQKKQKFELIAAHFNHQLRSDSEEETRILKDYCQKNEIPLFVAKWAKNEQPKSGIEAAAREVRYNFLTKIAKNETADYLLTAHHGDDLIENILLKFIRSGNPEEMNSLQAVGVMHGVTLLRPLLSSSKQEILAYDKERGISFIVDSTNKEDDTMRNRMRHHVVPILKKE 212
>gi|160933737|ref|ZP_02081125.1| hypothetical protein CLOLEP_02598 [Clostridium leptum DSM 753] >gi|156867614|gb|EDO60986.1| hypothetical protein CLOLEP_02598 [Clostridium leptum DSM 753] (320 aa)
Score = 215, Expect = 1.0e-15, Identities = 70/217 (32%), Positives = 103/217 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKI-------ACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLA 218
           P +  +AGVSGG DSM LL +   +            HVN+  R   A RD++ V  YC++  +PL V  +    E    K   +A  R +R+E F++ A    V  +  AH   D  E   + L         G   +G L G+      + RP I   + EI   C EHK+PY  D TN +  Y RN+VR ++    KE    F   V  M + + +    L + A++ L 
  S:    17 PDSAVVAGVSGGADSMALLHVLQSRRKDWPELKVTAAHVNHCLRGAEADRDEEHVRRYCQREGIPLEVLKIDVREEAAKRKLGLEACGRAVRYEFFRRLAGENGV--IATAHTLSDLAETVLLHL-------TRGTGLKG-LCGIPPVRENIVRPLIDCSRREIEDYCREHKIPYVTDSTNLEARYSRNKVRLQVLPALKEINPAFEEAVGRMAQSLREDDGCLCEEARELLG 239
>gi|85057872|ref|YP_456788.1| cell cycle protein MesJ [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518068|sp|Q2NIN4.1|TILS_AYWBP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|84789977|gb|ABC65709.1| cell cycle protein MesJ [Aster yellows witches'-broom phytoplasma AYWB] (436 aa)
Score = 215, Expect = 1.1e-15, Identities = 61/184 (33%), Positives = 101/184 (54%)
  Q:     6 YIAGVSGGPDSMLLLK-LYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKE 189
           YI  VSGG DSM LL  L  +KI   VVH N+   +   +++++V+ YC  L+  L  H   E    +KNFQAQAR +R ++  + A+ ++   +L AHH DD  E   +Q  +R   +  Y G++ +         +PF+   K +I++    +K+P+  D TN +  Y+RNQ+R ++  + K +  
  S:    16 YIIAVSGGVDSMALLHYLVAQKIKLQVVHFNHLTNSNTWKNKELVKNYC--LQNSLGFHYF-ELNCPQKNFQAQARLLRQQKLMQIAAKHRTPFILTAHHLDDLAETI-LQKISRSSTLLGYSGMQIQTSWTDFIFLKPFLYIPKAKIISYAAFYKIPFLEDYTNQKLTYQRNQIRHQVIPYLKTQTS 199
>gi|161506859|ref|YP_001576813.1| putative cell cycle protein [Lactobacillus helveticus DPC 4571] >gi|160347848|gb|ABX26522.1| putative cell cycle protein [Lactobacillus helveticus DPC 4571] (431 aa)
Score = 214, Expect = 1.5e-15, Identities = 54/182 (29%), Positives = 94/182 (51%)
  Q:     7 IAGVSGGPDSMLLLKLY-------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEK 188
           +   S GPDSM LL +        H K+    H N+  R  +  + K++++YC +  VPL +   P++   K   +A AR  R+    + A     D LL AHH DD +E   ++ + +        ++  G+++G+K+ RP + Y K E+L   +E+++ + ID TN      RN++R  +    K+E 
  S:    33 LVAASSGPDSMALLDMLKNLQDNAHFKLMAA-HFNHQLRADSEEESKLLKKYCSENHVPLFIAKWPKEDQPKVGIEAAARHARYAFLTQMAKENNADYLLTAHHGDDLLENILLKFIRSGNPEEMNSLQMIGKMHGIKLLRPLLGYSKAELLQYNQEYQIDFVIDSTNQADETMRNRLRHHVVPLLKKEN 221
>gi|170288158|ref|YP_001738396.1| tRNA(Ile)-lysidine synthetase [Thermotoga sp. RQ2] >gi|170175661|gb|ACB08713.1| tRNA(Ile)-lysidine synthetase [Thermotoga sp. RQ2] (414 aa)
Score = 213, Expect = 2.0e-15, Identities = 61/180 (33%), Positives = 96/180 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM--------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  VSGG DSM LL +  K       KI    H+++  R ++ RD++ VE  C+Q  +P+    V   ++WK   K  +  AR++R++  ++ A      K+ LAHH++D +E    +L          I+  G L G+        +  RPF+ + ++EI     E  VPY +DETN    Y RN +R  I    KE
  S:     9 LVAVSGGIDSMTLLYVLRKFSPLLKIKITAA-HLDHRIRESSRRDREFVERICRQWNIPVETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLETVVHRL----------IRGTGPL-GLACISPKREEFIRPFLVFKRSEIEEYAREKGVPYVVDETNYDVKYTRNFIRHRIVPLMKE 194
>gi|167465338|ref|ZP_02330427.1| tRNA(Ile)-lysidine synthetase [Paenibacillus larvae subsp. larvae BRL-230010] (424 aa)
Score = 212, Expect = 2.5e-15, Identities = 57/174 (32%), Positives = 95/174 (54%)
  Q:     7 IAGVSGGPDSMLLLKLYH--------KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGGPDS+ LL + +        K IA  V+  + K  +A  + K V  +   L +P  V  +      ++   N Q  AR+ R+E   K A++Y  DK+ LAHH DD  E   M++      +   GI  + +   +++ RP ++ +KNE+++ C EH++ +  D +N    Y RNQVR ++
  S:    24 VVAVSGGPDSIALLHMLYRLSDEQGWKVIAAHVNHQFRKEESA-EEAKYVMSFASGLGIPCEVGVIDVPAYIRETSLNPQVAAREKRYEFLHKIANVYNADKIALAHHADDQAETVLMRIVRGTGLSGLTGIPIKRKEKNVELVRPMLRIYKNEVISYCHEHQLHFFRDSSNDSRKYFRNQVRLDV 208
>gi|15643345|ref|NP_228389.1| hypothetical protein TM0579 [Thermotoga maritima MSB8] >gi|8928511|sp|Q9WZ48|TILS_THEMA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|4981097|gb|AAD35664.1|AE001733_1 conserved hypothetical protein [Thermotoga maritima MSB8] (414 aa)
Score = 212, Expect = 2.8e-15, Identities = 60/180 (33%), Positives = 97/180 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM--------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  VSGG DSM LL +  K       KI    H+++  R ++ RD++ VE  C+Q  +P+    V   ++WK   K  +  AR++R++  ++ A      K+ LAHH++D +E    +L          I+  G L G+        +  RPF+ + ++EI     ++ VPY +DETN    Y RN +R  I    KE
  S:     9 LVAVSGGIDSMTLLYVLRKFSPLLKIKITAA-HLDHRIRESSRRDREFVERICRQWNIPVETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLETVVHRL----------IRGTGPL-GLACISPKREEFIRPFLVFKRSEIEEYARKNNVPYVVDETNYNVKYTRNFIRHRIVPLMKE 194
>gi|148269484|ref|YP_001243944.1| tRNA(Ile)-lysidine synthetase [Thermotoga petrophila RKU-1] >gi|147735028|gb|ABQ46368.1| tRNA(Ile)-lysidine synthetase [Thermotoga petrophila RKU-1] (419 aa)
Score = 211, Expect = 3.3e-15, Identities = 62/180 (34%), Positives = 96/180 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM--------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  VSGG DSM LL +  K       KI    H+++  R ++ RD++ VE  C+Q  VP+    V   ++WK   K  +  AR++R++  ++ A      K+ LAHH++D +E    +L          I+  G L G+        +  RPF+ + ++EI     E  VPY +DETN    Y RN +R  I    KE
  S:    14 LVAVSGGIDSMTLLYVLKKFSPLLKIKITAA-HLDHRIRESSRRDREFVERICRQWNVPVETSEVDVPSLWKDSGKTLEEIARELRYDFLRRTAKKVGATKIALAHHKNDLLETVVHRL----------IRGTGPL-GLACISPKREEFIRPFLVFKRSEIEEYAREKGVPYVVDETNYDVKYTRNFIRHRIVPLMKE 199
>gi|163791058|ref|ZP_02185479.1| hypothetical protein CAT7_12110 [Carnobacterium sp. AT7] >gi|159873703|gb|EDP67786.1| hypothetical protein CAT7_12110 [Carnobacterium sp. AT7] (471 aa)
Score = 210, Expect = 4.4e-15, Identities = 58/186 (31%), Positives = 88/186 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACV------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           P  + +  VSGG DSM+LL L  +    V      VHVN+  R  ++ ++K + +YCK   +       P         +A AR+ R+  F+      +   LL  HH DD IE   M+L    +     GIK +   YG ++ RP + Y K  +    +E  + +  DETN    Y RN+ R +I    K+E
  S:    19 PTDRLLLAVSGGVDSMVLLDLIQRLPKVVRPWFGMVHVNHQLREASIEEEKFLVDYCKSANISFFFKRWPVKEQPTDGVEAAAREFRYAFFRNVLRDQQATHLLTGHHGDDQIETILMRLVRGGQLESIAGIKEQRSFYGSQLTRPLLPYSKKMLYHYSQERSLVFFEDETNKSLDYTRNRYRHQIVPLLKKE 211
>gi|104773521|ref|YP_618501.1| hypothetical protein Ldb0367 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513516|ref|YP_812422.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422602|emb|CAI97205.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092831|gb|ABJ57984.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (431 aa)
Score = 208, Expect = 7.0e-15, Identities = 55/189 (29%), Positives = 95/189 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD----ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  ++   SGGPDSM LL L  +          H+++  R  + ++ +++  YC + ++PL     P+    +   +A AR  R+    + A   K D LL AHH DD +E   ++L      R+      +  RG+   +K+ RP +   K ++LA  ++  + Y  DETN   I  RN++RQE+    K+E  + 
  S:    19 EGNFLVAASGGPDSMALLDLMRRLPGGFQLYAAHLDHQLRADSQKESQVLRAYCHKYQLPLYESVWPKSLHPESGLEAAARDYRYNFLFEVARQVKADYLLTAHHGDDLLENILLKLVRSGIPREMNSLKPVSQRGQ---VKLVRPLLAVGKADLLAYAKKQGLEYVEDETNFTGITARNRLRQEVVPLLKKESPDL 212
>gi|167052388|ref|ZP_02278786.1| hypothetical protein LmonF_02352 [Listeria monocytogenes FSL F2-515] (178 aa)
Score = 208, Expect = 7.2e-15, Identities = 49/141 (34%), Positives = 83/141 (58%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKN 147
           +  VSGGPDS+ LL       L  K+   V H+N+  R  A ++Q++VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L     ++ + GI+ + EL G +  RPF+  +K+
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPNYKS 175
>gi|167403367|ref|ZP_02308198.1| hypothetical protein LmonocytFSL_01387 [Listeria monocytogenes FSL J2-003] (185 aa)
Score = 208, Expect = 7.8e-15, Identities = 50/144 (34%), Positives = 84/144 (58%)
  Q:     7 IAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV---PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEIL 150
           +  VSGGPDS+ LL       L  K+   V H+N+  R  A ++Q++VE +C++  +P  +  V         +K  +  AR +R++ F+K  +   ++KL+LAHH DD IE   M+L     ++ + GI+ + EL G +  RPF +  K ++L
  S:    25 LVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFYQLQKQKLL 178
>gi|153812536|ref|ZP_01965204.1| hypothetical protein RUMOBE_02935 [Ruminococcus obeum ATCC 29174] >gi|149831461|gb|EDM86549.1| hypothetical protein RUMOBE_02935 [Ruminococcus obeum ATCC 29174] (471 aa)
Score = 208, Expect = 7.8e-15, Identities = 63/177 (35%), Positives = 105/177 (59%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHT--VPEDTV-WKKNFQAQARKIRFEQFQK----AASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++ I GVSGGPDSM +L + +        ++  VVHVN+  R   ALRDQ+MVE+ C + K+P  V+   VP   + WK   +   RK+R   F+K    A ++ +  ++ LAH+++D  E     L AR   +  G+ +   L G ++ RP +   ++EI+   EE+ +   +D +N +  Y RN++R+ I
  S:    23 SEIILGVSGGPDSMTMLHILNGLRDEFGYRLR-VVHVNHGIRGKEALRDQQMVEKICSEWKIPCAVYNYDVPALALSWKMGTEEAGRKVRRIAFEKEKENAVAIPEQVRVALAHNQNDMAETMLHHL-ARGTGIR-GLCSLKPLNG-EIIRPLLCLERSEIVNYVEENSIQTVLDSSNMEDDYTRNRIRRHI 210
>gi|154505539|ref|ZP_02042277.1| hypothetical protein RUMGNA_03076 [Ruminococcus gnavus ATCC 29149] >gi|153794197|gb|EDN76617.1| hypothetical protein RUMGNA_03076 [Ruminococcus gnavus ATCC 29149] (469 aa)
Score = 206, Expect = 1.1e-14, Identities = 66/174 (37%), Positives = 98/174 (56%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIA---CVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVH--TVPEDTVWKK-NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           IAG+SGG DS+ LL +     +KI      VHVN+  R   A RD++  E +C++  VP IV+   V E    KK + +   R +R + F++    Y   K+ LAHH++D  E   + L AR      G   RG L G++     + RP +   + EI    +EH++ Y  DETNA   Y RN++R +I
  S:    22 IAGISGGADSICLLFVLLRLQEKIGFDVIAVHVNHGLRGENAKRDERFTETFCRERNVPCIVYHENVKEIAAQKKLSVEEAGRLVRRKAFEEVRIRYGGTKIALAHHQNDNAETMLLNL-AR------GTGIRG-LSGIRPVNGYMIRPLLGINRKEIEYYLKEHQLSYCEDETNAGDEYTRNRIRHQI 202
>gi|116495973|ref|YP_807707.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus casei ATCC 334] >gi|116106123|gb|ABJ71265.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus casei ATCC 334] (436 aa)
Score = 205, Expect = 1.5e-14, Identities = 73/287 (25%), Positives = 133/287 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR--AMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWL-------AHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLLYK 288
           P T+ +  VSGG DSM+LL L  K       V   ++  R  + ++Q  V    +QL+VP++         W+++      +A AR+ R+      A+    + ++ AHH DD +E    +L AR    A   GI+     +G ++ RP + Y K  I +  ++H V +  D +NA P Y RNQ+R ++    K++  +    +          L     +  +WL       A  + R     P   QR L+   L     +V    +  +L  +   +++ + L   I ++++ E++  L +
  S:    13 PHTRVLVAVSGGVDSMVLLNLAVKAADLDVVVATFDHRLRPESQQEQAFVVAAAQQLQVPVVTGQ------WRRSDGQPTSEAAARQARYAFLAATAAEQHAEVVMTAHHADDQLETILFRL-ARSGDPAALIGIRADRAWHGRRLVRPLLPYSKAMIRSYADQHNVRFCEDSSNADPHYARNQLRHQVIPAFKKQNTQLLAHIQTFTMEQTGLLALAEAQLAEWLQRLQVDDATVNWRAASSQPEAVQRLLLKKILQQWQPNVDRQLLSPVLASLSGTKERRFDLGGGISIAVQSEQIVRLTR 309
>gi|42518368|ref|NP_964298.1| hypothetical protein LJ0281 [Lactobacillus johnsonii NCC 533] >gi|61216579|sp|Q74LA3|TILS_LACJO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|41582653|gb|AAS08264.1| hypothetical protein LJ_0281 [Lactobacillus johnsonii NCC 533] (431 aa)
Score = 205, Expect = 1.5e-14, Identities = 54/183 (29%), Positives = 97/183 (53%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHKKIA------CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           +++   SGGPDS+ LLK+    +        V H+++  R  +  + ++++     LKV L+    P +   +   +A+AR+ R+    K    Y+ D LL AHH DD IE   ++ + +   A    ++  G L  MK+ RP +KY K+E+L   ++H + +  D+TN +    RN++R  +    K+E
  S:    19 KFLLAASGGPDSVALLKMLVNFLPNPSEQLIVAHLDHCLRDDSFLESQLLQRLTSALKVKLVEKKWPVELHPQAGVEAKAREYRYAFLAKVGRKYQTDYLLTAHHGDDLIENILLKFIRSGDVAEMNSLQIVGNLGSMKLLRPLVKYSKDELLKYDKDHHLDFIEDKTNFEDDTLRNRLRHHVVPLLKKE 208
>gi|49482736|ref|YP_039960.1| hypothetical protein SAR0510 [Staphylococcus aureus subsp. aureus MRSA252] >gi|61217256|sp|Q6GJG2|TILS_STAAR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|49240865|emb|CAG39532.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (431 aa)
Score = 205, Expect = 1.6e-14, Identities = 58/174 (33%), Positives = 93/174 (53%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN--FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL--------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM LL       K  ++K+ C+ HVN+  R+ ++ + + +E YC++  + L +  +       +N   Q +AR  R+E F +  ++ + D LL AHH DD       QL+     ++ G  TR +L         G ++YRP +   K EI    E + +PY  DE+N    Y RN +R  I
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL-HVNHGVRSASIEEARFLEAYCERHHIDLHIKKLDLSHSLNRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDD-------QLETIMYRIFNGKSTRNKLGFDELSKRNGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIRNRI 197
>gi|167729802|emb|CAO80714.1| putative tRNA(Ile)-lysidine synthase (tilS-like) [Candidatus Cloacamonas acidaminovorans] (482 aa)
Score = 205, Expect = 1.7e-14, Identities = 54/174 (31%), Positives = 94/174 (54%)
  Q:     7 IAGVSGGPDSMLLLKLYHKK------IACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH--TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + G SGG DS  +L L+ +          V+H+N+  R   +  D+  V++ C+ L +P+I+    VPE      N + QARK+RFE F K    Y  DK+LLAH ++D  +   + L+  + A   G+     + G KV  P + + + E+  + ++  + +  D +N +  ++RN +R EI
  S:    27 LLGCSGGADSNAMLYLFSRLRVPLNLTLLVIHINHQIRGAESDADEDFVKQLCQDLNIPVIIRKIVVPE----TGNLENQARKLRFEVFNKILESYNFDKILLAHQKED--QAETVMLNFLRGAGISGMAGIKGITG-KVVHPLLCFSRKELEEVLKQAGISWRTDSSNLETKFRRNLLRNEI 202
>gi|191639452|ref|YP_001988618.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Lactobacillus casei] >gi|190713754|emb|CAQ67760.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Lactobacillus casei BL23] (436 aa)
Score = 204, Expect = 2.1e-14, Identities = 56/179 (31%), Positives = 93/179 (51%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR--AMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P T+ +  VSGG DSM+LL L  K       V   ++  R  + ++Q  V    +QL+VP++         W+++      +A AR+ R+      A+    + ++ AHH DD +E    +L AR    A   GI+     +G ++ RP + Y K  I +  ++H V +  D +NA P Y RNQ+R ++
  S:    13 PHTRVLVAVSGGVDSMVLLNLAVKAADLDVVVATFDHRLRPESQQEQAFVVAAAQQLQVPVVTGQ------WRRSDGQPTSEAAARQARYAFLAATAAEQHAEVVMTAHHADDQLETILFRL-ARSGDPAALIGIRADRAWHGRRLVRPLLPYSKAMIRSYADQHNVRFCEDSSNADPHYARNQLRHQV 194
>gi|109647742|ref|ZP_01371645.1| tRNA(Ile)-lysidine synthetase [Desulfitobacterium hafniense DCB-2] >gi|109640832|gb|EAT50387.1| tRNA(Ile)-lysidine synthetase [Desulfitobacterium hafniense DCB-2] (472 aa)
Score = 204, Expect = 2.2e-14, Identities = 59/179 (32%), Positives = 95/179 (53%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLY--------HKKIACVV-HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P ++ +A VSGGPDS+ L  +          +KI  V+ HV++  R  +  ++KMV+   +  ++P ++H        K   K+FQ  AR+ R+  +Q+         L  AHH  D  E    +L         G  T G L G+     K+ RP +   K +IL  C   K+PY +D +N +PIY RN++R ++
  S:    16 PGSRILAAVSGGPDSVALAHILWRYIQDKQEQKITLVITHVHHGVREESDDEEKMVQNMARDWEIPCLIHRFDSKNYAKSVGKSFQTAAREWRYACWQEDMRKENCTLLATAHHLGDQAETVLYRL-------LRGSGTAG-LAGIYPQKGKLIRPLLTVTKEDILEYCRNEKLPYALDHSNEEPIYVRNKIRLQL 203
>gi|73663556|ref|YP_302337.1| hypothetical protein SSP2247 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72496071|dbj|BAE19392.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (431 aa)
Score = 204, Expect = 2.3e-14, Identities = 62/174 (35%), Positives = 90/174 (51%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIV-HTVPEDTVWKKN-FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM+LL       K  + K+ C+ HVN+N R  A  ++  ++++CK   V L V H    D + K N  +  AR  R++ F +     K D LL AHH+DD IE    + +  R      G+  +      ++ +P +   KNEI      H+VPY  DETN Q  Y RN +R  I
  S:    17 VLAVSTGVDSMVLLHELITRLKDSYAKLTCL-HVNHNIRPIAKEEEYFLKQFCKAHHVELYVRHLDLSDVIEKGNSIENDARVARYQWFDEMMYELKADILLTAHHQDDQIETIFYRVMTGRSTRSSLGMAYQTTRASYQICKPLLSTTKNEIRDYQVMHRVPYYEDETNTQNHYVRNDIRNRI 199
>gi|78043578|ref|YP_359085.1| tRNA(Ile)-lysidine synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|77995693|gb|ABB14592.1| tRNA(Ile)-lysidine synthetase [Carboxydothermus hydrogenoformans Z-2901] (449 aa)
Score = 204, Expect = 2.4e-14, Identities = 59/186 (31%), Positives = 98/186 (52%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           P  + + GVSGGPDSM LL     Y +++     VVHVN+  R   +  D+++V ++ ++  +   V  + +    ++N QA AR+ R+E F +       DK+ LAH   D  E   M +         G  T G L G+     ++ RP    ++ E+++  E   +PY +D +N  P Y RN+VR ++  +  EE
  S:    20 PGEKVVVGVSGGPDSMALLFCLLKYREEVDFSLEVVHVNHGLRGRESDLDEELVLDFTRKYGINFHVKKLDDLKDLRENLQAVARQKRYEFFYEVLEKTGADKIALAHTASDVAETVMMNI-------LRGAGTEG-LCGIWPVRDRIIRPLYTVFRREVMSFVERKNIPYRVDSSNLVPKYLRNKVRLKLFPFINEE 209
>gi|57651385|ref|YP_185441.1| hypothetical protein SACOL0553 [Staphylococcus aureus subsp. aureus COL] >gi|87161906|ref|YP_493196.1| hypothetical protein SAUSA300_0487 [Staphylococcus aureus subsp. aureus USA300] >gi|88194269|ref|YP_499061.1| hypothetical protein SAOUHSC_00484 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220683|ref|YP_001331505.1| hypothetical protein NWMN_0471 [Staphylococcus aureus subsp. aureus str. Newman] >gi|161508749|ref|YP_001574408.1| hypothetical protein USA300HOU_0503 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728153|ref|ZP_02760430.1| cell cycle control ATP-binding protein MesJ [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|61216391|sp|Q5HIG6|TILS_STAAC tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|57285571|gb|AAW37665.1| tRNA(Ile)-lysidine synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87127880|gb|ABD22394.1| MesJ/Ycf62 family protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201827|gb|ABD29637.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373483|dbj|BAF66743.1| isoleusyl-tRNA-2-lysl-cytidine synthase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160367558|gb|ABX28529.1| cell cycle control ATP-binding protein MesJ [Staphylococcus aureus subsp. aureus USA300_TCH1516] (431 aa)
Score = 203, Expect = 2.4e-14, Identities = 58/174 (33%), Positives = 93/174 (53%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN--FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL--------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM LL       K  ++K+ C+ HVN+  R+ ++ + + +E YC++  + L +  +       +N   Q +AR  R+E F +  ++ + D LL AHH DD       QL+     ++ G  TR +L         G ++YRP +   K EI    E + +PY  DE+N    Y RN +R  I
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL-HVNHGVRSASIEEARFLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDD-------QLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIRNRI 197
>gi|15923499|ref|NP_371033.1| hypothetical protein SAV0509 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926186|ref|NP_373719.1| hypothetical protein SA0467 [Staphylococcus aureus subsp. aureus N315] >gi|148266968|ref|YP_001245911.1| hypothetical protein SaurJH9_0531 [Staphylococcus aureus subsp. aureus JH9] >gi|150393014|ref|YP_001315689.1| hypothetical protein SaurJH1_0544 [Staphylococcus aureus subsp. aureus JH1] >gi|156978837|ref|YP_001441096.1| hypothetical protein SAHV_0506 [Staphylococcus aureus subsp. aureus Mu3] >gi|61216721|sp|Q99W94|TILS_STAAM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217307|sp|Q7A7A6|TILS_STAAN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|13700399|dbj|BAB41697.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14246277|dbj|BAB56671.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|147740037|gb|ABQ48335.1| tRNA(Ile)-lysidine synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|149945466|gb|ABR51402.1| tRNA(Ile)-lysidine synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|156720972|dbj|BAF77389.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (431 aa)
Score = 203, Expect = 2.8e-14, Identities = 58/174 (33%), Positives = 93/174 (53%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN--FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL--------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM LL       K  ++K+ C+ HVN+  R+ ++ + + +E YC++  + L +  +       +N   Q +AR  R+E F +  ++ + D LL AHH DD       QL+     ++ G  TR +L         G ++YRP +   K EI    E + +PY  DE+N    Y RN +R  I
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL-HVNHGVRSASIEEARFLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDD-------QLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYIRNDIRNRI 197
>gi|89892946|ref|YP_516433.1| hypothetical protein DSY0200 [Desulfitobacterium hafniense Y51] >gi|89332394|dbj|BAE81989.1| hypothetical protein [Desulfitobacterium hafniense Y51] (472 aa)
Score = 203, Expect = 3.1e-14, Identities = 58/179 (32%), Positives = 95/179 (53%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLY--------HKKIACVV-HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P ++ +A VSGGPDS+ L  +          +KI  V+ HV++  R  +  ++KMV+   +  ++P ++H        K   K+FQ  AR+ R+  +Q+         L  AHH  D  E    +L         G  T G L G+     K+ RP +   K +IL  C   K+PY +D +N +P+Y RN++R ++
  S:    16 PGSRILAAVSGGPDSVALAHILWRYIQDKQEQKITLVITHVHHGVREESDDEEKMVQNMARDWEIPCLIHRFDSKNYAKSVGKSFQTAAREWRYACWQEDMRKENCTLLATAHHLGDQAETVLYRL-------LRGSGTAG-LAGIYPQKGKLIRPLLTVTKEDILEYCRNEKLPYALDHSNEEPVYVRNKIRLQL 203
>gi|82750216|ref|YP_415957.1| hypothetical protein SAB0458 [Staphylococcus aureus RF122] >gi|82655747|emb|CAI80146.1| conserved hypothetical protein [Staphylococcus aureus RF122] (431 aa)
Score = 202, Expect = 3.3e-14, Identities = 58/174 (33%), Positives = 92/174 (52%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN--FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--------GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM LL       K  ++K+ C+ HVN+  R+ ++ + + +E YC+   + L +  +       +N   Q +AR  R+E F +  ++ + D LL AHH DD       QL+     ++ G  TR +L         G ++YRP +   K EI    E + +PY  DE+N    Y RN +R  I
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL-HVNHGVRSASIEEARFLEAYCEGHHIDLHIKKLDLSHSLNRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDD-------QLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIRNRI 197
>gi|116333183|ref|YP_794710.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus brevis ATCC 367] >gi|116098530|gb|ABJ63679.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus brevis ATCC 367] (450 aa)
Score = 202, Expect = 3.5e-14, Identities = 64/240 (26%), Positives = 117/240 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEK-----------EEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           P+   +  VS G DSM+LL+L        +    VVHVN+  R  +  +   ++++C   ++ L+    P D       +A AR  R++ F +     K D +  AH  D+ +E   ++L    + A   G+     L G +V RP + + K  + A   E +VP+  D TN + I  RN+VR ++    K+E            ++    +   ++ + Q+L ++M R+       +V  L R+ + +QR L+   +
  S:    19 PQQHGLVAVSTGVDSMVLLQLLMTLPVTMRPKLTVVHVNHQLRQQSQTEAAFLKKWCAAHQISLVTTKWPIDQHPSHGVEAAARAFRYDFFAQQLHQQKADWVATAHQADEQVETILLKLIRGGQLAQLTGMAASRPLAGGRVIRPLLPFTKERLKAYAREQQVPWYEDATNQELIASRNRVRHQLIPLLKQENPQVVEHVMTYAQQLQATLMISDQALDQQLQTIMTRSD------NVAGLLRHSIAEQRLLLTRLI 270
>gi|29374904|ref|NP_814057.1| hypothetical protein EF0263 [Enterococcus faecalis V583] >gi|61216623|sp|Q839B3|TILS_ENTFA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29342362|gb|AAO80128.1| conserved domain protein [Enterococcus faecalis V583] (462 aa)
Score = 202, Expect = 3.5e-14, Identities = 59/198 (29%), Positives = 95/198 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA------CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMN 199
           P    +  VSGG DSM LL L  +          V HVN+  R  + ++ + +  YC+Q ++     T  ED   ++N +A+AR  R+E F++   +     L+ AHH DD  E   M+L      +   GIK R      ++ RP + Y K E+    +     Y  DETN    Y RN++R ++    K+E  +F   + + +
  S:    17 PHQTIVVAVSGGVDSMALLTLMEQVAEKEQLQLVVAHVNHQLREASAQEAQYLATYCQQREL-TYYETRWEDPEKQRNLEAKARTFRYEFFKEVMEIEGAAVLMTAHHLDDQAETILMKLIRGTNFSHSAGIKERRPFATGELIRPLLIYPKEELYQFAQRQAFVYFEDETNQTNEYLRNRLRNQVLPLLKQENPQFLDQIASFS 220
>gi|21282193|ref|NP_645281.1| hypothetical protein MW0464 [Staphylococcus aureus subsp. aureus MW2] >gi|49485373|ref|YP_042594.1| hypothetical protein SAS0466 [Staphylococcus aureus subsp. aureus MSSA476] >gi|61217254|sp|Q6GBX9|TILS_STAAS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217380|sp|Q8NXZ4|TILS_STAAW tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|21203629|dbj|BAB94329.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49243816|emb|CAG42241.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] (431 aa)
Score = 202, Expect = 3.8e-14, Identities = 58/174 (33%), Positives = 93/174 (53%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN--FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL--------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM LL       K  ++K+ C+ HVN+  R+ ++ + + +E YC++  + L +  +       +N   Q +AR  R+E F +  ++ + D LL AHH DD       QL+     ++ G  TR +L         G ++YRP +   K EI    E + +PY  DE+N    Y RN +R  I
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL-HVNHGVRSASIEEARFLEVYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDD-------QLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIRNRI 197
>gi|27469192|ref|NP_765829.1| hypothetical protein SE2274 [Staphylococcus epidermidis ATCC 12228] >gi|57866063|ref|YP_187744.1| MesJ/Ycf62 family protein [Staphylococcus epidermidis RP62A] >gi|61217168|sp|Q5HRP5|TILS_STAEQ tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217351|sp|Q8CQV3|TILS_STAES tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|27316741|gb|AAO05916.1|AE016751_211 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57636721|gb|AAW53509.1| MesJ/Ycf62 family protein [Staphylococcus epidermidis RP62A] (432 aa)
Score = 201, Expect = 4.8e-14, Identities = 61/178 (34%), Positives = 88/178 (49%)
  Q:     3 KTQYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP-EDTVWKKN-FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K   +  VS G DSM LL       +  ++K+ CV HVN+  R  +  ++  + EYC Q  + + +  +   D V   N  Q +AR+ R+E F    +  + D LL AHH DD  E    +L   R      G+         KVYRP +   K EILA    +++PY  D +N    Y RN +RQ I
  S:    11 KAHIVVAVSTGIDSMSLLYSLLNDYQHTYRKLTCV-HVNHGLREQSYEEEAFLREYCHQHHIDIYIKRLDLSDIVADGNSIQQEARQRRYEWFGDIIAQLRADVLLTAHHLDDQFETIIYRLFTGRSTRNSLGMTYESYFNQYKVYRPMLNLKKTEILAYQYANQIPYYEDMSNQDRKYVRNDIRQRI 197
>gi|169189801|ref|ZP_02849797.1| tRNA(Ile)-lysidine synthetase [Paenibacillus sp. JDR-2] >gi|169003453|gb|EDS50321.1| tRNA(Ile)-lysidine synthetase [Paenibacillus sp. JDR-2] (475 aa)
Score = 201, Expect = 5.3e-14, Identities = 59/174 (33%), Positives = 94/174 (54%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALR-DQKMVEEYCKQLKVP--LIVHTVP---EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +A VSGGPDSM LL L        +      HVN+  R  A R + ++V +Y ++L VP  +I   +P   E+T    N Q+ AR+ R+    + A  Y    + LAHH DD  E   M+ +         G+  + +   +++ RP ++  K++I+  C E  VPY +D +N +  Y RN VR ++
  S:    29 VAAVSGGPDSMALLHLLWQAARQEQLTVIAAHVNHGFRKDASRQEAEVVRQYAEKLGVPFEMIELDMPAYIEET--GINAQSAAREKRYAFLHETAVKYGASAIALAHHADDQAETVLMRVIRGAGLTGLAGMAPKRKEKNVELIRPLLRMNKSDIVRYCSERDVPYCLDSSNNERYYFRNVVRLDV 213
>gi|151570919|gb|EDN36573.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. novicida GA99-3549] (398 aa)
Score = 198, Expect = 1.0e-13, Identities = 67/205 (32%), Positives = 105/205 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI------ANWSKEEKEEFYIGVCAMNRVIGQKLFS 208
           +  I G SGG DS +LL +  +  I  + +++N+N    +L+ Q   ++ C++  +  I H++  D V K ++F+A A K R   FQK   LY    LLL HH+DD  E   +Q +     A   GI    EL    V RP +KY K EI    + + + Y  D++N    Y+RN +R +I       N +  +       +CA +  I QKL +
  S:    18 SHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQRYNLQFISHSL--DKVPKGESFEAWASKQRMAFFQKIMQLYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPYYKELQHGGVLRPLLKYSKIEIEEFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLT 230
>gi|187931484|ref|YP_001891468.1| predicted ATPase of the PP-loop superfamily [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712393|gb|ACD30690.1| predicted ATPase of the PP-loop superfamily [Francisella tularensis subsp. mediasiatica FSC147] (398 aa)
Score = 197, Expect = 1.3e-13, Identities = 66/205 (32%), Positives = 105/205 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI------ANWSKEEKEEFYIGVCAMNRVIGQKLFS 208
           +  I G SGG DS +LL +  +  I  + +++N+N    +L+ Q   ++ C++  +  I H++  D V K ++F+A A K R   FQK    Y    LLL HH+DD  E   +Q +     A   GI    EL+   V RP +KY K EI    + + + Y  D++N    Y+RN +R +I       N +  +       +CA +  I QKL +
  S:    18 SHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQKYNLQFISHSL--DKVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKIEIEGFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLT 230
>gi|56708293|ref|YP_170189.1| PP-loop family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670764|ref|YP_667321.1| PP-loop family protein [Francisella tularensis subsp. tularensis FSC198] >gi|134301750|ref|YP_001121718.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. tularensis WY96-3418] >gi|123359434|sp|Q14H05.1|TILS_FRAT1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|166988060|sp|A4IXE6.1|TILS_FRATW tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61216407|sp|Q5NFK3|TILS_FRATT tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|54113183|gb|AAV29225.1| NT02FT1257 [synthetic construct] >gi|56604785|emb|CAG45864.1| PP-loop family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321097|emb|CAL09247.1| PP-loop family protein [Francisella tularensis subsp. tularensis FSC 198] >gi|134049527|gb|ABO46598.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. tularensis WY96-3418] >gi|151569020|gb|EDN34674.1| hypothetical protein FTBG_00586 [Francisella tularensis subsp. tularensis FSC033] >gi|157122056|gb|EDO66196.1| PP-loop family protein [Francisella tularensis subsp. holarctica FSC022] (398 aa)
Score = 197, Expect = 1.3e-13, Identities = 66/205 (32%), Positives = 105/205 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI------ANWSKEEKEEFYIGVCAMNRVIGQKLFS 208
           +  I G SGG DS +LL +  +  I  + +++N+N    +L+ Q   ++ C++  +  I H++  D V K ++F+A A K R   FQK    Y    LLL HH+DD  E   +Q +     A   GI    EL+   V RP +KY K EI    + + + Y  D++N    Y+RN +R +I       N +  +       +CA +  I QKL +
  S:    18 SHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQKYNLQFISHSL--DKVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKIEIEGFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLT 230
>gi|187735920|ref|YP_001878032.1| tRNA(Ile)-lysidine synthetase [Akkermansia muciniphila ATCC BAA-835] >gi|187425972|gb|ACD05251.1| tRNA(Ile)-lysidine synthetase [Akkermansia muciniphila ATCC BAA-835] (334 aa)
Score = 197, Expect = 1.5e-13, Identities = 53/174 (30%), Positives = 80/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +AG+SGG DSM LL L      C     HVN+  R  A  ++  V  Y   L +P +   V   ++        +  AR+ R   F K A+ Y    + LAHHR+D  E A + L      ++          G+ V RP + + + +I +  E   +P+  D +N    Y RN +R EI
  S:    22 LAGISGGRDSMALLSLLSGMPGCNLVACHVNHQLRPEAEEEEMFVLRYAASLGIPCVRERVNVRSMAHTRGIAIEEAAREARQASFLKWAAGYPGALVALAHHRNDQQETALLHLCRGASGIHGMFPVSTWANGLTVVRPMLDFSREDITSYLEHRHIPWREDSSNQSAEYTRNALRHEI 201
>gi|118497835|ref|YP_898885.1| ATPase [Francisella tularensis subsp. novicida U112] >gi|194323808|ref|ZP_03057584.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella tularensis subsp. novicida FTE] >gi|166988059|sp|A0Q7B6.1|TILS_FRATN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|118423741|gb|ABK90131.1| predicted ATPase of the PP-loop superfamily [Francisella tularensis subsp. novicida U112] >gi|194322172|gb|EDX19654.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella tularensis subsp. novicida FTE] (398 aa)
Score = 193, Expect = 3.5e-13, Identities = 66/205 (32%), Positives = 105/205 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI------ANWSKEEKEEFYIGVCAMNRVIGQKLFS 208
           +  I G SGG DS +LL +  +  I  + +++N+N    +L+ Q   ++ C++  +  I H++  D V K ++F+A A K R   FQK    Y    LLL HH+DD  E   +Q +     A   GI    EL+   V RP +KY K EI    + + + Y  D++N    Y+RN +R +I       N +  +       +CA +  I QKL +
  S:    18 SHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQRYNLQFISHSL--DKVPKGESFEAWASKQRMAFFQKIMQPYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKIEIEEFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNIGQTLSRSANICAESNNILQKLLT 230
>gi|163938071|ref|YP_001642955.1| tRNA(Ile)-lysidine synthetase [Bacillus weihenstephanensis KBAB4] >gi|163860268|gb|ABY41327.1| tRNA(Ile)-lysidine synthetase [Bacillus weihenstephanensis KBAB4] (476 aa)
Score = 193, Expect = 4.2e-13, Identities = 59/186 (31%), Positives = 95/186 (51%)
  Q:     7 IAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKV---PLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           + GVSGGPDS+ LL     K   K++  VV HV++  R   +  D + V+  CK+L V    L ++       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C + KV   ID +N + +Y RN++R+ +  + KEE  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGNESYEDLQFVQGLCKELGVICETLRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRSFHNGYLIRPLLGVTKEEIVDYCNKLKVIPRIDPSNKKEVYTRNRLRKYVLPYLKEENPQMH 222
>gi|171325971|ref|ZP_02914466.1| tRNA(Ile)-lysidine synthetase [Geobacillus sp. WCH70] >gi|171088084|gb|EDT34440.1| tRNA(Ile)-lysidine synthetase [Geobacillus sp. WCH70] (462 aa)
Score = 192, Expect = 5.4e-13, Identities = 59/191 (30%), Positives = 89/191 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK-----KIACVV-HVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           P +  I GVSGGPDS+ LL  +        I  +  HV++  R   +  D   V+ +C    +  I   V  D        K   Q  AR+ R+  F +    YK   L L HH DD +E   M+L        Y GI  +   YG  + RPF+   + +I A C +H++    D +N +  Y RN+ R  +  + K+E    +
  S:    17 PNSTVIVGVSGGPDSLALLHFFWSIRQEWNITLIAAHVDHMFRGKQSEEDMNFVKHFCAARGI--ICEAVQMDVPAFQRESKLGVQEAARQCRYRFFGELMKKYKAHYLALGHHGDDQVETILMRLVRGSTSKGYAGIPAKRPFYGGYIIRPFLAISRADIDAYCRQHQITPRHDASNDKDDYTRNRFRHHVIPFLKKENPRLH 218
>gi|151572365|gb|EDN38019.1| hypothetical protein FTDG_00820 [Francisella tularensis subsp. novicida GA99-3548] (398 aa)
Score = 191, Expect = 6.3e-13, Identities = 66/205 (32%), Positives = 104/205 (50%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI------ANWSKEEKEEFYIGVCAMNRVIGQKLFS 208
           +  I G SGG DS +LL +  +  I  + +++N+N    +L+ Q   ++ C++  +  I H++  D V K ++F+A A K R   FQK    Y    LLL HH+DD  E   +Q +     A   GI    EL    V RP +KY K EI    + + + Y  D++N    Y+RN +R +I       N +  +       +CA +  I QKL +
  S:    18 SHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQICQKYNLQFISHSL--DKVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPYYKELQHGGVLRPLLKYSKIEIEEFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLT 230
>gi|89898057|ref|YP_515167.1| PP-loop superfamily ATPase [Chlamydophila felis Fe/C-56] >gi|89331429|dbj|BAE81022.1| PP-loop superfamily ATPase [Chlamydophila felis Fe/C-56] (317 aa)
Score = 190, Expect = 9.6e-13, Identities = 56/184 (30%), Positives = 91/184 (49%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC--VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           K  Y+  +SGG DS+ LL L   +      VHV+Y  R ++ R+ + +E  C+   VP+IV  VP +    ++ +  AR+ R+  F K      +  + LAHH +D  E   K  L+    +   G+  RGE+Y  G+ + RP +   K  +    +   + Y  D TN    Y R ++R +I  W +E
  S:    22 KKSYLLALSGGSDSLFLLYLLKSRGVSFIAVHVDYGWRESSYREAEELELRCQAEGVPIIVDHVPPEYRTSRDQENAARRYRYALFHKVCQKKNLSGIFLAHHANDQAETVLKRVLEGAHLSNLKGM--RGEVYYEGIPILRPLLHIPKIVLSRTLDAANIHYVHDITNTDERYLRARMRNKIFPWLEE 208
>gi|114565668|ref|YP_752822.1| tRNA(Ile)-lysidine synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336603|gb|ABI67451.1| tRNA(Ile)-lysidine synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (454 aa)
Score = 190, Expect = 9.7e-13, Identities = 51/179 (28%), Positives = 90/179 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA------CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P  + + GVSGGPDSM LL + HK          V+H+N+  R  A  +++ V E+C+   +           +    KK  +   R  R+  F +     + D +  AHH+DD  E   + L   +  + +   +  +G+L      RP +   K EI+   +E+++PY +D++N    + RN++R E+
  S:    17 PGKKVLLGVSGGPDSMALLHIMHKLTTEMDLGLAVLHLNHGLRPEAAAEEEFVREHCRNWGIDFYSRQADIRALALQEKKTLEEAGRDCRYRYFFEQLEELQADYIATAHHQDDQAETVLLHLLRGSGLKGLRGIMPRKGQLL-----RPLLALSKAEIIHYLDENQIPYCLDQSNNDLKFLRNRIRCEL 201
>gi|150020112|ref|YP_001305466.1| tRNA(Ile)-lysidine synthetase [Thermosipho melanesiensis BI429] >gi|149792633|gb|ABR30081.1| tRNA(Ile)-lysidine synthetase [Thermosipho melanesiensis BI429] (423 aa)
Score = 189, Expect = 1.1e-12, Identities = 58/185 (31%), Positives = 94/185 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLI---VHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           + GVSGG DSM LL L +         I CV  V++  R  +  +  +V+E+ + L VP I   +  +      K + +  ARK+R+E F +        K+ +AH+ +D +E    +L   + A  +GI      YGMK     + RP + + + +I      +K+PY +D++N    Y RN +R  I    KE    F
  S:    24 LIGVSGGVDSMTLLYLLNGVKDILNIDIVCVT-VDHGLRKESKEEINLVKEFSRSLDVPCISGEIDVLGYSKEKKLSIEEAARKLRYEFFYRIKEKVGASKIAVAHNLNDLVENVLFRLS--RGAGPFGI------YGMKPVKGNIIRPLLFFTREDIEDFAGNNKIPYAVDKSNFDTKYTRNFIRHNIIPKFKELNPSF 214
>gi|189461602|ref|ZP_03010387.1| hypothetical protein BACCOP_02261 [Bacteroides coprocola DSM 17136] >gi|189431712|gb|EDV00697.1| hypothetical protein BACCOP_02261 [Bacteroides coprocola DSM 17136] (426 aa)
Score = 189, Expect = 1.1e-12, Identities = 58/180 (32%), Positives = 96/180 (53%)
  Q:     7 IAGVSGGPDSMLLLK-LYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKK--NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +SGG DS+ LL+ L  +   CV  H N++ R   + RD++ V+  C+ L VPL ++H        +K  + +  AR++R+E F++         + +AHHRDD +E   + L  R   +  G+K    + G KV RP +   +++ILA   + K  Y  D TN +  Y RN++R  +    KE
  S:    23 LVALSGGADSVALLRVLLLEGYNCVAAHCNFHLRGEESDRDEEFVQNLCRGLDVPLQVIHFDTNGYASRKRISIEMAARELRYEWFEQVRLQVGASVIAVAHHRDDSVETFLLNL-VRGTGIN-GLKGIAAVNG-KVVRPLLDVSRDDILAFLADLKQDYVTDSTNLEDEYLRNKLRLNVIPLLKE 205
>gi|187251952|ref|YP_001876434.1| tRNA(Ile)-lysidine synthetase [Elusimicrobium minutum Pei191] >gi|186972112|gb|ACC99097.1| tRNA(Ile)-lysidine synthetase [Elusimicrobium minutum Pei191] (241 aa)
Score = 189, Expect = 1.2e-12, Identities = 60/176 (34%), Positives = 92/176 (52%)
  Q:     5 QYIAGVSGGPDSMLLL----KLYHKK----IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGI-KTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + + GVSGG DS+ LL    +L  KK     AC  H+N++ R  A +D+   ++ C+QL V L V T     +  KN    +  ARK R+  F+ AA       L LAHH DD +E   +  L   K     GI + R       + RP +   + +++   + +K+ +  DETN+   Y RN VR ++
  S:    27 KVLVGVSGGADSVCLLHFLTQLAQKKRFRVYAC--HINHSLRENAKKDELFTKKLCEQLGVELFVITKDVKNIALKNKLSIEHAARKARYSAFESAAKKINAGYLALAHHLDDNVETFFLNILRGTKAKGLTGIPRVRPLNKNTVIIRPLLNIRRQDVINYVKFNKLKFITDETNSDEKYTRNWVRNKL 213
>gi|23097532|ref|NP_690998.1| cell-cycle protein [Oceanobacillus iheyensis HTE831] >gi|61216653|sp|Q8EU18|TILS_OCEIH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|22775755|dbj|BAC12033.1| cell-cycle protein [Oceanobacillus iheyensis HTE831] (466 aa)
Score = 189, Expect = 1.2e-12, Identities = 62/209 (29%), Positives = 99/209 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIACV-VHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTV---WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQ 215
           I GVSGG DSM LL          +I  + + +N+  R   +  DQK VE++C    +  I H V        ++ + +  AR++R+E ++        D L L HH DD +E   M+L        + GI  +      ++ RPF+   K  IL   +E++VP+  D+TN    Y RN  R EI     +  E  +I    ++  + +    L K A +
  S:    22 IVGVSGGSDSMALLHFLKNLQEQWEIEVIALTINHQLRGEDSTADQKFVEQWCFHSDIRCIAHQVDVGEYQRQYRVSEELAARRLRYEIYEAEMRKQGADYLALGHHGDDQVETLFMRLTRVATSNAFEGIPVKRSFASGQLIRPFLCVNKQLILNYVKENEVPFREDQTNKDNKYTRNYYRNEIIPLLTKNNERLFITAQRLSETLREDENYLAKEANR 241
>gi|118475834|ref|YP_892985.1| cell cycle protein [Bacillus thuringiensis str. Al Hakam] >gi|118415059|gb|ABK83478.1| cell cycle protein [Bacillus thuringiensis str. Al Hakam] (480 aa)
Score = 189, Expect = 1.3e-12, Identities = 60/190 (31%), Positives = 96/190 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C E K+   ID +N + +Y RN++R+ +    KEE  + +
  S:    26 RSTIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV--ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH 226
>gi|49476703|ref|YP_034416.1| cell cycle protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166997011|ref|ZP_02263470.1| cell cycle protein [Bacillus cereus AH820] >gi|196036405|ref|ZP_03103802.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus W] >gi|196041776|ref|ZP_03109066.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus NVH0597-99] >gi|196047393|ref|ZP_03114606.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus 03BB108] >gi|61216513|sp|Q6HPV4|TILS_BACHK tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|49328259|gb|AAT58905.1| cell cycle protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195991035|gb|EDX55006.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus W] >gi|196021795|gb|EDX60489.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus 03BB108] >gi|196027396|gb|EDX66013.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus NVH0597-99] (476 aa)
Score = 189, Expect = 1.3e-12, Identities = 82/262 (31%), Positives = 136/262 (51%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE----------------KEEFYIGVCA---MNRVIGQKL---FSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHI--DVTGDKIDAILDFIQPFQ 264
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C E K+   ID +N + +Y RN++R+ +    KEE                ++E Y+   A   MN+VI +K     SL   A + ++ P    L+R  +    QL+ ++L  + I   ++   ID +++F +  Q
  S:    22 RSTIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV--ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMP----LQRRGI----QLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|30260254|ref|NP_842631.1| hypothetical protein BA0062 [Bacillus anthracis str. Ames] >gi|47525316|ref|YP_016665.1| hypothetical protein GBAA0062 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183097|ref|YP_026349.1| hypothetical protein BAS0062 [Bacillus anthracis str. Sterne] >gi|165872559|ref|ZP_02217191.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0488] >gi|167635086|ref|ZP_02393403.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0442] >gi|167641508|ref|ZP_02399756.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0193] >gi|170688892|ref|ZP_02880094.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0465] >gi|170707562|ref|ZP_02898015.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0389] >gi|177655625|ref|ZP_02936988.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0174] >gi|190569013|ref|ZP_03021914.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis Tsiankovskii-I] >gi|61216616|sp|Q81VX7|TILS_BACAN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|30253575|gb|AAP24117.1| conserved hypothetical protein [Bacillus anthracis str. Ames] >gi|47500464|gb|AAT29140.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177024|gb|AAT52400.1| conserved hypothetical protein [Bacillus anthracis str. Sterne] >gi|164711687|gb|EDR17232.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0488] >gi|167510493|gb|EDR85891.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0193] >gi|167529560|gb|EDR92310.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0442] >gi|170127558|gb|EDS96432.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0389] >gi|170667116|gb|EDT17877.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0465] >gi|172080036|gb|EDT65135.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0174] >gi|190559937|gb|EDV13921.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis Tsiankovskii-I] (476 aa)
Score = 189, Expect = 1.3e-12, Identities = 60/190 (31%), Positives = 96/190 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C E K+   ID +N + +Y RN++R+ +    KEE  + +
  S:    22 RSTIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV--ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH 222
>gi|65317524|ref|ZP_00390483.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Bacillus anthracis str. A2012] (480 aa)
Score = 188, Expect = 1.3e-12, Identities = 60/190 (31%), Positives = 96/190 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C E K+   ID +N + +Y RN++R+ +    KEE  + +
  S:    26 RSTIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV--ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH 226
>gi|196230473|ref|ZP_03129335.1| tRNA(Ile)-lysidine synthetase [Chthoniobacter flavus Ellin428] >gi|196225403|gb|EDY19911.1| tRNA(Ile)-lysidine synthetase [Chthoniobacter flavus Ellin428] (311 aa)
Score = 188, Expect = 1.5e-12, Identities = 54/179 (30%), Positives = 92/179 (51%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK---KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRG-ELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P+ + + GVSGG DS+ LL   H    +   V H+++  R  ++ D + VE+  ++L    ++      T+ K   K+ +  AR+ R   F   A  +   +L LAHH DD +E     L     A   A    + TR  +   +++ RPF+  W+ EI A    HK+ +  D +N+   + RN++R +I
  S:     7 PEERCLIGVSGGRDSVALLHQLHAAGFRELIVCHLDHALRAESVADAQFVEKLARKLDYAFVLQREDVATLAKQRKKSLETTAREARISFFTHVAREHDCPRLFLAHHADDQVETLLFNLFRGAGAAGLAGMSALSTRTIDGVTLQISRPFLGTWREEIEAYILRHKLSFVEDASNSDRKFTRNRLRHDI 196
>gi|116628949|ref|YP_814121.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus gasseri ATCC 33323] >gi|116094531|gb|ABJ59683.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus gasseri ATCC 33323] (431 aa)
Score = 188, Expect = 1.5e-12, Identities = 52/183 (28%), Positives = 94/183 (51%)
  Q:     5 QYIAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           +++   SGGPDS+ L  +         K   V H+++  R  +  + +++++     K+ LI  + P     +   +A+AR+ R+         Y+VD LL AHH DD IE   ++ + +   A    ++  G L  M++ RP IKY K+++L   + + + Y  DETN +    RN++R  +    K+E
  S:    19 KFLLAASGGPDSVALFHMLVNFLPNPSKQLIVAHLDHCLRKDSYLESELLQKLTTAFKIKLIEKSWPVALHPQTGIEAKAREFRYAFLAHTGKKYQVDYLLTAHHGDDLIENILLKFIRSGDVAEMNSLQIVGNLDSMRLLRPLIKYSKDQLLEYDKRNGLDYIEDETNFEDDTLRNRLRHYVVPLLKKE 208
>gi|125974740|ref|YP_001038650.1| tRNA(Ile)-lysidine synthetase [Clostridium thermocellum ATCC 27405] >gi|125714965|gb|ABN53457.1| tRNA(Ile)-lysidine synthetase [Clostridium thermocellum ATCC 27405] (470 aa)
Score = 188, Expect = 1.7e-12, Identities = 55/178 (30%), Positives = 94/178 (52%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHK-----KIACV-VHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K + + GVSGGPDS+ LL +  K      +  V VHVN+  R   A  D+  VE  CK+L V L+   +    + K+   + +   R  R+  F++ A  +   ++ +AH+++D  E   M +  R   +  G++    + G ++ RP +   + EI   C  H +   ID TN + IY RN++R ++
  S:    18 KDKIVVGVSGGPDSVCLLHILCKLRESMDLGLVAVHVNHMLRGDEASGDEAFVENLCKKLNVELVTRRIDIKKLAKERRLSLEETGRIERYRLFEEVADNFGAQRIAVAHNKNDQAETVLMNI-IRGTGLD-GLRGMDYIRG-RIIRPLLGVERTEIENYCRIHNLNPRIDSTNLENIYTRNKIRLDL 202
>gi|70727501|ref|YP_254417.1| hypothetical protein SH2502 [Staphylococcus haemolyticus JCSC1435] >gi|68448227|dbj|BAE05811.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (431 aa)
Score = 187, Expect = 1.7e-12, Identities = 55/174 (31%), Positives = 89/174 (51%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIV-HTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM L           +K++ C+ HVN+  R  + +++  +E +CKQ ++   V H    D V + K+ QA AR++R+E F +       D LL AHH DD +E    +L   R      GI  +       + RP ++  K +I     +++VPY  D +N+   Y RN +R  +
  S:    16 VIAVSTGVDSMSLFHNLLSQSSRTYKQLTCL-HVNHGLREASHKEEAFIEAFCKQYEITCYVKHLNLTDVVAQGKSIQADARQLRYEWFDEMMKRLDADVLLTAHHLDDQLETIFYRLFTGRSTRSTLGIDVQSIRNHYTICRPLLEVSKEDIRDYQHKYQVPYYEDSSNSDNKYVRNDIRNRL 198
>gi|167747340|ref|ZP_02419467.1| hypothetical protein ANACAC_02059 [Anaerostipes caccae DSM 14662] >gi|167653318|gb|EDR97447.1| hypothetical protein ANACAC_02059 [Anaerostipes caccae DSM 14662] (437 aa)
Score = 187, Expect = 1.8e-12, Identities = 65/180 (36%), Positives = 99/180 (55%)
  Q:     1 MPKTQYIA-GVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED---TVWKK--NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +  +IA GVSGG DS+ LL      K  +    C VH+N+  R  A +DQ+ VE  C++ KVP I  T  ED   T  K+  + +   R IR+  F+K   ++   K+ +AHH++D   QA+  L      M  G   +G L GM+     V RP +   K EILA  +E    +  D +N    + RN++R ++
  S:    14 IGQGDFIAVGVSGGADSVCLLLLLCELKQEYDLELCAVHINHGIRREAFKDQEFVENLCRRRKVPWI--TFSEDVKGTAEKQSMSLEEAGRMIRYRCFRKVLDMHGGGKIAVAHHQND---QAETML----YRMSRGTGIQG-LKGMEAVRADVIRPLLCLKKEEILAYLKEKDQDWMEDASNEDNTFARNKIRNQV 200
>gi|42526849|ref|NP_971947.1| hypothetical protein TDE1341 [Treponema denticola ATCC 35405] >gi|61217302|sp|Q73N15|TILS_TREDE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|41817164|gb|AAS11858.1| conserved hypothetical protein [Treponema denticola ATCC 35405] (460 aa)
Score = 187, Expect = 1.8e-12, Identities = 57/176 (32%), Positives = 94/176 (53%)
  Q:     5 QYIAGVSGGPDSMLLLKLY-------HKKIACVVHVNYNKRTT--ALRDQKMVEEYCKQLKVPLIVHTVPEDTVW------KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +  VSGG DSM +L  +       + +I  V+ VN+N R     L D + V ++C   K P I+  +P++TV+      K   +  AR +R+ +F+KAA     D +L AH+++D  E   M+L    +     GI  R      +  RP +   ++EI    +E  +P+  D TN +  Y RN+VR  +
  S:    31 RLLLAVSGGADSMAMLSAFLELKSDINAEIF-VLTVNHNIRPEKETLGDAQFVLDFCND-KCPCILAEIPKNTVFDEAKNRKTGIEDAARFLRYNEFEKAADSLNADYILTAHNKNDNYETVLMRLFQGSEPEALMGISPRRG----RFIRPMLNISRSEIEEYLKEKNIPWREDATNLEASYLRNKVRHNL 216
>gi|89256102|ref|YP_513464.1| PP-loop family protein [Francisella tularensis subsp. holarctica] >gi|115314576|ref|YP_763299.1| PP-loop superfamily ATPase [Francisella tularensis subsp. holarctica OSU18] >gi|156502120|ref|YP_001428185.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010788|ref|ZP_02275719.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella tularensis subsp. holarctica FSC200] >gi|122325399|sp|Q0BMM2.1|TILS_FRATO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|122500940|sp|Q2A488.1|TILS_FRATH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|166988058|sp|A7NB76.1|TILS_FRATF tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|89143933|emb|CAJ79152.1| PP-loop family protein [Francisella tularensis subsp. holarctica LVS] >gi|115129475|gb|ABI82662.1| probable PP-loop superfamily ATPase [Francisella tularensis subsp. holarctica OSU18] >gi|156252723|gb|ABU61229.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. holarctica FTNF002-00] (398 aa)
Score = 187, Expect = 1.9e-12, Identities = 64/205 (31%), Positives = 104/205 (50%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI------ANWSKEEKEEFYIGVCAMNRVIGQKLFS 208
           +  I G SGG DS +LL +  +  I  + +++N+N    +L+ Q   ++ C++  +  I H++  D V K ++F+A A K R   FQK    Y    LLL HH+DD  E   +Q +     A    I    EL+   V RP +KY K +I    + + + Y  D++N    Y+RN +R +I       N +  +       +CA +  I QKL +
  S:    18 SHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQKYNLQFISHSL--DKVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLASIPHYKELHHGGVLRPLLKYSKIDIEGFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLT 230
>gi|152973911|ref|YP_001373428.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022663|gb|ABS20433.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] (476 aa)
Score = 187, Expect = 2.0e-12, Identities = 78/259 (30%), Positives = 131/259 (50%)
  Q:     4 TQYIAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKV---PLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE----------------KEEFYIGVCA---MNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQR---QLVYSFLITHHI-----DVTGDKIDAILDFIQP 262
           +  + GVSGGPDS+ LL     K   K +  VV HV++  R   +  D + VE  C +L +    + ++ +        N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EIL  C++  +   ID +N + +Y RN++R+ +  + KEE                ++E Y+   A   MN+VI        K++ ++L    +   +   +P QR   QL+ ++L  + I      +  DK+ A    IQP
  S:    23 STIVVGVSGGPDSLALLYYLLEKREAKNLTIVVAHVDHMFRGDESYEDLQFVENLCHELGILCETIRINVLQYQQQHGMNAQVAARECRYAFLERIMRKYDAGYVALGHHGDDQVETILMRLVRGSTPQGYAGIAVKRPFHNGYLIRPLLAVTKEEILDYCDQLGIMPRIDSSNKKEVYTRNRLRKYVLPYLKEENPQVHEHFQKFSQLMQEDEAYLQELAFEKMNKVI-------TKKSDKYLVL-SIPAFESLSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIAFFKRIQP 311
>gi|62185345|ref|YP_220130.1| hypothetical protein CAB732 [Chlamydophila abortus S26/3] >gi|62148412|emb|CAH64179.1| conserved hypothetical protein [Chlamydophila abortus S26/3] (317 aa)
Score = 186, Expect = 2.4e-12, Identities = 52/184 (28%), Positives = 86/184 (46%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC--VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           K  Y+  +SGG DS+ LL L   +      VHV+Y  R ++ R+ + ++  C++  VPLIV  VP      K+ +  AR+ R+  F K      +  + LAHH +D  E   K  L+        G+ +      + + RP +   K  ++   +   + Y  D TN    Y R ++R +I  W +E
  S:    22 KKSYLLALSGGSDSLFLLYLLKSRGVSFTAVHVDYGWRESSYREAEELKLRCQEEGVPLIVDHVPSKYTTSKDPENTARRYRYALFCKICREDNLAGIFLAHHANDQAETVLKRVLEGASLGNLKGMTSGASYNRIPLLRPLLHIPKQVLMQTLDAENIAYVHDVTNTDERYLRARMRNKIFPWLEE 208
>gi|169830304|ref|YP_001716286.1| tRNA(Ile)-lysidine synthetase [Candidatus Desulforudis audaxviator MP104C] >gi|169637148|gb|ACA58654.1| tRNA(Ile)-lysidine synthetase [Candidatus Desulforudis audaxviator MP104C] (470 aa)
Score = 186, Expect = 2.5e-12, Identities = 57/179 (31%), Positives = 85/179 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA------CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P    + GVSGGPDS+ LL + +   A       V H+N+  R   A  D + V +  ++  +P IV      T  K    + Q  AR++R+E F +AA      ++ L HH DD  E      L     A   GI     L+     RP +   + EI A C    +   +D +N  P+Y RN++R E+
  S:    19 PGMGVLVGVSGGPDSVALLDVLYGLRAVLGISITVAHLNHRLRGAEAEADARYVRKLAEKFGLPCIVEECDVPTFRKAERLSIQTAARELRYEFFARAARETGARRVALGHHADDQAETILHHFLRGTGPAGLAGIAPVRGLF----IRPLLGIRRREIEAYCRARGLDPRLDPSNLDPVYTRNRLRAEL 204
>gi|160894589|ref|ZP_02075365.1| hypothetical protein CLOL250_02141 [Clostridium sp. L2-50] >gi|156863900|gb|EDO57331.1| hypothetical protein CLOL250_02141 [Clostridium sp. L2-50] (485 aa)
Score = 186, Expect = 2.7e-12, Identities = 59/174 (33%), Positives = 94/174 (54%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIAC---VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH--TVPEDTVWKKNFQAQA-RKIRFEQFQKAASLYKVD--KLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I GVSGG DS+ LL +     +KI      VHVN+  R T A  D+  V EYCK+L +P   +   VP+    +K  + +A R  R+  F +AA  Y +   K+ +AH+++D  E   + +      A   GI  + +    ++ RP +   + EI A  E+  + Y  D TN +  Y RN++R ++
  S:    27 IVGVSGGADSICLLTVLAGLREKIELKLYAVHVNHMIRGTEADADESYVAEYCKKLGIPCDCYHIDVPQLAKEQKLTEEEAGRNARYGAFARAADKYGITDYKVAVAHNKNDVAETVLLNMVRGTGIAGMAGIPVKRD----RIVRPLLSCTRTEIEAYLEQQGIQYCTDSTNLENDYARNKIRNQV 209
>gi|192809557|ref|ZP_03038232.1| tRNA(Ile)-lysidine synthetase [Geobacillus sp. Y412MC10] >gi|192802228|gb|EDV78733.1| tRNA(Ile)-lysidine synthetase [Geobacillus sp. Y412MC10] (476 aa)
Score = 186, Expect = 2.7e-12, Identities = 61/210 (29%), Positives = 108/210 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK--------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQK-LFSLMKRAKQW 216
           +  VSGGPDS+ LL + H+        ++ C  HV++  R  + ++ +MV E  + L +PL    +      +   K  Q  AR+ R+E   + A  +    + LAHH DD  E   M+L         G IK +     +++ RPF++ +K +I+ LC      Y +D +N Q  Y+RN +R E+  + +    +F   +  +  ++ Q+  F  ++ AKQ+
  S:    30 VVAVSGGPDSVALLHVLHEISQHRTPLRLICA-HVHHGFRKESDQEAEMVRELAESLGLPLETAFIDIPAYMEESGKGGQEAAREKRYEFLLQTARKHNARSVALAHHADDQAETVFMRLLRGSGLSGLGGIKFKRTEKKVELIRPFLRMYKADIVELCRVCGFQYAVDHSNLQTKYRRNAIRLEVFPFLERYNGQFSSSLNQLAEIVQQEDDFVELEAAKQF 251
>gi|21674432|ref|NP_662497.1| MesJ protein [Chlorobium tepidum TLS] >gi|61216669|sp|Q8KC15|TILS_CHLTE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|21647616|gb|AAM72839.1| tRNA(Ile)-lysidine synthetase [Chlorobium tepidum TLS] (331 aa)
Score = 186, Expect = 2.7e-12, Identities = 56/171 (32%), Positives = 84/171 (49%)
  Q:    10 VSGGPDSMLLLKLY-------HKKIACVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGGPDSM LL L+       H ++  V H N+  R  A   D+  V + C +L +   V    T    + WKK+ +  AR +R++ F +        ++   HH DD  E     L       + G    G L G++V      RP + + + EI+A  EE +V +  D TN    Y RN +R  +
  S:    28 VSGGPDSMALLHLFASVASVLHCRLG-VAHCNFMLRGDASDADESFVRDACAELGIDFHVRRFDTASVSSAWKKSIEETARLLRYDFFGELCREASYTRIATGHHSDDNAETVLFNL-------FRGAGISG-LRGIRVRHGAIIRPLLPFTRREIVAYLEEKRVVWRDDHTNEGIEYDRNFIRNRV 205
>gi|13899157|gb|AAG12421.1| MesJ [Chlorobium tepidum] (351 aa)
Score = 186, Expect = 2.9e-12, Identities = 56/171 (32%), Positives = 84/171 (49%)
  Q:    10 VSGGPDSMLLLKLY-------HKKIACVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGGPDSM LL L+       H ++  V H N+  R  A   D+  V + C +L +   V    T    + WKK+ +  AR +R++ F +        ++   HH DD  E     L       + G    G L G++V      RP + + + EI+A  EE +V +  D TN    Y RN +R  +
  S:    48 VSGGPDSMALLHLFASVASVLHCRLG-VAHCNFMLRGDASDADESFVRDACAELGIDFHVRRFDTASVSSAWKKSIEETARLLRYDFFGELCREASYTRIATGHHSDDNAETVLFNL-------FRGAGISG-LRGIRVRHGAIIRPLLPFTRREIVAYLEEKRVVWRDDHTNEGIEYDRNFIRNRV 225
>gi|29840521|ref|NP_829627.1| MesJ/Ycf62 family protein [Chlamydophila caviae GPIC] >gi|61216617|sp|Q822B9|TILS_CHLCV tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29834870|gb|AAP05505.1| MesJ/Ycf62 family protein [Chlamydophila caviae GPIC] (317 aa)
Score = 185, Expect = 3.1e-12, Identities = 48/184 (26%), Positives = 91/184 (49%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC--VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           K  Y+  +SGG DS+ LL L   +      VHV++  R ++ R+ + ++  C++  +P+++  VP +    ++ +  AR+ R+  F K      +  + LAHH +D  E   K  L+    +   G+  +     + ++RP +   K  I+ + +   VP   D TN    Y R ++R++I  W +E
  S:    22 KKSYLLALSGGSDSLFLLYLLKSRGVAFTAVHVDHGWRESSYREAEELKIRCEEEGIPILIDHVPPEYRTSRDPENAARRYRYTLFHKVCKEQNLAGIFLAHHANDQAETVLKRLLEGASLSNLKGMSPKTSYEDIPLFRPLLHIPKQIIINVLDAENVPCVQDITNTDERYLRARMRKKIFPWLEE 208
>gi|154490240|ref|ZP_02030501.1| hypothetical protein PARMER_00472 [Parabacteroides merdae ATCC 43184] >gi|154089132|gb|EDN88176.1| hypothetical protein PARMER_00472 [Parabacteroides merdae ATCC 43184] (444 aa)
Score = 185, Expect = 3.1e-12, Identities = 54/174 (31%), Positives = 85/174 (48%)
  Q:     7 IAGVSGGPDSMLLLK-LYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + GVSGG DS+ LL  L     +C+  H N++ R   +LRD++ V EY ++L VP ++              + +  AR++R+  F++  +      + +AHHRDD +E   M L      R M  GI+ R       V RP +   + +IL       + Y  D TN    Y RN +R  +
  S:    22 LVGVSGGADSIALLTILVESGYSCIAAHCNFHLRGDESLRDEQFVREYARKLDVPFLMTDFDTRKYAADRHLSIEMAARELRYGWFEEQRAATGAQAVAVAHHRDDSVETLLMNLVRGTGIRGM-SGIRPRNGF----VVRPLLAVSREDILEWLAGRGLTYVTDSTNLSDAYTRNFIRLRV 198
>gi|150392226|ref|YP_001322275.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus metalliredigens QYMF] >gi|149952088|gb|ABR50616.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus metalliredigens QYMF] (467 aa)
Score = 185, Expect = 3.3e-12, Identities = 56/180 (31%), Positives = 97/180 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACV------VHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +SGGPDS+ LL +  +  A         H+N+N R   A  D + V  +C+QL +   V ++      +KN    +   R +R+E F++        K+ +AH+++D  E   M+L         G   +G L  +     K+ RP ++  + +I   CE +++   ID+TN+QPIY RN++R E+  + KE
  S:    22 VVAISGGPDSVCLLHVLSRLKAAYKLEIYGAHLNHNFRGMDAQMDAQYVANFCEQLNILCFVKSMDVLGYAEKNGLSSEEAGRVLRYEFFEEIGQKVGASKIAVAHNQNDQAETVLMRL-------LRGTGIQG-LTAIRHKRDKIIRPLLETDRGKIEDYCETYELSPRIDQTNSQPIYHRNKIRLELIPYLKE 208
>gi|15896451|ref|NP_349800.1| cell cycle protein MesJ-like protein [Clostridium acetobutylicum ATCC 824] >gi|61216713|sp|Q97EB0|TILS_CLOAB tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15026275|gb|AAK81140.1|AE007816_4 Cell cycle protein MesJ ortholog, ATPase of the PP-loop superamily [Clostridium acetobutylicum ATCC 824] (461 aa)
Score = 184, Expect = 4.1e-12, Identities = 57/195 (29%), Positives = 103/195 (52%)
  Q:     7 IAGVSGGPDSMLLLKLYHK------KIACVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRV 201
           +  VSGGPDS+ LL +  K         C  HVN+  R  A  +D++ V+++C++L +   V  V  + +    K + +   R+IR+  F++    +K +K+ +AH+ +D  E   M++   +     GIK    +      RP I+  ++ I   CE+ K+   ID TN +  Y RN++R ++  +  +   E  +G  A+NR+
  S:    22 VVAVSGGPDSICLLHILFKLKDKFNTSICAAHVNHCIRGEAADKDEEYVKKFCEKLDIQFYVKRVDVNKIAHEKKISSEMAGREIRYAFFEEVKERFKANKIAIAHNANDQAETIMMRI--IRGTGTEGIKGIRPVRDGYYIRPLIEIRRSSIEKYCEDEKLMPRIDATNLERDYNRNKIRLDLIPYIVKNFNEDIVG--ALNRL 222
>gi|168163565|ref|ZP_02598798.1| cell cycle protein [Bacillus cereus H3081.97] (476 aa)
Score = 184, Expect = 4.3e-12, Identities = 81/262 (30%), Positives = 137/262 (52%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE----------------KEEFYIGVCA---MNRVIGQKL---FSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHI--DVTGDKIDAILDFIQPFQ 264
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L+V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C + K+   ID +N + +Y RN++R+ +    KEE                ++E Y+   A   MN+VI +K     SL   A + ++ P    L+R  +    QL+ ++L  + I   ++   ID +++F +  Q
  S:    22 RSTIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLEV--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMP----LQRRGI----QLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|42779142|ref|NP_976389.1| hypothetical protein BCE_0061 [Bacillus cereus ATCC 10987] >gi|61216566|sp|Q73FE5|TILS_BACC1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|42735057|gb|AAS38997.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] (476 aa)
Score = 184, Expect = 4.5e-12, Identities = 81/262 (30%), Positives = 137/262 (52%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE----------------KEEFYIGVCA---MNRVIGQKL---FSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHI--DVTGDKIDAILDFIQPFQ 264
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK+L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C + K+   ID +N + +Y RN++R+ +    KEE                ++E Y+   A   MN+VI +K     SL   A + ++ P    L+R  +    QL+ ++L  + I   ++   ID +++F +  Q
  S:    22 RSTIVVGVSGGPDSVALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKELGV--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCHKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMP----LQRRGI----QLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|167452925|ref|ZP_02319148.1| hypothetical protein LmonocytoFSL_01277 [Listeria monocytogenes FSL J2-064] (165 aa)
Score = 184, Expect = 4.6e-12, Identities = 48/130 (36%), Positives = 75/130 (57%)
  Q:     5 QYIAGVSGGPDSMLLL------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDT---VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYG 134
           + +  VSGGPDS+ LL       L  K+   V H+N++ R  A  +Q +VE +C+   +P  +  V   +     +K  +  AR +R++ F+K  +  K++KL LAHH DD IE   M+L  R  A   + GI+ + EL G
  S:    23 KLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHINHHLRENAANEQNVVEAFCESQGIPFYIEEVDVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRL-VRGSASIGWSGIQPKRELKG 162
>gi|166984640|ref|ZP_02255975.1| hypothetical protein BcerAH_20013 [Bacillus cereus AH187] (476 aa)
Score = 184, Expect = 4.6e-12, Identities = 59/190 (31%), Positives = 97/190 (51%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK+L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C + K+   ID +N + +Y RN++R+ +    KEE  + +
  S:    22 RSTIVVGVSGGPDSVALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKELGV--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCHKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH 222
>gi|89100508|ref|ZP_01173369.1| Cell cycle protein MesJ [Bacillus sp. NRRL B-14911] >gi|89084774|gb|EAR63914.1| Cell cycle protein MesJ [Bacillus sp. NRRL B-14911] (462 aa)
Score = 183, Expect = 5.3e-12, Identities = 64/235 (27%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKI------ACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-----------KEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQR---QLVYSFL 241
           + GVSGGPDS+ LL L  KK          +H ++  R   + ++ + V+ +C++  +P  +         K   K+ Q  AR+ R+  F++A        L L HH DD +E   M+L          GI       G ++ RPF+   + EI   C  +++    D +N + +Y RN+ R+ +  + K E            EE       +  +  +++ ++MK+ +      D       P+P QR   QL+ ++L
  S:    23 LVGVSGGPDSLALLHLLWKKRKVWGAEPAAIHFDHMFRGEESYQEARFVQSFCEERNIPFEMRREDVSAYMKESGKSSQTAARECRYRFFEEAMKASGASYLALGHHGDDQMETILMRLTRGSTGEARSGIPFSRPFGGGEIIRPFLCLERGEIEEYCLSNELDPRRDPSNEKDVYSRNRFRRNVLPFLKSENPQAHVHFQRFSEELRGDEQLLQELTAREMNTVMKKKEDAEITIDAERFMLMPMPLQRRGIQLILNYL 282
>gi|110802414|ref|YP_699728.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens SM101] >gi|110682915|gb|ABG86285.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens SM101] (469 aa)
Score = 183, Expect = 5.4e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELKELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLTPRIDETNLEEIYSRNKIR 200
>gi|160947239|ref|ZP_02094406.1| hypothetical protein PEPMIC_01172 [Peptostreptococcus micros ATCC 33270] >gi|158446373|gb|EDP23368.1| hypothetical protein PEPMIC_01172 [Peptostreptococcus micros ATCC 33270] (457 aa)
Score = 183, Expect = 6.4e-12, Identities = 56/171 (32%), Positives = 96/171 (56%)
  Q:     7 IAGVSGGPDSMLLLKL-----YHKKIACVV-HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKT-RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +  VSGG DSM++L L     Y  K+  VV H N++ R  A RD+K V+  C+  K  L  ++  ED +   N      +  AR +R++ F +   +  ++ +  AH+++D  E   M+ L         GI++ RG+L      RP + + ++EI    EE+ +P+  D+TN + +Y RN++R
  S:    20 LLAVSGGKDSMIMLDLFNYFKYELKLNLVVCHFNHSLRDDADRDEKFVKTQCE--KYGLKFYSKKEDVLLYSNENKLSTEEGARFLRYKFFDEVKRIENLEYIATAHNKNDLAETVIMRILRGTGINGLIGIQSERGDLI-----RPILNFSRDEIEKYIEENNIPFVEDKTNFEELYLRNKIR 196
>gi|88606751|ref|YP_505718.1| tRNA(Ile)-lysidine synthetase [Anaplasma phagocytophilum HZ] >gi|88597814|gb|ABD43284.1| tRNA(Ile)-lysidine synthetase [Anaplasma phagocytophilum HZ] (447 aa)
Score = 183, Expect = 6.4e-12, Identities = 58/187 (31%), Positives = 92/187 (49%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKL---YHKKIACV-----VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           +P  QY   VSGG DSM L++L   +HK  A V     + VN+  R  A  +   V +    L   L  H +  +   +K  Q  AR IR++   +  S + V  LL AH ++D  E   ++L+ R   +    GI+ R  +  + + RP + + + EI     +H+ P+  D +N+ P Y+R   R  I N    E
  S:     5 VPNAQYAVAVSGGVDSMTLMRLVALFHKSSASVGSPTILTVNHGFRPEARNEVSFVHKQATMLG--LECHMLHWENPIRKKSQVVARNIRYQLLLQWCSAHNVKVLLTAHTKNDQAETVLIRLE-RGSGIDGLAGIRERSVIGDVTIIRPLLDFTRREIQEYAIQHQQPWIEDPSNSDPKYRRTFYRNFINNCKHPE 198
>gi|182626023|ref|ZP_02953786.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens D str. JGS1721] >gi|177908730|gb|EDT71241.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens D str. JGS1721] (469 aa)
Score = 182, Expect = 6.8e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|168215140|ref|ZP_02640765.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens CPE str. F4969] >gi|170713441|gb|EDT25623.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens CPE str. F4969] (469 aa)
Score = 182, Expect = 6.8e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|110798778|ref|YP_697160.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens ATCC 13124] >gi|123049568|sp|Q0TMI0.1|TILS_CLOP1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|110673425|gb|ABG82412.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens ATCC 13124] (456 aa)
Score = 182, Expect = 7.1e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:     7 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 187
>gi|18311454|ref|NP_563388.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens str. 13] >gi|61216685|sp|Q8XHL1|TILS_CLOPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|18146138|dbj|BAB82178.1| probable cell-cycle protein [Clostridium perfringens str. 13] (469 aa)
Score = 182, Expect = 7.1e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|168218232|ref|ZP_02643857.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens NCTC 8239] >gi|182379755|gb|EDT77234.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens NCTC 8239] (469 aa)
Score = 182, Expect = 7.2e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|168206867|ref|ZP_02632872.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens E str. JGS1987] >gi|168211206|ref|ZP_02636831.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens B str. ATCC 3626] >gi|170661729|gb|EDT14412.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens E str. JGS1987] >gi|170710765|gb|EDT22947.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens B str. ATCC 3626] (469 aa)
Score = 182, Expect = 7.3e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|169343171|ref|ZP_02864192.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens C str. JGS1495] >gi|169298723|gb|EDS80799.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens C str. JGS1495] (469 aa)
Score = 182, Expect = 7.3e-12, Identities = 59/173 (34%), Positives = 97/173 (56%)
  Q:     5 QYIAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  +SGGPDS+ LL       +L H ++    HVN+  R  +AL+D+  VEE CK L +   V  V  + + ++   + +   R+ R++ F++  + Y +DK+ +AH+ +D  E   M      RA+  G    G L G+K        RP +   + EI   CE + +   IDETN + IY RN++R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAA-HVNHCLRGESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIM------RALR-GTGIEG-LVGIKPVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|169335539|ref|ZP_02862732.1| hypothetical protein ANASTE_01954 [Anaerofustis stercorihominis DSM 17244] >gi|169258277|gb|EDS72243.1| hypothetical protein ANASTE_01954 [Anaerofustis stercorihominis DSM 17244] (464 aa)
Score = 182, Expect = 7.6e-12, Identities = 64/202 (31%), Positives = 94/202 (46%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACV------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHT-----VPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQ 204
           K + +  +SGG DS+ LL + +     +       H+N+N R  A RD+K V + CK   VPL + +     + ED+      +   RK R+E   K      +DK   AHH  D  E   +        M  G   RG L G+ V      RP +   K EIL   EE+++ Y  D TN    Y RN +R  I    +E  +  Y     ++ V G+
  S:    25 KDKVMIALSGGSDSVCLLHILNTLKNDMGFSLYAFHLNHNIREEAKRDEKFVLDLCKTYDVPLFLESEDMPALHEDSSL--GLEEIGRKKRYELINKIMKENHIDKAATAHHLLDHSESMILN-------MVRGSGIRG-LRGISVKNDNIIRPILNLTKEEILCYIEENELEYVTDVTNFDTDYSRNNIRHNILPHLEEINDNVYNHFFELSSVAGE 232
>gi|167856269|ref|ZP_02479001.1| tRNA(Ile)-lysidine synthase [Haemophilus parasuis 29755] >gi|167852593|gb|EDS23875.1| tRNA(Ile)-lysidine synthase [Haemophilus parasuis 29755] (422 aa)
Score = 182, Expect = 7.7e-12, Identities = 66/244 (27%), Positives = 119/244 (48%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACV------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE------LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV------CAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHI 246
           +T +  G+SGG DS +LL L+ +    +      +H+++     A       E+ C+Q  +P  V  V      K+  +A AR  R++  Q+   + + + L  AHH DD +E   + L   KR    GI+  G       L  + ++RP + + K +ILA  E+H++ +  DE+N    + RN +RQ       +  ++F   V      CA  + + ++L      ++      D+   + + L  Q+QLV  +L   H+
  S:    16 QTAFFIGLSGGVDSAVLLHLFAQARQALNLKLRAIHIHHGLNPNADSWATFCEQLCEQWAIPFTVCKV--QVQGKQGLEANARTARYQAIQQ--HIQRNEMLATAHHLDDQVETFFLAL---KRG--SGIQGLGAMQAVSFLQNIAIFRPLLSFNKTDILAYAEQHQLEWIEDESNFNTDFDRNFLRQTALPLLNQRWQQFNQMVARSSQHCAEQQQLIEELLHPELASRLQNGGLDITGFEHFSLLKQQQLVRLWLAQAHL 268
>gi|52145153|ref|YP_081675.1| cell cycle protein [Bacillus cereus E33L] >gi|61216463|sp|Q63HD6|TILS_BACCZ tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51978622|gb|AAU20172.1| cell cycle protein [Bacillus cereus E33L] (476 aa)
Score = 181, Expect = 8.5e-12, Identities = 59/189 (31%), Positives = 95/189 (50%)
  Q:     4 TQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C + K+   ID +N + +Y RN++R+ +    KEE  + +
  S:    23 STIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH 222
>gi|51894334|ref|YP_077025.1| cell cycle protein [Symbiobacterium thermophilum IAM 14863] >gi|61217236|sp|Q67JG9|TILS_SYMTH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51858023|dbj|BAD42181.1| cell cycle protein [Symbiobacterium thermophilum IAM 14863] (482 aa)
Score = 181, Expect = 9.8e-12, Identities = 51/179 (28%), Positives = 87/179 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P  + I  VSGGPDS+ L  + ++          + H+++  R  A R D   V +  ++L +PL   T+   E    + + +  AR+ R+ +  + A+     +    H+R+D  E   M+L          GI       G+ + RP +   + EILA C  H +   +D TN Q  ++RN++R EI
  S:    19 PGDRVIVAVSGGPDSLALTHVLYRLAPAWRLSLHLFHLDHGLRGEASRADAAFVADLARELSLPLTTVTLRPGELEAMRGSLEDNARRRRYAEMARLAAAIGAQRAATGHNRNDQAETVLMRLLRGSGSTGLAGIPPVRREGGLTIIRPLLGASRQEILAYCRAHGLTPRMDATNLQGDFERNRIRLEI 207
>gi|88801375|ref|ZP_01116903.1| putative cell-cycle protein [Polaribacter irgensii 23-P] >gi|88782033|gb|EAR13210.1| putative cell-cycle protein [Polaribacter irgensii 23-P] (436 aa)
Score = 181, Expect = 9.8e-12, Identities = 54/174 (31%), Positives = 92/174 (52%)
  Q:     7 IAGVSGGPDSMLLLKLYH--KKIACVVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  +SGG DS++L +L    K    + H N+N R      D   VEE  K+L V     +   + + K+   + Q  AR +R+  FQ+ ++ +  D +L AHH DD +E   + L      A + GI     ++G  V RP +++ + EIL   +E+ + +  D++NA   Y RN++R +I
  S:    22 LIAISGGLDSVVLTRLLSTLKFDITLAHCNFNLRGIESNLDAIFVEELAKELAVKCFSTSFKTEKLAKEKKESTQIAARNLRYHWFQEISARHHFDYILTAHHADDNLETFLINLTRGTGLAGFTGIPP---VHG-NVIRPLLQFSREEILHFAKENNICWREDQSNASTKYLRNKIRHKI 198
>gi|167767831|ref|ZP_02439884.1| hypothetical protein CLOSS21_02368 [Clostridium sp. SS2/1] >gi|167710570|gb|EDS21149.1| hypothetical protein CLOSS21_02368 [Clostridium sp. SS2/1] (480 aa)
Score = 181, Expect = 1.0e-11, Identities = 55/174 (31%), Positives = 88/174 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHKK------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I GVSGG DS+ LL + ++           VH+N+  R  A+ DQK V++ C QL +   +  +    + K+   + +   RK R++ F K    Y  DK+ +AHH++D   QA+  L    R    YG     E  G  + RP +   K EI+   +E    +  D +N    + RNQ+R ++
  S:    33 IIGVSGGADSVYLLLILNELRESMNLTITAVHINHMIRREAVDDQKFVQDLCGQLSILCKIFEIDVKQIAKREKMSLEEAGRKARYDAFAKTMKKYNADKIAIAHHQND---QAETFLYRVVRGTGIYGAGAMREKDG-NLIRPLLCVKKEEIVKYLKEAGQAWVEDASNQDDAFARNQIRNQV 212
>gi|47570187|ref|ZP_00240841.1| cell cycle protein mesJ [Bacillus cereus G9241] >gi|47553131|gb|EAL11528.1| cell cycle protein mesJ [Bacillus cereus G9241] (476 aa)
Score = 181, Expect = 1.0e-11, Identities = 59/190 (31%), Positives = 96/190 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           ++  + GVSGGPDS+ LL  L  K+ A      V HV++  R   +  D + V++ CK L V  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C + K+   ID +N + +Y RN++R+ +    KEE  + +
  S:    22 RSTIVVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV--ICETIRINVSQYQQQYGMNAQVAARECRYVFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH 222
>gi|146299894|ref|YP_001194485.1| tRNA(Ile)-lysidine synthetase [Flavobacterium johnsoniae UW101] >gi|146154312|gb|ABQ05166.1| tRNA(Ile)-lysidine synthetase [Flavobacterium johnsoniae UW101] (436 aa)
Score = 181, Expect = 1.1e-11, Identities = 53/173 (30%), Positives = 89/173 (51%)
  Q:     9 GVSGGPDSMLLLKLYHKKI--ACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIV-----HTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
            VSGG DSM+LL L+ +      V+H N+  R   +  DQ+ ++ YC +  + +           ED  +K + Q  AR++R+  F +       D LL AHH DD +E   + L  R   +    GI  + +    K+ RP + + + EIL   +E+ + +  D +NA   Y RN++R ++ 
  S:    24 AVSGGLDSMVLLHLFKQLNYEITVLHCNFQLRGLESFGDQEFIQNYCDKNNIKIFTTQFDTQAFAED--YKLSIQVAARELRYSWFYELLEEKHFDYLLTAHHADDNLETFIINL-TRGTGLDGLTGIPEQND----KIIRPLLPFSREEILKYAQENNIEWREDSSNASTKYVRNKIRHDLV 199
>gi|150025676|ref|YP_001296502.1| tRNA(Ile)-lysidine synthase [Flavobacterium psychrophilum JIP02/86] >gi|149772217|emb|CAL43693.1| tRNA(Ile)-lysidine synthase [Flavobacterium psychrophilum JIP02/86] (434 aa)
Score = 180, Expect = 1.1e-11, Identities = 54/174 (31%), Positives = 93/174 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHK---KIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVP-LIVHTVPEDTV--WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +   SGG DSM++L L+ K    IA + H N+  R   +  DQ+ V+EY  + K+P  + H   E+    +K + Q  AR++R+  F +       D +L AHH DD +E   + L  R   +    GI  + E    ++ RP + + ++EI    +E+ + +  D +NA   Y RN++R ++
  S:    22 LLATSGGIDSMVMLHLFQKLNYNIA-IAHCNFQLRGLESFGDQQFVQEYASKNKIPAFVTHFDTENFAKDYKLSTQIAARELRYNWFYELLETENFDFILTAHHADDNLETFIINL-TRGTGLDGLTGIPEQNE----QIIRPLLPFSRSEIEEYTKENSIQWREDSSNASDKYLRNKIRHDL 198
>gi|153092409|gb|EDN73472.1| possible PP-loop superfamily ATPase [Mannheimia haemolytica PHL213] (421 aa)
Score = 180, Expect = 1.2e-11, Identities = 55/178 (30%), Positives = 93/178 (52%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE------LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +T ++ G+SGG DS++LL L+ +    V  ++V++     A       E+YCK+L +P I+  V  D+      +  AR+ R++  Q+   L   +    AHH DD   QA+  L A KR    G+K          L    V+RP + + K++++    +H++ +  DE+NA   Y RN +R  I
  S:    18 QTAFLIGLSGGVDSVVLLHLFARTSFHVRAIYVHHGLSPNADDWAAFCEQYCKRLNIPFILQKVRVDS--SNGVENGAREARYQAIQQ--QLKPNEVFATAHHLDD---QAETFLLALKRG--SGVKGLSAMQAVTFLQNFTVFRPLLTFTKSDLMGYAVQHQLGWIEDESNADNRYDRNFLRNSI 194
>gi|69245448|ref|ZP_00603443.1| PP-loop [Enterococcus faecium DO] >gi|68195830|gb|EAN10266.1| PP-loop [Enterococcus faecium DO] (481 aa)
Score = 180, Expect = 1.2e-11, Identities = 61/213 (28%), Positives = 113/213 (53%)
  Q:     4 TQYIAGVSGGPDSMLLLKLY---HKKIA---CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEK-------EEFYIGVCAMNRVIGQKLFSLM-KRAKQW 216
           ++ +A VSGG DSM+LL L     ++I     +VH+N+  R  +  +   +  YC++  +PL V ++ ED   K   + +AR  R+++F +     + D L+ AHH DD IE   M++    +   + GIK        ++ RP + + K ++     E ++ Y  D+TN     +RN++R  +    K+E        ++F   +   ++VI + +  L+ K  +QW
  S:    31 SRILAAVSGGVDSMVLLHLLLQVQRQIGFSLGIVHINHQLREESAEEAAYLRSYCEEKNLPLYV-SIWEDPA-KSAIETEARNFRYQEFTRVMEEGQYDTLMTAHHGDDQIETVLMKIVRGGQLNTFSGIKEVQPFATGRLIRPLLSFSKEDLYTYAAESQLVYFEDQTNQLLDIQRNRLRHLVVPQLKQENTQALRHFQQFSQQIQWADQVIQKYMGQLIEKEVEQW 256
>gi|184152910|ref|YP_001841251.1| cell cycle protein [Lactobacillus reuteri F275] >gi|183224254|dbj|BAG24771.1| cell cycle protein [Lactobacillus reuteri F275] (477 aa)
Score = 180, Expect = 1.3e-11, Identities = 50/185 (27%), Positives = 91/185 (49%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  VS G DSM+LL L       ++    V H+N+  R  +  +++ + +YCKQ  + L V   P+D   +   +  AR+ R++ F+K     +   LL AHH++D  E   M++    + +   GI+ R       + RP + + K ++     +H + +  D+TN     +RN+ R  I    +EE  + 
  S:    38 VVAVSTGVDSMVLLDLLQHLSSKNRPQIIVAHMNHELRKQSQLEERFIRQYCKQNDLKLAVTHWPQDLHPQTGIENAARQARYQFFRKVMKDNRASILLTAHHQNDLAETMLMKMTRGGQLSQLVGIRDRRPFASGTLIRPLLPFSKQQLKKYALQHHLKWYEDKTNKDLNIQRNRFRHAIIPMLEEENPQL 229
>gi|148543503|ref|YP_001270873.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri F275] >gi|148530537|gb|ABQ82536.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri F275] (464 aa)
Score = 180, Expect = 1.3e-11, Identities = 50/185 (27%), Positives = 91/185 (49%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  VS G DSM+LL L       ++    V H+N+  R  +  +++ + +YCKQ  + L V   P+D   +   +  AR+ R++ F+K     +   LL AHH++D  E   M++    + +   GI+ R       + RP + + K ++     +H + +  D+TN     +RN+ R  I    +EE  + 
  S:    25 VVAVSTGVDSMVLLDLLQHLSSKNRPQIIVAHMNHELRKQSQLEERFIRQYCKQNDLKLAVTHWPQDLHPQTGIENAARQARYQFFRKVMKDNRASILLTAHHQNDLAETMLMKMTRGGQLSQLVGIRDRRPFASGTLIRPLLPFSKQQLKKYALQHHLKWYEDKTNKDLNIQRNRFRHAIIPMLEEENPQL 216
>gi|145634599|ref|ZP_01790308.1| pyridoxine kinase [Haemophilus influenzae PittAA] >gi|145268144|gb|EDK08139.1| pyridoxine kinase [Haemophilus influenzae PittAA] (430 aa)
Score = 178, Expect = 2.3e-11, Identities = 49/175 (28%), Positives = 88/175 (50%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+ K               +H+++     A    K  ++ C Q ++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++  G+L+GM + RP + + +NE+    ++  + +  DE+N    + RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAIHIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKKY--LQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQKEGQLFGMSILRPLLSFTRNELEDYIQQENLSWVEDESNGDNRFDRNFLRNEI 200
>gi|155122075|gb|ABT13943.1| hypothetical protein MT325_M389R [Paramecium bursaria chlorella virus MT325] (499 aa)
Score = 177, Expect = 2.6e-11, Identities = 51/200 (25%), Positives = 95/200 (47%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE-------DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDA-RKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIG 203
           T+ I  +SGG DSM+   + H           VV VNY  R +A  ++  V ++      PL V  + E       D   +  ++   R +R+  ++          +++ H++DD +E     + + +K     G+ T     G+  +RP +   KN+I+A   EH++P+  + T   P  KR Q+R ++A    +  E F  G+  + + + 
  S:   195 TKLIMSISGGSDSMVAFHIIHGLKEAFGYDIDVVMVNYTNRNSAYAEEAFVADWVNSFGYPLHVRRIDEIKRKQCADNQLRTVYEKYTRDVRYATYKTLGP----HPVVMGHNKDDCLENILQNIGSCQKYDNLSGMDTLVVQDGIPFFRPLLDVSKNDIVAYAREHQIPFLPNST--PPTMKRGQIRNKVAPVLNDWNELFVPGLFQLKKTMA 402
>gi|57240790|ref|ZP_00368738.1| conserved hypothetical protein [Campylobacter lari RM2100] >gi|57018409|gb|EAL55183.1| conserved hypothetical protein [Campylobacter lari RM2100] (318 aa)
Score = 177, Expect = 2.8e-11, Identities = 55/180 (30%), Positives = 86/180 (47%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMY---YGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           K   +A   G   S L   L +K I   +  +NY  R  + ++++  +E  K+    + V      T  +KNF+A AR +R+E F +    YK + L+LAH+ +D  E   MQ    K A +    G K   +     + RP I   K+EIL   ++  + Y  DE+N    Y RN +R+  AN
  S:    10 KKNLLAFSHGSDSSALFFMLLNKNIDFDLALINYKTRKNSDKEEQSAKELAKKYNKKIFVKIA---TKIEKNFEANARAVRYEFFDEICKKYKYENLILAHNLNDKFEWFLMQFS--KGAGFVELLGFKAVEKKENFIIVRPLINTSKDEILNFLKKENIKYFYDESNDDEKYFRNFIRKNFAN 188
>gi|89211108|ref|ZP_01189485.1| PP-loop [Halothermothrix orenii H 168] >gi|89159267|gb|EAR78938.1| PP-loop [Halothermothrix orenii H 168] (468 aa)
Score = 176, Expect = 3.3e-11, Identities = 50/181 (27%), Positives = 91/181 (50%)
  Q:     7 IAGVSGGPDSMLLLKL-------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           + GVSGGPDS+ LL +       Y  K+  V H+++  R  A R+ + V        +  I+       +      + +  ARK+RF    K  +   ++K+ +AH++DD +E   + +  R   +    GI     + G++V  P +  ++ EI+  C+   +    D TN + IY RN++R  I  + ++E
  S:    24 LVGVSGGPDSLTLLDMLVRVKDEYGLKLV-VFHLDHKFRQEAAREARYVSNITNNYGLKCIIEEFDVPGLMNDEGLSPEEAARKVRFNLMIKWVNSLNLNKIAVAHNKDDLVETVFLHM-FRGTGLKGLTGIDPVSRIGGVEVIHPLLNIYRQEIMDYCQRRNLNPVYDPTNQETIYTRNKIRHHIIPYIEDE 214
>gi|188584721|ref|YP_001916266.1| tRNA(Ile)-lysidine synthetase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349408|gb|ACB83678.1| tRNA(Ile)-lysidine synthetase [Natranaerobius thermophilus JW/NM-WN-LF] (509 aa)
Score = 176, Expect = 4.2e-11, Identities = 63/174 (36%), Positives = 101/174 (58%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIACVV-HVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHT-VPEDTV--WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK----------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + GVSGGPDS+ LL + ++     +   VV H+N+  R  +A  D   V++  + L++P+I      +D +  +K + Q  AR  R++ F++AA  +   KL L HH DD +E   ++L         G  T+G L GM+          + RP ++  K+EI    + +K+ Y ID TN +  Y RN+VR EI
  S:    22 LVGVSGGPDSVALLHVLYELRQELQFKLVVSHLNHGFRDKSAEEDADFVKKLAEDLELPIIYDKWQVKDYINYYKLSPQQGARIQRYKFFEQAAKDFGATKLALGHHIDDQVETFFLRL-------IRGAGTQG-LSGMQFIRKLNNDLLLIRPLLEVSKSEIKEYLQTNKLKYKIDPTNQETNYLRNKVRHEI 207
>gi|126646938|ref|ZP_01719448.1| putative cell-cycle protein [Algoriphagus sp. PR1] >gi|126576986|gb|EAZ81234.1| putative cell-cycle protein [Algoriphagus sp. PR1] (439 aa)
Score = 175, Expect = 4.2e-11, Identities = 59/176 (33%), Positives = 89/176 (50%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHKKIAC--VVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVH-----TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +Y+   SGG DS+ L  L H+      V HVN++ R   +  D+  V+   +Q   P  VH     +  ED   K + Q  AR IR+E F++      +  +LLAHH DD +E   + L         G    G LYGM     K+ RP + + + EIL      ++ +  D +N    YKRN++R +I
  S:    20 KYLLACSGGLDSVCLGTLLHQSGFSFEVAHVNFHLREKESDGDELFVKNLAEQWNAPFHVHQADTYSFVEDH--KVSTQMAARDIRYEWFEQIRKERNLAGILLAHHEDDQLETIFLNL-------LRGTGIEG-LYGMAEKRGKLIRPLLPFSRAEILEFATAMELAWREDSSNKSTDYKRNKLRIDI 198
>gi|160878299|ref|YP_001557267.1| tRNA(Ile)-lysidine synthetase [Clostridium phytofermentans ISDg] >gi|160426965|gb|ABX40528.1| tRNA(Ile)-lysidine synthetase [Clostridium phytofermentans ISDg] (492 aa)
Score = 175, Expect = 4.8e-11, Identities = 61/189 (32%), Positives = 85/189 (44%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKL-------YHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDT-----VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGI-KTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEE 190
           P    I GVSGG DS+ LL         YH  +   VHVN+  R   A  D+  V+  C  L +PL  H V ED      +     +   R +R+  F++     K  K+ +AH+R+D  E     L          GI K RG+     + RP +   + EI        + Y ID TN    Y RN++R  I   +  E  E
  S:    17 PFDTVIVGVSGGADSICLLTCLHRLREQYHLNLY-AVHVNHMLRGMEADEDEAFVQSMCNSLSIPL--HCVREDVKRIAELSGTTIEEAGRNLRYLSFEQECERVKAHKIAVAHNRNDNAETVLFHLFRGTGLTGMTGIPKKRGQ-----IIRPLLCVTREEIETFLFNEHIFYRIDSTNLSNDYTRNKIRLSILPIATNEINE 212
>gi|167036726|ref|YP_001664304.1| tRNA(Ile)-lysidine synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855560|gb|ABY93968.1| tRNA(Ile)-lysidine synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] (458 aa)
Score = 175, Expect = 4.9e-11, Identities = 71/231 (30%), Positives = 124/231 (53%)
  Q:     7 IAGVSGGPDSMLLLK-------LYHKKIACVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYI-GVCAMNRVI----------GQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLV 237
           + GVSGGPDS+ +L        L++ K+  +VHVN+  R  A  RD + VE+ C++LK+P  +       + K+   + +   R +R++ F++     K +K+ +AH+++D +E   + L      A   GIK         + RP I+  + EI    +E  +   ID TN + +YKRN+VR ++  +  E  E   I  +  M ++I           +K+F+ +    Q     D+++LK      QR+LV
  S:    22 VMGVSGGPDSLCMLDILYNLKDLFNLKLY-IVHVNHMIRGEAAKRDAQFVEDMCRKLKLPFFLFEKDVKKIAKEMGYSEEEAGRYVRYQAFEEVLKEVKGNKIAVAHNKNDVVETVFLNLIRGSGMAGLIGIKP----VNGNIIRPLIEIEREEIEKYLKEKDLKPAIDFTNYEDLYKRNKVRLKLIPFINETFEVDIIENIYRMAKIILEENDYLEKECEKIFNEVCYFNQEEIFADIKKLKTQHPAIQRRLV 270
>gi|87198103|ref|YP_495360.1| tRNA(Ile)-lysidine synthetase-like [Novosphingobium aromaticivorans DSM 12444] >gi|123491176|sp|Q2GC97.1|TILS_NOVAD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|87133784|gb|ABD24526.1| tRNA(Ile)-lysidine synthetase-like protein [Novosphingobium aromaticivorans DSM 12444] (326 aa)
Score = 175, Expect = 4.9e-11, Identities = 51/181 (28%), Positives = 90/181 (49%)
  Q:     2 PKTQYIAGVSGGPDS---MLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD--ARKRAMYYGIKTRGELYG---MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           P  +    VSGGPDS   MLL++    +  CV  V++  R  +  +  MV   C+   +    HT+  D       Q +ARK R+      A    +  ++ AHH DD  E   M+L+  A  R +  G++    + G   +++ RP + + + E++AL E+  +   +D +N    Y+R ++R  +A+
  S:    24 PSGRVCLAVSGGPDSLALMLLMQEVAPRDFCVATVDHGLRAESAAEAAMVAGLCEMRGI--AYHTLRLDLAGGSAVQERARKARYAALADLARRDGLSAVVTAHHADDQAETLVMRLNRGAGLRGL-AGMRAASSVPGAGEVRLLRPLLGWRRAELVALVEDAGLAPVLDPSNHDHRYERVRIRDVMAS 209
>gi|148322418|gb|EDK87668.1| PP loop family cell cycle protein MesJ [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (448 aa)
Score = 175, Expect = 5.3e-11, Identities = 80/276 (28%), Positives = 142/276 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKR-TTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLA--------HPD------VRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQ------QKHYRL-KDEIFLSIKDER 282
           + G SGGPDS+ L+++  K       KI  +VH+N+  R   A  D+    EY K+  + + +  +P   + K   K  +   R+ R++ F +     +  K+  AH++DD IE    +L  R  ++    GIK +       V RP  + +K +IL    ++++ Y ID+TN +  + RN +R ++  + +E            N     K+FSL+K  ++           + D      + + K     D++ L+  FL   +I+V  +KID I   I+          K YR+ KD  +L I+D++
  S:    24 VVGFSGGPDSVFLVEMLKKLQHFFNFKI-YLVHINHLLRGEDADSDENFSFEYAKKNNLEIFIKRIPVKEIAKEIGKTLEEVGREERYKFFSEIYEKVRATKIATAHNKDDQIETFLFRL-IRGTSLQGLEGIKIKNN----NVIRPISEIYKKDILEYLNKNEIQYKIDKTNFENEFTRNSIRLDLIPFIEER----------YNIKFKDKIFSLIKEIRENNQNNSLNLSDYTDSENRIILEKTKFLSNFDKKNLLSLFLNKKNIEVNRNKIDEISSLIKSNGTKKIDLDKSYRIVKDYTYLYIEDKK 317
>gi|94496969|ref|ZP_01303543.1| ATPase [Sphingomonas sp. SKA58] >gi|94423645|gb|EAT08672.1| ATPase [Sphingomonas sp. SKA58] (314 aa)
Score = 175, Expect = 5.4e-11, Identities = 49/181 (27%), Positives = 87/181 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKL----YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           P  ++   VSGGPDSM LL L    +  ++A V  V++  R  +  +  +V  +C    +  +  T+P D     N QA AR  R+   +   + + +D ++ AHH DD +E   M+L+  + +   G+     + G +V RP +   K  + A  +   +PY  D +N    + R  +R  ++ 
  S:    26 PAIRFGIAVSGGPDSMALLCLAASAFPGRVAAVT-VDHGLRRESADEAALVARWCVAHGIEHV--TLPADATVTGNVQAWARTTRYRLMEAWRASHAIDWIMTAHHADDQLETLVMRLN--RGSGIGGLAGVRAVSG-RVIRPLLGERKAMLQAFVDREGLPYVQDPSNRDRRFDRATLRMALSG 204
>gi|164686638|ref|ZP_02210666.1| hypothetical protein CLOBAR_00231 [Clostridium bartlettii DSM 16795] >gi|164604367|gb|EDQ97832.1| hypothetical protein CLOBAR_00231 [Clostridium bartlettii DSM 16795] (462 aa)
Score = 175, Expect = 5.4e-11, Identities = 49/180 (27%), Positives = 97/180 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + G+SGGPDS+ LL + ++      I     H+N+  R   A +D   V   C+++ +   V ++      ++N    +  ARK+R+E F +       +K+ +AH+ +D  E   M++   +    +G++    +    + RP +   ++EI + CE++ +   ID+TN  PIY RN++R ++  + +E
  S:    23 VLGISGGPDSVCLLHILNRLKEQFDIEIYAAHLNHQIRGIEAQKDALYVTRLCEEMGIKYFVRSIDVPKYCQENKLSIEDGARKLRYEMFFEIMQRTHANKIAIAHNVNDQAETILMRI--MRGTGLHGLRGIEYIRDNVIIRPILDIERSEIESYCEQYNLNPRIDQTNLDPIYTRNKIRLKLLPYMQE 210
>gi|123430775|ref|XP_001307953.1| PP-loop family protein [Trichomonas vaginalis G3] >gi|121889608|gb|EAX95023.1| PP-loop family protein [Trichomonas vaginalis G3] (444 aa)
Score = 174, Expect = 6.6e-11, Identities = 56/169 (33%), Positives = 88/169 (52%)
  Q:     9 GVSGGPDSMLL------LKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQ--ARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           GVSGG DSM L      LK        V H+N+  R TA RD++ V++ C+   +  I  TV  D   + K F ++   R +R+E F++ +   K+   L AH+ +D +E     +   +     G+     + G  +YRP I   + EI     ++K+ Y  DETN + IY RN++R
  S:    24 GVSGGADSMYLFYNFMDLKEDWNLDIIVCHLNHGIRETAKRDEEFVKKSCQAYGIKFISKTVNMDEFAREKKFSSEEAGRILRYEFFRENSQGRKI---LTAHNANDRVETVLFNI--MRGTGLKGLSGITHVNG-DIYRPLINIKREEIEDYLHKNKLQYFDDETNFEEIYTRNKIR 195
>gi|157364389|ref|YP_001471156.1| tRNA(Ile)-lysidine synthetase [Thermotoga lettingae TMO] >gi|166988068|sp|A8F7F8.1|TILS_THELT tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157314993|gb|ABV34092.1| tRNA(Ile)-lysidine synthetase [Thermotoga lettingae TMO] (447 aa)
Score = 174, Expect = 7.0e-11, Identities = 56/180 (31%), Positives = 92/180 (51%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK---KIACVV---HVNYNKRTTALRDQKMVEEYCKQLKVPLIVH--TVPEDTVWKK-NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG--ELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           P  + +  +SGG DSM LL +  K   K+ C +   H+N+  R  A+RD++ V  YCK+  V + V    VP+    +K   +  AR  R+    + A    +D + LAH+ +D +E            +Y  ++  G   +  MK+      RP + + + +I A  + + +PY  DETN    Y RN +R  I 
  S:    22 PGHKVLVALSGGMDSMSLLNILLKLRQKLNCEIFAAHLNHMIRENAIRDEQFVYSYCKKAGVKIFVERFDVPKFCADRKIGIEEGARAARYTFLNRIAHENGIDLIALAHNLNDLVETI----------LYRIVRGTGLSGIVCMKLKDENKIRPLLYFKREQIEAYIKRNNIPYVQDETNFNLKYSRNYIRHRIV 207
>gi|195953926|ref|YP_002122216.1| tRNA(Ile)-lysidine synthetase [Hydrogenobaculum sp. Y04AAS1] >gi|195933538|gb|ACG58238.1| tRNA(Ile)-lysidine synthetase [Hydrogenobaculum sp. Y04AAS1] (306 aa)
Score = 173, Expect = 7.5e-11, Identities = 70/231 (30%), Positives = 109/231 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-KIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVY-----RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHP---DVRELKRYPLPDQRQLV 237
           + G SGG DSM+L  L +K K A      + H N++ R  A  D+    ++ K LK+P+ V +    ++ K N +  ARK R+E  QK +     +K+  AHH DD  E   +           G   +G L G K Y     RP I   K+EI A  +E  + +  D TN      RN +R ++    K     F   V   + ++  +   L    +  + +    DV+ LK+ P   QR++V
  S:    24 LIGFSGGVDSMVLSCLMYKLKDALGIEIGLAHFNHHLREDADEDEAFCIDFAKSLKLPIYVESFDIKSL-KGNIEENARKKRYEFLQKTSKKEGYNKIATAHHLDDLAETMILWF-------VRGGGLKG-LSGFKAYKENIIRPLITATKDEIRAFAKEQHLNWKEDYTNYDETISRNLIRHKVIPILKTINPNFLSTVLQESIILQDEEAFLEDYTEHVIKNIDVFDVKSLKQEPRAIQRRIV 259
>gi|91201108|emb|CAJ74167.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (482 aa)
Score = 173, Expect = 7.8e-11, Identities = 56/179 (31%), Positives = 86/179 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC--------VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV---WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P    I GVSGGPDS+ LLK  H   A         V H+N+  R   +  D++ V++   +L +P I   V    +    K + +  ARK R+  + +A+  Y V  +   H+ DD  E    ++     A   G      L        + RP +  WK EIL    + K  Y +D +N +  Y RN++R E+
  S:    22 PDDSVIVGVSGGPDSVALLKTLHFLNAAKNLRLRLYVAHLNHQLRGDFSEEDEQFVQDLANKLSLPFISKRVNIGKIASETKLSLEEMARKERYTFYSEASQNYNVSHVATGHNADDNAETILHRIIRGTGAPGLGGIPIKRLLSPGTPQLIIRPLLFAWKKEILEYLNKDKTKYRVDASNYEKEYTRNRIRHEL 216
>gi|75761780|ref|ZP_00741716.1| tRNA(Ile)-lysidine synthetase TilS [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490730|gb|EAO54010.1| tRNA(Ile)-lysidine synthetase TilS [Bacillus thuringiensis serovar israelensis ATCC 35646] (480 aa)
Score = 173, Expect = 7.8e-11, Identities = 56/189 (29%), Positives = 96/189 (50%)
  Q:     4 TQYIAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  + GVSGGPDS+ LL     K   K++  VV HV++  R   +  D + V++ C++L +  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C +  +   ID +N + +Y RN++R+ +    KEE  + +
  S:    27 STIVVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGDESHEDLQFVQDLCEELGI--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMH 226
>gi|168144486|ref|ZP_02587715.1| Cell cycle protein MesJ [Bacillus cereus G9842] (476 aa)
Score = 173, Expect = 7.9e-11, Identities = 56/189 (29%), Positives = 96/189 (50%)
  Q:     4 TQYIAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  + GVSGGPDS+ LL     K   K++  VV HV++  R   +  D + V++ C++L +  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C +  +   ID +N + +Y RN++R+ +    KEE  + +
  S:    23 STIVVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGDESHEDLQFVQDLCEELGI--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMH 222
>gi|167039445|ref|YP_001662430.1| tRNA(Ile)-lysidine synthetase [Thermoanaerobacter sp. X514] >gi|166853685|gb|ABY92094.1| tRNA(Ile)-lysidine synthetase [Thermoanaerobacter sp. X514] (458 aa)
Score = 173, Expect = 7.9e-11, Identities = 58/183 (31%), Positives = 100/183 (54%)
  Q:     7 IAGVSGGPDSMLLLK-------LYHKKIACVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKE 189
           + GVSGGPDS+ +L        L++ K+  +VHVN+  R  A  RD + VE+ C++LK+P  +       + K+   + +   R +R++ F++     K +K+ +AH+++D +E   + L      A   GIK         + RP I+  + EI    +E  +   ID TN + +YKRN+VR ++  +  E  E
  S:    22 VMGVSGGPDSLCMLDILYNLKDLFNLKLY-IVHVNHMIRGEAAKRDAQFVEDMCRKLKLPFFLFEKDVKKIAKEMGYSEEEAGRYVRYQAFEEVLKEVKGNKIAVAHNKNDVVETVFLNLIRGSGMAGLIGIKP----VNGNIIRPLIEIEREEIEKYLKEKDLKPAIDFTNYEDLYKRNKVRLKLIPFINETFE 211
>gi|15618905|ref|NP_225191.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae CWL029] >gi|15836528|ref|NP_301052.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae J138] >gi|16752030|ref|NP_445396.1| MesJ/Ycf62 family protein [Chlamydophila pneumoniae AR39] >gi|33242366|ref|NP_877307.1| putative p-loop ATPase [Chlamydophila pneumoniae TW-183] >gi|61216756|sp|Q9Z6R2|TILS_CHLPN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|4377326|gb|AAD19134.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae CWL029] >gi|7189770|gb|AAF38647.1| MesJ/Ycf62 family protein [Chlamydophila pneumoniae AR39] >gi|8979370|dbj|BAA99204.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae J138] >gi|33236877|gb|AAP98964.1| putative p-loop ATPase [Chlamydophila pneumoniae TW-183] (319 aa)
Score = 173, Expect = 9.1e-11, Identities = 46/184 (25%), Positives = 91/184 (49%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC--VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           K +Y+  +SGG DS+ L  L  ++      VH+++  R+T+ ++ K +EE C +  VP +++T+  +    K+ + QARK R+    ++        + LAHH +D  E   K  L++        +  R  +  + + RP +   K+ +    +   + Y  D +N    Y R ++R+++  W +E
  S:    24 KKRYLLALSGGSDSLFLFYLLKERGVSFTAVHIDHGWRSTSAQEAKELEELCAREGVPFVLYTLTAEEQGDKDLENQARKKRYAFLYESYRQLDAGGIFLAHHANDQAETVLKRLLESAHLTNLKAMAERSYVEDVLLLRPLLHIPKSSLKEALDARGISYLQDPSNEDERYLRARMRKKLFPWLEE 210
>gi|15806226|ref|NP_294931.1| cell cycle protein MesJ, putative/cytosine deaminase-related protein [Deinococcus radiodurans R1] >gi|84039866|gb|AAF10777.2|AE001969_6 cell cycle protein MesJ, putative/cytosine deaminase-related protein [Deinococcus radiodurans R1] (600 aa)
Score = 172, Expect = 9.6e-11, Identities = 53/176 (30%), Positives = 85/176 (48%)
  Q:     5 QYIAGVSGGPDSMLLLK--LYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT-RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           Q + GVSGG DS+ LL+  L    +  V H+++  R  ++ D   V + C +L VP  V  +    V  +   N +  AR++R++   +AA     + +L AH R D  E   M+L  R      GI   RG     +V RP++   + EI          +  D +NA P + R  +R+E+
  S:    57 QVLVGVSGGADSVGLLRALLAVGALPAVAHLDHALRPESVDDAAWVSDLCARLGVPCEVTRIDVGAVAARRNWNLEBAARRLRYDVLSRAAKHSGAEVILTAHTRRDQAETVLMEL-LRGEGRIRGIPPQRG-----RVRRPWLNVGRAEIETYLRGLGQDWREDASNADPRFTRAWLRREV 232
>gi|184154695|ref|YP_001843035.1| cell cycle protein [Lactobacillus fermentum IFO 3956] >gi|183226039|dbj|BAG26555.1| cell cycle protein [Lactobacillus fermentum IFO 3956] (449 aa)
Score = 172, Expect = 9.8e-11, Identities = 50/171 (29%), Positives = 81/171 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +  VS G DSM+LL L        +    V HVN++ RT +  ++  +  YC+Q  +PL V          K  +A AR+ R+  F      Y+   +  AHH+DD  E   M+L    R    G ++ +       + RP +   K ++    ++H++ +  DETN      RN+VR
  S:    25 VVAVSTGVDSMVLLDLLQNLPKLRRPRLIVAHVNHHLRTQSTAEEAFLRTYCRQRNLPLEVAQWAVAEHPAKGIEAAARRFRYSFFATVMDKYQAQAVATAHHQDDLAETVLMKLIRGGRIEQLGALRWQRPFASGALIRPLLALNKQDLRRYAKDHQLTWFEDETNRDLTPFRNRVR 202
>gi|147676532|ref|YP_001210747.1| ATPase [Pelotomaculum thermopropionicum SI] >gi|146272629|dbj|BAF58378.1| predicted ATPase [Pelotomaculum thermopropionicum SI] (473 aa)
Score = 172, Expect = 9.9e-11, Identities = 57/176 (32%), Positives = 91/176 (51%)
  Q:     5 QYIAGVSGGPDSMLLL-KLYHKK----IAC-VVHVNYNKRTTALRDQKM-VEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +  VSGGPDS+ LL  LY  K    I+  V H+N+  R      + + V +  ++  +P  V         K++    QA AR++RF  F +AA      ++ LAHH DD  E   + ++  + A   G+K    +      RP +   + EI   C+E K+PY  D +N + +Y RN+VR E+
  S:    22 KVLVAVSGGPDSVALLHALYLLKEELEISLHVAHLNHMFRGAESEAEALFVADMARRYGLPATVEARDVPAYQKQSGLSAQAAAREVRFRFFSEAAGKAGASRVALAHHADDQAET--ILINFLRGAGITGLKGISPVREGFYIRPLLTVRRAEIERYCKEMKLPYCRDSSNLKAVYTRNRVRLEL 205
>gi|30018334|ref|NP_829965.1| cell cycle protein MesJ [Bacillus cereus ATCC 14579] >gi|61216614|sp|Q81J84|TILS_BACCR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29893874|gb|AAP07166.1| Cell cycle protein MesJ [Bacillus cereus ATCC 14579] (476 aa)
Score = 172, Expect = 1.1e-10, Identities = 56/189 (29%), Positives = 95/189 (50%)
  Q:     4 TQYIAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           +  + GVSGGPDS+ LL     K   K++  VV HV++  R   +  D + V+  C++L +  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C +  +   ID +N + +Y RN++R+ +    KEE  + +
  S:    23 STIVVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGDESYEDLQFVQGLCEELGI--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLMPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMH 222
>gi|189346163|ref|YP_001942692.1| tRNA(Ile)-lysidine synthetase [Chlorobium limicola DSM 245] >gi|189340310|gb|ACD89713.1| tRNA(Ile)-lysidine synthetase [Chlorobium limicola DSM 245] (325 aa)
Score = 172, Expect = 1.1e-10, Identities = 53/174 (30%), Positives = 82/174 (47%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIAC---VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGGPDSM LL L       + C   V H N+  R   +  D++ V E C+ L V        T      WKK+ +  AR  R+  F+      ++ K+   HH  D  E     L   +     G+K    ++G +V RP +   K++IL   +E ++P+  D +N    Y RN +R  +
  S:    25 LVAVSGGPDSMALLYLLCAVASVVRCRISVAHCNFQLRGEESDSDERFVMEQCRLLGVECFSRQFDTAAVSASWKKSVEETARLQRYSWFETLLQEREMTKIATGHHVSDNAETILFNL--FRGTSLLGLKGIRAMHG-RVIRPLLLLHKSDILGYLQEKEIPFRTDASNESIDYDRNFIRNRV 205
>gi|163725709|ref|ZP_02133229.1| tRNA(Ile)-lysidine synthetase [Desulfatibacillum alkenivorans AK-01] >gi|161400950|gb|EDQ25198.1| tRNA(Ile)-lysidine synthetase [Desulfatibacillum alkenivorans AK-01] (271 aa)
Score = 172, Expect = 1.2e-10, Identities = 60/174 (34%), Positives = 83/174 (47%)
  Q:     4 TQYIAGVSGGPDSMLL---LKLYHKKIAC---VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
            + +AGVSGGPDS  L   L    K+ A    V HVN+  R   + RD   V+E    L VP  + TV      K++    +  AR+ R   F +A   +  D + L HH DD  E   M +   + A   G+     + G K  RP  K  + EIL  C E+ + +  D TN      RNQ+R
  S:    31 ARVLAGVSGGPDSTALVHVLSRLQKEFALQLGVAHVNHCLRGEESDRDALFVQELANSLDVPFHMETVDVAAARKESGLSLEEAAREARKAFFSRAMQEHGYDFVALGHHADDNAEW--MLISLIRGAGAGGLSGIPPVNG-KTVRPLFKLTRKEILKYCRENALKWVQDSTNQDQSILRNQIR 211
>gi|77918602|ref|YP_356417.1| cell cycle protein [Pelobacter carbinolicus DSM 2380] >gi|77544685|gb|ABA88247.1| cell cycle protein [Pelobacter carbinolicus DSM 2380] (458 aa)
Score = 171, Expect = 1.2e-10, Identities = 54/179 (30%), Positives = 91/179 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLK-LYH-----KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIV--HTVPEDTVWKKNFQAQARKIRFEQF-QKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P    + G+SGG DSM+LL  L H     +      H+++  R  +  D   V  +C++  VPL V    VP      K    +A +    +F Q+ A +     + L HHR+D +E    +L         G    G L GM++      RP + + + +ILA  ++H++P+  D +NA  ++ RN++R E+
  S:    17 PGDAILVGLSGGADSMVLLDVLLHVADSLQLAILAAHLDHGMRPESADDAAFVARFCRRRDVPLTVGHRDVPALARQHKQGLEEAAREARREFLQQTARVEGCRFIALGHHRNDQVETFLHRL-------LRGSGLSG-LAGMRLRSGPFIRPLLSFSRQDILAYLDDHQIPHVEDASNADTVFTRNRLRHEL 201
>gi|168138218|ref|ZP_02581447.1| Cell cycle protein MesJ [Bacillus cereus B4264] (476 aa)
Score = 171, Expect = 1.3e-10, Identities = 56/186 (30%), Positives = 94/186 (50%)
  Q:     7 IAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           + GVSGGPDS+ LL     K   K++  VV HV++  R   +  D + V+  C++L +  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C +  +   ID +N + +Y RN++R+ +    KEE  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGDESYEDLQFVQGLCEELGI--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLMPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMH 222
>gi|167938109|ref|ZP_02525184.1| Cell cycle protein MesJ [Bacillus cereus AH1134] (476 aa)
Score = 171, Expect = 1.5e-10, Identities = 78/261 (29%), Positives = 135/261 (51%)
  Q:     4 TQYIAGVSGGPDSMLLL-----KLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE----------------KEEFYIGVCA---MNRVIGQKL---FSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHI--DVTGDKIDAILDFIQPFQ 264
           +  + GVSGGPDS+ LL     K   K++  VV HV++  R   +  D + V+  C++L +  I  T+  +       +  N Q  AR+ R+   ++    Y    + L HH DD +E   M+L        Y GI  +   +   + RP +   K EI+  C +  +   ID +N + +Y RN++R+ +    KEE                ++E Y+   A   MN+VI +K     SL   A + ++ P    L+R  +    QL+ ++L  + I   ++   ID +++F +  Q
  S:    23 STIVVGVSGGPDSLALLYYLLEKRAEKQLKIVVAHVDHMFRGDESHEDLRFVQGLCEELGI--ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLMPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSVQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMP----LQRRGI----QLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|145630423|ref|ZP_01786204.1| pyridoxine kinase [Haemophilus influenzae 22.4-21] >gi|144984158|gb|EDJ91595.1| pyridoxine kinase [Haemophilus influenzae R3021] (430 aa)
Score = 170, Expect = 1.7e-10, Identities = 50/175 (28%), Positives = 90/175 (51%)
  Q:     6 YIAGVSGGPDSMLLLKLY--------HKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+        H +   +  +H+++     A    K  ++ C QL++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ R  L+GM + RP + + + ++    ++ K+ +  DE+N    Y RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLQPLSIRAIHIHHGLSPNADSWAKHCQDLCDQLQIPLIIERVQVDKT--NGIEAGAREARYQAIKKY--LQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQRSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEI 200
>gi|91214572|ref|ZP_01251545.1| putative cell-cycle protein [Psychroflexus torquis ATCC 700755] >gi|91186999|gb|EAS73369.1| putative cell-cycle protein [Psychroflexus torquis ATCC 700755] (437 aa)
Score = 170, Expect = 1.7e-10, Identities = 53/178 (29%), Positives = 91/178 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKL---YHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           T ++  +SGG DS++L  L    H     + H N+  R   + RD++ VE     LK    + T   +++ K++    Q  ARK+R++ FQ+       + LL AHH +D +E   + L +R   +    GI  R       + RP +K+ K E+     +H + +  D++NA   Y RN++R +I 
  S:    19 TPFLIAISGGLDSVVLAHLCNSLHLDFG-LSHCNFQLRGLDSTRDEEFVENLSISLKCEFFIKTFQTESIAKESKSSIQLTARKLRYDWFQELIETTSHNYLLTAHHLNDDLETFIINL-SRSTGLKGLTGIPQRNS----HILRPLLKFSKAELKEYAIKHNIYWREDQSNASTKYLRNEIRHKIV 199
>gi|155370502|ref|YP_001426036.1| hypothetical protein FR483_N404R [Paramecium bursaria Chlorella virus FR483] >gi|155123822|gb|ABT15689.1| hypothetical protein FR483_N404R [Paramecium bursaria Chlorella virus FR483] (513 aa)
Score = 170, Expect = 1.7e-10, Identities = 50/200 (25%), Positives = 95/200 (47%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE-------DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDA-RKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIG 203
           T+ I  +SGG DSM+   + H           VV VNY  R +A  ++  V ++      PL V  + E       +   +  ++   R +R+  ++          +++ H++DD +E     + + +K     G+ T     G+  +RP +   KN+I+A   EH++P+  + T   P  KR Q+R ++A    +  E F  G+  + + + 
  S:   209 TKLIMSISGGSDSMVAFHIIHGLKEAFGYDIDVVMVNYTNRDSAYAEEAFVADWVNSFGYPLHVRRIDEIKRKQCANNQLRTVYEKYTRDVRYATYKTLGP----HPVVMGHNKDDCLENILQNIGSCQKYDNLSGMDTLVVQDGIPFFRPLLDVSKNDIVAYAREHQIPFLPNST--PPTMKRGQIRNKVAPVLNDWNELFVPGLFQLKKTMA 416
>gi|163789070|ref|ZP_02183514.1| tRNA(Ile)-lysidine synthetase [Flavobacteriales bacterium ALC-1] >gi|159875734|gb|EDP69794.1| tRNA(Ile)-lysidine synthetase [Flavobacteriales bacterium ALC-1] (439 aa)
Score = 170, Expect = 1.8e-10, Identities = 48/181 (26%), Positives = 92/181 (50%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHK--KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           + +++ +  +SGG DS++L  L H+      + H N+N R   +  D+  V E   QL V + +      T     K++ Q  AR++R++ F + A   K D +L AHH DD +E     ++  +     G+    E+    + RP +++ + +I +   E+ + +  D +N+   Y RN++R E+ 
  S:    16 LNESKLLIAISGGIDSVVLAHLCHQFQLNFTLAHCNFNLRGEESNADEDFVLELADQLNVEVFIQNFDTQTYADENKRSIQMAARELRYDWFTELAEQLKFDYILTAHHADDNLET--FLINFTRGTGLNGLTGIPEI-NDNIVRPLLQFSREQIESYANENAIKWREDSSNSSRKYLRNKLRHEVV 199
>gi|53733246|ref|ZP_00349670.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R2866] (430 aa)
Score = 170, Expect = 1.8e-10, Identities = 50/175 (28%), Positives = 89/175 (50%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKKIAC------------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+ K   C             +H+++     A    +  ++ C QL++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ R  L+GM + RP + + + ++    ++ K+ +  DE+N    Y RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAK--LCQKQPHLPPLSVRAIHIHHGLSPNAESWVQHCQDLCDQLQIPLIIERVQVDKT--NGIEAGAREARYQAIKK--HLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQRSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEI 200
>gi|167629385|ref|YP_001679884.1| tRNA(Ile)-lysidine synthase [Heliobacterium modesticaldum Ice1] >gi|167592125|gb|ABZ83873.1| tRNA(ile)-lysidine synthase [Heliobacterium modesticaldum Ice1] (463 aa)
Score = 170, Expect = 2.0e-10, Identities = 53/200 (26%), Positives = 92/200 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA------CVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQ---ARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRV 201
           P+ + +  VSGG DS+ LL L+H+          V H N+  R  A   D+  V     +L +P      P+   W +    +   AR++R++  ++ A     D++ L HH DD +E               G   RG L GM +      RP + + + E+ A  +  +  +  D +N   +Y RN++R E+     +    F   +  M+R+
  S:    17 PQQRVLIAVSGGIDSVSLLLLFHQAAPQMDLKLSVAHYNHGLRGEAADEDEAFVAALAGRLGLPCYRERAPQGW-WTREPGTKMEAARRLRYDFLERVAKAAGADRIALGHHADDQVETVLFHF-------LRGSGLRG-LAGMPIRRGPYIRPLLAFRRAELAAFLQAERQEWRHDASNDSTLYTRNRIRHELIPLLHDYNPRFAEAIGRMSRL 222
>gi|172056094|ref|YP_001812554.1| tRNA(Ile)-lysidine synthetase [Exiguobacterium sibiricum 255-15] >gi|171988615|gb|ACB59537.1| tRNA(Ile)-lysidine synthetase [Exiguobacterium sibiricum 255-15] (414 aa)
Score = 170, Expect = 2.0e-10, Identities = 54/180 (30%), Positives = 90/180 (50%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKI--ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQA--RKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +PK   +  VSGG DSM+L  L ++      +VHV++  R  +  + + V  + +  +V + +  +     W+    +QA  R  R+  FQ+  +      L+LAHHRDD +E   +QL  R  A   GI         +++RP + Y K ++    +  +V +  DETNA   Y RNQ+R  +
  S:     7 LPKEPLLVAVSGGCDSMVLAHLLYEANHDLMIVHVHHGLRKESDEEAEAVRAWAEARRVGIRMTRLE----WEGQAPSQAACRTRRYAFFQEVMAETGRRHLVLAHHRDDQLETLLIQL-IRGEAGVDGIPRIRSFATGQIHRPLLPYSKQQLYDYAKARQVVWHEDETNAGTKYLRNQMRHRL 185
>gi|189485208|ref|YP_001956149.1| tRNA(Ile)-lysidine synthase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287167|dbj|BAG13688.1| tRNA(Ile)-lysidine synthase [uncultured Termite group 1 bacterium phylotype Rs-D17] (321 aa)
Score = 169, Expect = 2.1e-10, Identities = 49/177 (27%), Positives = 92/177 (51%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLY---HKKIACV---VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY-GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +P  + I  VSGG DSM +L L+    KK+  V   V+ N+N R  ++++ + V+    +  +  ++  +      KK   + +   R +R+   ++ +  YK +K+  AH+ +D  E   M+L  R    + GI  + ++   + V RP +   +  I      HK+P+  D++N   IY RN++R
  S:    18 IPGDKIILSVSGGMDSMCMLHLFWRLAKKMDIVFLAVNFNHNLRKESVKEAETVKNLSAEFGIDCLLEEIGVKEYSKKYSLSVETAGRNLRYLTLERISKKYKCNKIATAHNANDNAETVLMRL-LRGSGNFAGIPQKRKINRNIVVIRPLLPVKRKFIEEYVRNHKLPFCTDKSNFSDIYTRNKIR 203
>gi|88857960|ref|ZP_01132602.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Pseudoalteromonas tunicata D2] >gi|88819577|gb|EAR29390.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Pseudoalteromonas tunicata D2] (428 aa)
Score = 169, Expect = 2.4e-10, Identities = 54/178 (30%), Positives = 90/178 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIAC-------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKV-DKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           KT  +A +SGG DS++LL L     A         VHVN+     A   Q   +  C +L +P    +V  D   +++ +A AR++R+   Q   S+ +V D +LL  H+DD +E   +QL      +    +    E  G  + RP ++  +  I A C++  + +  DE+N+   Y RN +R +I
  S:    19 KTLTVA-LSGGVDSVVLLHLVATYQALNPDVKVQAVHVNHGISPHAHAWQDFCQRLCAELTIPFNAISVTIDKKNRQSLEAVARELRY---QALVSVTQVQDVILLGQHQDDQVETFFLQLKRGSGLSGLSAMANTSEFEGRILVRPLLETSRASIEAFCQQFNLSHIEDESNSDVKYDRNYLRHQI 201
>gi|145640364|ref|ZP_01795948.1| DNA mismatch repair protein [Haemophilus influenzae R3021] >gi|145274950|gb|EDK14812.1| DNA mismatch repair protein [Haemophilus influenzae 22.4-21] (430 aa)
Score = 169, Expect = 2.5e-10, Identities = 52/190 (27%), Positives = 93/190 (48%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           ++  +SGG DS +LL L+ K               +H+++     A    K  ++ C QL++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ +  L+GM + RP + + + ++    ++ K+ +  DE+N    Y RN +R EI    +E    F + V
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSIRAIHIHHGLSPNADSWAKHCQDLCDQLQIPLIIERVQVDKT--NGIEAGAREARYQAIKK--HLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAHFDLAV 215
>gi|114776817|ref|ZP_01451860.1| PP-loop [Mariprofundus ferrooxydans PV-1] >gi|114552903|gb|EAU55334.1| PP-loop [Mariprofundus ferrooxydans PV-1] (324 aa)
Score = 169, Expect = 2.5e-10, Identities = 46/172 (26%), Positives = 88/172 (51%)
  Q:     9 GVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           G SGG DS  LL +  ++   V   HV++  R +++++ +++ E  +  ++ L V  +P  +   +N +A+ARK R+ QF++ +    +  L L HHRDD  E   M+ L     +   G++ R     + ++RP ++    E+ A      + +  D +N      RN++RQ +
  S:    24 GWSGGADSTALLLMLQQQGYRVQAWHVDHGWRESSIKETELLAEKARGWEIELQVARLPAPS--GRNREAEARKGRYAQFEQWSEATGITTLCLGHHRDDQAETVCMRMLQGAGISGCRGMQQRRRHGRLDIFRPLLQVKAGELKAALRAADINWLEDPSNNDMTIWRNRIRQGL 196
>gi|150008036|ref|YP_001302779.1| putative cell-cycle protein [Parabacteroides distasonis ATCC 8503] >gi|149936460|gb|ABR43157.1| putative cell-cycle protein [Parabacteroides distasonis ATCC 8503] (438 aa)
Score = 168, Expect = 2.8e-10, Identities = 53/174 (30%), Positives = 85/174 (48%)
  Q:     7 IAGVSGGPDSMLLLK-LYHKKIACV-VHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + G+SGG DS+ LL  L      C+ +H N++ R   + RD+    E+ + L+VP   H +  DT+        + +  AR++R+  F++           +AHHRDD +E   M L      R M  GI+ R       + RP +   + +ILA   +    Y +D TN    Y RN +R  +
  S:    22 LVGLSGGADSVALLGVLVRLGYPCIALHCNFHLRGEESDRDEAFACEFAESLEVPF--HKIDFDTISYAGERHLSIEMAARELRYAWFEEMRERLGGQATAVAHHRDDNVETVLMNLIRGTGIRGM-SGIRPRNGF----IVRPLLCVSREDILAWLADQGYAYMVDSTNLSDAYTRNFIRLNV 198
>gi|116493275|ref|YP_805010.1| tRNA(Ile)-lysidine synthetase, MesJ [Pediococcus pentosaceus ATCC 25745] >gi|116103425|gb|ABJ68568.1| tRNA(Ile)-lysidine synthetase, MesJ [Pediococcus pentosaceus ATCC 25745] (456 aa)
Score = 168, Expect = 3.2e-10, Identities = 62/259 (23%), Positives = 131/259 (50%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-----------KEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL--ITHHIDVTGDKIDAILDFIQPFQQ 265
           +  VS G DS +L+       K+ H+++  V HVN+  R  ++ +++ + ++C+Q ++  +    P+    +   +A AR+ R+  F++         LL AH+ D+  E   MQ +         GI  R       + RPF+K+ K  ++   +E+K+ +  D+TN    + RN+VR EI    ++E           +++       +++V+ +KL  L +         D+  L++  LP Q++++   +  +   I +  +K+D ++  +   +Q
  S:    22 VVAVSTGVDSTVLINALINSTKIKHQQL-IVAHVNHQLREQSIEEERFLHKWCRQHQITFMETDWPKSQHPQHGVEAAAREFRYTFFKQVMHDQHAQVLLTAHNADEQAENFVMQVIRGGWLNQLNGIPERRTFAQGWLIRPFLKFTKQFLIETAQENKLRWFEDQTNRTTEFLRNRVRNEIIPAFRKENPRVVEHIQHYQDQLLEQSNLVDQVVLEKLTKLQRDES-----FDLLALRKESLPWQKKIILKIITEVNAEIAINENKLDELVRLVNNTKQ 295
>gi|15672001|ref|NP_266175.1| hypothetical protein L1002 [Lactococcus lactis subsp. lactis Il1403] >gi|61216729|sp|Q9CJH4|TILS_LACLA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|12722856|gb|AAK04117.1|AE006241_6 cell cycle protein MesJ [Lactococcus lactis subsp. lactis Il1403] (423 aa)
Score = 168, Expect = 3.4e-10, Identities = 58/203 (28%), Positives = 95/203 (46%)
  Q:     4 TQYIAGVSGGPDSMLLLK-LYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKM-QLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKL 206
           ++ +  +SGG DSM L   LY  K        + H+N+  R  +  ++  + E   +LKVP+ V     D    +  +  AR  R++ F+K       + LL AHH+ D +E   M Q+  R      GI  R    G ++ RP +K+ K E+ A        Y  D TN    Y RN++R ++    K+E  +F   +  ++  I + L
  S:    22 SKILLALSGGKDSMTLFNWLYDLKEVLGIELGLAHINHGLREESKFEEIALREMATKLKVPIYV-----DKFTGEFTEKNARDFRYQFFEKLMIGENYNILLTAHHQGDLVETVLMRQITGRPLRSLQGIADRQPFAGGQLIRPLLKFTKEELDAQT------YYEDSTNQGLDYFRNRIRNQLIPELKKENPQFSQSISDLSSEIKKAL 220
>gi|71906484|ref|YP_284071.1| PP-loop [Dechloromonas aromatica RCB] >gi|71846105|gb|AAZ45601.1| PP-loop [Dechloromonas aromatica RCB] (323 aa)
Score = 167, Expect = 3.6e-10, Identities = 57/178 (32%), Positives = 77/178 (43%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPF---------IKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQE 179
           P  +   G+SGG DS++LL L  +         +HV++     A        +YC  L VPL +  V  DT      +A ARK R+  F + A+    D LLL HHR D  E     L         G    G   GM   R F         +   +NEI A      + +  DE+NA     RN +R E
  S:    26 PSERLAVGLSGGCDSVVLLHLLTRLGFAGRLDAIHVHHGLSPNADAWGTFCADYCTGLGVPLTIRHVSVDTASGLGLEAAARKARYSVFAEVAT----DCLLLGHHRSDQAETVLFNL-------LRGTGVTGA-AGMPAERQFGRLRLLRPLLASSRNEIEAYAMSAGLAWIDDESNADVSLTRNFLRHE 204
>gi|108805006|ref|YP_644943.1| tRNA(Ile)-lysidine synthetase-like protein [Rubrobacter xylanophilus DSM 9941] >gi|108766249|gb|ABG05131.1| tRNA(Ile)-lysidine synthetase-like protein [Rubrobacter xylanophilus DSM 9941] (444 aa)
Score = 167, Expect = 4.0e-10, Identities = 58/180 (32%), Positives = 90/180 (50%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLK----LYHKKIACVVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           M  ++ +A VSGGPDS+ LL+    L ++    V+HV++  R    R D + V E C+ L +   V ++  +   +   Q +AR+ R+    + A       + + H+ DD  E   + L AR   +    GI   RG     +V RP I+  + EIL   E     Y +D TN  P Y RN+VR E+
  S:    19 MDLSRPLALVSGGPDSVALLRALVGLGYEP--AVLHVDHGLRGEESRGDAEFVRELCRGLGLRCEVRSLRLE--GRAGLQERARRERYRIAGEVAGRLGASAVAVGHNADDVAETLLLNL-ARGSGLRGLSGIPPVRG-----RVCRPLIERTRAEILGYLEALGQGYRVDSTNLLPKYARNRVRLEV 196
>gi|167933096|ref|ZP_02520183.1| putative cell-cycle protein [candidate division TM7 single-cell isolate TM7b] (228 aa)
Score = 167, Expect = 4.2e-10, Identities = 52/174 (29%), Positives = 88/174 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC----VVHVNYNKRTTALRD----QKMVEEYC---KQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           IA +SGG DS++LL L  K+       V HVN+  R  +  D    +KM  +Y    +Q+ + L +H   E           AR  R+   +K +  +   K++ AHH DD IE   + L         G +    +    +YRP   ++KN++L   +++ + +  D TN+  +Y RN++R+ I
  S:     3 IAAISGGVDSIVLLDLLSKRYKTSDIIVAHVNHGIRVESSEDADFVRKMSAKYGMRYRQIDLNLGLHASEE----------VARDQRYTFLRKLSKEFNA-KIVTAHHADDIIETIAINL-----VRGTGWRGLAVMSAKDIYRPLTCFYKNDLLLYAKKNGLEWREDSTNSSDLYLRNRLRKRI 171
>gi|61216750|sp|Q9RV23|TILS_DEIRA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (582 aa)
Score = 167, Expect = 4.3e-10, Identities = 54/176 (30%), Positives = 86/176 (48%)
  Q:     5 QYIAGVSGGPDSMLLLK--LYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT-RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           Q + GVSGG DS+ LL+  L    +  V H+++  R  ++ D   V + C +L VP  V  +    V  +   N +A AR++R++   +AA     + +L AH R D  E   M+L  R      GI   RG     +V RP++   + EI          +  D +NA P + R  +R+E+
  S:    40 QVLVGVSGGADSVGLLRALLAVGALPAVAHLDHALRPESVDDAAWVSDLCARLGVPCEVTRIDVGAVAARRNWNLEA-ARRLRYDVLSRAAKHSGAEVILTAHTRRDQAETVLMEL-LRGEGRIRGIPPQRG-----RVRRPWLNVGRAEIETYLRGLGQDWREDASNADPRFTRAWLRREV 214
>gi|28377429|ref|NP_784321.1| cell cycle protein MesJ [Lactobacillus plantarum WCFS1] >gi|61216640|sp|Q88Z33|TILS_LACPL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|28270261|emb|CAD63162.1| cell cycle protein MesJ [Lactobacillus plantarum WCFS1] (448 aa)
Score = 167, Expect = 4.5e-10, Identities = 51/179 (28%), Positives = 84/179 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR--AMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P+   +  VS G DSM+LL L  +  A       V HVN++ R  +  +   + +YC+Q  + L++         K   +A  R+ R+  F K     +   +L AHH +D +E   M+L AR    +   GI T       ++ RP + + K+++     E  V Y  D TN      RN++R  +
  S:    19 PQQTVVVAVSTGVDSMVLLHLLQRLPAAERPRVVVAHVNHHLREQSQMEADYLRQYCQQQNLKLVMADWLPAAHPKSGIEAAGRQFRYHVFAKVMRENRATAVLTAHHANDQVETYLMKL-ARGGDISQLTGIATSRPFATGRLIRPLLTWSKDQLRNYAAEQHVVYFEDVTNQDVALTRNRIRHRV 204
>gi|68249007|ref|YP_248119.1| putative cell cycle protein MesJ [Haemophilus influenzae 86-028NP] >gi|68057206|gb|AAX87459.1| putative cell cycle protein MesJ [Haemophilus influenzae 86-028NP] (430 aa)
Score = 166, Expect = 4.7e-10, Identities = 52/190 (27%), Positives = 95/190 (50%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKKIAC------------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM----YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           ++  +SGG DS +LL L+ K   C             +H+++     A    K  +  C Q ++PLI+  V  D       +A AR+ R++  +K   + ++  L+ AHH +D   Q +    A KR         ++ +  L+GM ++RP + + + ++    ++ K+ +  DE+N    Y RN +R EI    +E    F + V
  S:    19 FLIALSGGLDSTVLLSLFAK--LCQKQPHLPPLSVRAIHIHHGLSPNADSWAKHCQNLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKKHLQIQEM--LVTAHHLND---QTETFFLALKRGSGLQGLSAMQQQSVLFGMPIFRPLLGFTRPQLEDYAQQEKLNWVTDESNEDNRYDRNFLRNEILPKLRERWAHFDLAV 215
>gi|149372519|ref|ZP_01891631.1| tRNA(Ile)-lysidine synthetase [unidentified eubacterium SCB49] >gi|149354562|gb|EDM43126.1| tRNA(Ile)-lysidine synthetase [unidentified eubacterium SCB49] (436 aa)
Score = 166, Expect = 4.8e-10, Identities = 76/275 (27%), Positives = 131/275 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHKK--IACVVHVNYNKRTTALR-DQKMVEEYCKQLKVPL---IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA----NWSKEEKEEFYIGVC---AMNRVIGQ---KLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQP----FQQKHYRLKD--EIFLSIKDE 281
           I   SGG DS +L +L  +     C+ H N++ R  A   D   VE    +L +P    +  T       K + Q  AR++R++ F++  +  K D +  AHH DD +E   + L         G   RG L G+      + RP + + + EIL   ++ +  +  D +NA   Y RN +R  +     N SK   +  +  V    A  +++G     L++L+   K+     ++  +K   +P+Q  ++Y  L         D I+  L   Q     F + H  LKD  ++ L+++D 
  S:    22 IVACSGGLDSTVLTRLLKQLGFTICIAHCNFSLRGEASDGDAAFVENLATELDIPFYKTVFDTKAFANDHKLSTQMAARELRYQWFKELRTQIKFDLIATAHHADDMLETVLINLS-------RGTGIRG-LTGIPELTETIIRPLLPFSRTEILNFAKKSEFYWREDASNASTDYLRNDLRHNVIPAYKNASKNVLKGLHNTVSHLQATEQLVGDYIVLLYNLL--VKETSEGYEIDLIKLADIPNQSAVLYELLSPFGFTAWDDIIN--LTNAQSGKMVFSESHRLLKDRKKLILTLQDS 311
>gi|167957510|ref|ZP_02544584.1| putative cell-cycle protein [candidate division TM7 single-cell isolate TM7c] (275 aa)
Score = 166, Expect = 4.9e-10, Identities = 52/174 (29%), Positives = 88/174 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC----VVHVNYNKRTTALRD----QKMVEEYC---KQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           IA +SGG DS++LL L  K+       V HVN+  R  +  D    +KM  +Y    +Q+ + L +H   E           AR  R+   +K +  +   K++ AHH DD IE   + L         G +    +    +YRP   ++KN++L   +++ + +  D TN+  +Y RN++R+ I
  S:     3 IAAISGGVDSIVLLDLLSKRYKTSDIIVAHVNHGIRVESSEDADFVRKMSAKYGMRYRQIDLNLGLHASEE----------VARDQRYTFLRKLSKEFNA-KIVTAHHADDIIETIAINL-----VRGTGWRGLAVMSAKDIYRPLTCFYKNDLLLYAKKNGLEWREDSTNSSDLYLRNRLRKRI 171
>gi|16272353|ref|NP_438566.1| cell cycle protein [Haemophilus influenzae Rd KW20] >gi|1175240|sp|P44689|TILS_HAEIN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|1573375|gb|AAC22063.1| cell cycle protein (mesJ) [Haemophilus influenzae Rd KW20] (430 aa)
Score = 166, Expect = 5.0e-10, Identities = 56/190 (29%), Positives = 95/190 (50%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKKIAC------------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE------LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           ++  +SGG DS +LL L+ K   C             +H+++     A    K  ++ C Q ++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D   Q +    A KR    G+K  G       L+GM + RP + + + ++    ++ K+ +  DE+N    Y RN +R EI    +E    F + V
  S:    19 FLIALSGGLDSTVLLSLFAK--LCQKQPHLPPLSIRAIHIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKKY--LQTQEMLVTAHHLND---QTETFFLALKRGS--GLKGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAHFDLAV 215
>gi|34763208|ref|ZP_00144172.1| Cell cycle protein MesJ [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887118|gb|EAA24225.1| Cell cycle protein MesJ [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (446 aa)
Score = 166, Expect = 5.0e-10, Identities = 52/180 (28%), Positives = 96/180 (53%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACV------VHVNYNKR-TTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + G SGGPDS+ L+++  K    +      VH+N+  R   A  D+K   EY K+  + + +  +P   + K   K  +   R+ R++ F +     + +K+  AH++DD IE    +L  R  ++    GIK +       + RP  + +K +IL    ++K+ Y ID+TN +  + RN +R ++  + +E
  S:    24 VVGFSGGPDSVFLVEMLKKLKNFINFKIYLVHINHLLRGEDADSDEKFSIEYAKKNNLEIFIKRIPVKEISKEVGKTLEEVGREERYKFFSEIYKKVEANKIATAHNKDDQIETFLFKL-IRGTSLQGLEGIKVKNN----NIIRPISEIYKKDILEYLNKNKIQYKIDKTNFENEFTRNSIRLDLIPFIEE 210
>gi|53732991|ref|ZP_00349623.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R2846] (430 aa)
Score = 166, Expect = 5.1e-10, Identities = 51/190 (26%), Positives = 92/190 (48%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           ++  +SGG DS +LL L+ K               +H+++     A    +  ++ C Q ++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ R  L+GM + RP + + + ++    ++ K+ +  DE+N    Y RN +R EI    +E    F + V
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAIHIHHGLSPNAESWVQHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKK--HLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQRSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAHFDLAV 215
>gi|145628768|ref|ZP_01784568.1| DNA mismatch repair protein [Haemophilus influenzae 22.1-21] >gi|144979238|gb|EDJ88924.1| DNA mismatch repair protein [Haemophilus influenzae 22.1-21] (397 aa)
Score = 166, Expect = 5.5e-10, Identities = 48/175 (27%), Positives = 88/175 (50%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+ K               +H+++     A    K  ++ C Q ++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ +  L+GM ++RP + + + ++    ++ K+ +  DE+N    Y RN +R EI
  S:    19 FLVALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAIHIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKK--HLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPIFRPLLGFTRPQLEDYAQKEKLNWITDESNEDNRYDRNFLRNEI 200
>gi|168713578|ref|ZP_02745855.1| putative ATPase [Clostridium difficile QCD-63q42] (462 aa)
Score = 166, Expect = 5.8e-10, Identities = 49/180 (27%), Positives = 93/180 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + G+SGGPDS+ LL + ++      I     H+N+  R   A +D   V + C+ + +   V ++      +    + +  ARK+R+E F +     K +K+ + H+ +D  E   M++   +     G+K    +    + RP +   +NEI   CE + +   ID+TN + IY RN++R ++  + K+
  S:    23 VLGLSGGPDSVCLLHVLNRLKKDFNIEIYAAHLNHQIRGIEAQKDALYVSKLCEDMGIIFFVKSINVPKYCENEGLSLEEGARKLRYEMFYEIKDKIKANKIAIGHNLNDQAETVMMRI--MRGTGLKGLKGIDYIRDNCIIRPILDVERNEIEEYCEAYNLNPRIDKTNLENIYTRNKIRLDLLPYMKD 210
>gi|126701186|ref|YP_001090083.1| putative ATPase [Clostridium difficile 630] >gi|145952358|ref|ZP_01801368.1| hypothetical protein CdifQ_04004104 [Clostridium difficile QCD-32g58] >gi|168697423|ref|ZP_02729700.1| putative ATPase [Clostridium difficile QCD-37x79] >gi|168723564|ref|ZP_02755841.1| putative ATPase [Clostridium difficile QCD-76w55] >gi|168732016|ref|ZP_02764293.1| putative ATPase [Clostridium difficile QCD-97b34] >gi|196127358|ref|ZP_03119107.1| putative ATPase [Clostridium difficile ATCC 43255] >gi|196162195|ref|ZP_03122756.1| putative ATPase [Clostridium difficile CIP 107932] >gi|122973554|sp|Q181G3.1|TILS_CLOD6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|115252623|emb|CAJ70466.1| putative ATPase [Clostridium difficile 630] (462 aa)
Score = 166, Expect = 5.8e-10, Identities = 49/180 (27%), Positives = 93/180 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + G+SGGPDS+ LL + ++      I     H+N+  R   A +D   V + C+ + +   V ++      +    + +  ARK+R+E F +     K +K+ + H+ +D  E   M++   +     G+K    +    + RP +   +NEI   CE + +   ID+TN + IY RN++R ++  + K+
  S:    23 VLGLSGGPDSVCLLHVLNRLKKDFNIEIYAAHLNHQIRGIEAQKDALYVSKLCEDMGIIFFVKSINVPKYCENEGLSLEEGARKLRYEMFYEIKDKIKANKIAIGHNLNDQAETVMMRI--MRGTGLKGLKGIDYIRDNCIIRPILDVERNEIEEYCEAYNLNPRIDKTNLENIYTRNKIRLDLLPYMKD 210
>gi|78189702|ref|YP_380040.1| MesJ protein [Chlorobium chlorochromatii CaD3] >gi|78171901|gb|ABB28997.1| MesJ protein [Chlorobium chlorochromatii CaD3] (354 aa)
Score = 166, Expect = 6.0e-10, Identities = 50/174 (28%), Positives = 83/174 (47%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIAC---VVHVNYNKR-TTALRDQKMVEEYCKQLKVPLIVHTVPEDTV---WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGGPDSM LL L+      + C   + H N+  R + +  D+  V+E      +P  V       V   WKK+ +  AR +R+  F++   ++   K+   HH +D  E     L  R  ++  G++     +G  + RP +   K  I     E ++PY +D +N    Y RN +R  +
  S:    54 LLAVSGGPDSMALLSLFCAVQPFLQCSLALAHCNFQLRDSESDSDEAFVQEQATARNLPCFVERFETRNVAATWKKSLEESARLLRYAFFERLMQVHGFHKVATGHHVNDNAETILFNL-VRGTSL-LGLRGIRAQHG-TIIRPMLLLHKPAITTYLHEQQIPYRVDSSNEGTEYDRNFIRHRL 234
>gi|81429211|ref|YP_396212.1| ATPase [Lactobacillus sakei subsp. sakei 23K] >gi|78610854|emb|CAI55906.1| Putative ATPase of the PP-loop superfamily, cell cycle protein [Lactobacillus sakei subsp. sakei 23K] (459 aa)
Score = 166, Expect = 6.0e-10, Identities = 55/209 (26%), Positives = 100/209 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQ 215
           I   S G DSM+LL L        K    V HVN+  RT ++ ++  + ++C +  + L V   P     +   +A AR+ R++ F+   +  K D L+ AHH DD +E   M+ + + +     GI+++       + RP + + K ++      + +    D+TN +    RN+VR  +  + K+E  +        NR   Q+L +L+ +  Q
  S:    23 IVATSTGVDSMVLLTLLQRLPTALKPQLIVAHVNHELRTESVAEEAYLRQFCLENDLSLQVAHWPLQQHPQTGIEAAAREFRYQFFEHLMTAEKADYLVTAHHGDDQLETLMMKFIRSGELHEMRGIQSQRPFADGTLIRPLLPFAKQDLRDYALANNITSFEDQTNYETTVLRNRVRHTLVPFLKQENGQILQNA---NR-FSQQLTALLGQQAQ 234
>gi|189467232|ref|ZP_03016017.1| hypothetical protein BACINT_03617 [Bacteroides intestinalis DSM 17393] >gi|189435496|gb|EDV04481.1| hypothetical protein BACINT_03617 [Bacteroides intestinalis DSM 17393] (443 aa)
Score = 166, Expect = 6.1e-10, Identities = 55/171 (32%), Positives = 85/171 (49%)
  Q:     7 IAGVSGGPDSMLLLKLY-HKKIAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +  +SGG DS+ LL+L       C   H N++ R   ++RD+  V E C QL VPL V    T+ E      + +  AR++R+  F++       D + +AHH+DD +E   + L         G    G L G++     + RP +   + EI    +E    Y  D TN Q  Y RN++R
  S:    23 LVTLSGGADSVALLRLLLDMGYTCEAAHCNFHLRGDESVRDEMFVRELCLQLVVPLHVQHFQTMEEAEKRHISIEMAARELRYAWFEQLRLQQGADVIAVAHHKDDSVETLLLNL-------IRGTGING-LLGIRPKNGNIVRPLLCLDRKEITEYLQEIGQSYVTDSTNLQDEYTRNKIR 196
>gi|57168991|ref|ZP_00368120.1| conserved hypothetical protein [Campylobacter coli RM2228] >gi|57019657|gb|EAL56346.1| conserved hypothetical protein [Campylobacter coli RM2228] (321 aa)
Score = 165, Expect = 6.4e-10, Identities = 53/182 (29%), Positives = 89/182 (48%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLK-LYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           + K + +   S G DS  L   L  KKI   +V +NY  R  +  +++  +E   +    + + + P   V K NF+ +AR  R++ F+K         L+LAHH +D +E   MQL      A   G++   +     + RP +   K+EIL+  +E+ + Y  DE+N    Y RN +R+  +N
  S:    11 LKKGRNLLAFSYGSDSSALFHFLVQKKIDFDLVMINYKTRKNSDLEEQKSKELALEFHKKIFIKSAP---VIKGNFEKEARDFRYDFFEKICLEQNYSNLILAHHLNDQLEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFMSKDEILSYLKENDIFYFQDESNENEKYFRNYIRKNFSN 192
>gi|57241883|ref|ZP_00369823.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195] >gi|57017075|gb|EAL53856.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195] (322 aa)
Score = 165, Expect = 6.6e-10, Identities = 64/211 (30%), Positives = 97/211 (45%)
  Q:     1 MPKTQYIA---------GVSGGPDSMLLLKLYHKK--IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVY---------RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMK 211
           MPK  ++            S G DS  L  L  ++  I  +  +NY  R  +  +++      K+    + + T P    +K NF+  AR  R+  F+K       + L+LAH  +D  E   MQL     AM        EL GM  +         RP +   K +ILA   E+K+ Y  DE+N    +KRN +R+   ++S E    F  GV        QK FS ++
  S:     1 MPKLSFLEHLRERKNLLAFSYGSDSTALFYLLERENVIFDMALINYKTRQNSDLEEEEARLLAKRFHKQIFIQTAPR---FKGNFEKNARDFRYAFFEKICIEEGYENLILAHQLNDLFEWFLMQLSKGAGAM--------ELLGMSAFEKRENYTLIRPLLNVTKEQILAFLRENKLKYFDDESNKDLKFKRNFIRE---HFSDEFLRHFSKGV--------QKSFSFLR 209
>gi|85707586|ref|ZP_01038652.1| ATPase [Erythrobacter sp. NAP1] >gi|85689120|gb|EAQ29123.1| ATPase [Erythrobacter sp. NAP1] (292 aa)
Score = 165, Expect = 7.5e-10, Identities = 50/165 (30%), Positives = 77/165 (46%)
  Q:    17 MLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKV--YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           MLL          V+ +++  R  A R+   VE  C+ L VP     V   T+   N QA+AR+ R+    + A+  K+  +  AHH DD  E   M+L AR   +    G++    L G  V   RP + + K E+ A+     +    D +N  P + R +VRQ +A
  S:     1 MLLGAAARPGDIAVMSIDHGIRPEAAREVAFVETICQSLDVPFTSAKV---TLGAGNLQAKAREARYAALVQWAAQQKIGHVATAHHIDDQAETLLMRL-ARGSGLPGLAGVREWTHLPGSDVPLIRPLLGFRKAELEAVVASAGITPVSDPSNENPAFDRVRVRQHLA 165
>gi|148827606|ref|YP_001292359.1| cell cycle protein [Haemophilus influenzae PittGG] >gi|148718848|gb|ABQ99975.1| cell cycle protein [Haemophilus influenzae PittGG] (430 aa)
Score = 165, Expect = 7.8e-10, Identities = 48/175 (27%), Positives = 91/175 (52%)
  Q:     6 YIAGVSGGPDSMLLLKLY--------HKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+        H +I  +  +H+++     A    K  ++ C Q ++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ +  L+GM++ RP + + + ++    ++ K+ +  DE+N    + RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAKLCQKQPHLQILSLRAIHIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKK--HLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMQILRPLLGFTRPQLEDYAQKEKLNWITDESNKDNRFDRNFLRNEI 200
>gi|169825696|ref|YP_001695854.1| tRNA(Ile)-lysidine synthase [Lysinibacillus sphaericus C3-41] >gi|168990184|gb|ACA37724.1| tRNA(Ile)-lysidine synthase [Lysinibacillus sphaericus C3-41] (468 aa)
Score = 164, Expect = 8.0e-10, Identities = 57/174 (32%), Positives = 85/174 (48%)
  Q:     7 IAGVSGGPDSMLLLKLY-----HKKIAC-VVHVNYNKRTTA-LRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DSM LL  +     H  I    VHV++  R  A   D+  V++YC    V L    +   T+  K   N Q   R+ R+  F++       +KL+ AHH DD +E   M L  +A   +M  GI+ +    G  + RPF+   K EI        + Y  D +N++  Y RN+ R  +
  S:    24 LIAVSGGVDSMALLHYFVQTKEHWNIRVEAVHVDHMLRGEASAEDRAFVQKYCDDNGVYLHATAISIPTILAKENGNIQLICRRERYRYFKEVLYETNANKLVTAHHADDQLESVLMALTKNATMNSM-QGIRPQRNFEGKTLIRPFLTVTKTEIGEYLLRKGLNYREDASNSKDTYVRNRFRHHV 208
>gi|71281989|ref|YP_268314.1| tRNA(Ile)-lysidine synthetase [Colwellia psychrerythraea 34H] >gi|71147729|gb|AAZ28202.1| tRNA(Ile)-lysidine synthetase [Colwellia psychrerythraea 34H] (462 aa)
Score = 164, Expect = 8.1e-10, Identities = 56/176 (31%), Positives = 88/176 (50%)
  Q:     5 QYIAGVSGGPDSMLLL---------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM----YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + I   SGG DS +LL         K+ + +I  V HVN+     A R QK+ E+ C +L V LIV  V   +  +++ +A AR  R+   +      K   +L  HH DD   Q++  L A KR         +  + +L    + RP +   + EI    E H++ +  DE+N    + RN +RQ+I
  S:    23 ELIVAYSGGIDSQVLLHALVQLKQNKIINNEIT-VCHVNHGLSGNAERWQKLAEQECIKLSVNLIVKRVNVRSKAQQSLEALARDARYNALKSLRE--KKSVVLTGHHSDD---QSETFLLALKRGAGLKGLSAMSVQTQLDQHLLVRPLLNVARQEIENYAENHQLSWVEDESNLDTCFDRNFIRQKI 205
>gi|167761978|ref|ZP_02434105.1| hypothetical protein BACSTE_00323 [Bacteroides stercoris ATCC 43183] >gi|167700210|gb|EDS16789.1| hypothetical protein BACSTE_00323 [Bacteroides stercoris ATCC 43183] (431 aa)
Score = 164, Expect = 8.1e-10, Identities = 54/176 (30%), Positives = 87/176 (49%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKK-IAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           P  + +  +SGG DS+ LL+L       C   H N++ R   + RD+  V + C + +VPL  HTV  DT         + +  AR++R+  F++       D + +AHH+DD +E   + L         G    G L G++     + RP +   + EI++        Y  D TN Q  Y RN++R
  S:    18 PTDKVLVALSGGADSVALLRLLQASGYDCEAAHCNFHLRGAESDRDEAFVRQLCVKQQVPL--HTVHFDTARTAEERHISIEMAARELRYGWFEEIRQKINADAIAVAHHQDDSVETLLLNL-------IRGTGING-LRGIRPKNGHIVRPLLCLERKEIISYLNRIGQDYVTDSTNLQDEYTRNKIR 196
>gi|168180996|ref|ZP_02615660.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum NCTC 2916] >gi|182668056|gb|EDT80035.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum NCTC 2916] (468 aa)
Score = 164, Expect = 8.8e-10, Identities = 60/198 (30%), Positives = 101/198 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  D + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++  R   +    GI   R +LY     RP I   + +I   C+++K+   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYTNNLGFFSKTINMDKIAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-MRGTGLQGLIGINPIRDDLY----IRPLINVLREDIENYCDKYKLNPRIDKTNLQSIYTRNKIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|19705273|ref|NP_602768.1| cell cycle protein MesJ [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|61216676|sp|Q8RHN5|TILS_FUSNN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|19713236|gb|AAL94067.1| Cell cycle protein MesJ [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (448 aa)
Score = 164, Expect = 9.6e-10, Identities = 70/256 (27%), Positives = 129/256 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKR-TTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQ--------WLAHPD------VRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQP 262
           + G SGGPDS+ L+++  K       KI  +VH+N+  R   A  D+    EY K+  + + +  +P   + K   K  +   R+ R++ F +       +K+  AH++DD IE    +L  R  ++    GIK +       + RP  + +K +IL    ++++ Y ID+TN +  + RN +R  +  + +E            N     K+FSL++  ++           + D      + ++K     D++ L+  FL   +I+V  +KID I   I+ 
  S:    24 VVGFSGGPDSVFLVEMLKKLQYFFNFKI-YLVHINHLLRGEDADSDENFSFEYAKKNNLEIFIKRIPVKEIAKEVGKTLEEVGREERYKFFSEIYEKVGANKIATAHNKDDQIETFLFRL-IRGTSLQGLEGIKIKNN----NIIRPISEIYKKDILEYLNKNEIQYKIDKTNFENEFTRNSIRLNLIPFIEER----------YNIKFKDKIFSLIEEIRENNQNNSLNLSNYTDSENRIILEKIKFLSDFDKKNLLSLFLNQKNIEVNRNKIDEINSLIKS 290
>gi|83588977|ref|YP_428986.1| tRNA(Ile)-lysidine synthetase-like [Moorella thermoacetica ATCC 39073] >gi|83571891|gb|ABC18443.1| tRNA(Ile)-lysidine synthetase-like [Moorella thermoacetica ATCC 39073] (455 aa)
Score = 164, Expect = 9.7e-10, Identities = 50/180 (27%), Positives = 90/180 (50%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIAC---------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +P  + + GVSGGPDS+ LL   H  +           V H+N+  R  A  D + V +      +P+ V     D +  +     + +A AR++R+  FQ+ A+     ++ + H  +D  E   + L   + +   G+K      G ++ RP +   + EI A C ++ +    D TN  P Y+RN++R ++
  S:    16 VPGDKVVVGVSGGPDSLALL---HSLMTLQEEYGYTLQVAHLNHGLRPEAAADAEYVRDLATGWGLPVTVAQ--RDVLAYRQEHHLSIEAAAREVRYNFFQEVAAAVGATRIAVGHQAEDQAETVLLNL--LRGSGLTGLKAMLPRRG-RLIRPLLFVTRAEIEAYCRDNGLHPRRDFTNEDPAYRRNKIRHQL 201
>gi|15602154|ref|NP_245226.1| hypothetical protein PM0289 [Pasteurella multocida subsp. multocida str. Pm70] >gi|61216731|sp|Q9CNY2|TILS_PASMU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|12720522|gb|AAK02373.1| MesJ [Pasteurella multocida subsp. multocida str. Pm70] (431 aa)
Score = 164, Expect = 1.0e-09, Identities = 50/180 (27%), Positives = 89/180 (49%)
  Q:     1 MPKTQ--YIAGVSGGPDSMLLLKLYHKK-------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +P TQ  ++ G SGG DS  LL L+ K        +   +H+++     A       ++ C+Q+ +PLIV  V  D    K  +A AR+ R++  ++   L   +    AHH+ D  E   + L      A    ++ +  LY + + RP + + +  +L   ++   P+  DE+N    Y+RN +R E+
  S:    13 LPPTQHQFLIGFSGGLDSTALLLLFAKLREKQPHLMLRAIHIHHGLSANADAWVTHCQQICQQVAIPLIVEQVKIDQ--HKGIEAGAREARYQAIRQ--HLLPNEMFATAHHQQDQTETFFLALKRGSGLAGLGAMQRKSTLYCLPICRPLLTFTRQMLLDYVKQAGCPWVEDESNTDSRYERNFLRHEV 198
>gi|145636327|ref|ZP_01791996.1| putative cell cycle protein MesJ [Haemophilus influenzae PittHH] >gi|145270492|gb|EDK10426.1| putative cell cycle protein MesJ [Haemophilus influenzae PittHH] (301 aa)
Score = 163, Expect = 1.1e-09, Identities = 50/179 (27%), Positives = 93/179 (51%)
  Q:     6 YIAGVSGGPDSMLLLKLY--------HKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI-----ANWS 184
           ++  +SGG DS +LL L+        H +I  +  +H+++     A    K  +  C Q ++PLI+  V  D       +A AR+ R++  +K     +V  L+ AHH +D  E   + L         G ++ +  L+GM ++RP + + + ++    ++ K+ +  DE+N    + RN +R EI     A W+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLQILSLRAIHIHHGLSPNADSWAKHCQNLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKKHLQTQEV--LVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPIFRPLLGFTRPQLEDYAKKEKLNWITDESNEDNRFDRNFLRNEILPELRARWA 209
>gi|163755244|ref|ZP_02162364.1| tRNA(Ile)-lysidine synthetase [Kordia algicida OT-1] >gi|161324664|gb|EDP95993.1| tRNA(Ile)-lysidine synthetase [Kordia algicida OT-1] (436 aa)
Score = 163, Expect = 1.1e-09, Identities = 52/186 (27%), Positives = 95/186 (51%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIACVV--HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + +++ +  +SGG DS++L  L +K    +   H N+  R   +  D+  V+     LK  +       +T     K + Q  AR +R+E FQ+ A  ++ D +L AHH+DD +E   + L +R   +  G+    +  G  + RP + + + +ILA  + + + +  D +NA   Y RN++R +I    KE
  S:    16 LKQSKLLIAISGGLDSVVLANLLYKLDFSIAFAHCNFQLRGEESNEDEVFVKTLGNSLKAGVFTKKFNTETYANEQKLSIQMAARALRYEWFQEIADKFQYDYILTAHHQDDMLETFLINL-SRGTGI-DGLTGIPQQNG-NIVRPLLPFTQVDILAYAKNNNLLWREDSSNASTKYVRNKIRHDIVPLLKE 204
>gi|167627656|ref|YP_001678156.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189035967|sp|B0TYH9.1|TILS_FRAP2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|167597657|gb|ABZ87655.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella philomiragia subsp. philomiragia ATCC 25017] (400 aa)
Score = 163, Expect = 1.1e-09, Identities = 52/177 (29%), Positives = 88/177 (49%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK-KIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTR---GELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  I G SGG DS +LL +     I  + +++N+N    AL+ Q   +  C    +  I H++ +     ++F+A A K R + F +  S Y    LLL HH DD  E   +Q  A + +   G+ +     +L    V RP + Y K +I     ++K+ +  D++N    Y+RN +R +I
  S:    18 SHIIIGYSGGVDSSVLLDITKDLDIPTIAIYINHNIHPDALKWQLHCQTICNNANIDFIAHSLDQ-APKGESFEAWASKQRMDFFIEIMSQYSSPILLLGHHLDDQAETFLIQ--AIRGSGLAGLASMPYYKQLNHGAVLRPLLDYTKKDIQDYASQNKINHIYDDSNENIKYRRNLIRNQI 196
>gi|145220203|ref|YP_001130912.1| tRNA(Ile)-lysidine synthetase [Prosthecochloris vibrioformis DSM 265] >gi|145206367|gb|ABP37410.1| tRNA(Ile)-lysidine synthetase [Prosthecochloris vibrioformis DSM 265] (329 aa)
Score = 163, Expect = 1.1e-09, Identities = 77/286 (26%), Positives = 129/286 (45%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLY-------HKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE------------------EKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLL 286
           M     +  VSGGPDSM LL L+       H ++  V H N+  R   +L D+  V E C++L +   V     +   ++   + +  AR +R++ F +        K+   HH  D  E     L     +    GI++R   +G  + RP +   K +IL    E  + Y ID +N    + RN +R  +     E                  E EEF     AM+ +I ++    ++ A+ WL   DV  LK   + +Q++++   L  H   V    +  ++D +     +   L+    +  KD RL  L
  S:    19 MDGEPLLVAVSGGPDSMALLSLFLAVQPVLHCRLG-VAHCNFGLRGPDSLADEAFVREACRRLGLECFVARFDTELYCREHRLSIEESARTLRYDYFGRLMKSEGFTKVATGHHVADNAETILFNLFRGTSQPSLRGIRSR---HG-SIIRPMLLLHKADILGYLREKGMRYRIDRSNESDSHDRNFIRNRVIPLLLERFPDKLMPSLQRLSEQSGELEEFL--ESAMDGLIERE--PGLQPAQGWL---DVAALKTLTVFEQKEVLKRALREHGYSVDAVLLQRLVDLLTTQPGRRVMLEGGGEVVWKDRRLCFL 322
>gi|163814651|ref|ZP_02206040.1| hypothetical protein COPEUT_00802 [Coprococcus eutactus ATCC 27759] >gi|158450286|gb|EDP27281.1| hypothetical protein COPEUT_00802 [Coprococcus eutactus ATCC 27759] (497 aa)
Score = 163, Expect = 1.2e-09, Identities = 56/192 (29%), Positives = 93/192 (48%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVWK-KNFQAQ--ARKIRFEQFQKAASLYKVDKLLLA--HHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAM 198
           + GVSGG DS+ L+ +  +          VVH+N+  R  A   DQ+ VEE C++  V    + +   T+   + F  +   R  R++ F      Y+ +  ++A  H+R+D  E     + AR   M  GIK    +    + RP +   ++EI    +   +PY  D TN +  Y RN++R +I     E  E+    +C M
  S:    39 VCGVSGGADSVSLITVLVRLCGYLGIELHVVHINHMIRGAAADSDQEYVEELCRKYGVSCNSYNIDVQTMASDRGFTVEEAGRLARYDAFDTVRRQYEGEGCVIAVAHNRNDVAETVIFNM-ARGTGMG-GIKGIAPVR-ENIVRPLLGCDRSEIEGYLDRMGIPYCTDATNNEDDYTRNKIRHKILPLMVEINEQAVEHICDM 239
>gi|120602664|ref|YP_967064.1| tRNA(Ile)-lysidine synthetase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120562893|gb|ABM28637.1| tRNA(Ile)-lysidine synthetase [Desulfovibrio vulgaris subsp. vulgaris DP4] (390 aa)
Score = 163, Expect = 1.2e-09, Identities = 50/185 (27%), Positives = 83/185 (44%)
  Q:     7 IAGVSGGPDSMLLLKLYH---KKIA---CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED---TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG--ELYGM-------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  +SGG DS  LL + H   +++      +HV++  R  +  + +    +C  L +PL VHT+  D    VW+   +   RK R++    A      D +   HH  D  E   M+L          ++  G   L GM       ++ RP +   K+ + A      V +  D +NA   Y RN++R  +      E   F
  S:    66 VVALSGGADSTALLLILHYLRQRLGLSLSALHVDHGLRPESAAEARAAVTFCHALGIPLAVHTLAVDELAAVWRVGTEEAGRKARYDLLAAALPSAAADWICTGHHLGDLAEDVLMRL----------VRGCGWPALGGMRLCDPARRILRPLLLTGKDRLEAFLATLGVSWTEDPSNASDTYLRNRMRHGVIPLLTAENPGF 258
>gi|145638685|ref|ZP_01794294.1| pyridoxine kinase [Haemophilus influenzae PittII] >gi|145272280|gb|EDK12188.1| pyridoxine kinase [Haemophilus influenzae PittII] (430 aa)
Score = 163, Expect = 1.3e-09, Identities = 49/175 (28%), Positives = 88/175 (50%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+ K               +H+++     A    K  ++ C QL++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D  E   + L         G ++ +  L+GM + RP + + + ++    ++ K+ +  DE+N    Y RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSIRAIHIHHGLSQNADCWAKHCQDLCDQLQIPLIIERVQVDKT--NGIEAGAREARYQAIKKY--LQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEI 200
>gi|90426215|ref|YP_534585.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisB18] >gi|90108229|gb|ABD90266.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisB18] (346 aa)
Score = 163, Expect = 1.3e-09, Identities = 49/177 (27%), Positives = 90/177 (50%)
  Q:    10 VSGGPDSMLLL--------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           VSGGPDS+ L+         L       V+ V++  R  A R+ + V+ +  +L +P   H       W+ +       A AR+ R++   +AA       ++ AH RDD  E   M++      A    +  + E +G+ + RP ++  K +++A  ++ K+ +  D +N  P Y R ++R  IA +++E
  S:    31 VSGGPDSLALMWLAARWRKALRRGPAISVITVDHGLRPEAAREARDVKRHAAELDLP---HRT---LRWRGDKPSTGVPAAAREARYQLLARAARAAGASHVMTAHTRDDQAETLLMRMSRGSGIAGLAAMARQTERFGVIIARPLLEVSKAQLVATLDKAKIGFATDPSNTDPRYARPRLRGLIAAYAEE 215
>gi|167751544|ref|ZP_02423671.1| hypothetical protein EUBSIR_02545 [Eubacterium siraeum DSM 15702] >gi|167655352|gb|EDR99481.1| hypothetical protein EUBSIR_02545 [Eubacterium siraeum DSM 15702] (324 aa)
Score = 162, Expect = 1.4e-09, Identities = 63/215 (29%), Positives = 102/215 (47%)
  Q:     7 IAGVSGGPDSMLLL-KLYHKK-------IACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK--NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPD 221
           IA VSGG DS+ LL  LY  K        AC  HVN+N R   +  D++ V   C+ L +PL   ++  + + +K  + +  AR++R++ F+   S+ K   +  AH   D  E   + +  R  A+    GI  + +     + RP +   + +I   C E+ + Y  D TN    Y RN++R ++    KE               I   LFS + R  Q ++  D
  S:    27 IAAVSGGADSVALLYVLYSLKDELGFSLAAC--HVNHNLRGEESDSDERFVRRMCRFLDIPLYTASIKVNDLRQKHDSLEECARRLRYDFFE---SISKGRLIATAHTASDNCETILINM-VRGTALSGICGIPAKRD----NIIRPLLYNTREDIELYCSENCLDYVTDSTNLSDDYTRNKIRHKVVPLLKE---------------INPSLFSAISRLSQSVSDDD 229
>gi|161833732|ref|YP_001597928.1| putative tRNA(Ile)-lysidine synthetase [Candidatus Sulcia muelleri GWSS] >gi|152206222|gb|ABS30532.1| putative tRNA(Ile)-lysidine synthetase [Candidatus Sulcia muelleri GWSS] (436 aa)
Score = 162, Expect = 1.4e-09, Identities = 53/170 (31%), Positives = 89/170 (52%)
  Q:     8 AGVSGGPDSMLLLKLYHKKI---ACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQ--ARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL----YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
             VS G DSM+LL +  K      CV+H N+N R   + +D+  ++E+C  LK  ++  +   + + K NF  Q  ARK+R++ F+   +    D + L HH DD IE   + L         G   +G +    +  K+ RP   + K EI++  +E+ + +  D +N    Y RN++R
  S:    24 VSVSSGLDSMVLLDVLIKICNFTICVIHCNFNLRGKDSDKDELFIQEFC--LKHKILFKSKNFNPI-KSNFSIQMMARKLRYDWFKYLLNNSYCDYIALGHHLDDSIETFFINLIR-------GTGIKGLIGINNFKKKIIRPLSFFSKKEIISYAQENNIKWREDNSNYDHKYLRNRIR 193
>gi|119356415|ref|YP_911059.1| tRNA(Ile)-lysidine synthetase [Chlorobium phaeobacteroides DSM 266] >gi|119353764|gb|ABL64635.1| tRNA(Ile)-lysidine synthetase [Chlorobium phaeobacteroides DSM 266] (325 aa)
Score = 162, Expect = 1.4e-09, Identities = 55/174 (31%), Positives = 84/174 (48%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIAC---VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DSM LL L+    + + C    VH N+  R   +  D++ V+E C  L V    +TV  DT+     WK + +  AR +R+  F    S + +  +   HH +D  E   M  +  +     G++      G K+ RP +   K EIL   +E  + + ID TN      RN +R  I
  S:    25 LLAVSGGSDSMALLHLFCAIRRAVPCRISAVHCNFRLRAEESDEDERFVQEACLALGVT--CYTVGFDTLKMAGEWKTSIEETARILRYRYFDTLLSEHGMKVVATGHHVNDNAET--MLFNLFRGTSLLGLRGIRAKRG-KIIRPLLLVHKVEILGYIDEKHIAFRIDATNFGIDPDRNFIRNRI 205
>gi|88713485|ref|ZP_01107567.1| putative cell-cycle protein [Flavobacteriales bacterium HTCC2170] >gi|88707995|gb|EAR00233.1| putative cell-cycle protein [Flavobacteriales bacterium HTCC2170] (434 aa)
Score = 162, Expect = 1.4e-09, Identities = 53/184 (28%), Positives = 98/184 (53%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIA--CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +++++   SGG DS++L  L  +      + H N+  R   + +D++ V+E  + LKVP  V  +  DT+   N      Q  ARK+R+E F+     + +  L+ AHH DD IE   + L +R   +    GI ++      ++ RP + + + +I+   ++  + +  D++N +  Y RN++R EI    KE
  S:    18 QSRFLLACSGGLDSVVLAHLCSELGLDFSLAHCNFKLRDIESDKDERFVKELAEILKVPCFV--ICFDTLEYANEQGVSIQMAARKMRYEWFKSLKKQHSIKTLVTAHHADDNIETFLINL-SRGTGIKGLTGIPSKTN----EISRPLLAFSRLQIMEYAKQSNIEWREDQSNKETKYLRNKIRHEIVPRLKE 204
>gi|148825315|ref|YP_001290068.1| pyridoxine kinase [Haemophilus influenzae PittEE] >gi|148715475|gb|ABQ97685.1| pyridoxine kinase [Haemophilus influenzae PittEE] (430 aa)
Score = 162, Expect = 1.4e-09, Identities = 46/175 (26%), Positives = 87/175 (49%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+ K               +H+++     A    K  ++ C Q ++PLI+  V  D       +A AR+ R++  +K     ++  L+ AHH +D  E   + L         G ++ +  L+GM + RP + + + ++    ++ K+ +  DE+N    + RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAIHIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKKHLQTQEI--LVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNGDNRFDRNFLRNEI 200
>gi|160902337|ref|YP_001567918.1| tRNA(Ile)-lysidine synthetase [Petrotoga mobilis SJ95] >gi|189035968|sp|A9BJK2.1|TILS_PETMO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|160359981|gb|ABX31595.1| tRNA(Ile)-lysidine synthetase [Petrotoga mobilis SJ95] (311 aa)
Score = 162, Expect = 1.7e-09, Identities = 56/175 (32%), Positives = 81/175 (46%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKI------ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM--------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           + GVSGG DSM LL +  K          V H+N+  R  A  D+  V + C +LK+P     V   T  KKN    +   RK+R+E F +       +K+  AHH DD  E            M Y I     +YG+        ++ +P +     EI      + + Y  D+ N    Y RN++R EI 
  S:    27 LLGVSGGKDSMSLLHVMSKLSKTMGFEISVAHLNHCMREEADNDEAFVRQACWKLKIPFFSKKVDVFTYSKKNKVGVEVAGRKLRYEFFYETLRRLSYNKIATAHHMDDLFE-----------TMIYRILRGTGIYGLGGLIPIEEEITKPMLCVDLEEIKNYVTINNIEYVEDKYNYSLDYARNKIRYEIT 207
>gi|34541632|ref|NP_906111.1| hypothetical protein PG2046 [Porphyromonas gingivalis W83] >gi|61216584|sp|Q7MTC4|TILS_PORGI tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|34397950|gb|AAQ67010.1| conserved hypothetical protein [Porphyromonas gingivalis W83] (454 aa)
Score = 162, Expect = 1.7e-09, Identities = 57/180 (31%), Positives = 89/180 (49%)
  Q:     7 IAGVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +SGG DS+ LL    +L ++ +A   H N++ R   +  D   VE  C+ L VPL  H +  DTV        + +  AR++R+E F +      ++ + +AHH DD  E   + L         G    G L GM       + RP +   ++EI A   + K+ Y  D +N    ++RN VR  I    KE
  S:    27 LVALSGGADSVALLCVLRELGYETVA--AHCNFHLRGVESDEDAAFVERLCRDLDVPL--HRIDFDTVRYARERSISIEMAARELRYEWFGQLRKELAIEYVAVAHHADDNAETMVLNL-------CRGTGISG-LCGMPYKRNDGIVRPLLDATRDEIEAYLLDQKITYRTDSSNEDTRFRRNLVRHRIMPLLKE 210
>gi|116626117|ref|YP_828273.1| tRNA(Ile)-lysidine synthetase [Solibacter usitatus Ellin6076] >gi|122251826|sp|Q01QT2.1|TILS_SOLUE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|116229279|gb|ABJ87988.1| tRNA(Ile)-lysidine synthetase [Solibacter usitatus Ellin6076] (440 aa)
Score = 161, Expect = 1.8e-09, Identities = 50/172 (29%), Positives = 83/172 (48%)
  Q:     9 GVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           GVSGG DS+ LL    +L   K++ V+HV++  R    R D + V E   ++ +P  +  V   T+   N + + R+ R   F +  +    D++ L H R D  E    + L     A   GI+    +    + RP I+  + EI     E ++P+  D TNA   + RN++R  +
  S:    11 GVSGGADSVCLLHALVELGGLKLS-VLHVDHGLRGAESRADAEFVGELAARMGLPFCLREV---TLGPGNVEQEGRRARLRFFHEQLAAGNCDRVALGHTRSDQAETVLFRFLRGSGTAGLAGIRP---VTAEGIVRPLIELERAEIEEYLRERQIPWREDATNAGEEFARNRIRHGL 181
>gi|15966489|ref|NP_386842.1| hypothetical protein SMc02940 [Sinorhizobium meliloti 1021] >gi|61216708|sp|Q92JY3|TILS_RHIME tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15075760|emb|CAC47315.1| Hypothetical protein [Sinorhizobium meliloti 1021] (453 aa)
Score = 161, Expect = 1.9e-09, Identities = 55/173 (31%), Positives = 81/173 (46%)
  Q:    10 VSGGPDSMLLLKLYHKKIAC---------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP--EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRA----------MYYGIKTRGELYGMKVY--RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           VSGG DSM LL   H  IA             V++  R  +  + + V  +C  L    I H +   E        QA AR  R+E   +AA     D + + H RDD  E   M++ AR +                     LYG +++  RPF+   + EI +  +   V +  D +NA P ++R +VR  IA 
  S:    26 VSGGSDSMGLLVALHSAIAADERRGFSLAACTVDHALRPQSACEAEDVAAFCAALG---IAHRICRWEGAKPSTGIQAAARNKRYELLAEAADALGADCIAIGHTRDDQQETVAMRI-ARGKGDGAGDGQGEGHGGAGMAASMLYGRRIWVLRPFLGLARAEIRSFLQARGVSWIDDPSNANPAFERVRVRARIAT 217
>gi|146338275|ref|YP_001203323.1| tRNA(Ile)-lysidine synthase [Bradyrhizobium sp. ORS278] >gi|146191081|emb|CAL75086.1| tRNA(Ile)-lysidine synthase [Bradyrhizobium sp. ORS278] (367 aa)
Score = 161, Expect = 1.9e-09, Identities = 53/188 (28%), Positives = 89/188 (47%)
  Q:    10 VSGGPDSMLLLKL---YHKKIA-----CVVHVNYNKRTTALRDQKMVEEYCKQLKVP--LIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCA 197
           VSGGPDSM LL L   + + +A       + V++  R  A R+  MV+ + +QL+V   ++  T P+ T         AR  R+    +AA       +L AH RDD  E   M+L   + +   G+     +    G+ + RP ++  K  ++A      + +  D TN  P Y R ++R  +   + E  +   +   A
  S:    40 VSGGPDSMALLWLAARWRQALADGPRLVAITVDHGLRPEARREAAMVKRFARQLEVSHRMLRWTEPKPTT---GIPEAARLARYRLLARAARQAGASHVLTAHTRDDQAETVLMRL--LRGSGIVGLAAMAPVSARDGLLLARPLLEISKARLVATLRSAGIEFADDPTNHDPAYTRPRLRALMPALAAEGGDSRTLATLA 235
>gi|61216557|sp|Q72C25|TILS_DESVH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (347 aa)
Score = 161, Expect = 2.0e-09, Identities = 50/185 (27%), Positives = 83/185 (44%)
  Q:     7 IAGVSGGPDSMLLLKLYH---KKIA---CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED---TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG--ELYGM-------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  +SGG DS  LL + H   +++      +HV++  R  +  + +    +C  L +PL VHT+  D    VW+   +   RK R++    A      D +   HH  D  E   M+L          ++  G   L GM       ++ RP +   K+ + A      V +  D +NA   Y RN++R  +      E   F
  S:    23 VVALSGGADSTALLLILHYLRQRLGLSLSALHVDHGLRPESAAEARAAVTFCHALGIPLAVHTLTVDELAAVWRVGTEEAGRKARYDLLAAALPSPAADWICTGHHLGDLAEDVLMRL----------VRGCGWPALGGMRLCDPARRILRPLLLTEKDRLEAFLATLGVSWTEDPSNASDTYLRNRMRHGVIPLLTAENPGF 215
>gi|15612646|ref|NP_240949.1| cell-cycle protein [Bacillus halodurans C-125] >gi|61216744|sp|Q9KGH8|TILS_BACHD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|10172695|dbj|BAB03802.1| cell-cycle protein [Bacillus halodurans C-125] (462 aa)
Score = 161, Expect = 2.0e-09, Identities = 51/187 (27%), Positives = 85/187 (45%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIACVV---HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP---EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKM-QLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYI 193
           I  VSGGPDSM LL     + +++   V   H N+  R  A  ++  V ++C    +      +P      +  +  Q  AR++R++  +  A  +    +   HH DD IE   M Q+         GI  R E+  + + RPF+   K +I   C+E  +    D +N    Y RN+ R  I  + + E    ++
  S:    22 IVAVSGGPDSMALLHFLFSHREQLGITVMAAHGNHQLRQEADEEETFVHQFCLSHGILFTSARLPVKERMEMSGEGVQVTARELRYKWLEAEAKKHGAAFIATGHHGDDQIETILMKQVRGTFPLSRGGIPVRREVGDVLIVRPFLGITKGQIEHYCKEVNIEPKRDPSNNASSYTRNRFRHTIIPFIRGENPNAHL 218
>gi|172087739|ref|YP_205328.2| tRNA(Ile)-lysidine synthetase [Vibrio fischeri ES114] >gi|171902329|gb|AAW86440.2| tRNA(Ile)-lysidine synthetase [Vibrio fischeri ES114] (456 aa)
Score = 161, Expect = 2.1e-09, Identities = 53/179 (29%), Positives = 93/179 (51%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLY-----HKKIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRF---EQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV---YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           K   I  +SGG DSM+LL+L       K++ C+ VHVN+     A   +     YCK+L +PL +  V      +++ +  ARK R+   E++ ++ SL     LL   H+DD +E   + L  ++ +   G+ +   +  +K     RP +   +  I    ++H++ +  DE+N    + RN +R EI 
  S:    31 KPHLIVALSGGVDSMVLLRLAGMYAKEKQLECMAVHVNHGLSLHANDWEVSCASYCKELDIPLYIERVNLKVSPQESLEEVARKARYHALEKYMQSNSL-----LLTGQHQDDQVETFFLAL--KRGSGPAGLSSMPSIIPLKTGYKCRPLLFTSRQHITEYAQQHQLTWVEDESNQDTRFDRNFLRHEIT 214
>gi|116253706|ref|YP_769544.1| putative tRNA(Ile)-lysidine synthase [Rhizobium leguminosarum bv. viciae 3841] >gi|115258354|emb|CAK09456.1| putative tRNA(Ile)-lysidine synthase [Rhizobium leguminosarum bv. viciae 3841] (485 aa)
Score = 161, Expect = 2.2e-09, Identities = 60/211 (28%), Positives = 102/211 (48%)
  Q:     7 IAGVSGGPDSMLLLKLY--------HKKIA-CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK--VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWL 217
           +A +SGG DS  LL L         H KI+ C   V++  R  +  + + V   C  L +P   HT     +W     K    A AR+ R+   + AA  ++ D ++  H  DD  E  +M+   R   +  GI     L+  +  + RP +   + +I A  +E  VP+  D +N    Y+R ++R+++++ +  EK+   IG     R+      +L  R  +WL
  S:    26 LAAISGGSDSTGLLLLLDEAVKAAPHLKISLCAATVDHALRAGSADEARDVAALCASLGIP---HTT---MIWEGDKPKTGIMAAAREARYGLLETAAESFEADLIVTGHTFDDQRETLQMR-GMRTEQISTGIAD-AVLFNRRFWILRPLLFSSRADIRAFLKERGVPWIDDPSNEDIKYERVRMRRQLSDDAGMEKD---IGAAWEERL------ALSSRGAEWL 235
>gi|168334111|ref|ZP_02692324.1| tRNA(Ile)-lysidine synthetase [Epulopiscium sp. 'N.t. morphotype B'] (450 aa)
Score = 161, Expect = 2.2e-09, Identities = 54/173 (31%), Positives = 84/173 (48%)
  Q:     5 QYIAGVSGGPDSMLLLK-LYHKK----IAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + +  VSGG DSM+LL  LY  K    I+  + HVN+  R  A +D + V+ Y K+ ++   V     + +  K   + +A  RK+R+E F+         K+  AH  +D  E   M+ L         GI  + E     + RP +   + E+   C  H + Y  D TN   IY RN++R
  S:    25 EIVVAVSGGADSMMLLDYLYRNKNFLYISIRIAHVNHKMRVDAEKDMEFVKNYAKEREIICDVLECDIEALAAKTKMSSEAAGRKVRYEFFESLPH----TKIATAHTANDQAETVLMRFLRGSDVKGLSGINAKRE----NIIRPILCITREEVEFYCNHHGIEYKTDHTNFLEIYTRNKIR 199
>gi|168183607|ref|ZP_02618271.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum Bf] >gi|182673269|gb|EDT85230.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum Bf] (468 aa)
Score = 161, Expect = 2.2e-09, Identities = 59/198 (29%), Positives = 100/198 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  D + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++  R   +    GI   R +LY     RP I   + +I   C+ +++   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKDQLRIKDIYVAHINHGVRGAESNADEKYVENFCYTNNLGFFSKTINMDKIAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-MRGTGLQGLIGINPIRDDLY----IRPLINVLREDIENYCDRYELNPRIDKTNLQSIYTRNKIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|46579870|ref|YP_010678.1| hypothetical protein DVU1459 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46449286|gb|AAS95937.1| conserved domain protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (390 aa)
Score = 161, Expect = 2.2e-09, Identities = 50/185 (27%), Positives = 83/185 (44%)
  Q:     7 IAGVSGGPDSMLLLKLYH---KKIA---CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPED---TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG--ELYGM-------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  +SGG DS  LL + H   +++      +HV++  R  +  + +    +C  L +PL VHT+  D    VW+   +   RK R++    A      D +   HH  D  E   M+L          ++  G   L GM       ++ RP +   K+ + A      V +  D +NA   Y RN++R  +      E   F
  S:    66 VVALSGGADSTALLLILHYLRQRLGLSLSALHVDHGLRPESAAEARAAVTFCHALGIPLAVHTLTVDELAAVWRVGTEEAGRKARYDLLAAALPSPAADWICTGHHLGDLAEDVLMRL----------VRGCGWPALGGMRLCDPARRILRPLLLTEKDRLEAFLATLGVSWTEDPSNASDTYLRNRMRHGVIPLLTAENPGF 258
>gi|90962327|ref|YP_536243.1| tRNA(Ile)-lysidine synthase TilS [Lactobacillus salivarius UCC118] >gi|90821521|gb|ABE00160.1| tRNA(Ile)-lysidine synthase TilS [Lactobacillus salivarius UCC118] (452 aa)
Score = 161, Expect = 2.3e-09, Identities = 56/207 (27%), Positives = 104/207 (50%)
  Q:     7 IAGVSGGPDSMLLLK--LYHKKI----ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRA 213
           +  VS G DSM+LL   L   K+      + ++++  R  +  + K ++E+C    +PL V+   ++    ++ +A AR++R+  F+K      ++ L+ AHH DD  E   M+L    + ++      ++   E Y  ++ RP + + K EI    ++  + Y  DETN    Y+RN++R  I    K E  EF   V    + +   L ++ + A
  S:    27 LLAVSTGVDSMVLLSGMLKLSKVLDVEINIAYIDHQLREQSKEETKFIKEFCFARNIPLYVYRWEKEEHPVQSIEAAAREVRYNFFEKVLKENNIEYLVTAHHGDDQAETFLMKLIRGGNIQQLQAIQSVRIFREDY--QIVRPMLIFNKKEIYDYAKQLGIKYYEDETNKSDDYQRNRLRHHIIPVLKAENPEFLKHVLGYTQQLTNNLQAIQEVA 241
>gi|160892659|ref|ZP_02073449.1| hypothetical protein CLOL250_00189 [Clostridium sp. L2-50] >gi|156865700|gb|EDO59131.1| hypothetical protein CLOL250_00189 [Clostridium sp. L2-50] (251 aa)
Score = 160, Expect = 2.3e-09, Identities = 58/178 (32%), Positives = 89/178 (50%)
  Q:     9 GVSGGPDSMLLL-------KLYHKK---IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVW----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           G+SGG DS+ LL       + Y KK   IA  V++ ++   TA      +E+ CK+L VP  IV T   D V+    +KN  +   K+R     +  +    +K+  AHH+DDFIE   M L    R   +  KT  +   + V RP +   + EI++   + ++P       A    KR   +Q +A   KE
  S:    29 GISGGKDSLTLLYALAELRRFYPKKFDLIAITVNLGFDNFDTA-----KIEQLCKELDVPYYIVDTEIYDIVFNVRKEKNPCSLCAKMRKGALNQKLNDLGCNKIAYAHHKDDFIETFLMSLLYEGRIHTFSPKTYLDKSELMVIRPLMYINEGEIISFKNDMQLPVIKSPCPADGYTKREYAKQTLAKLEKE 216
>gi|19699031|gb|AAL91135.1| MG083-like protein [Mycoplasma gallisepticum] (57 aa)
Score = 160, Expect = 2.3e-09, Identities = 30/50 (60%), Positives = 36/50 (72%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYC 52
           K QY+ GVSGGPDS+ LL  Y  +I    H+NYNKR TALRDQ +V +YC
  S:     6 KKQYLIGVSGGPDSIYLLDRYQDQIKVACHINYNKRPTALRDQLIVSDYC 55
>gi|194467678|ref|ZP_03073665.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri 100-23] >gi|194454714|gb|EDX43611.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri 100-23] (464 aa)
Score = 160, Expect = 2.4e-09, Identities = 45/174 (25%), Positives = 86/174 (49%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VS G DSM+LL L       ++    V H+N+  R  +  +++ + +YCK+  + L V   P+D   +   +  AR+ R+  F++     +   L+ AHH++D  E   M++    + +   GI+ R       + RP + + K ++     +H + +  D+TN     +RN+ R  I
  S:    25 VVAVSTGVDSMVLLDLLQHLPSKNRPQIIVAHMNHQLRKQSQLEERFIRQYCKRNDLKLAVAHWPQDLHPQTGVENAARQARYHFFREVMKDNQARILITAHHQNDLAETMLMKMTRGGQLSQLVGIRDRRPFASGTLIRPLLPFSKQQLKKYALQHHLKWYEDKTNKDLNIQRNRFRHAI 205
>gi|20808759|ref|NP_623930.1| ATPase [Thermoanaerobacter tengcongensis MB4] >gi|61217386|sp|Q8R7K9|TILS_THETN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|20517403|gb|AAM25534.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Thermoanaerobacter tengcongensis MB4] (467 aa)
Score = 160, Expect = 2.4e-09, Identities = 54/180 (30%), Positives = 97/180 (53%)
  Q:     7 IAGVSGGPDSMLLLK-LYHKKIAC-----VVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + G+SGGPDS+ +L  L++ K        VVHVN+  R   A +D + VE+ CK L +P  +       + KK   + +   R +R++ F++       +K+ +AH+++D  E   + +         G   RG L G+K     + RP I+  + EI    ++  +   ID TN + +Y RN++R ++  + +E
  S:    31 VMGISGGPDSLCMLDVLFNLKGKFNLKLYVVHVNHMIRGEDAKKDAEFVEKLCKDLDLPFFLFEENIPYLAKKMGLSEEQAGRYVRYKAFEETLKRVGGNKIAVAHNKNDVAETVLLNI-------LRGTGLRG-LIGIKPVNGNIIRPLIEIERREIEKYLKDKNLHPRIDHTNYEDLYTRNKIRLKVIPYIEE 217
>gi|196165461|ref|ZP_03125992.1| putative ATPase [Clostridium difficile QCD-23m63] (462 aa)
Score = 160, Expect = 2.5e-09, Identities = 48/180 (26%), Positives = 93/180 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           + G+SGGPDS+ LL + ++      I     H+N+  R   A +D   V + C+ + +   V ++      +    + +  ARK+R+E F +     K +K+ + H+ +D  E   M++   +     G+K    +    + RP +   ++EI   CE + +   ID+TN + IY RN++R ++  + K+
  S:    23 VLGLSGGPDSVCLLHVLNRLKKDFNIEIYAAHLNHQIRGIEAQKDALYVSKLCEDMGIIFFVKSINVPKYCENEGLSLEEGARKLRYEMFYEIKDKIKANKIAIGHNLNDQAETVMMRI--MRGTGLKGLKGIDYIRDNCIIRPILDVERSEIEEYCEAYNLNPRIDKTNLENIYTRNKIRLDLLPYMKD 210
>gi|148381467|ref|YP_001256008.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153932046|ref|YP_001385842.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153936096|ref|YP_001389249.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. Hall] >gi|148290951|emb|CAL85087.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC 3502] >gi|152928090|gb|ABS33590.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152932010|gb|ABS37509.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. Hall] (468 aa)
Score = 160, Expect = 2.5e-09, Identities = 59/198 (29%), Positives = 101/198 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  D + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++  R   +    GI   R +LY     RP I   + +I   C+++++   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYTNNLGFFSKTINMDKIAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-MRGTGLQGLIGINPIRDDLY----IRPLINVLREDIENYCDKYELNPRIDKTNLQSIYTRNRIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|170757599|ref|YP_001783167.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum B1 str. Okra] >gi|169122811|gb|ACA46647.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum B1 str. Okra] (468 aa)
Score = 160, Expect = 2.5e-09, Identities = 59/198 (29%), Positives = 101/198 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  D + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++  R   +    GI   R +LY     RP I   + +I   C+++++   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYTNNLGFFSKTINMDKIAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-MRGTGLQGLIGINPIRDDLY----IRPLINVLREDIENYCDKYELNPRIDKTNLQSIYTRNKIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|153939118|ref|YP_001392881.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum F str. Langeland] >gi|152935014|gb|ABS40512.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum F str. Langeland] (468 aa)
Score = 160, Expect = 2.7e-09, Identities = 59/198 (29%), Positives = 101/198 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  D + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++  R   +    GI   R +LY     RP I   + +I   C+++++   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYMNNLGFFSKTINMDKIAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-MRGTGLQGLIGINPIRDDLY----IRPLINVLREDIENYCDKYELNPRIDKTNLQSIYTRNRIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|145632651|ref|ZP_01788385.1| DNA mismatch repair protein [Haemophilus influenzae 3655] >gi|144986846|gb|EDJ93398.1| DNA mismatch repair protein [Haemophilus influenzae 3655] (430 aa)
Score = 160, Expect = 2.7e-09, Identities = 51/175 (29%), Positives = 90/175 (51%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK----------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE------LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++  +SGG DS +LL L+ K               +H+++     A    K  ++ C Q ++PLI+  V  D       +A AR+ R++  +K   L   + L+ AHH +D   Q +    A KR    G+K  G       L+GM ++RP + + + ++    ++ K+ +  DE+N    + RN +R EI
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKRPHLPPLSVRAIHIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT--NGIEAGAREARYQAIKK--HLQTQEMLVTAHHLND---QTETFFLALKRGS--GLKGLGAMQQQSVLFGMPIFRPLLGFTRPQLEDYAKKEKLNWITDESNEDNRFDRNFLRNEI 200
>gi|153808575|ref|ZP_01961243.1| hypothetical protein BACCAC_02871 [Bacteroides caccae ATCC 43185] >gi|149128897|gb|EDM20114.1| hypothetical protein BACCAC_02871 [Bacteroides caccae ATCC 43185] (426 aa)
Score = 160, Expect = 2.8e-09, Identities = 50/174 (28%), Positives = 88/174 (50%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKK-IAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           ++ +  +SGG DS+ LL++ H     C   H N++ R   + RD+  V + C  LK  + +HT   +T         + +  AR++R+  F++  + Y+ D + +AHH+DD IE   + L          GI+ R       + RP +   + EI+   +  +  Y  D TN +  Y RN++R
  S:    20 SKILVALSGGADSVALLRILHTAGYHCEAAHCNFHLRGEESNRDESFVRQLC--LKYNIRLHTTDFNTTQYAAEKHISIEMAARELRYNWFEEIKNKYRADVIAVAHHQDDSIETMLLNLIRGTGITGLLGIRPR----NGAIVRPLLCVNRKEIIQYLQNIEQDYVTDSTNLEDEYTRNKIR 196
>gi|118443998|ref|YP_877128.1| cell cycle protein MesJ, putative [Clostridium novyi NT] >gi|118134454|gb|ABK61498.1| Cell cycle protein MesJ, putative [Clostridium novyi NT] (464 aa)
Score = 160, Expect = 2.8e-09, Identities = 52/176 (29%), Positives = 95/176 (53%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHK-----KIACVV-HVNYNKRTTALRDQKM-VEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +  +SGGPDS+ LL + H       I+ V  HVN+  R  A  + +M V++ C++L +   V       + K+   + +   R++R++ F++       +K+ +AH+ +D  E   M+ L         GI+  R  ++     RP I   ++EI   C+ +K+   ID+TN + IY RN++R E+
  S:    20 KVVVALSGGPDSICLLHILHTLKDEINISIVAAHVNHCLRGEAADNDEMYVKKICEELGIQCFVKREDVHRISKERGISCEMAGREVRYQFFEEVLHKINGNKIAIAHNANDQAETVLMRILRGTGLEGLVGIRPVRDNIF----VRPIINLTRDEIENYCDINKLNPRIDKTNFENIYTRNKIRLEL 203
>gi|166154184|ref|YP_001654302.1| tRNA(Ile)-lysidine synthase [Chlamydia trachomatis 434/Bu] >gi|166155059|ref|YP_001653314.1| tRNA(Ile)-lysidine synthase [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930172|emb|CAP03656.1| tRNA(Ile)-lysidine synthase [Chlamydia trachomatis 434/Bu] >gi|165931047|emb|CAP06610.1| tRNA(Ile)-lysidine synthase [Chlamydia trachomatis L2b/UCH-1/proctitis] (321 aa)
Score = 159, Expect = 3.1e-09, Identities = 47/178 (26%), Positives = 86/178 (48%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKK--IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE--DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K +Y+  +SGG DS+ L+ L   +      VHV+Y  R T+ ++   +   C+Q ++P I+   PE  D +  ++ +  AR+ R+E F +         + L HH DD  E   K   +        G+  +     + + RP +   K++I+   + H+V Y  D TN    + R ++R+ +
  S:    22 KKKYLLALSGGSDSLFLMYLLKSRAIFFTAVHVDYGWRETSYQEASDLAALCEQEQIPFILDR-PEATDPMDSRDIENAARRYRYELFYRLCKEKCFSGVFLGHHADDQAETILKRVFEGAHLGNLKGMSAQVMYRDVALLRPLLHIPKHKIVEALDSHQVQYVQDITNCNERFLRARMRERL 203
>gi|76789585|ref|YP_328671.1| TilS [Chlamydia trachomatis A/HAR-13] >gi|76168115|gb|AAX51123.1| TilS [Chlamydia trachomatis A/HAR-13] (321 aa)
Score = 159, Expect = 3.3e-09, Identities = 47/178 (26%), Positives = 86/178 (48%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKK--IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE--DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K +Y+  +SGG DS+ L+ L   +      VHV+Y  R T+ ++   +   C+Q ++P I+   PE  D +  ++ +  AR+ R+E F +         + L HH DD  E   K   +        G+  +     + + RP +   K++I+   + H+V Y  D TN    + R ++R+ +
  S:    22 KKKYLLALSGGSDSLFLMYLLKSRAIFFTAVHVDYGWRETSYQEASDLAALCEQEQIPFILDR-PEATDPMDSRDIENAARRYRYELFYRLCKEKCFSGVFLGHHADDQAETILKRVFEGAHLGNLKGMSAQVMYRDVALLRPLLHIPKHKIVEALDSHQVQYVQDITNCNERFLRARMRERL 203
>gi|126667577|ref|ZP_01738547.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Marinobacter sp. ELB17] >gi|126628003|gb|EAZ98630.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Marinobacter sp. ELB17] (212 aa)
Score = 159, Expect = 3.4e-09, Identities = 53/170 (31%), Positives = 81/170 (47%)
  Q:    11 SGGPDSMLLLKLYHK----KIA-CVVHVNYNKRTTALRDQKMVEEYCKQLKVPL--IVHTVPEDTVWKKNFQAQARKIR---FEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           SGG DS LLL L+       IA   +H+N+  +  A        + C +L VPL  +  TVP         +  AR  R   FEQ+ +A  L     LLLAHH DD +E    +L      A   G+     L    + RP +++ + ++ A  E   +P+  D +N+   + RN +R  +
  S:    34 SGGLDSSLLLHLFAAITPASIALSALHINHQLQPNAAEVDAFCRDVCARLSVPLRVVSVTVPVKAEGVGGLEQAARAARYGVFEQYLRADEL-----LLLAHHGDDQLETVLFRLFRGSGVAGLAGMPFTRALCARALARPLLEFSRAQLEAWAEGAGLPWMEDPSNSDQRFDRNYLRNSV 209
>gi|126663890|ref|ZP_01734885.1| tRNA(Ile)-lysidine synthetase [Flavobacteria bacterium BAL38] >gi|126624154|gb|EAZ94847.1| tRNA(Ile)-lysidine synthetase [Flavobacteria bacterium BAL38] (219 aa)
Score = 159, Expect = 3.4e-09, Identities = 55/186 (29%), Positives = 97/186 (52%)
  Q:     6 YIAGVSGGPDSMLLLKLY-HKKIA-CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTV---WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           YIA VSGG DSM+LL L+ H + +  V+H N+  R   +  D + + +YC++  + L +     + +    K++ Q  ARK+R+  F +      V  +  AHH DD +E   + L +R   +  G+    E+   ++ RP + + + EI    + + + +  D +NA   Y RN++R ++    KE   EF
  S:    22 YIA-VSGGIDSMVLLHLFQHFQFSFGVLHCNFKLRGEESDADMRFIHDYCEENNIQLRIGFFETEMIAKELKESIQVTARKLRYNWFYEQMEENDVQFVATAHHLDDSLETFLINL-SRGTGID-GLTGIPEIND-QIIRPLLPFSREEIEQYAKVNNIQWREDASNATTKYLRNKLRHDVVPILKEINPEF 209
>gi|170760449|ref|YP_001788867.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A3 str. Loch Maree] >gi|169407438|gb|ACA55849.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A3 str. Loch Maree] (468 aa)
Score = 159, Expect = 3.5e-09, Identities = 59/198 (29%), Positives = 101/198 (51%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  D + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++  R   +    GI   R +LY     RP I   + +I   C+++++   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYTNNLGFFSKTINMDKIAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-MRGTGLQGLIGINPIRDDLY----IRPLINVLREDIENYCDKYELNPRIDKTNLQNIYTRNKIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|15834848|ref|NP_296607.1| MesJ/Ycf62 family protein [Chlamydia muridarum Nigg] >gi|61216745|sp|Q9PL79|TILS_CHLMU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|7190268|gb|AAF39100.1| MesJ/Ycf62 family protein [Chlamydia muridarum Nigg] (321 aa)
Score = 159, Expect = 3.5e-09, Identities = 49/184 (26%), Positives = 89/184 (48%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKK--IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVH----TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           K +Y+  +SGG DS+LL+ L   +      VHV+Y  R T+ ++   +   C++ ++P I+       P D    +N    AR+ R+E F +         + L HH DD  E   K   +        G+   G   G+ + RP +   K +I+   + +++ Y  D TNA   + R ++R+++  + +E
  S:    22 KKKYLLALSGGSDSLLLMYLLRSRGISFTAVHVDYGWRETSYQEACDLASLCEREQIPFILDRQEVANPMDFSDIENI---ARQYRYELFYRLCKERLFAGVFLGHHADDQAETILKRVFEGAHLGNLKGMARYGTYKGITLLRPLLHITKRQIVEALDNYRIEYVQDATNADERFLRARMREQLFPYLQE 209
>gi|15605575|ref|NP_220361.1| PP-loop superfamily ATPase [Chlamydia trachomatis D/UW-3/CX] >gi|61216368|sp|O84847|TILS_CHLTR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3329312|gb|AAC68437.1| PP-loop superfamily ATPase [Chlamydia trachomatis D/UW-3/CX] (321 aa)
Score = 159, Expect = 3.6e-09, Identities = 47/178 (26%), Positives = 86/178 (48%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKK--IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE--DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA-KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K +Y+  +SGG DS+ L+ L   +      VHV+Y  R T+ ++   +   C+Q ++P I+   PE  D +  ++ +  AR+ R+E F +         + L HH DD  E   K   +        G+  +     + + RP +   K++I+   + H+V Y  D TN    + R ++R+ +
  S:    22 KKKYLLALSGGSDSLFLMYLLKSRAIFFTAVHVDYGWRETSYQEASDLAALCEQEQIPFILDR-PEATDPMDSRDIENAARRYRYELFYRLCKEKCFSGVFLGHHADDQAETILKRVFEGAHLGNLKGMSAQVMYRDVALLRPLLHIPKHKIVEALDSHQVQYVQDITNCNERFLRARMRERL 203
>gi|163728640|ref|ZP_02136123.1| cell cycle protein MesJ [Vibrio fischeri MJ11] >gi|161398119|gb|EDQ22405.1| cell cycle protein MesJ [Vibrio fischeri MJ11] (456 aa)
Score = 158, Expect = 4.1e-09, Identities = 53/179 (29%), Positives = 92/179 (51%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLY-----HKKIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRF---EQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV---YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           K   I  +SGG DSM+LL+L       K++ C+ VHVN+     A   +     YC++L +PL +  V      +++ +  ARK R+   E+  +A SL     LL   H+DD +E   + L  ++ +   G+ +   +  +K     RP +   +  I    ++H++ +  DE+N    + RN +R EI 
  S:    31 KPHLIVALSGGVDSMVLLRLAGMYAKEKQLECMAVHVNHGLSKHASDWEVSCASYCEELDIPLYIERVNLKVSPQESLEEVARKARYHVLEKHMRANSL-----LLTGQHQDDQVETFFLAL--KRGSGPAGLSSMPSIIPLKTGYKCRPLLFTSRQHITEYAQQHQLTWVEDESNQDTRFDRNFLRHEIT 214
>gi|114706794|ref|ZP_01439694.1| PP-loop family protein [Fulvimarina pelagi HTCC2506] >gi|114537742|gb|EAU40866.1| PP-loop family protein [Fulvimarina pelagi HTCC2506] (458 aa)
Score = 158, Expect = 4.1e-09, Identities = 60/185 (32%), Positives = 88/185 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK--KIACVVH---VNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRA-MYYGIKTRGELYG-MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           P+   IA VSGGPDS+ LL L  +   +   VH   VN+  R  A  +   V E  ++L VP   H   E   W+      N QA AR+ R+    + A       +L AHHR D IE     L+   R     G++   +L   + + RPF++    ++ A+  E  +    D +NA   + R + R  IA  S E
  S:    37 PQRLLIA-VSGGPDSLALLVLASRLPNLVFAVHAATVNHGLRREADMEAAHVAEVSQRLGVP---H---ETLTWEGWDGSGNLQAAAREARYRLLAEEARRIGASAILTAHHRGDQIETVLQALERGDRENRLAGMRASRDLEPRLTLVRPFLEIPAEQLWAVLAEAGIASVDDPSNADRRFTRVRHRHAIAGMSDE 226
>gi|50086047|ref|YP_047557.1| cell cycle protein [Acinetobacter sp. ADP1] >gi|61216503|sp|Q6F880|TILS_ACIAD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|49532023|emb|CAG69735.1| tRNA(Ile)-lysidine synthetase [Acinetobacter sp. ADP1] (459 aa)
Score = 158, Expect = 4.3e-09, Identities = 52/177 (29%), Positives = 90/177 (50%)
  Q:     4 TQYIAGVSGGPDSMLLLKLY-----HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           T ++ G SGG DSMLLL L      HK  A  +++++  ++++      V+ + +Q  +P  +  V  DT    N + QAR+ R+  F+  + L   + L+LAHH+ D  E   ++L +       G+K  G +  ++       +RP +   + +I    E  K+PY  D TN    Y R   R+ +
  S:    31 TVFLIGCSGGMDSMLLLHLMSELFPHKVRA--IYIDHQLQSSSRAWGVFVQNFAQQSHIPFTIQPVIVDT---GNLENQAREARYAAFE--SHLKSNEVLVLAHHQQDQTETVLLRLLSGS-----GVKGLGAMKEIEQKKNICCWRPMLSVSRQQIEHWVEHLKIPYIQDLTNFDTTYDRAWCRETV 206
>gi|158319482|ref|YP_001511989.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus oremlandii OhILAs] >gi|158139681|gb|ABW17993.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus oremlandii OhILAs] (463 aa)
Score = 158, Expect = 4.5e-09, Identities = 54/180 (30%), Positives = 94/180 (52%)
  Q:     7 IAGVSGGPDSMLLL-KLYHKKIACVV-----HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHT--VPEDTVWKK-NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           I  +SGGPDS+ LL  LY  +    +     H+N+N R   A  D + V   C++L +   + +  VP+    K  + +   R +R+E F + A     +K+ +AH+ +D  E   M+L    R       T   +   ++ RP +   +  I   CE++++   ID+TN + IYKRN++R E+  + +E
  S:    22 IVAISGGPDSVCLLHNLYQLREEYNLELYGAHLNHNFRGIDAQVDAQYVANLCEELNILCFIKSMDVPQYAKEKGLSSEEAGRILRYEFFDEIAEQVGANKIAVAHNENDQAETVLMRL---LRGTGLQGLTAIHINRGRIIRPLLGVDRKSIEEYCEKYQLSPRIDKTNLESIYKRNKIRLELIPYLEE 208
>gi|150397822|ref|YP_001328289.1| tRNA(Ile)-lysidine synthetase [Sinorhizobium medicae WSM419] >gi|150029337|gb|ABR61454.1| tRNA(Ile)-lysidine synthetase [Sinorhizobium medicae WSM419] (453 aa)
Score = 158, Expect = 4.5e-09, Identities = 60/177 (33%), Positives = 86/177 (48%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTT----ALRDQKMVEE-----YCKQLKVPLIVHTVP--EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE------------LYGMKVY--RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           + +  VSGG DSM +L   H  IA   H  ++        ALR Q   E      +C+ L    I H     E        QA ARKIR+E    AA     D ++  H R+D  E  +M+   R R+   GI                 LYG +V+  RPF++  + EI +  +   V +  D +NA   ++R +VR  IA
  S:    21 RILVAVSGGSDSMGVLMALHAAIATGEHPGFSLAACTVDHALRPQSAEEAASVAAFCRTLD---IAHRTRRWEGAKPATGIQAAARKIRYELLAVAAEALGADCIVTGHTREDQHETIEMR---RARSNGPGIDDGEGEGHGGAGMAATMLYGRRVWVLRPFLRLGRAEIRSFLDARAVAWIDDPSNANHAFERVRVRARIA 216
>gi|188995854|ref|YP_001930106.1| putative cell-cycle protein [Porphyromonas gingivalis ATCC 33277] >gi|188595534|dbj|BAG34509.1| putative cell-cycle protein [Porphyromonas gingivalis ATCC 33277] (454 aa)
Score = 158, Expect = 4.6e-09, Identities = 57/180 (31%), Positives = 88/180 (48%)
  Q:     7 IAGVSGGPDSMLLL----KLYHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +SGG DS+ LL    +L ++ +A   H N++ R   +  D   VE  C+ L VPL  H +  DTV        + +  AR++R+E F        ++ + +AHH DD  E   + L         G    G L GM       + RP +   ++EI A   + K+ Y  D +N    ++RN VR  I    KE
  S:    27 LVALSGGADSVALLCVLRELGYETVA--AHCNFHLRGVESDEDAAFVEGLCRDLDVPL--HRIDFDTVRYARERSISIEMAARELRYEWFGLLRKELAIEYVAVAHHADDNAETMVLNL-------CRGTGISG-LCGMPYKRNDGIVRPLLDATRDEIEAYLLDQKITYRTDSSNEDTRFRRNLVRHRIMPLLKE 210
>gi|30249025|ref|NP_841095.1| hypothetical protein NE1022 [Nitrosomonas europaea ATCC 19718] >gi|61216622|sp|Q82VP4|TILS_NITEU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|30138642|emb|CAD84933.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] (458 aa)
Score = 157, Expect = 5.2e-09, Identities = 49/179 (27%), Positives = 90/179 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKL---YHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYG--MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P  +    +SGG DS++LL L   + + +      VHV +   T +       +  C  L +PL +H +      +++ +A AR+ R++ F+      + D ++LA H+DD +E   +QL   A  + +      R    G  ++++RP +   ++EIL     H + +  DE+N    Y RN +R +I
  S:    26 PGDRLTVALSGGVDSVVLLHLLTTFSESMQLEVSAVHVEHGISTYSGEWSAFCQSLCDSLAIPLSIHRLKIRRRPQESLEAIAREARYQIFKH----IQADYVMLAQHQDDQVETLILQLLRGAGVKGLSAMPTVRLLEPGKTIRLFRPLLNIPRSEILNYARLHGLSWVTDESNLDTSYDRNFLRHQI 210
>gi|193216339|ref|YP_001997538.1| tRNA(Ile)-lysidine synthetase [Chloroherpeton thalassium ATCC 35110] >gi|193089816|gb|ACF15091.1| tRNA(Ile)-lysidine synthetase [Chloroherpeton thalassium ATCC 35110] (323 aa)
Score = 157, Expect = 5.6e-09, Identities = 52/174 (29%), Positives = 86/174 (49%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDT-----VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +   SGG DSM LL L  K       ++A   H N+  R   +  D+   +  C  L++P  + T+  DT       K + +  AR +R+  F K A + +  K+  AHH +D  E     L      +   GI+ + E    K+ RP + + + E++   E  ++PY +D TN    Y RN +R ++
  S:    25 LLAFSGGADSMALLSLLKKVQPFLNLQLA-AAHCNFGLRGEESDADETFCQMQCDALEIP--IFTIHFDTKHFAQQHKMSIEEAARHLRYNFFYKLAEIERCSKIATAHHANDNAETILFNLFRGSSLLGLKGIRVKHE----KLVRPLLGFKRAELIEYLESQQLPYRLDLTNLSDAYDRNFIRLKV 205
>gi|170750723|ref|YP_001756983.1| tRNA(Ile)-lysidine synthetase [Methylobacterium radiotolerans JCM 2831] >gi|170657245|gb|ACB26300.1| tRNA(Ile)-lysidine synthetase [Methylobacterium radiotolerans JCM 2831] (345 aa)
Score = 157, Expect = 6.2e-09, Identities = 51/182 (28%), Positives = 80/182 (43%)
  Q:    10 VSGGPDSMLLL----KLYHKKIAC--VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELY-GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           VSGGPDS  L+    +L     A   V  V++  R+ +  + + V    + L +P  + T      W         Q  AR+ R+      A       +L  H RDD  E   ++L A    A   G++   +L  G+ + RPF+   K  ++A C    + Y  D  N  P + R ++R   A W   E+E  
  S:     5 VSGGPDSSALMHAAARLRDATGASLRVATVDHGLRSESGAEAEAVGRAARALGLPHAILT------WAGAKPGTGLQDAARRARYALLAAHAEAVGAGLVLTGHTRDDQAETVLIRLAAGSGPAGLAGMRAERDLGPGLALGRPFLHLPKASLVAWCAARGIAYARDPANGDPRFARGRLR---AAWPALEREGL 190
>gi|126653286|ref|ZP_01725397.1| hypothetical protein BB14905_08928 [Bacillus sp. B14905] >gi|126589960|gb|EAZ84089.1| hypothetical protein BB14905_08928 [Bacillus sp. B14905] (468 aa)
Score = 157, Expect = 6.2e-09, Identities = 56/174 (32%), Positives = 85/174 (48%)
  Q:     7 IAGVSGGPDSMLLLKLY-----HKKIAC-VVHVNYNKRTTA-LRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DSM LL  +     H  I    VHV++  R  A   D+  V++YC +  V L    +   T+      N Q   R+ R+  F++       +KL+ AHH DD +E   M L  +A   +M  GI+ +    G  + RPF+   K EI        + Y  D +N++  Y RN+ R  +
  S:    24 LIAVSGGVDSMALLHYFVQTQEHWNIRVEAVHVDHMLRGEASAEDRAFVQKYCDENDVYLHATAISIPTILALENGNTQLICRRERYRYFKEVLYKTNANKLVTAHHADDQLESVLMALTKNATMNSM-QGIRPQRYFEGKSLIRPFLTVTKTEIGEYLLRKGLNYREDVSNSKDTYVRNRFRHHV 208
>gi|116617526|ref|YP_817897.1| tRNA(Ile)-lysidine synthetase, MesJ [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096373|gb|ABJ61524.1| tRNA(Ile)-lysidine synthetase, MesJ [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (430 aa)
Score = 157, Expect = 6.2e-09, Identities = 56/179 (31%), Positives = 91/179 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACVV--HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQA--KMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYK-RNQVRQEI 180
           P+T  I  VSGG DS++L+    K  A +V  HVNY  R  +  D   V +   Q         + E+ VW+       +  AR+ R++ F++ A  Y  + + +AHH DD  E    KM    R + M  G++T+      KV RPF+   K E++   +++ + +  D+TN    Y  RN +R ++
  S:    15 PET-VIVAVSGGVDSVVLVHALSKTKANLVIAHVNYRLREESDDDADFVRQLATQ------TGAIFEEQVWQHIPDHAVEKAARQFRYDFFEELAQKYHTNTIAVAHHADDQAETVLLKMIRGGRLQQM-GGMQTKNH----KVIRPFLSITKQELITYAQDNHLGWRQDKTNFDVDYTPRNLLRNDV 190
>gi|86135031|ref|ZP_01053613.1| putative cell-cycle protein [Tenacibaculum sp. MED152] >gi|85821894|gb|EAQ43041.1| putative cell-cycle protein [Polaribacter dokdonensis MED152] (436 aa)
Score = 157, Expect = 6.5e-09, Identities = 47/174 (27%), Positives = 91/174 (52%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-KIA--CVVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  +SGG DS++L  L+H+  IA   + H N+  R  A   D++ V +  +     + + +   + +    KK+ Q  AR++R+  FQ+    +++D +L AHH DD +E   + L  R   +  + GI          + R  + + ++EIL   + + + +  D +NA   Y RN++R ++
  S:    22 LIAISGGLDSVVLTHLFHQLNIAEIALAHCNFKLRNKASDLDEEFVNKLSQITSNQIFIKSFQTEKISENQKKSIQITARELRYNWFQELMDEHQLDYILTAHHADDNLETFLINL-TRGSGLDGFTGIPA----INGNIVRTLLPFSRSEILNFAKSNNIEWREDASNASIKYVRNKIRHKV 199
>gi|86131835|ref|ZP_01050432.1| putative ATP-binding PP-loop protein [Cellulophaga sp. MED134] >gi|85817657|gb|EAQ38831.1| putative ATP-binding PP-loop protein [Dokdonia donghaensis MED134] (435 aa)
Score = 157, Expect = 6.6e-09, Identities = 54/175 (30%), Positives = 90/175 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKKIAC--VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDT---VWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           ++ +  VSGG DSMLLL L  +      V H N+N R   +  DQ  VE YCK   +P+ + +        + K + Q  AR++R++ F++ ++   +D +L AHH +D +E   + L         G   +G L G+     +V RP + + +  I     + K+ +  D +NA   Y RN +R 
  S:    19 SKILVTVSGGLDSMLLLLLCRQAGLTIRVAHCNFNLRGVESDGDQAFVESYCKLHNIPIYIKSFDTSAYAKIEKTSTQIAARELRYQWFKELSATEGLDYILTAHHLNDELETFLINLGR-------GTGVKG-LTGIPEINERVVRPLLPFSRKRIKEYALQEKLAWREDSSNATDNYVRNHLRH 196
>gi|187933472|ref|YP_001884417.1| tRNA(Ile)-lysidine synthase [Clostridium botulinum B str. Eklund 17B] >gi|187721625|gb|ACD22846.1| tRNA(Ile)-lysidine synthase [Clostridium botulinum B str. Eklund 17B] (468 aa)
Score = 156, Expect = 6.9e-09, Identities = 59/208 (28%), Positives = 105/208 (50%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYR------PFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKR 212
           + +  +SGGPDS+ LL +  +       +I    H+N+  R   A +D++ V   CK++ +P  V  V  +   K+   + +   R +R++ F +       +K+  AH+ +D  E    +       M  G    G L G+KVYR      P +   + E+    EE K+   ID+TN + IY RN++R +I  + +E   E  +       ++ QK  +L++R
  S:    20 KILIALSGGPDSLCLLNMLKELREELDIEIGAA-HLNHLLRGDDAFKDEEFVINTCKEMNIPCYVKRVDINKYSKEHRLSSELAGRNVRYDFFDEILKKEGFNKIATAHNANDQAETIIFR-------MMRGTGLEG-LGGIKVYRENKIIRPILCLTRTEVEKYIEEKKLNPRIDKTNFEKIYNRNKIRLDIIPYIQENFNEDIVKTLNRMSLLIQKDNALIER 235
>gi|124514863|gb|EAY56374.1| PP-loop-containing protein [Leptospirillum sp. Group II UBA] (504 aa)
Score = 156, Expect = 7.4e-09, Identities = 55/176 (31%), Positives = 89/176 (50%)
  Q:     5 QYIAGVSGGPDSMLLLKLYH-----KKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPL--------IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
            +   +SGG DS+ L  L H     +    +VH N+  R      D+  +  + + +  PL        +   VPED +         RK R+  F    +  + + L LAHH+DD +E   M L       + G   +G L GM      +++RP ++   +EI  +  +H++PY ID +N Q  Y RN+VR E+
  S:    41 HFHVAISGGADSVFLAFLLHLFLEDRHSLTLVHFNHRTRGKENEEDEIFLRNFARHIGRPLRIGILSEPLPDNVPEDFL---------RKKRYAFFDTLLTENRKNILFLAHHQDDQVETILMNL-------FRGTGPKGVL-GMLNKPDRRIFRPLLETGADEIRNVLSDHRIPYRIDSSNLQHDYLRNRVRMEL 219
>gi|149194101|ref|ZP_01871199.1| hypothetical protein CMTB2_03413 [Caminibacter mediatlanticus TB-2] >gi|149136054|gb|EDM24532.1| hypothetical protein CMTB2_03413 [Caminibacter mediatlanticus TB-2] (323 aa)
Score = 156, Expect = 8.1e-09, Identities = 59/176 (33%), Positives = 85/176 (48%)
  Q:     7 IAGVSGGPDS-MLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM---------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           +   SGG DS  L   L  K I   +  VNY+ R T+  D+++  EY K L          +D   KK  + +AR  R+  F++    Y    L+L H  +D  E   MQL         G+K   EL  M         K+YRPF    + EI+    +H + Y ID++N    YKRN +R+E +N
  S:     4 LLAFSGGIDSSALFFWLMEKNIDFDIAIVNYHTRETS--DEEV--EYAKYLAKKYNKKIFIKDCYLKKFSEKKARDCRYTFFEEIIKKYGYSTLILGHQLNDRFEWFLMQLSKGA-----GLK---ELIAMEKWEEREFYKIYRPFYNLSRREIIEYLHKHNIKYFIDKSNFDIKYKRNLIRKEFSN 178
>gi|118475434|ref|YP_892513.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter fetus subsp. fetus 82-40] >gi|118414660|gb|ABK83080.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter fetus subsp. fetus 82-40] (336 aa)
Score = 155, Expect = 9.1e-09, Identities = 55/189 (29%), Positives = 90/189 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHKK---IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD--------------ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           +   S G DS  L  + ++K     C   +NY  R  +  ++   +E C +    + +   P +     NF+ +AR IR + F +    +  D L+LAH  +D +E   MQL                 K A +  IK +     + V RP I   +NEI++  ++  + Y  D +N    +KRN +R   AN+S    E+F  GV
  S:    15 LLAFSYGTDSTALFHILNEKNIEFDCAF-INYKTRVQSDEEEVSAKELCLKFNKNIYIKIAPLNLENGSNFEKKARDIRHKFFDEICIKFNYDTLILAHQLNDCLEWLFMQLSKGSGTVQLCGLEPTNTKIAEFENIKKQ-----ISVIRPLINVSRNEIISYLKQKNINYFTDISNFDFKFKRNFIR---ANFSDAFIEKFEKGV 211
>gi|78357070|ref|YP_388519.1| ketose-bisphosphate aldolase, class-II [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78219475|gb|ABB38824.1| Ketose-bisphosphate aldolase, class-II [Desulfovibrio desulfuricans G20] (357 aa)
Score = 155, Expect = 9.1e-09, Identities = 51/185 (27%), Positives = 82/185 (44%)
  Q:     7 IAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLI-VHTVPED--TVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG--ELYGMK-------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +A  SGG DS  LL + H            VH+++  R  +  D   V + C    + L  V T   D     +   +   RK R+  + K A+L+    +   HH DD  E   M+L          I+  G   L GM+       + RP +   K ++    E  + P+  D +N+ P + RN++R  I    ++E   F
  S:    59 LAACSGGADSTALLLILHYLAPRMGHTVVAVHLDHALRQESADDAHFVSQLCSAAGIRLFSVRTDVADLAAAGRCGLEEAGRKARYAFYAKTAALFSRPVICTGHHADDLKEDVLMRL----------IRGAGWPALGGMQAVIPERSLLRPLLVTEKYKLTTFLEACRCPWREDASNSDPSFTRNRIRNTIIPLLQQENPSF 251
>gi|158520085|ref|YP_001527955.1| tRNA(Ile)-lysidine synthetase [Desulfococcus oleovorans Hxd3] >gi|158508911|gb|ABW65878.1| tRNA(Ile)-lysidine synthetase [Desulfococcus oleovorans Hxd3] (480 aa)
Score = 155, Expect = 9.4e-09, Identities = 63/200 (31%), Positives = 90/200 (45%)
  Q:     2 PKTQYIAGVSGGPDSMLLL--------KLYHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQ----ARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRV 201
           P    + GVSGGPDS+ LL        +L   +++ V HV++  R   A  DQ  V    ++L +P     + +     +N  A     AR  R+  F   A+ +   K+  AHH  D  E   M L         G    G L G+      + RP I   + +ILA      + Y  D TNA   + RN+VR  +     EE     I  C +NRV
  S:    29 PGEAVLVGVSGGPDSVALLHALVRLQPELAVARVS-VAHVHHGLRGAEADADQAFVAALAERLGLPFYTEKI-DVAAAARNTGASVEDAARTARYRFFSDTAAAHGYHKIATAHHAGDNAEWVLMNL-------VRGAGPEG-LSGIPPVRENIIRPLIHVSREDILAFLTHGGMDYVEDSTNADLTFTRNRVRHHLLPL-IEEHYNPGIAAC-LNRV 234
>gi|54293769|ref|YP_126184.1| hypothetical protein lpl0825 [Legionella pneumophila str. Lens] >gi|61216435|sp|Q5WYB4|TILS_LEGPL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|53753601|emb|CAH15059.1| hypothetical protein [Legionella pneumophila str. Lens] (431 aa)
Score = 155, Expect = 1.0e-08, Identities = 54/174 (31%), Positives = 85/174 (48%)
  Q:     7 IAGVSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE---LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I G SGG DS +LL        LY++ +A  VH+N+     +L  Q+  E+ C  L +  I   +  D     N +  AR  R++ F  ++ L   D L+L HH DD  E   +QL   + A   G+    E   L   ++ RPF+   + E+      H++ +  DE+N    Y RN +R  +
  S:    21 IVGFSGGLDSTVLLHVLASTPPLYNQLLA--VHINHGISGNSLNWQRHCEQLCLDLGIAFIAKAIEFDR--SANVEEAARNARYDFF--SSLLEDNDCLVLGHHLDDQAETVLLQL--FRGAGVDGLAAMQECSNLGAGQLARPFLTCPRVELEHYARIHELKWIEDESNQDTKYSRNYLRHRV 196
>gi|168576121|ref|ZP_02722026.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae MLV-016] >gi|183578020|gb|EDT98548.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae MLV-016] (425 aa)
Score = 155, Expect = 1.0e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|148997947|ref|ZP_01825460.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP11-BS70] >gi|168491781|ref|ZP_02715924.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC0288-04] >gi|169834329|ref|YP_001693445.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae Hungary19A-6] >gi|147755957|gb|EDK63000.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP11-BS70] >gi|168996831|gb|ACA37443.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae Hungary19A-6] >gi|183574048|gb|EDT94576.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC0288-04] (425 aa)
Score = 155, Expect = 1.1e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|168493989|ref|ZP_02718132.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC3059-06] >gi|183575851|gb|EDT96379.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC3059-06] (425 aa)
Score = 154, Expect = 1.2e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|168484297|ref|ZP_02709249.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC1873-00] >gi|172042410|gb|EDT50456.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC1873-00] (425 aa)
Score = 154, Expect = 1.2e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAETELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPKLEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|148984555|ref|ZP_01817843.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP3-BS71] >gi|147923332|gb|EDK74446.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP3-BS71] (425 aa)
Score = 154, Expect = 1.2e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|145300032|ref|YP_001142873.1| tRNA(Ile)-lysidine synthase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852804|gb|ABO91125.1| tRNA(Ile)-lysidine synthase [Aeromonas salmonicida subsp. salmonicida A449] (456 aa)
Score = 154, Expect = 1.2e-08, Identities = 56/170 (32%), Positives = 86/170 (50%)
  Q:    11 SGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGI--DETNAQPIYKRNQVRQEI 180
           SGG DS +LL L       H      +HV++     A       E  C+QL VPL+V  V       ++ +AQAR  R+++   AA   K + LL AHH+DD +E   + L   A  R +  GI       G  + RP +++ + E+  +     +P+G   DE+N    Y RN +RQ++
  S:    27 SGGLDSTVLLALAAQFAREHGLALRALHVHHGLSPHADEWVAHCEAVCQQLAVPLMVERVQLLRGNGESLEAQARDARYQRL--AARQEKGEWLLTAHHQDDQLETLLLALKRGAGLRGLA-GILPSQPFAGGLLLRPLLEFSRAELAEVAA--TLPFGWVEDESNQDVSYDRNFLRQQL 201
>gi|88805526|ref|ZP_01121045.1| putative cell-cycle protein [Robiginitalea biformata HTCC2501] >gi|88784344|gb|EAR15514.1| putative cell-cycle protein [Robiginitalea biformata HTCC2501] (439 aa)
Score = 154, Expect = 1.2e-08, Identities = 54/177 (30%), Positives = 88/177 (49%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKKIAC---VVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQF-QKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + ++   SGG DSM+L  L  K       + H N+N R  A   DQ+ V E   +L++    H    DT+   N      Q  AR +R+E F Q  AS   +  ++ AHH DD +E   + L  R   +    GI  R       + RP + + + ++ A  E  ++ +  D +N++  Y RN++R E+
  S:    19 SSFLLACSGGLDSMVLAHLC-KDAGLEFELAHCNFNLRGEASESDQEFVRETADKLRIK--THIKSFDTIGYANQNKVSIQMAARALRYEWFDQLTASENHLRYIVTAHHADDALETFLINL-GRGSGLEGLCGIPART----ANIRRPLLAFSREDLEAYAETARIAWREDASNSETRYLRNRLRHEV 199
>gi|169824693|ref|YP_001692304.1| cell cycle protein [Finegoldia magna ATCC 29328] >gi|167831498|dbj|BAG08414.1| cell cycle protein [Finegoldia magna ATCC 29328] (451 aa)
Score = 154, Expect = 1.3e-08, Identities = 51/174 (29%), Positives = 86/174 (49%)
  Q:     7 IAGVSGGPDSMLLLKLYHKK--------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + G+SGG DS+ LL +  K           C  H+N++ R TALRD+    +  ++  +      V        N    +   R +R++ F +       +K+ +AHH DD +E   + L       + G    G L G++     + RP +   K+EIL   +E+ + Y  DETN     +RN++R E+
  S:    24 LIGLSGGADSVFLLNILIKLQRDLDFEIYTC--HINHSYRDTALRDENFSRKISEENNIKFFSKKVDMKQYSIDNSISLEDSGRILRYKYFNEILKSEDFNKIAVAHHLDDQVETFFLHL-------FRGSGIDG-LCGIQYQNKNIIRPLLDVSKSEILNYLDENDIDYVTDETNFVADVQRNKIRLEM 203
>gi|160886327|ref|ZP_02067330.1| hypothetical protein BACOVA_04336 [Bacteroides ovatus ATCC 8483] >gi|156108212|gb|EDO09957.1| hypothetical protein BACOVA_04336 [Bacteroides ovatus ATCC 8483] (426 aa)
Score = 154, Expect = 1.3e-08, Identities = 50/176 (28%), Positives = 88/176 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKK-IAC-VVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK-----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           P  + +  +SGG DS+ LL + H     C   H N++ R   + RD+  V + C+++++ L  HT+  +T         + +  AR++R++ F+K     + D + +AHH+DD IE   + L          GI+ R       + RP +   + EI+   +     Y  D TN +  Y RN++R
  S:    18 PDDKILVALSGGADSVALLYILHTAGYHCEAAHCNFHLRGKESDRDELFVRQLCERMEIHL--HTIDFNTTQYATEKHISIEMAARELRYQWFEKIRKECQADVVAVAHHQDDSIETILLNLIRGTGITGLLGIRPR----NGTIVRPLLCINREEIIRYLQNIGQDYVTDSTNLEDEYTRNKIR 196
>gi|15902054|ref|NP_357604.1| hypothetical protein spr0010 [Streptococcus pneumoniae R6] >gi|116516781|ref|YP_815434.1| tRNA(Ile)-lysidine synthetase [Streptococcus pneumoniae D39] >gi|122279568|sp|Q04N53.1|TILS_STRP2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217356|sp|Q8DRP9|TILS_STRR6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15457538|gb|AAK98814.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077357|gb|ABJ55077.1| tRNA(Ile)-lysidine synthetase [Streptococcus pneumoniae D39] (425 aa)
Score = 154, Expect = 1.3e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETIFMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|148993574|ref|ZP_01823045.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP9-BS68] >gi|149003152|ref|ZP_01828061.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP14-BS69] >gi|149007705|ref|ZP_01831314.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP18-BS74] >gi|168487652|ref|ZP_02712160.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC1087-00] >gi|168489346|ref|ZP_02713545.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae SP195] >gi|147758893|gb|EDK65889.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147760700|gb|EDK67672.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP18-BS74] >gi|147927795|gb|EDK78817.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP9-BS68] >gi|183569575|gb|EDT90103.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC1087-00] >gi|183572160|gb|EDT92688.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae SP195] (425 aa)
Score = 154, Expect = 1.4e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|153815236|ref|ZP_01967904.1| hypothetical protein RUMTOR_01470 [Ruminococcus torques ATCC 27756] >gi|145847495|gb|EDK24413.1| hypothetical protein RUMTOR_01470 [Ruminococcus torques ATCC 27756] (488 aa)
Score = 154, Expect = 1.4e-08, Identities = 58/174 (33%), Positives = 91/174 (52%)
  Q:     7 IAGVSGGPDSM-LLLKL--YHKKIAC---VVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQA---QARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           IAGVSGG DS+ LLL L    +K      V HVN+  R  A   D++ V++ C +L V   V     + + +K  Q+     R++R E F++  +     K+  AHHRDD  E   + + AR      G   RG L G+        RP +   ++ I +   E  + + +D TN +  Y RN++R ++
  S:    30 IAGVSGGADSVCLLLTLCSLREKFGFEVKVCHVNHCLRGAAADADEEYVKKLCGELGVECRVFRKEVELIAEKRKQSCEEAGREVRREAFEQMCAENGGTKIATAHHRDDQAETVLLNI-AR------GTGIRG-LCGIVPVRDNRIRPLLSLTRDRIESYLRERGIVWRVDATNEEDDYTRNRIRHKV 210
>gi|94501920|ref|ZP_01308430.1| Cell cycle protein MesJ [Oceanobacter sp. RED65] >gi|94425973|gb|EAT10971.1| Cell cycle protein MesJ [Oceanobacter sp. RED65] (446 aa)
Score = 154, Expect = 1.4e-08, Identities = 53/173 (30%), Positives = 89/173 (51%)
  Q:     8 AGVSGGPDSMLLLKL------YHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIE---QAKMQLDARKRAMYYGIKTRGELYGMK---VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
            G+SGG DS++LL L      YH     +  +HVN+     A + Q+ VE  C+   +PL+ H V  +   K + +  AR  R++ F++  SL   D L+L HH+DD +E   Q  M+       +   +    +L   K   + RP +   K +I     +H++ Y  D++N    + RN  R ++
  S:    28 VGLSGGIDSVVLLFLCKQFVEYHHSSVELHGIHVNHGLSEFADQWQQHVEGLCEAWSIPLVSHRVELEQ--KGSIEEVARNARYDAFKR--SLDDQDVLVLGHHQDDQVETMMQRLMRGSGLSGLLSMNVARTLDLGNNKQAIILRPLLSTTKKQIEQYANDHQLKYVQDDSNLDTQFDRNFWRLQV 210
>gi|148988915|ref|ZP_01820330.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP6-BS73] >gi|147925726|gb|EDK76802.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP6-BS73] (425 aa)
Score = 154, Expect = 1.4e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPKLEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|149020169|ref|ZP_01835143.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP23-BS72] >gi|147930847|gb|EDK81828.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP23-BS72] (425 aa)
Score = 154, Expect = 1.4e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|15899960|ref|NP_344564.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae TIGR4] >gi|111658620|ref|ZP_01409270.1| hypothetical protein SpneT_02000210 [Streptococcus pneumoniae TIGR4] >gi|61217410|sp|Q97TC5|TILS_STRPN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|14971475|gb|AAK74204.1| tRNA(Ile)-lysidine synthetase [Streptococcus pneumoniae TIGR4] (425 aa)
Score = 154, Expect = 1.5e-08, Identities = 56/235 (23%), Positives = 113/235 (48%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +  +   I     ++ + +   +   D+++L  Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETIFMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIAELSNN-INVEDLQQLFSYSESTQRVLLQTYL 252
>gi|88798276|ref|ZP_01113862.1| cell cycle protein MesJ [Reinekea sp. MED297] >gi|88779052|gb|EAR10241.1| cell cycle protein MesJ [Reinekea sp. MED297] (439 aa)
Score = 153, Expect = 1.7e-08, Identities = 51/172 (29%), Positives = 81/172 (47%)
  Q:     9 GVSGGPDSMLLLKL----YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           G SGG DS+LLL L    Y       +HVN+     A + Q+      +QL    IV TV E     +  ++ AR  R++ F  A  + +   LLL HH DD IE   ++L     +    G+       G ++ RP +   + +I  + + H + +  DE+N    + RN +R E+
  S:    30 GYSGGVDSILLLSLACQAYGADQVTAIHVNHQVSEFATQWQEHCVAQAEQLGCSCIVRTV-EVGNRGQGIESDARDRRYDAF--ANVMPEGGTLLLGHHLDDQIETFFLRLLRGAGQHGLQGMVQESNRDGYRIIRPLLTTSRQDIELMAQHHGLRWIDDESNEDTRFDRNFLRHEV 203
>gi|170088506|ref|XP_001875476.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164650676|gb|EDR14917.1| predicted protein [Laccaria bicolor S238N-H82] (487 aa)
Score = 153, Expect = 1.7e-08, Identities = 59/178 (33%), Positives = 89/178 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHK--------------KIACVVHVNYNKRTTALRD------QKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-------------ARKRAMYYGIKTRGELY----GMK--VYRPFIKYWKNEILALCEEHKVPYGIDETNAQP-IYKRNQVRQEI 180
           +T      SGGPDS  LL L ++               I+  V  +  K+++ + +      Q +  E+    K+P      P        F+  AR  R+    +  +   VD L + HH DD +E A M+L               R+  M  GI  R   +    GM   + RP +   K+ ILA CE++ + Y  D TN QP I  RN +R+ I
  S:    21 RTSLAVANSGGPDSTCLLFLINRYLLEHPGSSSQPQRVISFTVDHDLQKKSSDMANHCRLFAQSIGVEHITS-KIPWGEGVYPPRPSPGDMFERTARDARYALLLQTLTRADVDVLAVGHHADDQVETALMRLGMGSTQLGAGGMRACRRWGMGAGIDERSLSWAGHKGMSKWIVRPLLDVGKDRILATCEQNNLEYITDPTNFQPHITIRNAIRRLI 237
>gi|153951323|ref|YP_001398742.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. doylei 269.97] >gi|152938769|gb|ABS43510.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. doylei 269.97] (321 aa)
Score = 153, Expect = 1.7e-08, Identities = 56/189 (29%), Positives = 91/189 (48%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVY---------RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           +A   G   S L   L  +KI   +V +NY  R  +  ++   +E   +    + +   PE   ++ NF+ +AR  R++ F+K       D L+LAHH +D  E   MQL +R   +        E+ GM+ Y         RP +   K+EI +  +E  + Y  DE+N    Y RN +R+   N+S     EF+ G+
  S:    18 LAFSYGSDSSALFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKYAPE---FQSNFEKKARDFRYDFFEKICLEQDYDHLILAHHLNDQFEWFLMQL-SRGAGL-------AEILGMQEYEQRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK---NFSNAFVSEFHQGL 202
>gi|149377460|ref|ZP_01895202.1| hypothetical protein MDG893_09401 [Marinobacter algicola DG893] >gi|149358227|gb|EDM46707.1| hypothetical protein MDG893_09401 [Marinobacter algicola DG893] (416 aa)
Score = 153, Expect = 1.8e-08, Identities = 49/166 (29%), Positives = 81/166 (48%)
  Q:    15 DSMLLLKLY-----HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV-------PE-DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           DS+LLL +      H      +H+N+  +  A   ++  E+ C++L VPL +  V       PE DT      +  AR  R++ F++   L   + LL+AHH DD  E    +L          G+     L   ++YRP + + + E+ A   EH + +  D +N    + RN +R  I
  S:     2 DSVLLLHVTAYLYAHSGQVSAIHINHQLQPNADDAERFCEDICRELGVPLDIRRVIVSSRETPEIDT--SGGVEEAARNARYQVFEEI--LAPGELLLMAHHGDDQAETVLFRLLRGTGVVGLGGMPITRPLGAGRLYRPLLDFSRAELHAWAAEHGIEWMEDPSNIDERFDRNFLRASI 177
>gi|196156208|ref|YP_002125697.1| cell cycle protein MesJ [Alteromonas macleodii 'Deep ecotype'] >gi|196111987|gb|ACG65703.1| cell cycle protein MesJ [Alteromonas macleodii 'Deep ecotype'] (441 aa)
Score = 153, Expect = 1.8e-08, Identities = 53/178 (29%), Positives = 85/178 (47%)
  Q:     3 KTQYIAGVSGGPDSMLLLKL-------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +T  +   SGG DS +LL+        Y+  I  V HV++     A    +  E  C+   V   +H V  DT  +K+ +A+ARK+R+              LLL  H +D +E   +QL  ++ A   G+   GE+       + RP +   K EI+   +   + +  DE+N Q  + RN +R EI
  S:    28 QTPLVVAYSGGVDSSVLLQAVIEYREQYNGPIHAV-HVHHGLSENADSWARHCELQCRLEDVEFHLHRVEVDTSARKSIEAEARKVRYNALLAVCKRIG-GVLLLGQHAEDQLETVLLQL--KRGAGPQGLAGMGEVQYRGNTLIMRPMLSLDKAEIVTFADNEMLQWVDDESNQQNSFDRNFLRNEI 211
>gi|88772827|gb|EAR04102.1| cell cycle protein MesJ [Alteromonas macleodii 'Deep ecotype'] (434 aa)
Score = 153, Expect = 1.9e-08, Identities = 53/178 (29%), Positives = 85/178 (47%)
  Q:     3 KTQYIAGVSGGPDSMLLLKL-------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +T  +   SGG DS +LL+        Y+  I  V HV++     A    +  E  C+   V   +H V  DT  +K+ +A+ARK+R+              LLL  H +D +E   +QL  ++ A   G+   GE+       + RP +   K EI+   +   + +  DE+N Q  + RN +R EI
  S:    21 QTPLVVAYSGGVDSSVLLQAVIEYREQYNGPIHAV-HVHHGLSENADSWARHCELQCRLEDVEFHLHRVEVDTSARKSIEAEARKVRYNALLAVCKRIG-GVLLLGQHAEDQLETVLLQL--KRGAGPQGLAGMGEVQYRGNTLIMRPMLSLDKAEIVTFADNEMLQWVDDESNQQNSFDRNFLRNEI 204
>gi|87118609|ref|ZP_01074508.1| cell cycle protein [Marinomonas sp. MED121] >gi|86166243|gb|EAQ67509.1| cell cycle protein [Marinomonas sp. MED121] (434 aa)
Score = 153, Expect = 1.9e-08, Identities = 52/172 (30%), Positives = 83/172 (48%)
  Q:     9 GVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           G+SGG DS+ LL L       H+  A  +H   ++   A    +  E  C+Q +V    H V  DT  K + +  AR  R++ F  A+ L K   LLLAHH  D  E    +L          G+  + EL    +YRP + + K  ++   +++ + +  DE+N    + RN +R +I
  S:    30 GLSGGVDSVALLHLLVEAGLGHRVKAIHIHHGLSQNADAWY--RFCEALCQQYQVAFKGHKVELDTQ-KHSIEEAARIARYDIF--ASYLNKNAYLLLAHHAGDQAETLMFRLLRGTGGKGLAGMPAKRELGAGFLYRPLLSFDKTNLIQYVKQNGLTWVEDESNQDEAFSRNHIRHQI 203
>gi|34498644|ref|NP_902859.1| cell cycle protein [Chromobacterium violaceum ATCC 12472] >gi|61216591|sp|Q7NT72|TILS_CHRVO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|34104497|gb|AAQ60855.1| cell cycle protein [Chromobacterium violaceum ATCC 12472] (435 aa)
Score = 152, Expect = 2.0e-08, Identities = 50/172 (29%), Positives = 84/172 (48%)
  Q:     9 GVSGGPDSMLLLKLYHKKIA-------CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           G SGG DS+ LL L  +  A         VHV++     A       +  C  L+VPL +  V       ++ +A AR+ R++ ++++AS    + + LAHH+DD  E   +QL      RA+      R    G  ++RP ++  +  + A  +     +  DE+N    Y+RN +R +I
  S:    22 GFSGGLDSVALLSLLCEARARRPEIGLSAVHVHHGLSPNADAWAAHCQALCDSLRVPLRIERVHVRAGGGESVEAAAREARYQVYRRSAS----EVIALAHHQDDQAETILLQLLRGGGARALAAMPALRELAPGKLLWRPLLEIPRERLEAYVKARGFAWVDDESNLDTRYRRNLLRHDI 198
>gi|187777491|ref|ZP_02993964.1| hypothetical protein CLOSPO_01066 [Clostridium sporogenes ATCC 15579] >gi|187774419|gb|EDU38221.1| hypothetical protein CLOSPO_01066 [Clostridium sporogenes ATCC 15579] (468 aa)
Score = 152, Expect = 2.0e-08, Identities = 60/198 (30%), Positives = 100/198 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VY-RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE-KEEFYIGVCAMNRVIGQ 204
           I GVSGGPDSM LL +          K   V H+N+  R   +  D+K VE +C    +     T+  + + K+   + ++  R+ R++ F          K+  AH+ +D  E   M++         G   +G L G+      VY RP I   +  I   CE++K+   ID+TN Q IY RN++R E+  + K+   E+    +C  + ++ +
  S:    22 IVGVSGGPDSMCLLHMLCLLKDELRIKDIYVAHINHGVRGAESDADEKYVENFCYMNNLGFFSKTIDMNKMAKEKGISSESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRI-------MRGTGLQG-LIGINPIRDGVYIRPLINVLRENIEYYCEKYKLNPRIDKTNLQSIYTRNKIRLELIPYIKDNFNEDIVNTLCRFSNIVSK 229
>gi|52353974|ref|NP_048910.2| hypothetical protein PBCV1_A554/556/557L [Paramecium bursaria Chlorella virus 1] >gi|34482010|dbj|BAC84999.1| hypothetical protein [Paramecium bursaria Chlorella virus 1] >gi|52221432|gb|AAC96914.2| similar to MesJ cell cycle protein [Chlorobium tepidum], corresponds to accession number AAG12421 [Paramecium bursaria Chlorella virus 1] (498 aa)
Score = 152, Expect = 2.1e-08, Identities = 51/209 (24%), Positives = 95/209 (45%)
  Q:     9 GVSGGPDSMLL------LKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE-------DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWL 217
            +SGG DSM L      L+ ++     V  VNY  R  A  ++  V ++   L  P+ V  + E       D   +  ++   RK+R+  ++  +    V    + H++DD +E     +    K     G+ T     G+K +RP +   K++I+     H +PY  + T A   +KR  VR  +     +  + F  G+  +   +G+    +   AK+++
  S:   203 SLSGGVDSMTLFHILDGLRGFYGYKMNVAMVNYTNRACAYDEEYFVTDWANWLGYPISVRRIEEINRKPCIDADIRTLYETYTRKVRYNTYKTISHGAFV---AMGHNKDDCLENILQNICSGHKYDNLNGMDTVVVQDGIKFFRPLLGVSKDDIIEYARGHNIPYLPNSTPAH--FKRGMVRNSVVPCMNDWDDRFIPGLFKLKDTMGEMSMMMEITAKEFV 420
>gi|33241260|ref|NP_876202.1| ATPase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|61216600|sp|Q7V9L9|TILS_PROMA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|33238790|gb|AAQ00855.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Prochlorococcus marinus subsp. marinus str. CCMP1375] (336 aa)
Score = 152, Expect = 2.1e-08, Identities = 51/177 (28%), Positives = 92/177 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKL-------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQF-QKAASLYK------VDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  +  VSGG DSM LLKL       Y  K+  V H ++     + +  + +EE+CK  K+    +   +  V   + +  AR  R++   Q+A +L K       +++L  H  +D  E   M L   A  + +    + R     +++ RP +++ + E + +C+E  +P  ID +N+   Y RN++R EI
  S:    33 SSLLISVSGGQDSMALLKLILDLQRIYEWKVH-VWHGDHGWHNQSRQIAEELEEWCKCQKLSFFCNRTNKQKV---STEEDARNWRYKSLIQQAKTLSKESPSLPCERVLTGHTANDRTETFIMNLARGAHLKGLSSLREDRTLETKIQLIRPILRFSRQETIQICDEMDLPIWIDPSNSNIAYSRNKIRAEI 221
>gi|119504829|ref|ZP_01626907.1| cell cycle protein [marine gamma proteobacterium HTCC2080] >gi|119459434|gb|EAW40531.1| cell cycle protein [marine gamma proteobacterium HTCC2080] (426 aa)
Score = 152, Expect = 2.1e-08, Identities = 52/172 (30%), Positives = 84/172 (48%)
  Q:     9 GVSGGPDSMLLLKLYHKKIACV----------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           G+SGG DS+ LL L H  +  V          VH+++     A    ++  + C+QL + L V+ V   T   K  +A AR  R+  +++   L   + LLLAHH DD +E    + L       + G+  R EL    + RP +   ++ I    +  ++ Y ID +N    + R  +R EI
  S:     3 GLSGGCDSIALLHLAHAWLDHVGPERRPALRAVHIHHGLAPEADAWVEVCHDVCQQLSIALSVYRVTPVTDEGKGIEAAARTARYSVYRQ--ELKSGEVLLLAHHADDQVETVLQRLLRGTGPKGFAGMPRRRELGQGVLSRPLLGVARSVIKRWADNRELAYVIDASNQDMRFDRGFLRTEI 183
>gi|160943996|ref|ZP_02091226.1| hypothetical protein FAEPRAM212_01497 [Faecalibacterium prausnitzii M21/2] >gi|158444672|gb|EDP21676.1| hypothetical protein FAEPRAM212_01497 [Faecalibacterium prausnitzii M21/2] (478 aa)
Score = 152, Expect = 2.2e-08, Identities = 56/170 (32%), Positives = 83/170 (48%)
  Q:     8 AGVSGGPDSMLLL--------KLYHKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY--GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           A VSGG DSM LL        +  +   AC  HVN+  R  +A RD+  V   C +L VPL + H     +      +  AR++R+  F +      +D +  AH  +D  E   ++L AR   ++   GI+ R   Y     RP +   + E  A+C     P+  DETN    Y RN++R
  S:    29 AAVSGGADSMALLLLLRQLQPRFGYTLSAC--HVNHGLRGQSADRDEAFVRAECARLGVPLRVFHAAELASPPAHAGEDWARRLRYTAFAQLQG-QGIDAIATAHTANDQAETLLLRL-ARGTGLHGAGGIRPRRGCY----LRPLLCLSRAETEAVCRAAGQPWVTDETNDTDAYARNRLR 202
>gi|33864611|ref|NP_896170.1| MesJ-like protein [Synechococcus sp. WH 8102] >gi|33632134|emb|CAE06590.1| possible MesJ homolog [Synechococcus sp. WH 8102] (349 aa)
Score = 152, Expect = 2.2e-08, Identities = 48/171 (28%), Positives = 86/171 (50%)
  Q:    10 VSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR--AMYYGIKTRGELY-----GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGG DSM LL       +L+H  +  + H ++   + +      +  +C+Q  +P+ V   P+ +      +A AR  R+ Q Q+ A     D ++  H   D  E   +QL AR    A    ++    L+     G ++ RP + + + +  A+C + +VP   D +N  P + RN++R E+
  S:    51 VSGGQDSMALLVLLQELQRLHHWPLN-IWHGDHGWHSGSAVIAADLRSWCQQRDLPIQVDQAPQGST---ASEASARHWRYSQLQQRAEELGAD-VVTGHTASDRAETLLLQL-ARGTDLAGLGALRPVRPLFNDSPDGAQLRRPLLGFSRADTAAVCRDLQVPIWHDPSNQSPAFARNRIRAEV 229
>gi|149013373|ref|ZP_01834082.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP19-BS75] >gi|182682980|ref|YP_001834727.1| mesJ/ycf62 family protein [Streptococcus pneumoniae CGSP14] >gi|194398531|ref|YP_002036732.1| tRNA(Ile)-lysidine synthase [Streptococcus pneumoniae G54] >gi|147762896|gb|EDK69844.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP19-BS75] >gi|182628314|gb|ACB89262.1| mesJ/ycf62 family protein [Streptococcus pneumoniae CGSP14] >gi|194358198|gb|ACF56646.1| tRNA(Ile)-lysidine synthase [Streptococcus pneumoniae G54] (425 aa)
Score = 152, Expect = 2.5e-08, Identities = 58/235 (24%), Positives = 112/235 (47%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKR---YPLPDQRQLVYSFL 241
           +  +SGG DSM L K+   Y K++     + HVN+ +R  +  ++K + +   + ++P+ +     +       +A+AR  R++ FQ+         L+ AHH DD +E   M+L    R  Y  GIK +  +  +++ RPF+ + K +  ++       +  D +N +  Y RN++R       ++E   F   +      IG ++        +   + DV  L++   Y    QR L+ ++L
  S:    23 VLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFS-----EARARNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDFPSIF------HFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILG----IGNEILDYDLAIAELSNNIDVENLQQLFSYSESTQRVLLQTYL 252
>gi|166033184|ref|ZP_02236013.1| hypothetical protein DORFOR_02906 [Dorea formicigenerans ATCC 27755] >gi|166027541|gb|EDR46298.1| hypothetical protein DORFOR_02906 [Dorea formicigenerans ATCC 27755] (516 aa)
Score = 152, Expect = 2.5e-08, Identities = 62/178 (34%), Positives = 95/178 (53%)
  Q:     3 KTQYIAGVSGGPDSMLLL----KLYHKKIAC--------VVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVH--TVPE-DTVWKKNFQAQARKIRFEQFQKAASLYK-----------------------------VDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K + I GVSGG DS+ LL    KL  ++            VHV++  R  +A  D++ V + C    VPL+V+   + E    W  + +   RK R E F +  + Y                                K+ LAHHR+D  E     L    D R      G+     + G  + RP +   +NEI +  E+  + Y  DETNA+ +Y RN++R ++
  S:    18 KDRVIVGVSGGADSVCLLFVLTKLRDERQKSGDGTLEITAVHVHHGLRGDSADADERYVRKICDAWNVPLVVYHKNIRELAKCWNMSEEEAGRKARREAFLEVRNQYSDVPCDNAQYGDIQSRHAECANGRQESAQGFGKIALAHHRNDEAETVLFHLCRGTDVR------GLGGIAPVSGFWI-RPLLNIGRNEIESYLEKVGISYCTDETNAENVYARNKLRNQV 237
>gi|61217331|sp|Q7UA26|TILS_SYNPX tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (337 aa)
Score = 152, Expect = 2.5e-08, Identities = 48/171 (28%), Positives = 86/171 (50%)
  Q:    10 VSGGPDSMLLL-------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR--AMYYGIKTRGELY-----GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGG DSM LL       +L+H  +  + H ++   + +      +  +C+Q  +P+ V   P+ +      +A AR  R+ Q Q+ A     D ++  H   D  E   +QL AR    A    ++    L+     G ++ RP + + + +  A+C + +VP   D +N  P + RN++R E+
  S:    39 VSGGQDSMALLVLLQELQRLHHWPLN-IWHGDHGWHSGSAVIAADLRSWCQQRDLPIQVDQAPQGST---ASEASARHWRYSQLQQRAEELGAD-VVTGHTASDRAETLLLQL-ARGTDLAGLGALRPVRPLFNDSPDGAQLRRPLLGFSRADTAAVCRDLQVPIWHDPSNQSPAFARNRIRAEV 217
>gi|194335822|ref|YP_002017616.1| tRNA(Ile)-lysidine synthetase [Pelodictyon phaeoclathratiforme BU-1] >gi|194308299|gb|ACF42999.1| tRNA(Ile)-lysidine synthetase [Pelodictyon phaeoclathratiforme BU-1] (328 aa)
Score = 151, Expect = 2.8e-08, Identities = 48/176 (27%), Positives = 84/176 (47%)
  Q:     5 QYIAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +  VSGGPDSM +L L+       +    V H N+  R   +  D+  V ++C+ L +   V    T+     WK++ +  AR +R+  F++        K+   HH +D  E     L       + G+   G L G+     K+ RP + + K +++A  +E  +    D +N    Y RN +R  +
  S:    23 RVLVAVSGGPDSMAMLSLFCAVRPLLRAELAVAHCNFQLRGAESDGDESFVLDHCRSLDLECFVDHFDTLRFAGEWKRSVEESARILRYTFFRQVMEQKGFSKIATGHHVNDNAETILFNL-------FRGVSLPG-LRGIRALNGKIIRPMLLFHKADMVAYLKEKGITSRTDTSNYANDYDRNFIRNRV 205
>gi|145344203|ref|XP_001416626.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144576852|gb|ABO94919.1| predicted protein [Ostreococcus lucimarinus CCE9901] (714 aa)
Score = 151, Expect = 2.9e-08, Identities = 49/212 (23%), Positives = 103/212 (48%)
  Q:     9 GVSGGPDSMLLLK-LYHKKIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPL---IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYK-RNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHP 220
            +SGG DSM+L   L H+    V +H++Y  R  +  +   V+++  +  +      V  +      ++ ++ ++R+IR+  +++A + +    +LL HH  D  E     L      +   G+   G + G++++RP + + K+++L     + +PY +D T   P +  R ++R ++       ++ F IG+     VIG+    L +   + L  P
  S:   259 SLSGGVDSMVLAYILKHQGYDVVTLHIDYKNRPESTEEADFVDDWSLRHGMKFERCTVDQIRRGVTPREQYEIESRRIRYGFYKEAGAKHGFPAVLLGHHHGDVQENIITNLMRGANLLSVNGMSDEGVVEGVRIWRPMLSHVKDDVLTFAHAYGIPYFLDST---PTWSTRGKLRNQLVPLL---EDMFGIGLLRNLSVIGENSEQLSEMVDKSLFKP 471
>gi|119946581|ref|YP_944261.1| tRNA(Ile)-lysidine synthetase [Psychromonas ingrahamii 37] >gi|119865185|gb|ABM04662.1| tRNA(Ile)-lysidine synthetase [Psychromonas ingrahamii 37] (460 aa)
Score = 151, Expect = 2.9e-08, Identities = 49/178 (27%), Positives = 81/178 (45%)
  Q:     9 GVSGGPDSMLLLKLYHKKIA-------CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
            +SGG DS++LL L+ +  A       C  H+N+     A   Q   E  C  L V      V  +   + + +A AR+ R+       +L     L+ AHH+DD +E   + L          GI+   +L    + RP + + + ++ A  E  ++ +  DE+N    + RN +RQ I    KE
  S:    31 ALSGGLDSVVLLHLFTRLRAFDKKYSLCAHHINHGLSDNAAHWQLFCENLCASLAVDFCCSPVILEKKNRTSLEALAREKRYACL--TGNLLDNSYLITAHHQDDQLETVLLALKRGSGSTGLQGIQKMQKLQKGHLIRPLLNFSRQQLAAYAELFQLDWVEDESNQDQDFDRNFIRQTITPLLKE 214
>gi|195998279|ref|XP_002109008.1| hypothetical protein TRIADDRAFT_52590 [Trichoplax adhaerens] >gi|190589784|gb|EDV29806.1| hypothetical protein TRIADDRAFT_52590 [Trichoplax adhaerens] (462 aa)
Score = 150, Expect = 3.4e-08, Identities = 52/188 (27%), Positives = 85/188 (45%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKL---YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVP-LIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARK-----RAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKE 189
           P T     VSGG DS+ L  L   Y +K+  +  V++  R  + ++ + V E   +L +P  IV       V  +  Q  AR  R+    +      +  LL  HH +D IE    +L  +        M      R     + + RP + + K ++  +C ++KV +  D +N   +YKRNQ+RQ +A      K 
  S:    15 PSTPVALAVSGGVDSISLCVLARQYFQKLFAIT-VDHRLRAESSQEAQNVNEILDKLNIPHKIVSCNWNQEVNFRKVQELARLKRYRLLGEECQNQNIQYLLTGHHLNDQIETFIFRLSCKSGIDGLSCMKLSQNLRLHFPPITLIRPLLSFQKTQLQEVCHQNKVIWIEDPSNMSLMYKRNQIRQGLAALQNSSKN 210
>gi|149236285|ref|XP_001524020.1| hypothetical protein LELG_04833 [Lodderomyces elongisporus NRRL YB-4239] >gi|146452396|gb|EDK46652.1| hypothetical protein LELG_04833 [Lodderomyces elongisporus NRRL YB-4239] (523 aa)
Score = 150, Expect = 3.5e-08, Identities = 52/175 (29%), Positives = 93/175 (53%)
  Q:     4 TQYIAGVSGGPDSMLL---LKLYHKKIAC------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP---EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTR------------------GELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQP-IYKRNQVRQ 178
           T+   G+SGGPDSMLL   LK  ++++         + ++++ R  +  + + +        +   + ++     D     NF+  AR  RFE         ++  L L HH+DD +E    +L     ++Y    TR                  G+++   + RP + ++K++I+  CE H +PY ID TN  P + +RN +RQ
  S:    24 TKVGIGLSGGPDSMLLSWLLKTTNEQLMNNRLKIHAITIDHSFRAGSKVEAQKLTPTMNNWGIKHSIKSLDYGDADPKLFTNFEEIARIKRFEALNDLCCEQRIPFLFLGHHKDDQVETFVQRLQGNS-SIYGLAGTRQVSPLPSSRDLPPLETKDGQVF---LVRPLLDFYKDDIVKTCELHNIPYVIDPTNKNPKLTRRNFLRQ 225
>gi|89891402|ref|ZP_01202908.1| tRNA(Ile)-lysidine synthase [Flavobacteria bacterium BBFL7] >gi|89516433|gb|EAS19094.1| tRNA(Ile)-lysidine synthase [Flavobacteria bacterium BBFL7] (443 aa)
Score = 150, Expect = 3.5e-08, Identities = 50/180 (27%), Positives = 92/180 (51%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKI--ACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNF----QAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + + + +  +SGG DS++L  L         + H N+N R + + +D++ V E   + K+   V T  E + +  +     Q  AR++R++ F      +  D +L AHH DD IE   + L+  + A   G++   +L G  V RP + + + +I+      +V +  D +N    Y+RNQ+R +I
  S:    16 LKENRLLIAISGGLDSVVLTHLLFNAGYDITLAHCNFNLRDSESDQDEQFVRELADRFKIDCHV-TQFETSQYASDHGVSTQMAARELRYDFFNDLCKDHNYDFILTAHHLDDQIETFFINLN--RGAGLKGLQGIPQLNG-NVIRPLLPFSREQIMEYAMNSQVLWREDSSNRSNKYQRNQLRNQI 198
>gi|125622900|ref|YP_001031383.1| cell cycle protein mesJ [Lactococcus lactis subsp. cremoris MG1363] >gi|124491708|emb|CAL96627.1| cell cycle protein mesJ [Lactococcus lactis subsp. cremoris MG1363] (422 aa)
Score = 150, Expect = 3.9e-08, Identities = 72/277 (25%), Positives = 127/277 (45%)
  Q:     4 TQYIAGVSGGPDSMLLLK-LYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKM-QLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNR-------VIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITH-HIDVTGDKIDAILDFIQPFQQKHYRL-KDEIFLSIKD 280
           ++ +  +SGG DSM L   LY  +        + H+N+  R  +  +++ + +    L++P+ V     D    +  + +AR+ R+  F+K       D LL AHH+ D +E   M Q+  R      GI         ++ RP +K+ K E+ A        +  D TN    Y RN++R ++     +E  +F   +  ++        VI QK+  L    ++   H  + + K      Q  ++ +F   +  I V+  K + IL  I+  QQ   +L KD  F+  KD
  S:    22 SKILLALSGGKDSMTLFNWLYELRAKLHIELGIAHINHGLRPESDFEEQALRKMASDLEIPIFV-----DRFTGEFTEQKAREFRYHFFEKIMIAENYDVLLTAHHQGDVVETVLMRQITGRPLRSLQGIADCQPFAKGQLIRPLLKFTKEELDAAV------FYEDSTNQGVDYFRNRIRNQLIPELTKENPQFSQAISDLSSEIKMALTVINQKISELEIVDEKISYHKFISQTKEL----QHFILQAFFAQYPEIKVSKKKFEEILHIIRRPQQYSAQLNKDFQFVKTKD 299
>gi|157150417|ref|YP_001451360.1| tRNA(Ile)-lysidine synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|189035973|sp|A8B000.1|TILS_STRGC tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157075211|gb|ABV09894.1| tRNA(Ile)-lysidine synthetase [Streptococcus gordonii str. Challis substr. CH1] (425 aa)
Score = 150, Expect = 4.0e-08, Identities = 50/171 (29%), Positives = 86/171 (50%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +  +SGG DSM LL L   Y K++     + H+N+ +R  A +++K ++E  ++L V ++  +     V+    +  AR  R+  F+K         L+ AHH DD  E   M++    R  Y  G+K R    G ++ RP +++ K +         V +  D +N +  Y RN+VR
  S:    23 LLAISGGLDSMTLLNLLYKYQKELDIELILAHINHKQRIEADQEEKQLKEIAQKLGVKILTSSFS--GVFS---EKSARDFRYNFFKKVMQEEDCTALVTAHHADDQAETIFMRILRGSRLRYLSGMKDRQPFGGGELIRPLLEFSKTDFPT------VFHFEDASNFENTYFRNRVR 189
>gi|148264776|ref|YP_001231482.1| tRNA(Ile)-lysidine synthetase [Geobacter uraniireducens Rf4] >gi|146398276|gb|ABQ26909.1| tRNA(Ile)-lysidine synthetase [Geobacter uraniireducens Rf4] (459 aa)
Score = 149, Expect = 4.4e-08, Identities = 51/185 (27%), Positives = 82/185 (44%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA-----CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           P    +  VSGG DS+ LL +     +      VVH+N+  R   +  D+  V E   +  V  +   V    + K+   + +   R  R+  F + A+  K   ++LAHH DD  E   M+L   + A   G+            RP +   + EI A   E  + +  D +NA   + RN+VR E+  + K 
  S:    17 PGDTVVVAVSGGADSVALLDVLAGFSSLRLRLIVVHLNHCLRGAESDADEAFVRELAGKYGVTFVTQAVDVQDLSKREKLSLEEAGRAARYRFFSEIAASCKARAVVLAHHADDQAETVLMRL--LRGAGGSGLCAMAAKSAGMYVRPLLSVTRFEIEAYLRERGLVFRTDSSNADVNFLRNRVRHELIPFLKS 208
>gi|188584569|ref|YP_001928014.1| tRNA(Ile)-lysidine synthetase [Methylobacterium populi BJ001] >gi|179348067|gb|ACB83479.1| tRNA(Ile)-lysidine synthetase [Methylobacterium populi BJ001] (342 aa)
Score = 149, Expect = 4.6e-08, Identities = 48/166 (28%), Positives = 76/166 (45%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHT--VPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELY-GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNA 167
           P    +  VSGGPDS  L+    +       V  V++  R  +  +   V     +L +P    T  VP         QA+AR  R++     A+      +L AH  DD  E   M+L A    +   G+     L  G+++ RPF+   K +++A CE H++P+  D +NA
  S:    23 PAVTALLAVSGGPDSTALMHAAARSGRAGLRVATVDHALRPDSAEEAAEVGRLAARLGLPHATLTWDVPR---RGSRIQAEARAARYQLLADHAARIGAGLVLTAHTLDDQAETVLMRLIAGSGPSGLAGMPVERPLAPGIRLVRPFLDLPKADLVAYCEAHRLPFLRDPSNA 192
>gi|154248857|ref|YP_001409682.1| tRNA(Ile)-lysidine synthetase [Fervidobacterium nodosum Rt17-B1] >gi|154152793|gb|ABS60025.1| tRNA(Ile)-lysidine synthetase [Fervidobacterium nodosum Rt17-B1] (457 aa)
Score = 149, Expect = 4.6e-08, Identities = 51/183 (27%), Positives = 88/183 (48%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKK------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +  VSGG DS+++L L+++          V   N+  RT A  +   V+++C+ L +P            ++N    +  AR +R+E  ++ A       +  AH+ +D +E   + L   K    +G+     + G+ + RP I + + EI    +E K+ Y ID TN    Y RN VR +I    KE
  S:    36 SSVLLAVSGGVDSIVMLDLFNRAKDELLINIGVATFNHKLRTEADDEVIFVQKFCEGLGIPFFPGEADVKMYCEQNKLSIEEGARILRYEFLKRTAKENGYSFIATAHNANDLLET--IILRQIKGTGPFGLAAIKPINGIFI-RPLIFFTRKEIEEYAKERKLEYVIDRTNFDIEYNRNFVRHKIVPLLKE 224
>gi|153952817|ref|YP_001393582.1| TilS [Clostridium kluyveri DSM 555] >gi|146345698|gb|EDK32234.1| TilS [Clostridium kluyveri DSM 555] (462 aa)
Score = 149, Expect = 4.8e-08, Identities = 48/174 (27%), Positives = 92/174 (52%)
  Q:     7 IAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I  VSGGPDS+ LL + +             HVN+  R     +D++ V+++C+ L V         + + K+   + ++  R++R++ F++     K +K+ +AH+ +D  E   M++   + A   G+     +      RP I+  ++EI   C+ + +   ID+TN + IY RN++R E+
  S:    22 IVAVSGGPDSICLLHMLYVLQNRLDITLYAAHVNHCLRGEEGDKDEEYVKKFCESLSVEFKSLKTDVNYIAKEKRISCESAGREVRYKFFEELKKKLKAEKIAIAHNANDQAETVLMRI--MRGAGLQGLTGINPVRDNVFVRPLIRITRDEIEKYCDNNNLHPRIDKTNLETIYSRNKIRLEL 203
>gi|148360562|ref|YP_001251769.1| cell cycle protein MesJ [Legionella pneumophila str. Corby] >gi|148282335|gb|ABQ56423.1| cell cycle protein MesJ [Legionella pneumophila str. Corby] (431 aa)
Score = 149, Expect = 4.8e-08, Identities = 51/174 (29%), Positives = 79/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV---YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I G SGG DS +LL +             VH+N+     +L  Q+  E+ C  L +  I   +  D     N +  AR  R++ F  ++ L   D L+L HH DD  E   +QL   + A   G+    E   + V    RPF+   + E+      H++ +  DE+N    Y RN +R  +
  S:    21 IVGFSGGLDSTVLLHVLASTPPLSNQLLAVHINHGISGNSLNWQRHCEQLCLDLGIAFIAKAIEFDR--SANVEEAARNARYDFF--SSLLEDNDCLVLGHHLDDQAETVLLQL--FRGAGVDGLAAMQECSNLGVGQLARPFLTCPRVELEHYARIHELKWIEDESNQDTKYSRNYLRHRV 196
>gi|139472899|ref|YP_001127614.1| PP-loop family protein [Streptococcus pyogenes str. Manfredo] >gi|134271145|emb|CAM29355.1| PP-loop family protein [Streptococcus pyogenes str. Manfredo] (428 aa)
Score = 149, Expect = 5.0e-08, Identities = 67/272 (24%), Positives = 125/272 (45%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH------IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  Y  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E       +Q + +  FL+  +      +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRYLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFN-----EQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYYYLKKDYYIFI 291
>gi|56418595|ref|YP_145913.1| hypothetical protein GK0060 [Geobacillus kaustophilus HTA426] >gi|61216398|sp|Q5L3T3|TILS_GEOKA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56378437|dbj|BAD74345.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (464 aa)
Score = 149, Expect = 5.1e-08, Identities = 51/186 (27%), Positives = 84/186 (45%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQ-KMVEEYC---------KQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           I GVSGGPDS+ LL ++       K      HV++  R     ++ + V+ +C          Q+ VP    +           Q  AR  R+  F +    ++   + + HH DD +E   M+L        Y GI  +   +G  + RPF+   + EI A C +  +    D +N +  Y RN+ R  I    ++E    +
  S:    22 IVGVSGGPDSLALLHVFLSLRDEWKLQVIAAHVDHMFRGRESEEEMEFVKRFCVERRILCETAQIDVPAFQRSA------GLGAQEAARICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGGYLIRPFLAVSRAEIEAYCRQMGLSPRCDPSNEKDDYTRNRFRHHIVPLLRQENPRLH 218
>gi|78187463|ref|YP_375506.1| MesJ protein [Pelodictyon luteolum DSM 273] >gi|78167365|gb|ABB24463.1| MesJ protein [Pelodictyon luteolum DSM 273] (332 aa)
Score = 149, Expect = 5.1e-08, Identities = 50/174 (28%), Positives = 80/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIAC---VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DSM LL L+      + C   VVH N+  R   +  D+  V E  + + +P  V    T+      +++ + +AR +R+  FQ+        K+   HH  D  E     L       + G+ T   L G++     + RP +   + EI    ++    Y  D TNA   Y RN +R  +
  S:    31 LVAVSGGADSMALLTLFIAVQAALGCTLAVVHCNFGLRGAESDADEAFVRECARLMGLPCFVRQFDTLASSVAARRSVEEEARVLRYGYFQEIIEREGYTKVATGHHVGDNAETMLFNL-------FRGV-TLPSLRGIRSRRGHIIRPLLFMHRAEIEEYLKQQGTGYRTDATNADDRYDRNFIRNRV 211
>gi|78183658|ref|YP_376092.1| MesJ-like protein [Synechococcus sp. CC9902] >gi|78167952|gb|ABB25049.1| possible MesJ-like [Synechococcus sp. CC9902] (337 aa)
Score = 149, Expect = 5.5e-08, Identities = 61/235 (25%), Positives = 102/235 (43%)
  Q:     7 IAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELY-----GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVC----------AMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFL 241
           +  VSGG DSM LL L       H+    + H +++    + +    + ++C    +PL + T PED       +A AR  R+    +    ++ D +   H   D  E   MQ+      A    ++    L      G ++ RP + + + E   +C + ++P   D  N  P + RN++R E+        EE   G            +  R     L +L     Q  A  D + L R P P +RQL+  +L
  S:    36 VVAVSGGQDSMALLGLLRDLMPVHQWRLVLWHGDHHWHPHSSQIASELNQWCDGQTLPLQIDTAPEDV---PQTEADARSWRYRCLTQLTHTHRADAVT-GHTASDRAETLLMQMSRGSDLAGLGSLRAVRPLQAHAPEGPQLRRPLLGFRRKETAQICSDLQLPIWNDPGNQSPDFARNRIRHEV----MPVLEELNPGCSRRLADFAERMSQLRDTQHNLAALALTTLQNKAGLDRKALGRLPQPTRRQLLAQWL 284
>gi|121535066|ref|ZP_01666883.1| tRNA(Ile)-lysidine synthetase [Thermosinus carboxydivorans Nor1] >gi|121306316|gb|EAX47241.1| tRNA(Ile)-lysidine synthetase [Thermosinus carboxydivorans Nor1] (468 aa)
Score = 149, Expect = 5.6e-08, Identities = 48/176 (27%), Positives = 81/176 (46%)
  Q:     5 QYIAGVSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +   SGGPDS+ L+ L H+          V HV++  R   + R+ + V  +C++L +   V  +    V  +   + Q  AR +R+   ++ A      K+   HHRDD  E   +         +      G L GM+     + RP +   + EI   C    +   +D +N    Y RN+VR E+
  S:    21 RVVVACSGGPDSLALVHLLHRLQPAYGFDMVVAHVDHMLRGAESAREAEFVRAFCRRLGLDCQVAAIDVPGVLAERGGSTQEVARTLRYAFLRRVADSLGGAKIATGHHRDDQAETVLIN--------FLRGAGPGGLRGMQPAAGGIIRPLLSVTRQEIEDYCAAEGLTPCLDSSNLHTDYLRNRVRLEL 203
>gi|37680722|ref|NP_935331.1| cell cycle protein MesJ [Vibrio vulnificus YJ016] >gi|61217308|sp|Q7MIH8|TILS_VIBVY tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|37199471|dbj|BAC95302.1| cell cycle protein MesJ [Vibrio vulnificus YJ016] (436 aa)
Score = 149, Expect = 5.6e-08, Identities = 50/193 (25%), Positives = 87/193 (45%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKI------ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE---LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
            T+ +   SGG DS +LL+L H+         C VHV++     A +  +    +C++  +PL V  V  D     + + +AR  R++  +  A +   D LL   H DD +E   + L  ++ +   G+ +  +       ++ RP +   + EI        + +  DE+N    Y RN +RQ+I     E    F   V
  S:    19 NTRLVVAFSGGVDSRVLLELAHRYAQEHLLPCCAVHVHHGLSHNADQWVQSCAAWCQEKNIPLTVERVQLDLTQGNSIEEEARNARYQALR--AHINADDLLLTGQHADDQVETFLLAL--KRGSGPKGLSSMAQQMPFSQGRLIRPLLDVRRQEIERCAHAIGLNWVEDESNQDTRYDRNFLRQQILPALSERWPSFAASV 216
>gi|186457577|ref|ZP_02967888.1| tRNA(Ile)-lysidine synthetase [bacterium Ellin514] >gi|184206163|gb|EDU03211.1| tRNA(Ile)-lysidine synthetase [bacterium Ellin514] (457 aa)
Score = 148, Expect = 5.8e-08, Identities = 51/176 (28%), Positives = 90/176 (51%)
  Q:     5 QYIAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM------------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + + GVSGG DSM+LL++       H     V H+N++ R  ++  D+++V    ++L    +V         +K   + +  AR++R E   ++A    +  + LAHH DD +E   ++L         G  + G L GM             + RP ++  K+E+    ++  V +  D TN      RN+VR E+
  S:    27 RILVGVSGGLDSMVLLEVLSELASKHDWTLAVAHLNHSLRGRSSDADERLVRRTAERLGCQCVVERAEVRKFGRKAGLSLEMAARRLRHEFLARSARKLGIKVVALAHHADDQVELFLLRL-------LRGASSEG-LAGMDWKVASPVDKGLGLVRPLLEVRKSELEGFAQQEGVKFRKDATNESQEILRNRVRHEL 216
>gi|42521051|ref|NP_966966.1| cell cycle protein MesJ, putative [Wolbachia endosymbiont of Drosophila melanogaster] >gi|61217299|sp|Q73FR9|TILS_WOLPM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|42410792|gb|AAS14900.1| cell cycle protein MesJ, putative [Wolbachia endosymbiont of Drosophila melanogaster] (431 aa)
Score = 148, Expect = 6.0e-08, Identities = 61/217 (28%), Positives = 107/217 (49%)
  Q:     3 KTQYIAGVSGGPDSMLLLKL---YHKK----IACVVHVNYNKRTTALRDQKMVEEYCKQL--KVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT---RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH 219
             Q    VSGG DS++LL L   + KK    +   + VN+  R  + ++   V  Y K+L  K   I++   ++   K N Q QARK R++   +      V  LL+AHH+DD  E   ++L+  + +   G+ +   +  L G+ ++RP + + ++EI    + H++ +  D +N    Y+R   R  +     +E     I + A++          MKRA + L H
  S:    18 NNQVAVAVSGGVDSIVLLHLMTNWAKKNKLSLPIALTVNHGLRPESQKEADFVVSYAKELGAKESFILNWEKQNI--KGNIQLQARKARYKLLAEWCKNNNVKYLLVAHHKDDQAETFLLRLE--RGSGVDGLSSMDYKSFLNGIDIFRPLLNFSRSEIEKYAKLHRLKWIEDRSNHDLKYRRTLYRNLLKASDNQEILTERICLTALH----------MKRAAKALMH 232
>gi|39996909|ref|NP_952860.1| cell cycle protein MesJ, putative [Geobacter sulfurreducens PCA] >gi|61216575|sp|Q74C65|TILS_GEOSL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39983797|gb|AAR35187.1| cell cycle protein MesJ, putative [Geobacter sulfurreducens PCA] (471 aa)
Score = 148, Expect = 6.3e-08, Identities = 49/179 (27%), Positives = 87/179 (48%)
  Q:     2 PKTQYIAGVSGGPDSM----LLLKLYHKKIACVV-HVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHT--VPEDTVWKK-NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL-YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P  + +  VSGG DS+    +L+ L   ++  VV H+N+  R  A   D++ VE+  +   +P +     V     W++ + +   R+ R+  F   A+      + LAHH DD  E   M+L   + A   G+     +  G K  RP +   + EI A  +   + +  D++N    + RN++R E+
  S:    26 PGDRVVVAVSGGADSVALVDILVSLNELRLDLVVAHLNHKLRGAASDEDERFVEQCAQTYALPFVSRGEQVKALAEWERLSLEDAGRRARYAFFDDVAAACGARTVALAHHADDQAETLLMRL--VRGAGGLGLSAMQPVGAGGKYVRPLLALGRQEIEAYLDARGLAFRQDQSNTDVAFLRNRIRHEL 212
>gi|27365224|ref|NP_760752.1| cell cycle protein MesJ [Vibrio vulnificus CMCP6] >gi|61217354|sp|Q8DBE4|TILS_VIBVU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|27361371|gb|AAO10279.1|AE016803_66 Cell cycle protein MesJ [Vibrio vulnificus CMCP6] (436 aa)
Score = 148, Expect = 6.4e-08, Identities = 50/193 (25%), Positives = 87/193 (45%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKI------ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE---LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
            T+ +   SGG DS +LL+L H+         C VHV++     A +  +    +C++  +PL V  V  D     + + +AR  R++  +  A +   D LL   H DD +E   + L  ++ +   G+ +  +       ++ RP +   + EI        + +  DE+N    Y RN +RQ+I     E    F   V
  S:    19 NTRLVVAFSGGVDSRVLLELAHRYAQEHLLPCCAVHVHHGLSHNADQWVQSCAAWCQEKNIPLTVERVQLDLTQGNSIEEEARNARYQALR--AHINADDLLLTGQHADDQVETFLLAL--KRGSGPKGLSSMAQQMPFSQGRLIRPLLDVRRQEIERCAHAIGLHWVEDESNQDTRYDRNFLRQQILPALSERWPSFAASV 216
>gi|52841023|ref|YP_094822.1| cell cycle protein MesJ [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|61216449|sp|Q5ZXE5|TILS_LEGPH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|52628134|gb|AAU26875.1| cell cycle protein MesJ [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (433 aa)
Score = 148, Expect = 6.9e-08, Identities = 51/174 (29%), Positives = 80/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE---LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I G SGG DS +LL +             VH+N+     +L  Q+  E+ C  L +  I   +  D     N +  AR  R++ F  ++ L   D L+L HH DD  E   +QL   + A   G+    E   L   ++ RPF+   + E+      H++ +  DE+N    Y RN +R  +
  S:    23 IVGFSGGLDSTVLLHVLASTPPLSNQLLAVHINHGISGNSLNWQRHCEQLCLDLGIAFIAKAIEFDR--SANVEEAARNARYDFF--SSLLEDNDCLVLGHHLDDQAETVLLQL--FRGAGVDGLAAMQECSNLGAGQLARPFLTCPRVELEHYARIHELKWIEDESNQDTKYSRNYLRHRV 198
>gi|189502540|ref|YP_001958257.1| hypothetical protein Aasi_1198 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497981|gb|ACE06528.1| hypothetical protein Aasi_1198 [Candidatus Amoebophilus asiaticus 5a2] (454 aa)
Score = 148, Expect = 7.3e-08, Identities = 45/174 (25%), Positives = 81/174 (46%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIA--CVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DS+++  L+H+      + H N+  R   +  D+  V    +Q +V             K N    Q  AR++R+  F++  +++++DKL  AHH +D +E     L      A  +GI  +       + RP +   K  +L   +   + +  D +N Q  Y RN +R ++
  S:    31 LLAVSGGVDSVVMCSLFHEARLHFAIAHCNFGLRGQESEEDEAFVHTLAQQYQVEFFTKRFNTKAYAKTNKLSTQMAARELRYAWFKELCNIHQIDKLATAHHANDCLETVLFNLTKGTSIAGLHGILPKQN----NLIRPLLFASKENLLQYAQAKGLSWREDSSNKQDDYARNLIRHQV 207
>gi|54296810|ref|YP_123179.1| hypothetical protein lpp0850 [Legionella pneumophila str. Paris] >gi|61216438|sp|Q5X6W4|TILS_LEGPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|53750595|emb|CAH12000.1| hypothetical protein [Legionella pneumophila str. Paris] (431 aa)
Score = 147, Expect = 7.5e-08, Identities = 51/174 (29%), Positives = 80/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE---LYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           I G SGG DS +LL +             VH+N+     +L  Q+  E+ C  L +  I   +  D     N +  AR  R++ F  ++ L   D L+L HH DD  E   +QL   + A   G+    E   L   ++ RPF+   + E+      H++ +  DE+N    Y RN +R  +
  S:    21 IVGFSGGLDSTVLLHVLASTPPLSNQLLAVHINHGISGNSLNWQRHCEQLCLDLGIAFIAKAIEFDR--SANVEEAARNARYDFF--SSLLEDNDCLVLGHHLDDQAETVLLQL--FRGAGVDGLAAMQECSNLGAGQLARPFLTCPRVELEHYARIHELKWIEDESNQDTKYSRNYLRHRV 196
>gi|121613548|ref|YP_001001102.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|148925625|ref|ZP_01809313.1| hypothetical protein Cj8486_1491c [Campylobacter jejuni subsp. jejuni CG8486] >gi|157415678|ref|YP_001482934.1| hypothetical protein C8J_1359 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005997|ref|ZP_02271755.1| hypothetical protein Cjejjejuni_07600 [Campylobacter jejuni subsp. jejuni 81-176] >gi|87249823|gb|EAQ72782.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|145845635|gb|EDK22726.1| hypothetical protein Cj8486_1491c [Campylobacter jejuni subsp. jejuni CG8486] >gi|157386642|gb|ABV52957.1| hypothetical protein C8J_1359 [Campylobacter jejuni subsp. jejuni 81116] (321 aa)
Score = 147, Expect = 7.8e-08, Identities = 52/189 (27%), Positives = 89/189 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           +A   G   S+L   L  +KI   +V +NY  R  +  ++   +E   +    + +   P+   ++ NF+ +AR  R++ F+K       D L+LAHH +D  E   MQL      A   G++   +     + RP +   K+EI +  +E  + Y  DE+N    Y RN +R+   N+S     EF+ G+
  S:    18 LAFSYGSDSSVLFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPK---FQSNFEKKARDFRYDFFEKICLEQGYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK---NFSNAFVSEFHQGL 202
>gi|15792770|ref|NP_282593.1| hypothetical protein Cj1453c [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149480|ref|ZP_01067711.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88596817|ref|ZP_01100054.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|61216748|sp|Q9PMK7|TILS_CAMJE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|85840262|gb|EAQ57520.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88191658|gb|EAQ95630.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360762|emb|CAL35561.1| putative tRNA(Ile)-lysidine synthase [Campylobacter jejuni subsp. jejuni NCTC 11168] (321 aa)
Score = 147, Expect = 7.9e-08, Identities = 52/189 (27%), Positives = 89/189 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           +A   G   S+L   L  +KI   +V +NY  R  +  ++   +E   +    + +   P+   ++ NF+ +AR  R++ F+K       D L+LAHH +D  E   MQL      A   G++   +     + RP +   K+EI +  +E  + Y  DE+N    Y RN +R+   N+S     EF+ G+
  S:    18 LAFSYGSDSSVLFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPK---FQSNFEKKARDFRYDFFEKICLEQGYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK---NFSNAFVSEFHQGL 202
>gi|170768385|ref|ZP_02902838.1| tRNA(Ile)-lysidine synthase [Escherichia albertii TW07627] >gi|170122489|gb|EDS91420.1| tRNA(Ile)-lysidine synthase [Escherichia albertii TW07627] (431 aa)
Score = 147, Expect = 7.9e-08, Identities = 51/177 (28%), Positives = 88/177 (49%)
  Q:     1 MPKTQYIAGVSGGPDSMLLL------KLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +   Q +   SGG DS +LL      ++ +  +    +HV++     A       E  C+Q +VPL+V  V   E+ +     +AQAR+ R++ F  A +L   + L+ A H DD  E   + L  ++ +   G+   GE+    G ++ RP +   + E+     EH + +  DE+N    Y RN +R
  S:    10 LSSRQILVAFSGGLDSTVLLHQLVQWRMENPGVTLRAIHVHHGLSANADAWVMHCENICQQWQVPLVVERVQLAEEGL---GIEAQARQARYQAF--AHTLLPGEVLVTAQHLDDQCETFLLAL--KRGSGPAGLSAMGEVSDFAGTQLIRPLLARTRGELELWAHEHGLRWIEDESNQDDTYDRNFLR 191
>gi|29347003|ref|NP_810506.1| putative cell-cycle protein [Bacteroides thetaiotaomicron VPI-5482] >gi|61216643|sp|Q8A7D1|TILS_BACTN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29338901|gb|AAO76700.1| putative cell-cycle protein [Bacteroides thetaiotaomicron VPI-5482] (426 aa)
Score = 147, Expect = 8.1e-08, Identities = 46/177 (25%), Positives = 86/177 (48%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKK-IAC-VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIV---HTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +P  + +  +SGG DS+ LL++ H     C   H N++ R   + RD++ V + C++  + L +   +T    T  + + +  AR++R+  F+K         + +AHH+DD +E     L          GI+ R       + RP +   + EI+   ++    +  D TN +  Y RN++R
  S:    17 LPDDKLLVALSGGADSVALLRVLHTAGYQCEAAHCNFHLRGEESNRDERFVRQLCQKYGIRLHITDFNTTQYATEKRISIEMAARELRYNWFEKIKEECGAHVIAVAHHQDDSVETMLFNLIRGTGITGLLGIRPR----NGAIVRPLLCINREEIIRYLQQIGQDFVTDSTNLEDEYTRNKIR 196
>gi|171778208|ref|ZP_02919437.1| hypothetical protein STRINF_00276 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283032|gb|EDT48456.1| hypothetical protein STRINF_00276 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (421 aa)
Score = 147, Expect = 8.2e-08, Identities = 53/185 (28%), Positives = 94/185 (50%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIA---CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNF-QAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           +  VSGG DSM LL    +Y KK+     + HVN+ +R  +  ++  + E+ K+ ++P+ V        +   F +  AR  R++ F++  + +    L+ AHH DD  E   M+L   +R R +  G++T       ++ RPF+ Y K E+  +       +  D+TN    + RN++R       +EE  +F
  S:    22 LIAVSGGVDSMNLLHFLYIYRKKLGVDIAIAHVNHKQRLESDTEEAYLREWAKEHQIPIYV------AYFSGAFSETAARDFRYKFFKELMAEHSYTALVTAHHADDQAETIFMRLLRGSRLRHL-SGMQTVNAFGDGELIRPFLAYSKKELPDIF------HFEDDTNRSLDFLRNRIRNHYFPILEEENPKF 202
>gi|117617562|ref|YP_855748.1| tRNA(Ile)-lysidine synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117558969|gb|ABK35917.1| tRNA(Ile)-lysidine synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (446 aa)
Score = 147, Expect = 8.2e-08, Identities = 56/170 (32%), Positives = 85/170 (50%)
  Q:    11 SGGPDSMLLLKL---YHKKIACVV---HVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGI--DETNAQPIYKRNQVRQEI 180
           SGG DS +LL L   + ++   V+   HV++     A       E  C+QL VPL+V  V        + +AQAR+ R+     AA L + + LL AHH+DD +E   + L   A  R +  G+       G  + RP ++  + E+        +PYG   DE+N    Y RN +RQ +
  S:    27 SGGLDSTVLLVLAAQFAREQGLVLRALHVHHGLSPNADEWVAHCETVCQQLAVPLLVERVQLQRDSGDSLEAQAREARY--LCLAAQLGEGEWLLTAHHQDDQLETLLLALKRGAGLRGL-AGMVPSQPFAGGLLLRPLLEVSRTELAD--AAASLPYGWVEDESNQDESYDRNFLRQRL 201
>gi|19745210|ref|NP_606346.1| putative cell-cycle protein [Streptococcus pyogenes MGAS8232] >gi|61217382|sp|Q8P322|TILS_STRP8 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|19747299|gb|AAL96845.1| putative cell-cycle protein [Streptococcus pyogenes MGAS8232] (428 aa)
Score = 147, Expect = 8.5e-08, Identities = 67/272 (24%), Positives = 125/272 (45%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH------IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  Y  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E       +Q + +  FL+  +      +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRYLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFN-----EQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQIAKQGYYYLKKDYYIFI 291
>gi|86151954|ref|ZP_01070167.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841062|gb|EAQ58311.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 260.94] (321 aa)
Score = 147, Expect = 8.5e-08, Identities = 52/189 (27%), Positives = 89/189 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           +A   G   S+L   L  +KI   +V +NY  R  +  ++   +E   +    + +   P+   ++ NF+ +AR  R++ F+K       D L+LAHH +D  E   MQL      A   G++   +     + RP +   K+EI +  +E  + Y  DE+N    Y RN +R+   N+S     EF+ G+
  S:    18 LAFSYGSDSSVLFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPK---FQSNFEKKARDFRYDFFEKICLEQGYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK---NFSNAFVSEFHQGL 202
>gi|124006425|ref|ZP_01691259.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Microscilla marina ATCC 23134] >gi|123988082|gb|EAY27753.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Microscilla marina ATCC 23134] (450 aa)
Score = 147, Expect = 8.8e-08, Identities = 50/179 (27%), Positives = 88/179 (49%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLY-----HKKIACVVHVNYNKRTTALR-DQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P+   +  VSGG DS++L  L+     H ++A + H N+  R  A   D++ V++  +   +P  V      T+    K + Q  AR +R+  F++  +      L  AHH++D +E   + L      A  +GIK +       + RP +   + EI A  +E  + +  D +N    Y RN++R E+
  S:    17 PQDNILLAVSGGIDSVVLTDLFAQIKSHGQVA-IAHCNFQLRGVASEEDEEFVKQLAQHYGIPCFVTRFDTYTLAQAQKGSIQMIARNLRYAWFEQLRTKEGYHYLATAHHQNDMVETVLLNLVRGTGIAGLHGIKVKQG----HIIRPMLFASREEIEAYAQEKGLKWCEDASNQDNKYYRNRLRNEV 200
>gi|58698494|ref|ZP_00373399.1| cell cycle protein MesJ [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534988|gb|EAL59082.1| cell cycle protein MesJ [Wolbachia endosymbiont of Drosophila ananassae] (431 aa)
Score = 147, Expect = 9.2e-08, Identities = 61/217 (28%), Positives = 107/217 (49%)
  Q:     3 KTQYIAGVSGGPDSMLLLKL---YHKK----IACVVHVNYNKRTTALRDQKMVEEYCKQL--KVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT---RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH 219
             Q    VSGG DS++LL L   + KK    +   + VN+  R  + ++   V  Y K+L  K   I++   ++   K N Q QARK R++   +      V  LL+AHH+DD  E   ++L+  + +   G+ +   +  L G+ ++RP + + ++EI    + H++ +  D +N    Y+R   R  +     +E     I + A++          MKRA + L H
  S:    18 NNQVAVAVSGGVDSIVLLHLMTNWAKKNKLSLPTALTVNHGLRPESQKEADFVVSYAKELGAKESFILNWEKQNI--KGNIQLQARKARYKLLAEWCKNNNVKYLLVAHHKDDQAETFLLRLE--RGSGVDGLSSMDYKSFLNGIYIFRPLLNFSRSEIEKYAKLHRLKWIEDRSNYDLKYRRTLYRNLLKASDNQEILTERICLTALH----------MKRAAKALMH 232
>gi|83816193|ref|YP_445830.1| tRNA(Ile)-lysidine synthetase [Salinibacter ruber DSM 13855] >gi|83757587|gb|ABC45700.1| tRNA(Ile)-lysidine synthetase [Salinibacter ruber DSM 13855] (468 aa)
Score = 147, Expect = 9.4e-08, Identities = 53/174 (30%), Positives = 81/174 (46%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYC--KQLKVPLIV-------HTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYG---MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +   SGG DSM  L +  +    V  +HVNY  R  A  D+ +V  +C  +   VPL V           ED    ++ QA AR++R++    AA+      +   HHRDD  E   + L          G++    L     + + RP +   ++ I A  E   +P+  D TN +  Y R  +R EI
  S:    25 LVAASGGVDSMTCLSVLRRLDVDVHALHVNYGLRAGADGDEALVRRWCHEQSPAVPLSVVALDAEARAASED----ESLQAAARRLRYDALAAAAAEIGAPVVATGHHRDDQAETLLLNLVRGSGPEGVAGMRPARPLEADPSVSLVRPLLDARRDAIEAYAESMGLPWRTDPTNQRHDYDRGVIRTEI 209
>gi|42572523|ref|NP_974357.1| RSY3 (RASPBERRY 3); ATP binding / ligase, forming carbon-nitrogen bonds / nucleotide binding [Arabidopsis thaliana] (660 aa)
Score = 146, Expect = 9.8e-08, Identities = 50/181 (27%), Positives = 92/181 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK----KIACV------------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYG--------------MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           P  +   GVSGGPDSM L  L  K     ++CV            + V++  R  +  + ++V     Q+ +   + +   D V  +    + Q  AR++R+E         +++ LL+AHH DD  E   ++L      +   G     E++               +++ RP +  WK ++  +C+  +  +  D TN   ++ RN++R  I N
  S:    83 PHNRIALGVSGGPDSMALCVLTAKWKTEGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC--DWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDAKHMKNQSIRLVRPLLDLWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGN 296
>gi|171058356|ref|YP_001790705.1| tRNA(Ile)-lysidine synthetase [Leptothrix cholodnii SP-6] >gi|170775801|gb|ACB33940.1| tRNA(Ile)-lysidine synthetase [Leptothrix cholodnii SP-6] (457 aa)
Score = 146, Expect = 9.8e-08, Identities = 52/178 (29%), Positives = 85/178 (47%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACV--------VHVNYNKRTTALRDQKMVEEYCKQLKVP---LIVHT--VPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           KT+     SGG DS  LL   H  +AC         +HV +     A       E  C+ L +    L +HT  +       ++ +A AR+ R+      A     D +LLAHHRDD +E     L A + A   G+     +    G+   RP++   ++ I +  + H + +  D++NA P + RN++R  +
  S:    12 KTRIAVAYSGGRDSSALL---HATVACAAARVDVHALHVQHGLSAFAPDWLAHCERRCRALSLQGARLWLHTRSLALQPARGESIEALARRERYRALASMAREAGCDTVLLAHHRDDQVE--TFLLQALRGAGAAGLSAMPSIAWREGLTWARPWLDRPRSAIQSYVDAHALEFVEDDSNASPRHARNRLRLTV 200
>gi|116510859|ref|YP_808075.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactococcus lactis subsp. cremoris SK11] >gi|116106513|gb|ABJ71653.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactococcus lactis subsp. cremoris SK11] (422 aa)
Score = 146, Expect = 9.9e-08, Identities = 71/277 (25%), Positives = 127/277 (45%)
  Q:     4 TQYIAGVSGGPDSMLLLK-LYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKM-QLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNR-------VIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITH-HIDVTGDKIDAILDFIQPFQQKHYRL-KDEIFLSIKD 280
           ++ +  +SGG DSM L   LY  +        + H+N+  R  +  +++ + +    L++P+ V     D    +  + +AR+ R+  F+K       D LL AHH+ D +E   M Q+  R      GI         ++ RP +K+ K E+ A        +  D TN    Y RN++R ++     +E  +F   +  ++        VI Q++  L    ++   H  + + K      Q  ++ +F   +  I V+  K + IL  I+  QQ   +L KD  F+  KD
  S:    22 SKILLALSGGKDSMTLFNWLYELRAKLHIELGIAHINHGLRPESDFEEQSLRKMASDLEIPIFV-----DRFSGEFTEQKAREFRYHFFEKIMIAENYDVLLTAHHQGDVVETVLMRQITGRPLRSLQGIADCQPFAKGQLIRPLLKFTKEELDAAV------FYEDSTNQGVDYFRNRIRNQLIPELTKENPQFSQAISDLSSEIKMALTVINQRISELEIIDEKISYHKFISQTKEL----QHFILQAFFAQYPEIKVSKKKFEEILHIIRRPQQYSAQLNKDFQFVKTKD 299
>gi|189184491|ref|YP_001938276.1| MesJ protein [Orientia tsutsugamushi str. Ikeda] >gi|189181262|dbj|BAG41042.1| MesJ protein [Orientia tsutsugamushi str. Ikeda] (441 aa)
Score = 146, Expect = 1.0e-07, Identities = 44/169 (26%), Positives = 87/169 (51%)
  Q:     9 GVSGGPDS---MLLLKLYHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVP-LIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
            VSGG DS   MLL+K +++K+     ++ ++++ R+ +  +   V   C+ +K+  + +H + +      N QAQARK R++        + +  L+  HH DD +E   ++L   + A   G+ +    +   +++ RP     K ++    E+  + +  D +N+   Y R QVR
  S:    26 AVSGGSDSLALMLLVKHWNEKVKGEITILTIDHHLRSESTSEADYVSSICQNIKLQHVTLHWIHKGIT--GNIQAQARKARYQLLTNYCQEHDILHLITGHHADDIVENFFIRL--LRGAGLAGLSSHNLFFVNNVRIIRPLFNITKQDLKKYLEQQNIKWINDPSNSSNKYLRTQVR 199
>gi|46199478|ref|YP_005145.1| putative cell cycle protein mesJ-like protein [Thermus thermophilus HB27] >gi|61217297|sp|Q72IF6|TILS_THET2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|46197104|gb|AAS81518.1| putative cell cycle protein mesJ-like protein [Thermus thermophilus HB27] (507 aa)
Score = 146, Expect = 1.1e-07, Identities = 50/176 (28%), Positives = 79/176 (44%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK--KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           PK   +  VSGG DS+ L  L  +  + A V H+++  R  +  DQ  V    ++L  P     V    + +   +N +A AR++R+    + A       +L AH  DD  E   +QL  +  A   GI+ R  +    V RP + + + E+ A        +  D TN  P   RN +R
  S:    15 PKDPLVLAVSGGGDSVALALLVKEAGRQAVVAHLDHGLRPESPLDQAFVRALAERLGFPFFTERVEVARIAQARGENLEAVAREVRYAFLHRVAREVGARAILTAHTLDDQAETVLLQL-LQGTARATGIREREGI----VVRPLLAHTREELRAYLRARGEAWREDPTNQDPALDRNFLR 190
>gi|55981511|ref|YP_144808.1| cell cycle protein MesJ [Thermus thermophilus HB8] >gi|61217197|sp|Q5SI38|TILS_THET8 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|55772924|dbj|BAD71365.1| probable cell cycle protein MesJ [Thermus thermophilus HB8] (507 aa)
Score = 146, Expect = 1.1e-07, Identities = 50/176 (28%), Positives = 79/176 (44%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK--KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK---KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           PK   +  VSGG DS+ L  L  +  + A V H+++  R  +  DQ  V    ++L  P     V    + +   +N +A AR++R+    + A       +L AH  DD  E   +QL  +  A   GI+ R  +    V RP + + + E+ A        +  D TN  P   RN +R
  S:    15 PKDPLVLAVSGGGDSVALALLVKEAGRQAVVAHLDHGLRPESPLDQAFVRALAERLGFPFFTERVEVARIAQARGENLEAVAREVRYAFLHRVAREVGARAILTAHTLDDQAETVLLQL-LQGTARATGIREREGI----VVRPLLAHTREELRAYLRARGEAWREDPTNQDPALDRNFLR 190
>gi|150005405|ref|YP_001300149.1| putative cell-cycle protein [Bacteroides vulgatus ATCC 8482] >gi|149933829|gb|ABR40527.1| putative cell-cycle protein [Bacteroides vulgatus ATCC 8482] (417 aa)
Score = 146, Expect = 1.1e-07, Identities = 56/176 (31%), Positives = 91/176 (51%)
  Q:     5 QYIAGVSGGPDSMLLLKL-----YHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + +  +SGG DS+ LL++     YH + A   H N++ R   + RD++ V E CK L V L  H    DTV   +      +  AR++R++ F++      +  + +AHHRDD +E     L+  + A   G+K      G  + RP ++  + +IL      +  Y  D TN Q  Y RN++R  I
  S:     4 KVLVALSGGADSVALLRVLLVLGYHCEAA---HCNFHLRGEESDRDERFVNELCKGLGVTL--HVTHFDTVTYASRHHVSIEMAAREMRYDWFEQLRKERGMAVIAVAHHRDDSVET--FLLNLIRGAGINGLKGISPHNGC-IVRPLLEVSRQDILDYLRCLRQGYVTDSTNLQDEYMRNKIRLNI 182
>gi|57238476|ref|YP_179607.1| PP-loop family protein [Campylobacter jejuni RM1221] >gi|61216392|sp|Q5HSX8|TILS_CAMJR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|57167280|gb|AAW36059.1| PP-loop family protein [Campylobacter jejuni RM1221] (321 aa)
Score = 146, Expect = 1.1e-07, Identities = 54/195 (27%), Positives = 92/195 (47%)
  Q:     1 MPKTQYIAGVSGGPDS-MLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           + K + +   S G DS  L   L  +KI   +V +NY  R  +  ++   +E   +    + +   P+   ++ NF+ +AR  R++ F+K       D L+LAHH +D  E   MQL      A   G++   +     + RP +   K+EI +  +E  + Y  DE+N    Y RN +R+   N+S     EF+ G+
  S:    11 LKKGKNLLAFSYGSDSSALFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPK---FQSNFEKKARDFRYDFFEKICLEQDYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRQNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK---NFSNAFVSEFHQGL 202
>gi|77464237|ref|YP_353741.1| cell cycle protein [Rhodobacter sphaeroides 2.4.1] >gi|77388655|gb|ABA79840.1| Probable cell cycle protein [Rhodobacter sphaeroides 2.4.1] (412 aa)
Score = 146, Expect = 1.1e-07, Identities = 53/171 (30%), Positives = 76/171 (44%)
  Q:    10 VSGGPDSMLLLKLYHK-KIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW--KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT-----RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGG DSM LL L  +  IA   V V++  R  A  + + V   C  L VP   H +     W  + N   QAR+ R       A    ++ + L H RDD  E   M+L   + A   G+       R E  GM   RP +   + E+ A        +  D +N  P + R ++RQ +
  S:    23 VSGGGDSMALLHLAAEAGIATRAVTVDHGLRPEAADEARAVGRVCADLGVP---HDILRWEGWDGRGNLMDQARRARLRLIAGWARGAGLEAVALGHTRDDVAETFLMRLA--RGAGVDGLAAMQAVRRAE--GMVWLRPLLGIGREELRADLRRRGASWIEDPSNDNPAFDRVRMRQAM 195
>gi|157827822|ref|YP_001496886.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii OSU 85-389] >gi|166988064|sp|A8GY99.1|TILS_RICB8 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157803126|gb|ABV79849.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii OSU 85-389] (430 aa)
Score = 146, Expect = 1.2e-07, Identities = 49/185 (26%), Positives = 92/185 (49%)
  Q:     9 GVSGGPDSMLLL---KLYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYI 193
            VSGG DS+ LL    ++ KK      V+ V++N R  + ++ + ++     L +            +  N Q +ARK R++          +  LL AHH DD+IE   ++L+  +++  +G+ +    +    ++ RP     K+E++     + + +  D++N    Y+RN +RQ++A      KEE YI
  S:    25 AVSGGSDSVALLYLANIWAKKNNIELFVLSVDHNLRDQSKQEIEYIQNTANDLGLKFYSLFFDHQNNFS-NLQERARKGRYDLMTSLCQKLDILVLLTAHHEDDYIENFCLRLE--RKSGVFGLSSSSVNWHNNTQIIRPLFNIPKSELVNYLATNNIKWFEDQSNLSTKYRRNTIRQKLA------KEEVYI 208
>gi|91206209|ref|YP_538564.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii RML369-C] >gi|122425129|sp|Q1RGN9|TILS_RICBR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|91069753|gb|ABE05475.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii RML369-C] (430 aa)
Score = 146, Expect = 1.2e-07, Identities = 49/185 (26%), Positives = 92/185 (49%)
  Q:     9 GVSGGPDSMLLL---KLYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYI 193
            VSGG DS+ LL    ++ KK      V+ V++N R  + ++ + ++     L +            +  N Q +ARK R++          +  LL AHH DD+IE   ++L+  +++  +G+ +    +    ++ RP     K+E++     + + +  D++N    Y+RN +RQ++A      KEE YI
  S:    25 AVSGGSDSVALLYLANIWAKKNNIELFVLSVDHNLRDQSKQEIEYIQNTANDLGLKFYSLFFDHQNNFS-NLQERARKGRYDLMTSLCQKLDILVLLTAHHEDDYIENFCLRLE--RKSGVFGLSSSSVNWHNNTQIIRPLFNIPKSELVNYLATNNIKWFEDQSNLSTKYRRNTIRQKLA------KEEVYI 208
>gi|94987642|ref|YP_595743.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS9429] >gi|94991508|ref|YP_599607.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS2096] >gi|94541150|gb|ABF31199.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS9429] >gi|94545016|gb|ABF35063.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS2096] (428 aa)
Score = 146, Expect = 1.2e-07, Identities = 66/272 (24%), Positives = 122/272 (44%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITH-HIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  +  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E        Q  L+  +L     +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFNEQSKSIQHFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYYYLKKDYYIFI 291
>gi|91788722|ref|YP_549674.1| tRNA(Ile)-lysidine synthetase-like [Polaromonas sp. JS666] >gi|91697947|gb|ABE44776.1| tRNA(Ile)-lysidine synthetase-like [Polaromonas sp. JS666] (326 aa)
Score = 146, Expect = 1.3e-07, Identities = 64/256 (25%), Positives = 110/256 (42%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAA----SLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIK---TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH----PDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAIL 257
           P   +   +SGG DS  LL    +K       VH+++  +  A   ++  +  C QL VPL V  V       ++ +  ARK R+  F   A    + + +  + +A H DD +E   M L   + A   G+     R E  G+  +RP +      + A   E  +P+  D TN    + RN++R  +     +   +F        R   Q    L++ A+Q LA     P +  L+    P Q  ++  +L       +  ++D +L
  S:    19 PGLPFAVALSGGADSTALLVGCAEKWPGQVRAVHIHHGLQAAADDFERHCQALCAQLNVPLAVKRVQARHAPGESPEDAARKARYAAFGAVAREEWAQHAIKDIAIAQHADDQVE--TMLLALSRGAGLPGLAAMPARWERDGIVYHRPLLAVPGALVRAWLVERGLPWVEDPTNTDERFTRNRIRARLLPALADAFPQFRETFARSARHAAQAQALLVEVAQQDLATVGLPPAITALQGLSQPRQANVLRHWLQLQQATPSAAQLDQLL 286
>gi|134299184|ref|YP_001112680.1| PP-loop domain-containing protein [Desulfotomaculum reducens MI-1] >gi|134051884|gb|ABO49855.1| PP-loop domain protein [Desulfotomaculum reducens MI-1] (252 aa)
Score = 145, Expect = 1.3e-07, Identities = 53/185 (28%), Positives = 85/185 (45%)
  Q:     2 PKTQYIAGVSGGPDSMLLL---KLYH----KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLI-----VHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           P  + + GVSGG DS  LL    LYH    KK+   +H  +         Q M +E C++L +PL      + T+  D   + N  +    +R      AA     +K+ LAHH DD +E   M L        +  KT  +   + + RPF+   +N++ AL     +P   +   A    KR +++  I   S++
  S:    25 PGDKVVVGVSGGKDSNSLLYCLSLYHRRYLKKVPFELHAVHLDMGLGADLQPM-KELCQRLAIPLTLKHTDIGTILFDIRKETNPCSLCANLRRGALHSAALELGFNKVALAHHLDDVMETFFMSLLFNGNMKTFSPKTYLDRTDLTLIRPFVYVTENQVKALLPLENIPVIHNPCPANKQTKREEIKNLINQLSEQ 220
>gi|56808856|ref|ZP_00366567.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Streptococcus pyogenes M49 591] (428 aa)
Score = 145, Expect = 1.3e-07, Identities = 66/272 (24%), Positives = 125/272 (45%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH------IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  +  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E       +Q + +  FL+  +      +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLTIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFN-----EQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYYYLKKDYYIFI 291
>gi|86152849|ref|ZP_01071054.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843734|gb|EAQ60944.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter jejuni subsp. jejuni HB93-13] (321 aa)
Score = 145, Expect = 1.4e-07, Identities = 50/182 (27%), Positives = 86/182 (47%)
  Q:     1 MPKTQYIAGVSGGPDS-MLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           + K + +   S G DS  L   L  +KI   +V +NY  R  +  ++   +E   +    + +   P+   ++ NF+ +AR  R++ F+K       D L+LAHH +D  E   MQL      A   G++   +     + RP +   K+EI +  +E  + Y  DE+N    Y RN +R+  +N
  S:    11 LKKGKNLLAFSYGSDSSALFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALRFHKKIFIKHAPK---FQSNFEKKARDFRYDFFEKICLEQDYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRQNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRKNFSN 192
>gi|9294051|dbj|BAB02008.1| unnamed protein product [Arabidopsis thaliana] (614 aa)
Score = 145, Expect = 1.5e-07, Identities = 50/179 (27%), Positives = 92/179 (51%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK----KIACV------------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYG--------------MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           T+   GVSGGPDSM L  L  K     ++CV            + V++  R  +  + ++V     Q+ +   + +   D V  +    + Q  AR++R+E         +++ LL+AHH DD  E   ++L      +   G     E++               +++ RP +  WK ++  +C+  +  +  D TN   ++ RN++R  I N
  S:    55 TKRALGVSGGPDSMALCVLTAKWKTEGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC--DWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDAKHMKNQSIRLVRPLLDLWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGN 266
>gi|27262508|gb|AAN87535.1| cell cycle protein MesJ [Heliobacillus mobilis] (308 aa)
Score = 145, Expect = 1.6e-07, Identities = 50/179 (27%), Positives = 86/179 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA-------CVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQ---ARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P+ + +  +SGG DS+ LL L+ KK++          H N+  R   +  D   V E   +L+VPL + T P    W++    +   AR++R++   ++A       + LAHH DD  E            M  G   +G L G+        RP + + + E+    +     +  D +N   +Y RN++R +I
  S:    20 PRERIVIALSGGADSVCLLLLF-KKVSPQFGIELAAAHYNHGMRGKESDEDAAFVAELTNRLQVPLFLETAPL-KWWQQEPGTKMEAARRLRYDFLSRSAEQAGARWIALAHHADDMAETVLFH-------MLRGSGIKG-LSGIPAKRGPFVRPLLPFRRKELEEFLKAEGQHWRHDSSNDSDVYTRNRIRHQI 204
>gi|99034626|ref|ZP_01314580.1| hypothetical protein Wendoof_01000607 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (407 aa)
Score = 145, Expect = 1.6e-07, Identities = 59/210 (28%), Positives = 102/210 (48%)
  Q:    10 VSGGPDSMLLLKL---YHKK----IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT---RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH 219
           VSGG DS++LL L   + KK    +   + VN+  R  + ++   V  Y K+L          E    K N Q QARK R++   +      V  LL+AHH+DD  E   ++L+  + +   G+ +   +  L G+ ++RP + + ++EI    + H++ +  D +N    Y+R   R  + +   +E     I + A++          MKRA + L H
  S:     1 VSGGVDSVVLLHLMTNWAKKNKLLLPIALTVNHGLRPESQKEADFVVSYAKELGAKESFILNWEKQNIKGNIQLQARKARYKLLAEWCKNNNVKYLLVAHHKDDQAETFLLRLE--RGSGVDGLSSMDYKSFLNGIYIFRPLLNFSRSEIEKYAKLHRLKWIEDRSNHDLKYRRTLYRNLLKSSDNQEILTERICLTALH----------MKRAAKALMH 208
>gi|73667491|ref|YP_303507.1| cell cycle protein MesJ [Ehrlichia canis str. Jake] >gi|72394632|gb|AAZ68909.1| cell cycle protein MesJ [Ehrlichia canis str. Jake] (433 aa)
Score = 145, Expect = 1.6e-07, Identities = 46/176 (26%), Positives = 88/176 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLY----HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHT----VPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
            + Y   VSGG DSM+LL L     +     ++ VN+  R  A ++   V ++ + L +   +      +PE      N Q+ AR+IR+    +  +  +++ L++AH ++D  E   ++L+ R   +    G++    L G+ + RP +   + E+L    ++ +P+  D +N    YKR   R 
  S:    16 NSAYAVAVSGGIDSMVLLHLSAQHRNHNTPIILTVNHGLRQEAKQEALFVFQHSQNLNLKCHILNWHGKLPES-----NIQSSARQIRYGLLLQWCNENRINYLMVAHQKNDQAETIMIRLE-RGSGLDGLAGMQECTYLNGICILRPLLSVSRTELLQYASQNNIPWINDPSNNNKKYKRTLYRN 195
>gi|152978797|ref|YP_001344426.1| tRNA(Ile)-lysidine synthetase [Actinobacillus succinogenes 130Z] >gi|150840520|gb|ABR74491.1| tRNA(Ile)-lysidine synthetase [Actinobacillus succinogenes 130Z] (427 aa)
Score = 145, Expect = 1.6e-07, Identities = 54/193 (27%), Positives = 88/193 (45%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHKKIAC-------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG------ELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVC 196
           ++Y+   SGG DS  LL L+ K            +H+++     A          C++L+VPLI+  V  +   K   +  AR+ R+   +     +  + +  AHH  D   Q +  L A KR    GIK  G       LYGM ++RP + + K E+        + +  D++NA   Y RN +R  I    +    +F + V 
  S:    14 SRYLIAFSGGADSTALLALFAKSRQNRPHLQLRAIHIHHGLNVAANDWAAHCRRICEKLEVPLIIERVEINK--KSGIEQGAREARYAAIR--CHRHADEIVATAHHLQD---QTETFLLALKRGS--GIKGLGAMQRESRLYGMPIFRPLLPFGKTELENYLRAQSLDWIEDDSNADNRYDRNFLRNRILPVLRRRWTDFDLAVS 210
>gi|25029100|ref|NP_739154.1| hypothetical protein CE2544 [Corynebacterium efficiens YS-314] >gi|61216660|sp|Q8FMG0|TILS_COREF tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|23494387|dbj|BAC19354.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] (313 aa)
Score = 144, Expect = 1.7e-07, Identities = 63/248 (25%), Positives = 111/248 (44%)
  Q:     9 GVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE-EKEEFYIGVC-AMNRVI--GQKL-FSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAI 256
           G+SGGPDS+ L+     + A V  + +N+N +  +    +      + +    ++ ++   TV   + +AQAR+ R+ +F +       D +   H  DD   QA+  L A  R    G+K+      + V RP +   + +    C E  +    D  N    ++R  +R+++     E    +   G+  A  R    G+ L F + KR  +W     VR L   P   +R ++  FL  H + VT  KI+A+
  S:    35 GLSGGPDSLALVAAARAEGAEVTAICINHNLQEGSAEVSERAAAQAEHMGATALIRSI---TVPPGSMEAQAREARYAEFAQ-----LTDTIWAGHTMDD---QAETFLLAGLRGNPAGMKSASRRPDLTVIRPLLGVRRADTHGACTELGLTPWQDPQNRDRAFRRVAIREQVLPLLAEIHAGDPVPGLALAATRAAMEGEALEFFVDKRRGEWADGFPVR-LAAEPHALRRLMLADFLRGHGVRVTSKKIEAV 277
>gi|116056560|emb|CAL52849.1| Predicted 3'-5' exonuclease (ISS) [Ostreococcus tauri] (1313 aa)
Score = 144, Expect = 1.7e-07, Identities = 43/172 (25%), Positives = 87/172 (50%)
  Q:     9 GVSGGPDSMLLLK-LYHKKIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPL---IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYK-RNQVRQEI 180
            +SGG DSM+L   L H+    V +H++Y  R  +  +   V+++  +  +      V  +      ++ ++ ++RKIR+  ++K+   +    +LL HH  D  E     L      +   G+  RG + G++++RP + + K ++L     + VPY +D T   P +  R ++R ++
  S:   866 SLSGGVDSMVLAYILKHQGYDVVTLHIDYKNRPESTEEADFVDDWSVRHGMKFERCTVDAIRRGVTPREQYEIESRKIRYGFYKKSGQKHGFPAVLLGHHHGDVQENIITNLMRGANLLSVNGMDKRGVVEGVRIWRPMLPHNKVDVLDFAHTYGVPYFLDST---PTWSTRGKLRNQL 1041
>gi|156452367|ref|ZP_02058738.1| tRNA(Ile)-lysidine synthetase [Methylobacterium chloromethanicum CM4] >gi|156188627|gb|EDO20825.1| tRNA(Ile)-lysidine synthetase [Methylobacterium chloromethanicum CM4] (347 aa)
Score = 144, Expect = 1.8e-07, Identities = 47/165 (28%), Positives = 78/165 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACVVHV---NYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELY-GMKVYRPFIKYWKNEILALCEEHKVPYGIDETN 166
           P    +  VSGGPDS  L+    +    ++HV   ++  R  +  +   V     +L    +VHT+     W         QA AR  R++     A+      +L AH  DD  E   M+L A    +   G++    L  G+++ RPF+   K +++A CE H++P+  D +N
  S:    23 PARPALLAVSGGPDSTALMHAAARAGRDLLHVATVDHALRPGSADEALGVGRLAAELG---LVHTI---LTWDAPRHGSRIQASARGARYKLLTDHAARIGAGLILTAHTLDDQAETVLMRLIAGSGPSGLAGMRDERPLAPGIRLVRPFLSLSKADLVAYCEMHRLPFLRDPSN 191
>gi|163699948|ref|ZP_02118805.1| tRNA(Ile)-lysidine synthetase [Methylobacterium nodulans ORS 2060] >gi|162433818|gb|EDQ44405.1| tRNA(Ile)-lysidine synthetase [Methylobacterium nodulans ORS 2060] (339 aa)
Score = 144, Expect = 1.8e-07, Identities = 51/177 (28%), Positives = 80/177 (45%)
  Q:    10 VSGGPDSMLLL----KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVP--LIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           VSGGPDS  L+    +L       V  V++  R  A  + + V     +L +P  ++  T P+    +   Q  AR  R+      A       LL AH  DD  E   M+L A    A   GI+    L G+ + RPF+   K  ++A C     P+ +D  NA   + R ++R+ + + + E
  S:    33 VSGGPDSTALMGGAARLPPLVPVMVATVDHGLRPEAAAEAEAVARLAGRLGLPHRILAWTGPKP---RTRLQEAARAARYRLLLDLAREQGAAALLTAHTLDDQAETVLMRLCAGSGPAGLGGIEPVRHLGGLALVRPFLDLPKARLVATCAAEGWPFVVDPGNADARFARGRLRRVMPHLAAE 213
>gi|157825192|ref|YP_001492912.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia akari str. Hartford] >gi|166988063|sp|A8GLX9.1|TILS_RICAH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157799150|gb|ABV74404.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia akari str. Hartford] (430 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/199 (24%), Positives = 95/199 (47%)
  Q:     8 AGVSGGPDSMLLLKLYH-----KKIA-CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKL 206
             VSGG DS+ LL L +       I   V+ V++N R  + ++   V+     L       +      +  N Q +AR  R++        + +  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     H + +  DE+N+   Y+RN +RQ++A  +   K E  +    +N ++  K 
  S:    24 VAVSGGSDSVALLYLANIWAEKNNIELSVISVDHNLREQSKQETYYVQNISNSLNRKHYSLSFDHQNNFS-NLQERARAGRYDLMTNLCLEFDILVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNIIRQKLAKGAGYIKAEIILQQLKINDLLDNKF 227
>gi|28894923|ref|NP_801273.1| putative cell cycle protein [Streptococcus pyogenes SSI-1] >gi|71902678|ref|YP_279481.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS6180] >gi|61217343|sp|Q879R7|TILS_STRP3 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|28810168|dbj|BAC63106.1| putative cell cycle protein [Streptococcus pyogenes SSI-1] >gi|71801773|gb|AAX71126.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS6180] (428 aa)
Score = 144, Expect = 1.9e-07, Identities = 66/272 (24%), Positives = 125/272 (45%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH------IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  +  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E       +Q + +  FL+  +      +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFN-----EQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYYYLKKDYYIFI 291
>gi|61216758|sp|Q9ZGE2|TILS_HELMO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3820563|gb|AAC84036.1| cell cycle protein MesJ [Heliobacillus mobilis] (470 aa)
Score = 144, Expect = 1.9e-07, Identities = 50/179 (27%), Positives = 86/179 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA-------CVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQ---ARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-----YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P+ + +  +SGG DS+ LL L+ KK++          H N+  R   +  D   V E   +L+VPL + T P    W++    +   AR++R++   ++A       + LAHH DD  E            M  G   +G L G+        RP + + + E+    +     +  D +N   +Y RN++R +I
  S:    20 PRERIVIALSGGADSVCLLLLF-KKVSPQFGIELAAAHYNHGMRGKESDEDAAFVAELTNRLQVPLFLETAPLKW-WQQEPGTKMEAARRLRYDFLSRSAEQAGARWIALAHHADDMAETVLFH-------MLRGSGIKG-LSGIPAKRGPFVRPLLPFRRKELEEFLKAEGQHWRHDSSNDSDVYTRNRIRHQI 204
>gi|22299159|ref|NP_682406.1| hypothetical protein tlr1616 [Thermosynechococcus elongatus BP-1] >gi|61217355|sp|Q8DIH2|TILS_SYNEL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|22295341|dbj|BAC09168.1| ycf62 [Thermosynechococcus elongatus BP-1] (344 aa)
Score = 144, Expect = 1.9e-07, Identities = 62/241 (25%), Positives = 115/241 (47%)
  Q:     4 TQYIAGVSGGPDSMLLLKLY-----HKKIACV-VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA-------NWSKEEKEEFYIGVCAMNRVI----GQKLFSLMKRAKQWLAHP---DVRELKRYPLPDQRQLVYSFLITH 244
           ++ +  +SGG DS+ L +L      H + + V VH ++  R  +  +   V++  ++  +P  V + P+        +A AR  R++ F+  A       ++ AH + D  E   + L        +   + +R  L  +++ RP +   + +  A C+ + +P   DETN    Y+RN++R E+        N + EE       + A +R       ++L   + R      HP   D   L+ +PL  QR+L+  FL  H
  S:    23 SRILIALSGGQDSVCLTRLLLDLQPHWQWSLVAVHCDHRWRADSTANANFVQQLAQKWHLPCEVVSAPD----LPKTEAAARSWRYQVFESVAKALDCTHVVTAHTQSDRAESLLLHLLRGTSPDGLATLLPSR-SLGAIQLVRPLLGMTRAQTAAFCQAYGLPIWQDETNHNLEYRRNRLRLELIPYLQQHFNPNVEEALAQTAELLASDRAYFEAEVERLAPTVLR-----EHPPALDRLRLREFPLALQRRLIQCFLRQH 275
>gi|15674260|ref|NP_268433.1| putative cell-cycle protein [Streptococcus pyogenes M1 GAS] >gi|71909825|ref|YP_281375.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS5005] >gi|94989520|ref|YP_597620.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10270] >gi|94993407|ref|YP_601505.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10750] >gi|61217414|sp|Q9A201|TILS_STRP1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|13621335|gb|AAK33155.1| putative cell-cycle protein [Streptococcus pyogenes M1 GAS] >gi|71852607|gb|AAZ50630.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS5005] >gi|94543028|gb|ABF33076.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10270] >gi|94546915|gb|ABF36961.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10750] (428 aa)
Score = 144, Expect = 2.0e-07, Identities = 66/272 (24%), Positives = 125/272 (45%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH------IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  +  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E       +Q + +  FL+  +      +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFN-----EQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYYYLKKDYYIFI 291
>gi|19071761|gb|AAL80000.1| RASPBERRY3 [Arabidopsis thaliana] (662 aa)
Score = 144, Expect = 2.1e-07, Identities = 49/181 (27%), Positives = 92/181 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK----KIACV------------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK----NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGELYG--------------MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           P  +   GVSGGPDSM L  L  K     ++CV            + V++  R  +  + ++V     Q+ +   + +   D V  +    + Q  AR++R+E         +++ LL+AHH DD  E   ++L      +   G     E++               +++  P + +WK ++  +C+  +  +  D TN   ++ RN++R  I N
  S:    83 PHNRIALGVSGGPDSMALCVLTAKWKTQGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC--DWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDAKHMKNQSIRLVGPLLDFWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGN 296
>gi|120436499|ref|YP_862185.1| PP-loop family protein [Gramella forsetii KT0803] >gi|117578649|emb|CAL67118.1| PP-loop family protein [Gramella forsetii KT0803] (437 aa)
Score = 144, Expect = 2.1e-07, Identities = 51/178 (28%), Positives = 88/178 (49%)
  Q:     4 TQYIAGVSGGPDSMLL--LKLYHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK-----VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           ++ +  VSGG DS++L  L L  K    + H N+N R   +  D+K V +    L+V +   +       + N    Q  AR++R+E F + ++  + D  L AHH +D +E   + L         G    G L G+K     + RP + + ++EI     +  + +  D +NA   Y RN++R +I 
  S:    19 SKLLLAVSGGVDSVVLAHLCLSAKLDFTIAHCNFNLRGDESDDDEKFVVDLADFLEVEVYTESFNTLKFAENNKISVQMAARELRYEWFAELSNSVQFDYTLTAHHANDNLETFLINL-------IRGTGPEG-LTGIKKEKNEIVRPLLPFTRSEIEDFARKKNLKWREDSSNASDKYMRNKIRHQIV 199
>gi|153854745|ref|ZP_01995979.1| hypothetical protein DORLON_01977 [Dorea longicatena DSM 13814] >gi|149752652|gb|EDM62583.1| hypothetical protein DORLON_01977 [Dorea longicatena DSM 13814] (473 aa)
Score = 143, Expect = 2.2e-07, Identities = 55/178 (30%), Positives = 86/178 (48%)
  Q:     3 KTQYIAGVSGGPDSMLLLKLYHKKIA------CVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTV-----WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM--KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K   IAGVSGG DS+ LL +  K          VVH+++  R  +A  D+  V   C++L V L+     ED        K   +   R +R   F++        ++ LAHH++D  E     L     +   G+K  G +  +  K  RP +   + EI    +E+ + Y  DETN +  Y RN++R  +
  S:    29 KDHVIAGVSGGADSVCLLFMLVKLQKEMRFGLTVVHIHHGLRGESADVDENYVRALCEKLDVELLA--FHEDVGRYAKEQKLTLEEAGRNVRRHIFEEVCHRKNGTRIALAHHQNDNAETLLWNL-----SRGCGLKGIGGISPVDGKYIRPLLGVRRQEIEEYLKENNIDYCTDETNLEDHYTRNRLRNHV 213
>gi|169852792|ref|XP_001833078.1| hypothetical protein CC1G_01140 [Coprinopsis cinerea okayama7#130] >gi|116505872|gb|EAU88767.1| hypothetical protein CC1G_01140 [Coprinopsis cinerea okayama7#130] (561 aa)
Score = 143, Expect = 2.2e-07, Identities = 65/204 (31%), Positives = 105/204 (51%)
  Q:    11 SGGPDSMLLLKLYHKKIACVVHVNYNKRT----TALRDQKMVEE-----------------------YCKQLKVPLIVHTVPEDTVWKK---------NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARK-----RAMY----YGIK-------TRGELYGMKVY--RPFIKYWKNEILALCEEHKVPYGIDETNAQP-IYKRNQVRQEIAN-------WSKEEKEEFY--IGVCAMNRVIGQKLFSLMKRAK 214
           SGGPDS  L+ L H+  +        K +     AL    + E                        +C      L +  +    +W +         +F+  AR  R++   KA      + L L HH DD +E + M+L         R M     +G+         + +L GM+++  RP ++  K+ ILA CE + + Y  D+TN QP I  RN +R  + N         K  KE+ +      + N  +G  L S ++RA+
  S:    32 SGGPDSTCLIYLLHQLFSTTGSQTRTKESLRYDQALSPGHLSESTSPRILSLTINHDLQASSDKMATHCSNFAAKLGLDHITSKILWGQPGFPPRPTESFERDARNARYDLLYKAMLSSGSNTLALGHHLDDQVETSLMRLGKGSTLLGARGMRPIRRWGMSEVPKWDFGQRDLQGMRMWMIRPLLQVGKDRILATCEANGLEYVTDKTNFQPDITIRNAIRHTLENNGDTSAVLEKRIKEQLHEIDEALSKNHELGLNLSSGLERAR 299
>gi|85859371|ref|YP_461573.1| tRNA(Ile)-lysidine synthetase [Syntrophus aciditrophicus SB] >gi|85722462|gb|ABC77405.1| tRNA(Ile)-lysidine synthetase [Syntrophus aciditrophicus SB] (476 aa)
Score = 143, Expect = 2.2e-07, Identities = 46/176 (26%), Positives = 87/176 (49%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC-------VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           P    IA VSGGPDS+ LL +    +AC       V H+N+  R + +  ++++V +  K+  +   V  +    + K +      +   R+ R+E F   A+     ++ L HHR+D  E   M     + +   G+K    +      RP ++  + +IL   +   +P+  D +N++  + RN++R
  S:    17 PGEHVIAAVSGGPDSVALLHVL-ISLACEYELTLSVAHLNHGLRGSESDAEEQLVRQLSKERGISCSVKRIDLQALRKCDRRKCSLEDIGRQERYEFFTALAAEIGASRIALGHHREDQAETVLMNFI--RGSGLEGLKGIRPVRDGCFIRPLLEVSRRDILDFLQAEHLPFLEDSSNSEDHFLRNRIR 202
>gi|145619725|ref|ZP_01775771.1| tRNA(Ile)-lysidine synthetase [Geobacter bemidjiensis Bem] >gi|144943975|gb|EDJ79054.1| tRNA(Ile)-lysidine synthetase [Geobacter bemidjiensis Bem] >gi|197088377|gb|ACH39648.1| tRNA(Ile)-lysidine synthetase [Geobacter bemidjiensis Bem] (457 aa)
Score = 143, Expect = 2.3e-07, Identities = 44/179 (24%), Positives = 83/179 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIAC-----VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P    +  VSGG DS+ LL +   ++ C     V H+N+  R   +  DQ  V        +P +  +     + ++   + +   R+ R+   ++ A  Y    + LAHH+DD  E   ++L   + +   G+       G K+ RP ++  + ++    ++ ++ Y  D TNA     RN +R E+
  S:    16 PGETVVVAVSGGADSVALLDIM-TRLECGLRLVVAHLNHCLRGAESDADQAFVASLADNYHLPFVSQSCDVADLARRERLSLEDAGRRARYAFLEQTAEQYGAFSIALAHHQDDQAETVLIRL--LRGSGGTGLSAMAGTAGDKLKRPLLQVSRVKLEQYLKQRELSYRTDSTNADTAILRNSIRHEL 200
>gi|193212239|ref|YP_001998192.1| tRNA(Ile)-lysidine synthetase [Chlorobaculum parvum NCIB 8327] >gi|193085716|gb|ACF10992.1| tRNA(Ile)-lysidine synthetase [Chlorobaculum parvum NCIB 8327] (334 aa)
Score = 143, Expect = 2.4e-07, Identities = 50/174 (28%), Positives = 81/174 (46%)
  Q:     7 IAGVSGGPDSMLLLK-------LYHKKIACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH---TVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGGPDSM LL        + H ++  V H N+  R   +  D+  V   C  L +   V    T    T WKK+ +  AR +R++ F++       + +   HH  D  E     L      +   GI+ R      ++ RP I + + EI++  +E  + +  D TNA   + RN +R  +
  S:    25 LVAVSGGPDSMALLHLLVAAAPVLHLRLG-VAHCNFGLRGEESDGDEAFVRYECAGLGLDFHVRRFDTKAVATTWKKSIEETARLLRYDFFEELCREKGYELIATGHHSGDNAETMLFNLFRGTAASGLRGIRMRQG----RLIRPLIPFSRQEIVSYLDEKSIAWRTDRTNAGLEHDRNYIRNRV 205
>gi|148981150|ref|ZP_01816312.1| cell cycle protein MesJ [Vibrionales bacterium SWAT-3] >gi|145960977|gb|EDK26302.1| cell cycle protein MesJ [Vibrionales bacterium SWAT-3] (443 aa)
Score = 143, Expect = 2.4e-07, Identities = 46/175 (26%), Positives = 85/175 (48%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           +   SGG DS +LL+L  +     +I C  +HV++     A +  +  + +C  L VPL V  V  D    ++ +  AR  R+  F+  + L + D L+   H DD +E   + L  ++ +   G+ +  ++    G  + RP +   + EI A      + +  DE+N    + RN +R ++ 
  S:    23 VVAFSGGVDSRVLLELAAQYTKTHEIDCQAIHVHHGLSDNADQWAEQCQVWCDDLSVPLAVERVSLDVRSGESIEKLARDARYNAFK--SHLRQGDVLVTGQHVDDQVETFLLAL--KRGSGPKGLSSMAKVMPFSGAHIVRPMLSVTRAEIEAFARRMGLTWVEDESNQDVRFDRNFIRHQVT 202
>gi|86142944|ref|ZP_01061366.1| putative cell-cycle protein [Flavobacterium sp. MED217] >gi|85830389|gb|EAQ48848.1| putative cell-cycle protein [Leeuwenhoekiella blandensis MED217] (436 aa)
Score = 143, Expect = 2.5e-07, Identities = 49/178 (27%), Positives = 88/178 (49%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHK-KIAC-VVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           +   +++  VSGG DS++L  L+ + KI   + H N+N R   +  D   VE+  ++L V   +     +      K + Q  AR++R+  F++   L+ +  L  AHH  D +E   + L +R   +    GI    +    ++ RP + + + EIL   E + + +  D +NA   Y RN +R 
  S:    16 LLNARFLLAVSGGLDSVVLAHLFSECKIDFEIAHCNFNLRGKESDADAVFVEKLAEKLHVKFHLQNFDTEAYAQDQKVSIQMAARELRYHWFEELCQLHHLPFLATAHHAKDDLETFLINL-SRGSGLNGLTGITAEND----RLVRPLLPFSREEILTYAEANTLAWREDSSNASDKYLRNHLRH 196
>gi|157342807|emb|CAO65519.1| unnamed protein product [Vitis vinifera] (551 aa)
Score = 143, Expect = 2.6e-07, Identities = 72/265 (27%), Positives = 126/265 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNY--NKRTTALRDQKMVEEYCKQL-----------KVPLIVHTVPEDTV--------W------KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM-YYGIKTRGEL--------------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANW-SKEEKEEF--YIGVCAMNRV-IGQKLFSLMKRAKQWLA-----------HPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQK 266
           P  +   GVSGGPDSM L         C++  ++  N   TA   +  ++     +           +  ++ H V +  +        W      + + Q  AR++R++ FQ     +++  LL+AHH DD +E   ++L      +   G+    +L              Y + + RP +++ K ++  +CE     +  D TN  P + RN++R  + N  S   K E    I  C   R  + Q   +L+      +A           HP   +++   L     LV  F+   H  V G     +LD+I+ F  K
  S:    80 PHHRIALGVSGGPDSMAL---------CILTADWKTNGLNTAGESRGFIDGLLAIIVDHGLRAESKDEANIVRHRVSDMGIRCEIAQCDWLDGKPKQGHLQEAAREMRYQIFQNVCIQHQIGVLLVAHHADDQVELFILRLSRDSGVLGLAGMAFASQLFSTYTNYFDEASDNYSILLVRPLLEFSKEDLYKICEGGNQEWVEDPTNQNPSFARNRIRLSLRNLPSCTFKYELQAVISACRKTRAYVDQICSNLINEVVSVMAQGYAVIDLEILHPS--KIEDICLSKFIALVLQFISQRHRPVRGSTSKLLLDYIRTFPCK 390
>gi|163854237|ref|YP_001642280.1| tRNA(Ile)-lysidine synthetase [Methylobacterium extorquens PA1] >gi|163665842|gb|ABY33209.1| tRNA(Ile)-lysidine synthetase [Methylobacterium extorquens PA1] (342 aa)
Score = 143, Expect = 2.6e-07, Identities = 46/165 (27%), Positives = 77/165 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKK---IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELY-GMKVYRPFIKYWKNEILALCEEHKVPYGIDETN 166
           P    +  VSGGPDS  L+    +    +  V  V++  R  +  + + V     +L    ++HT+     W         QA AR  R+      A+      +L AH  DD  E   M+L A    +   G++    L  G+++ RPF+   K +++A CE H++P+  D +N
  S:    23 PARPALLAVSGGPDSTALMHAAARAGRDLFRVATVDHALRPGSADEARAVGRLATELG---LIHTI---LTWDAPRHGSRIQASARGARYRLLTDHAARIGAGLILTAHTLDDQAETVLMRLIAGSGPSGLAGMREERVLAPGIRLVRPFLSLSKADLVAYCEMHRLPFLRDPSN 191
>gi|190571198|ref|YP_001975556.1| trna(ile)-lysidine synthase (ec 6.3.4.-) (trna(ile)-lysidine synthetase) (trna(ile)-2-lysyl-cytidine synthase) [Wolbachia pipientis] >gi|190357470|emb|CAQ54904.1| trna(ile)-lysidine synthase (ec 6.3.4.-) (trna(ile)-lysidine synthetase) (trna(ile)-2-lysyl-cytidine synthase) [Wolbachia pipientis] (430 aa)
Score = 143, Expect = 2.7e-07, Identities = 58/216 (26%), Positives = 103/216 (47%)
  Q:     4 TQYIAGVSGGPDSMLLLKL---YHKK----IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT---RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH 219
            Q    VSGG DS++LL L   + KK    +   + VN+  R+ + ++   +  Y K+L          E    K N Q QARK R++   +      V  LL+AHH+DD  E   ++L+  + +   G+ +   +  L G+ ++RP + + ++EI    + H++ +  D +N    Y+R   R  +     ++     I + A++          MKRA + L H
  S:    18 NQIAVAVSGGVDSIVLLHLMTNWAKKNKLSLPIALTVNHGLRSESQKEADFIISYAKELGAKESFILNWEKQNIKGNIQLQARKARYKLLAEWCKNNNVKCLLVAHHKDDQAETFLLRLE--RGSGVDGLSSMDYKSFLNGIYIFRPLLNFSRSEIERYAKLHQLRWIEDRSNYDLKYRRTLYRNLLKASDNQDVLTERICLTALH----------MKRAAKALMH 231
>gi|148285169|ref|YP_001249259.1| tRNA(Ile)-lysidine synthetase [Orientia tsutsugamushi str. Boryong] >gi|166988062|sp|A5CFP2.1|TILS_ORITB tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|146740608|emb|CAM81262.1| tRNA(Ile)-lysidine synthetase [Orientia tsutsugamushi Boryong] (441 aa)
Score = 143, Expect = 2.7e-07, Identities = 45/169 (26%), Positives = 85/169 (50%)
  Q:     9 GVSGGPDS---MLLLKLYHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVP-LIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
            VSGG DS   MLL+K +++K+     V+ ++++ R+ +  +   V   C+ +K+  + +H + +      N QAQARK R+         + +  L+  HH DD +E   ++L   + A   G+ +    +   +++ RP     K ++    E+  + +  D +N    Y R QVR
  S:    26 AVSGGTDSLALMLLVKHWNEKVKGEITVLTIDHHLRSESTSEADYVSSICQNIKLQHVTLHWIHKGIT--GNIQAQARKARYHLLTNYCQEHDILHLITGHHADDIVENFFIRL--LRGAGLAGLSSHNIFFVNNVRIIRPLFNITKQDLKKYLEQQNIKWINDPSNNSNKYLRTQVR 199
>gi|67458532|ref|YP_246156.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia felis URRWXCal2] >gi|75537001|sp|Q4UN67|TILS_RICFE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|67004065|gb|AAY60991.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia felis URRWXCal2] (430 aa)
Score = 143, Expect = 2.7e-07, Identities = 45/174 (25%), Positives = 87/174 (50%)
  Q:     8 AGVSGGPDSMLLLKLYH-----KKIA-CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           A VSGG DS+ LL L +       I   V+ V++N R  + ++   ++     L       +      +  N Q +AR+ R++          +  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     H + +  DE+N+   Y+RN +RQ++A
  S:    24 AAVSGGSDSVALLYLANIWAEKNNIELSVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS-NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNIIRQKLA 202
>gi|152993772|ref|YP_001359493.1| tRNA-lysidine synthase [Sulfurovum sp. NBC37-1] >gi|151425633|dbj|BAF73136.1| tRNA-lysidine synthase [Sulfurovum sp. NBC37-1] (323 aa)
Score = 143, Expect = 2.7e-07, Identities = 47/175 (26%), Positives = 85/175 (48%)
  Q:     8 AGVSGGPDSMLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           A  +G   S L   L    I   +  V+YN R  +  +    +   K+ K  L  HT+ +  ++  +F+++ARK R++ F+        D L+ AH  +D +E   M+L      +   G++         + RP ++Y K+E+L   +E+  PY IDE+N    Y+RN  R++ ++
  S:    16 AFSAGVDSSALFFLLIENNIRFDIAIVDYNIREQSKNELAHAKALAKEHK--LFCHTI-QAPMFDTHFESKARKFRYKFFESLIQTEGYDNLITAHQLNDQLEWLLMRLTKGAGVSELIGLEPVTHRENYTLVRPLLEYSKDELLIYLKENNHPYFIDESNIDVKYERNLFRKQFSD 189
>gi|157803229|ref|YP_001491778.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia canadensis str. McKiel] >gi|157784492|gb|ABV72993.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia canadensis str. McKiel] (432 aa)
Score = 142, Expect = 2.9e-07, Identities = 52/186 (27%), Positives = 90/186 (48%)
  Q:     8 AGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYI 193
             VSGG DS+ LL L   + KK      V+ V++N R  + ++   ++     L       +      +  N Q +AR+ R+           +  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     H + +  DE+N    YKRN VRQ++A      KEE YI
  S:    26 VAVSGGSDSVALLYLTNVWAKKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYNLSFDHQNNFS-NLQERAREGRYNLMTNLCLELDILALLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWHNNIQIIRPLYNIPKSELVEYLVNHNIKWFEDESNLSDKYKRNLVRQKLA------KEEDYI 210
>gi|116051635|ref|YP_789526.1| hypothetical protein PA14_17280 [Pseudomonas aeruginosa UCBPP-PA14] >gi|115586856|gb|ABJ12871.1| putative cell cycle protein [Pseudomonas aeruginosa UCBPP-PA14] (442 aa)
Score = 142, Expect = 3.0e-07, Identities = 50/175 (28%), Positives = 81/175 (46%)
  Q:     6 YIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +    SGG DS +LL L  +            +HV++  +  A       +  C+ L +PL V  V        + +  AR  R+  FQ  A+L +   LL A H DD  E    +L   A  R +     +R  L G ++ RP +   + E+ A  + H++ +  D +N  P + RN +R+EI
  S:    23 WCVAFSGGLDSTVLLHLLAQLARSEALPALSALHVHHGLQAAADGWPAHCQAVCRSLGIPLRVERV--QVAVGGSIEQAARDARYRAFQ--ANLGEGQVLLTAQHLDDQAETLLFRLLRGAGLRGLAAMPASR-PLGGGRLCRPLLGVSRAELEAYAQTHRLDWVEDPSNQDPRFSRNYLRREI 201
>gi|134298004|ref|YP_001111500.1| tRNA(Ile)-lysidine synthetase [Desulfotomaculum reducens MI-1] >gi|134050704|gb|ABO48675.1| tRNA(Ile)-lysidine synthetase [Desulfotomaculum reducens MI-1] (472 aa)
Score = 142, Expect = 3.0e-07, Identities = 53/174 (30%), Positives = 87/174 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYH---KKIAC---VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQA-----------QARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + GVSGG DS++LL + +   +++     V H+N+  R   A  D   V+E C    +P         TV K+N  A            AR++R++ +          K+ LAHH +D  E   M  L         GI   R  LY     RP +K  ++EI    +   + + ID +N + +Y+RN++R ++
  S:    24 LVGVSGGLDSVVLLHILNCLKEELGISLHVAHLNHMFRGEEATEDALFVQELCSNWGIPC--------TVEKRNVPAYAQARGLSSELAAREVRYQFYDDVREETGGHKIALAHHANDQAESVLMNMLRGSGLKGISGIAPVRDNLY----IRPLLKLLRSEIEQYGQRKGLTFRIDSSNLEVVYRRNKLRHQL 205
>gi|146310390|ref|YP_001175464.1| tRNA(Ile)-lysidine synthetase [Enterobacter sp. 638] >gi|145317266|gb|ABP59413.1| tRNA(Ile)-lysidine synthetase [Enterobacter sp. 638] (426 aa)
Score = 142, Expect = 3.3e-07, Identities = 53/176 (30%), Positives = 83/176 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLK---LYHKKIACV----VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP-EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           P  Q + G SGG DS +LL    L+ ++   V    +HV++   + A       E  CK   +PLIV  V   D       +AQARK R+  F+K  +L   + L+ A H DD  E   + L      A    +  R E  G ++ RP +   +  +    +++ + +  DE+N    Y RN +R
  S:    12 PYRQLLVGFSGGLDSTVLLHRLMLWREQEPDVQIRAIHVHHGLSSNADHWVAHCESLCKSWHIPLIVERVKLRDE--GLGTEAQARKARYLAFEK--TLQAGEALVTAQHLDDQCETFLLALKRGSGPAGLSAMPVRTEFAGSQLIRPLLGETRTSLEKWAQDYNLCWIDDESNQDDRYDRNFLR 192
>gi|169634324|ref|YP_001708060.1| tRNA(Ile)-lysidine synthetase [Acinetobacter baumannii SDF] >gi|169153116|emb|CAP02190.1| tRNA(Ile)-lysidine synthetase [Acinetobacter baumannii] (467 aa)
Score = 142, Expect = 3.4e-07, Identities = 51/178 (28%), Positives = 89/178 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKL----YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K+ ++ G SGG DSMLLL L    + +KI   +++++  +  +    ++V      L +P I+  V    +   N +AQAR+ R++ +Q+   L + + LLLAHH+ D  E   ++L         A    I  R +   M ++RPF+   + +I     + +V Y  D  N    Y R   R+ +
  S:    30 KSSFLIGCSGGMDSMLLLHLMAQIFPQKIRA-IYIDHQLQDQSAEWAEVVATQATILNIPYIIQKV---QIANGNLEAQARQARYQAYQQ--HLQENEILLLAHHQQDQAETVILRLLSGAGVDGLAAMQAIDYRKD---MTIWRPFLDLTREQIALWTAQLEVKYIDDPMNYDNHYDRVWCREAL 206
>gi|194553321|ref|YP_002088348.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] >gi|126195714|gb|EAZ59777.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] (442 aa)
Score = 142, Expect = 3.4e-07, Identities = 50/175 (28%), Positives = 81/175 (46%)
  Q:     6 YIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +    SGG DS +LL L  +            +HV++  +  A       +  C+ L +PL V  V        + +  AR  R+  FQ  A+L +   LL A H DD  E    +L   A  R +     +R  L G ++ RP +   + E+ A  + H++ +  D +N  P + RN +R+EI
  S:    23 WCVAFSGGLDSTVLLHLLAQLARSEALPALSALHVHHGLQAAADGWPAHCQAVCRSLGIPLRVERV--QVAVGGSIEQAARDARYRAFQ--ANLGEGQVLLTAQHLDDQAETLLFRLLRGAGLRGLAAMPASR-PLGGGRLCRPLLGVSRAELEAYAQTHRLDWVEDPSNQDPRFSRNYLRREI 201
>gi|15598834|ref|NP_252328.1| hypothetical protein PA3638 [Pseudomonas aeruginosa PAO1] >gi|61216741|sp|Q9HXZ3|TILS_PSEAE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|9949797|gb|AAG07026.1|AE004783_11 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] (442 aa)
Score = 142, Expect = 3.4e-07, Identities = 50/175 (28%), Positives = 81/175 (46%)
  Q:     6 YIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +    SGG DS +LL L  +            +HV++  +  A       +  C+ L +PL V  V        + +  AR  R+  FQ  A+L +   LL A H DD  E    +L   A  R +     +R  L G ++ RP +   + E+ A  + H++ +  D +N  P + RN +R+EI
  S:    23 WCVAFSGGLDSTVLLHLLAQLARSEALPALSALHVHHGLQAAADGWPAHCQAVCRSLGIPLRVERV--QVAVGGSIEQAARDARYRAFQ--ANLGEGQVLLTAQHLDDQAETLLFRLLRGAGLRGLAAMPASR-PLGGGRLCRPLLGVSRAELEAYAQAHRLDWVEDPSNQDPRFSRNYLRREI 201
>gi|84389775|ref|ZP_00991327.1| Cell cycle protein MesJ [Vibrio splendidus 12B01] >gi|84376876|gb|EAP93750.1| Cell cycle protein MesJ [Vibrio splendidus 12B01] (444 aa)
Score = 142, Expect = 3.4e-07, Identities = 46/177 (25%), Positives = 80/177 (45%)
  Q:     4 TQYIAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
            + I   SGG DS +LL+L       H    C VHV++     A    +  + +C  L V L V  V  D    ++ +  AR  R+  FQK  S   V  L+   H DD +E   + L  ++ +   G+ +  ++       + RP +   + +I     +  + +  DE+N    + RN +R ++
  S:    20 NRLIVAFSGGVDSRVLLELAAQYAQTHGIECCAVHVHHGLSKNADHWAEQCQTWCDALSVSLAVERVSLDIDSGESVEKLARDARYNAFQKHLSFGDV--LITGQHIDDQLETFLLAL--KRGSGPKGLSSMAKMMPFANAHIVRPLLSVTRTDIEGAARDMALTWVEDESNQDLRFDRNFIRHQV 201
>gi|85372930|ref|YP_456992.1| ATPase [Erythrobacter litoralis HTCC2594] >gi|84786013|gb|ABC62195.1| ATPase [Erythrobacter litoralis HTCC2594] (319 aa)
Score = 142, Expect = 3.6e-07, Identities = 52/173 (30%), Positives = 83/173 (47%)
  Q:    10 VSGGPDSMLLLKLYHKKI---ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMK------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           VSGGPDS+ LL L +  +        +++  R  A  +  MV   C++L V  + HTV E  +   N Q +ARK R+E   +       D    AHH DD  E   M+ +     +   GI+ R  L   +      V RP +++ + E+  +  +  +    D +N    Y R QVR+ +A+
  S:    20 VSGGPDSLALLLLANTALPGRVVAATIDHGLRPEAADEAAMVGGLCERLGV--LHHTV-EVALEPGNTQDRARKARYEALCRCFGEQGADTFATAHHADDQAETLLMRFNRGSGLSGLAGIRARTVLLSPEPLGEYLVVRPLLEWRREELAGIVADAGLAPVQDPSNVDTRYDRVQVRRALAD 199
>gi|169797140|ref|YP_001714933.1| tRNA(Ile)-lysidine synthetase [Acinetobacter baumannii AYE] >gi|169150067|emb|CAM87961.1| tRNA(Ile)-lysidine synthetase [Acinetobacter baumannii] (467 aa)
Score = 141, Expect = 3.7e-07, Identities = 51/178 (28%), Positives = 89/178 (50%)
  Q:     3 KTQYIAGVSGGPDSMLLLKL----YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           K+ ++ G SGG DSMLLL L    + +KI   +++++  +  +    ++V      L +P I+  V    +   N +AQAR+ R++ +Q+   L + + LLLAHH+ D  E   ++L         A    I  R +   M ++RPF+   + +I     + +V Y  D  N    Y R   R+ +
  S:    30 KSSFLIGCSGGMDSMLLLHLMAQIFPQKIRA-IYIDHQLQDQSAEWAEVVATQATILNIPYIIQKV---QIANGNLEAQARQARYQAYQQ--HLQENEILLLAHHQQDQAETVILRLLSGAGVDGLAAMQAIDYRKD---MTIWRPFLDLTREQIALWTAQLEVKYIDDPMNYDNHYDRVWCREAL 206
>gi|50913357|ref|YP_059329.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS10394] >gi|61217204|sp|Q5XEL7|TILS_STRP6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|50902431|gb|AAT86146.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS10394] (428 aa)
Score = 141, Expect = 3.9e-07, Identities = 66/272 (24%), Positives = 125/272 (45%)
  Q:     7 IAGVSGGPDSMLLLK---LYHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHH------IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSI 278
           +  VSGG DSM LL    L+  K+     + HVN+ +R+ +  ++  ++ + K+  +P+ V     + ++    +  AR  R+  F+          L+ AHH DD  E   M+L    R  +  GIK+       ++ RPF+ + K ++       ++ +  D +N +  + RN+VR       K+E   F  G+  +  +    LF   K     +   D+ E       +Q + +  FL+  +      +D+   +   +L  IQ  +Q +Y LK + ++ I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNF--EGIFS---EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDL------PEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQL-ALENSLLFQAFKELTNHITTTDLTEFN-----EQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQIAKQGYYYLKKDYYIFI 291
>gi|86146872|ref|ZP_01065191.1| Cell cycle protein MesJ [Vibrio sp. MED222] >gi|85835324|gb|EAQ53463.1| Cell cycle protein MesJ [Vibrio sp. MED222] (448 aa)
Score = 141, Expect = 4.1e-07, Identities = 48/190 (25%), Positives = 84/190 (44%)
  Q:     7 IAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK---VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVC 196
           +   SGG DS +LL+L       H    C VHV++     A    +  + +C    VPL +  V  D    ++ +  AR  R++  QK  S   V  L+   H DD +E   + L  ++ +   G+ +  ++       + RP +   + +I A   +  + +  DE+N    + RN +R ++     E    F   VC
  S:    23 VVAFSGGVDSRVLLELAAKYAKSHHIECCAVHVHHGLSKNADLWAEQCQTWCDASSVPLAIERVSLDINSGESVEKLARDARYDSLQKHLSFGDV--LITGQHIDDQLETFLLAL--KRGSGPKGLSSMAKVMSFGEAFIVRPLLSVTRLDIEASAHDMGLTWVEDESNQDLRFDRNFIRHQVTPTLTERWPSFRESVC 217
>gi|107103152|ref|ZP_01367070.1| hypothetical protein PaerPA_01004221 [Pseudomonas aeruginosa PACS2] (442 aa)
Score = 141, Expect = 4.6e-07, Identities = 50/175 (28%), Positives = 81/175 (46%)
  Q:     6 YIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +    SGG DS +LL L  +            +HV++  +  A       +  C+ L +PL V  V        + +  AR  R+  FQ  A+L +   LL A H DD  E    +L   A  R +     +R  L G ++ RP +   + E+ A  + H++ +  D +N  P + RN +R+EI
  S:    23 WCVAFSGGLDSTVLLHLLVQLARSEALPALSALHVHHGLQAAADGWPAHCQAVCRSLGIPLRVERV--QVAVGGSIEQAARDARYRAFQ--ANLGEGQVLLTAQHLDDQAETLLFRLLRGAGLRGLAAMPASR-SLGGGRLCRPLLGVSRAELEAYAQAHRLDWVEDPSNQDPRFSRNYLRREI 201
>gi|108563137|ref|YP_627453.1| hypothetical protein HPAG1_0712 [Helicobacter pylori HPAG1] >gi|107836910|gb|ABF84779.1| hypothetical protein HPAG1_0712 [Helicobacter pylori HPAG1] (338 aa)
Score = 140, Expect = 5.0e-07, Identities = 53/176 (30%), Positives = 86/176 (48%)
  Q:     7 IAGVSGGPDSMLLLKLY-HKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDA----RKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIAN 182
           + G SGG DS  L  L   K IA  +  V+YN +   L   +  ++  +       +H  P+    ++NF+ QARKIR++ F+     Y    L+LAHH +D +E   MQL           +   + RG  Y   + RP +   K+ +  L ++ K  +  D++N+   +KRN  R+  AN
  S:    19 LLGFSGGLDSTCLFHLLVGKNIAFDIALVDYNTQKQRLEIIQHAQKLAQAHHKKCYIHYAPK---IERNFEMQARKIRYDFFETLMREYSYKHLILAHHLNDRLEWFLMQLSKGAGLNTLLSFQAYEKRG-FYA--IVRPLLYTPKDTLKTLAKDQK--FFEDDSNSSLKFKRNFFRKHYAN 192
>gi|157953048|ref|YP_001497940.1| hypothetical protein NY2A_B744L [Paramecium bursaria Chlorella virus NY2A] >gi|155123275|gb|ABT15143.1| hypothetical protein NY2A_B744L [Paramecium bursaria Chlorella virus NY2A] (504 aa)
Score = 140, Expect = 5.0e-07, Identities = 50/192 (26%), Positives = 87/192 (45%)
  Q:     4 TQYIAGVSGGPDSMLL------LKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE-------DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           ++    +SGG DSM L      L+ ++     V  VNY  R  A  ++  V ++   L  P+ V  + E       D   +  ++   RK+R+  ++   S+     + + H++DD +E     +    K     GI T  +      +RP +   K+EI+A    H +PY  + T A   +KR  VR  +     +  E F  G+
  S:   198 SEITMSLSGGVDSMTLFHILDGLRGFYGYKMNVAMVNYTNRACAYDEEYFVTDWANWLGYPISVRRIEEINRKPCIDANIRTLYETYTRKVRYNTYK---SISHEAFVAMGHNKDDCLENILQNICSGHKYDNLAGIVTVVKQDDNNFFRPLLDVSKDEIIAYARYHNIPYLPNSTPAH--FKRGMVRNFVVPCMNDWDERFIPGL 398
>gi|39934200|ref|NP_946476.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris CGA009] >gi|61216538|sp|Q6NAQ6|TILS_RHOPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39648048|emb|CAE26568.1| YaeN protein [Rhodopseudomonas palustris CGA009] (346 aa)
Score = 140, Expect = 5.4e-07, Identities = 48/177 (27%), Positives = 79/177 (44%)
  Q:    10 VSGGPDSMLLL--------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG---ELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           VSGGPDS+ L+         L       VV V++  R  A  + + V+     L +P        D       QA AR  R+    KAA       ++ AH RDD  E   M+L   + +   G+       E  G+ + RP +   K  ++A   + ++ +  D +NA P + R ++R+ +   + E
  S:    31 VSGGPDSLALMWLAARWRKALKRGPALAVVTVDHGLRPEAAAEARAVKRLAASLDLPHRTLRWSGDKP-STGIQAAARGARYRLLAKAAKTLGASHVMTAHTRDDQAETVLMRLS--RGSGIAGLAAMAREIERDGVVLARPLLDVPKARLIATLAKARIAFATDPSNADPRFTRPRLRELMPQLAAE 215
>gi|3929907|emb|CAA10333.1| hypothetical protein [Wolinella succinogenes] (210 aa)
Score = 140, Expect = 5.4e-07, Identities = 48/171 (28%), Positives = 78/171 (45%)
  Q:     7 IAGVSGGPDSM-LLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + G SGG DS  L   L  ++I   +  VNY++R  A  ++   +E   + +      + P   +   NF+ QAR  R+  F+         +LLLAHH  D +E   M+L      +   G  +R    G ++ RP  +  K  +     +H++ Y  DE+N  P   RN+ R
  S:    19 LLGFSGGVDSTALFFLLLEREIPFDIALVNYHQRAQAKEEESYAKELAHRHQKRCFTLSCP---LGPSNFEHQARLERYRFFESLIHQEGYARLLLAHHLGDRLEWLLMRLAQGSSLSTLLGFSSREIRLGYELIRPLGEITKEALYDYLHQHQIRYFEDESNRDPKPLRNRFR 189
>gi|157953860|ref|YP_001498751.1| hypothetical protein AR158_C670L [Paramecium bursaria Chlorella virus AR158] >gi|156068508|gb|ABU44215.1| hypothetical protein AR158_C670L [Paramecium bursaria Chlorella virus AR158] (504 aa)
Score = 140, Expect = 5.9e-07, Identities = 49/209 (23%), Positives = 95/209 (45%)
  Q:     9 GVSGGPDSMLL------LKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPE-------DTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWL 217
            +SGG DSM L      L+ ++     V  VNY  R  A  ++  V ++   L  P+ V  + E       D   +  ++   RK+R+  ++   ++ +   + + H++DD +E     +    K     G+       G+K +RP +   K++I+     H +PY  + T A   +KR  VR  I     +  + F  G+  +   + +    +   AK+++
  S:   203 SLSGGVDSMTLFHILDGLRGFYDYKMNVAMVNYTNRVCAYDEEYFVTDWANWLGYPISVRRIEEINRKPCIDADIRTLYETYTRKVRYNTYK---TISREAFVAMGHNKDDCLENILQNICSGHKYDNLNGMDIVVVQDGIKFFRPLLDVSKDDIIEYARGHNIPYLPNSTPAH--FKRGMVRNSIVPCMNDWDDRFIPGLFKLRDTMREMSMMMEITAKEFV 420
>gi|154175317|ref|YP_001408589.1| PP-loop family protein [Campylobacter curvus 525.92] >gi|112803929|gb|EAU01273.1| PP-loop family [Campylobacter curvus 525.92] (330 aa)
Score = 140, Expect = 5.9e-07, Identities = 50/166 (30%), Positives = 78/166 (46%)
  Q:    30 VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK---------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           +  V+YN+R  +  +         +        +V    + + NF+  ARK R+E F +  +      L+LAH  DD  E   MQL     A   G+    EL GM          + RP +K+ K+++ A  +E  + Y IDETN    ++RN +RQ   N+S+     F  GV
  S:    44 IAIVDYNERAQSKDEVASARALAAKFDKKCFTKSV---NLSRSNFECTARKARYEFFAEICAKNGYKNLILAHQLDDRFEWFLMQL-----AKGAGLN---ELLGMSDFERRKDYDILRPLLKFKKSQLEAFLKERGLKYFIDETNFSHKFRRNFMRQ---NFSEPFLARFSNGV 204
>gi|194547537|ref|YP_002082565.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|126168483|gb|EAZ53994.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] (442 aa)
Score = 140, Expect = 6.1e-07, Identities = 50/175 (28%), Positives = 81/175 (46%)
  Q:     6 YIAGVSGGPDSMLLLKLYHK-------KIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +    SGG DS +LL L  +            +HV++  +  A       +  C+ L +PL V  V        + +  AR  R+  FQ  A+L +   LL A H DD  E    +L   A  R +     +R  L G ++ RP +   + E+ A  + H++ +  D +N  P + RN +R+EI
  S:    23 WCVAFSGGLDSTVLLHLLAQLARSEALPALSALHVHHGLQAAADGWPAHCQVVCRSLGIPLRVERV--QVAVGGSIEQAARDARYRAFQ--ANLGEGQVLLTAQHLDDQAETLLFRLLRGAGLRGLAAMPASR-PLGGGRLCRPLLGVSRAELEAYAQTHRLDWVEDPSNQDPRFSRNYLRREI 201
>gi|32474937|ref|NP_867931.1| cell cycle protein homolog mesJ [Rhodopirellula baltica SH 1] >gi|61216595|sp|Q7UNE1|TILS_RHOBA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|32445477|emb|CAD75478.1| cell cycle protein homolog mesJ [Rhodopirellula baltica SH 1] (397 aa)
Score = 140, Expect = 6.2e-07, Identities = 54/174 (31%), Positives = 87/174 (50%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIA--------------------CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVP----EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM----YYGIKTRGEL-YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + G SGG DS+ L+ L  +  A                     V H N+  R   +  D+  V + C QL++PL++H VP      T    + +   R+IR + F++AA  +    + +AH  DD   QA+  L    R        GI    EL   + V RP ++  ++ +     E   P+  D +N   IY RN +R ++
  S:    40 LVGCSGGADSVALICLLAELWAEESNGLNPANETVTKPVAPLVVAHCNHGLRGEESNADEAFVRQICDQLQLPLVIHHVPPLNNSATSGPVSDERTLRQIRRDFFERAAKQHGCRYVAVAHSADD---QAETMLHHFIRGTGPLGLAGIAEASELDTDIVVRRPLLQVRRDTLRDGLREIGQPWREDASNRHTIYTRNWIRHDV 240
>gi|182414547|ref|YP_001819613.1| tRNA(Ile)-lysidine synthetase [Opitutus terrae PB90-1] >gi|177841761|gb|ACB76013.1| tRNA(Ile)-lysidine synthetase [Opitutus terrae PB90-1] (353 aa)
Score = 140, Expect = 6.3e-07, Identities = 71/281 (25%), Positives = 129/281 (45%)
  Q:     6 YIAGVSGGPDSMLLLKLY------HKKIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM---KVY-RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI-ANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAH--P-------DVRELKRYPLPDQRQLVYSFLITHH--IDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDERLTLL 286
           ++   SGG DS+ LL L       H++     H N+  R   AL+D++     C  L VPL V    +     K  +A+AR  R   F +     +   L   H +DD  E   M+L AR   +  G+     +  M   KV+ RP +   K E+ A        +  D+TNA   Y R+++RQ +   W     E   +   A++R + ++  + +   + WLA   P       ++R L+  P+   R+ ++ +L+ H     ++     ++L  +   +     +   +F  +  +RL ++
  S:    42 WMVAFSGGADSLALLLLLWAHWPEHRRRLSAAHFNHRLRGRAALQDERFCARVCAALHVPLAVDHWEDRPA--KPSEAEARTARHAFFDRQLRKRRARVLWFGHQQDDIAETLLMRL-ARGSGLA-GLAAPRPVQAMPAGKVHLRPLLGLKKAELAAALRRCGASWCEDQTNAGEHYLRSRIRQRVLPAWRAAVGERDALAGAALSRELMEEDDTAL---QAWLARLAPLREDGSLNLRRLRGVPVAVVRRALHQWLLQHERSTGLSRQCFASLLAAVLTRRTTRLSIGTGVFAEVGRDRLRIV 338
>gi|78223098|ref|YP_384845.1| tRNA(Ile)-lysidine synthetase-like [Geobacter metallireducens GS-15] >gi|78194353|gb|ABB32120.1| tRNA(Ile)-lysidine synthetase-like [Geobacter metallireducens GS-15] (468 aa)
Score = 139, Expect = 6.5e-07, Identities = 44/179 (24%), Positives = 82/179 (45%)
  Q:     2 PKTQYIAGVSGGPDSM----LLLKLYHKKIACVV-HVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P    +  VSGG DS+    +L+ L   ++  VV H+N++ R   +  D++ V +      +P          +    + + +   R+ R+E F + A+ Y    + LAHH DD  E   ++    + A   G+         +  RP +   ++EI        + + ID +NA   + RN++R E+
  S:    20 PGDTVVVAVSGGADSVALLDILISLSDLRLNLVVAHLNHSLRGAESDGDERFVADLAASRGLPFAGEKADVRALSIRERLSLEDAGRRARYEFFDRVATQYGARSVALAHHADDQAETLLLR--LLRGAGVTGLSAMAPRRDGRFVRPLLTLSRSEIEGYLHGRGLRFRIDSSNADTAFLRNRIRHEL 205
>gi|84624777|ref|YP_452149.1| cell cycle protein [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368717|dbj|BAE69875.1| cell cycle protein [Xanthomonas oryzae pv. oryzae MAFF 311018] (434 aa)
Score = 139, Expect = 6.6e-07, Identities = 49/180 (27%), Positives = 83/180 (46%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +P    +   SGG DS  LL+L      Y +     +HV++     A       +  C  L+VPL +  V  +       +A AR  R   F  A +L   + L LAHHRDD  E   ++ L A  +     ++ +       ++RP + + + ++LA     +V +  D +NA P + RN +R ++
  S:    12 IPPGPVLLAYSGGMDSSALLQLLAATPRYRQAGLRALHVHHGLHADADAWAAHCQRSCDALQVPLQIVRVQVERDSGLGLEAAARNARHIAF--AHTLAAGEWLTLAHHRDDQAETFLLRALRASGQEGLAAMRPQRPFADGTLWRPLLAHSRADLLAYALAQEVRWIEDPSNADPRHDRNFLRSQV 196
>gi|149174369|ref|ZP_01852996.1| hypothetical protein PM8797T_03444 [Planctomyces maris DSM 8797] >gi|148846914|gb|EDL61250.1| hypothetical protein PM8797T_03444 [Planctomyces maris DSM 8797] (354 aa)
Score = 139, Expect = 6.7e-07, Identities = 50/186 (26%), Positives = 88/186 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLK-----------LYHKKIACVVHVNYNKRTTAL-RDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM----YYGI-KTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
           P  + +  VSGG DSM LL+           L       + H+N+  R TA   D + +++ C++L +P +      +       + Q R  R+    + A   +  ++ +AH  DD   QA+  L    R        GI +TR    G+ + RP ++  + E++         Y  DE+NA   + RN++R ++    K+E
  S:    36 PAQRTLIAVSGGADSMALLRALKCLAQSSESLIPPDGLVIAHLNHGLRGTASDEDAEWLKQECRRLSLPCVTEKQELNQGPDSGLEEQCRTARYGFLTRVAIAEQCTQIAVAHTLDD---QAETVLHHIIRGTGITGLRGIPQTRVLQQGLHLIRPLLQISREEVVEFLNVCGQEYRNDESNADTSFTRNRIRHQLLPLLKKE 235
>gi|120553850|ref|YP_958201.1| tRNA(Ile)-lysidine synthetase [Marinobacter aquaeolei VT8] >gi|120323699|gb|ABM18014.1| tRNA(Ile)-lysidine synthetase [Marinobacter aquaeolei VT8] (445 aa)
Score = 139, Expect = 6.7e-07, Identities = 69/265 (26%), Positives = 115/265 (43%)
  Q:     1 MPKTQYI-AGVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV---------YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA-----NWSKEEKEEFYIG-VCAMNRVIGQKLFSLMKRAKQWLAHPDVR-ELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQ 265
           +P  Q +   +SGG DS LLL +       V  +H+N+  ++   + ++   + C  L V L V  V   T    + +  AR  R+E F++   L   D LL+AHH DD  E    +L         G    G L GM V         YRP++   ++ +  +  E  V +  D +N   ++ RN +R  +       W    K   +    CA +  + Q+L  L     QW +  D +  ++  P     ++    L+   I   G  + A+ D+     Q
  S:    24 LPACQELWVALSGGLDSSLLLHVVAAAYPRVRALHINHQLQSNHDQTERACIDLCAGLGVELQVRRVNVATG-AGSLEESARAARYEVFREV--LGDNDLLLMAHHADDQAETVLFRL-------LRGTGVNG-LAGMPVSRSLGRGHLYRPWLGVSRSRLEQVAREQGVSWAEDPSNQSEVHDRNYLRHSVMPGLKQRWPGLLKRVAHSARACAESETLSQRLAEL-----QWQSCGDDKGRIRLAPFSALGRIERRNLVRWWIHGRGLPVPALSDWCSALDQ 291
>gi|167772098|ref|ZP_02444151.1| hypothetical protein ANACOL_03472 [Anaerotruncus colihominis DSM 17241] >gi|167665896|gb|EDS10026.1| hypothetical protein ANACOL_03472 [Anaerotruncus colihominis DSM 17241] (467 aa)
Score = 139, Expect = 6.7e-07, Identities = 54/173 (31%), Positives = 80/173 (46%)
  Q:     8 AGVSGGPDSMLLLKLYHKKI-------ACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMY--YGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           A VSGG DS+ LL     ++       AC  H+N+  R   + RD+++V   C Q  V L V  V    +      + +  AR+ R+  F++ A  +   K+  AH   D  E   + L AR   +    GI   RG+     + RP I   + +  A C  H + Y  D TN      RN +R  I
  S:    23 AAVSGGADSVALLDFLCAQLDLGLTVRAC--HLNHCLRGEESDRDEQLVRTMCAQYGVALDVRRVDVRALAHTRGLSLETAAREARYAFFEEVARTHGC-KIATAHTLSDAAETVVLNL-ARGTGIVGLCGIPPVRGD-----IVRPLIGCTRAQTEAYCAAHGLCYVTDSTNLTDSCTRNHIRHNI 200
>gi|33151295|ref|NP_872648.1| cell-cycle protein MesJ [Haemophilus ducreyi 35000HP] >gi|61216603|sp|Q7VPN7|TILS_HAEDU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|33147515|gb|AAP95037.1| probable cell-cycle protein MesJ [Haemophilus ducreyi 35000HP] (428 aa)
Score = 139, Expect = 6.7e-07, Identities = 49/174 (28%), Positives = 83/174 (47%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY------GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  +SGG DS++LL L+ +    +  +++++     A       E  CKQ  +P I+  V  D       +A AR  R++    A  +   + L  AHH +D   QA+  L A KR    G+K    +        M ++RP +   K EI    ++ ++ +  DE+N    Y RN +R +I
  S:    21 LLSLSGGIDSVVLLDLFSRTTTPLRAIYIHHGLSANADNWADFCEALCKQYNIPFILQKVTVDK--STGIEAGARTARYKAI--AEHIQANEILATAHHLND---QAETFLLALKRG--SGVKGLSAMQIVSHRQNMTIFRPLLSTTKKEIQQYAKQQQLCWIEDESNQNNHYDRNFLRNQI 193
>gi|15794272|ref|NP_284094.1| hypothetical protein NMA1350 [Neisseria meningitidis Z2491] >gi|77358707|ref|YP_338292.1| tRNA(Ile)-lysidine synthetase [Neisseria meningitidis MC58] >gi|77358709|ref|YP_338291.1| tRNA(Ile)-lysidine synthetase [Neisseria meningitidis MC58] >gi|61216742|sp|Q9JUE9|TILS_NEIMA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|73919876|sp|Q4W568|TILS_NEIMB tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|66731914|gb|AAY52148.1| tRNA(Ile)-lysidine synthetase [Neisseria meningitidis MC58] >gi|66731931|gb|AAY52164.1| tRNA(Ile)-lysidine synthetase [Neisseria meningitidis MC58] >gi|121052202|emb|CAM08525.1| hypothetical protein NMA1350 [Neisseria meningitidis Z2491] (426 aa)
Score = 139, Expect = 6.8e-07, Identities = 52/171 (30%), Positives = 81/171 (47%)
  Q:    10 VSGGPDSMLLLKLYHKK------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +SGG DS++LL L  +       I   +H+++     A       + YC  L V L  V    E        +A AR+ R+  F +       D L LAHHRDD IE   + +      R  A    ++  GE  G+ ++RP + + + +I    ++H +P   DE+N    Y RN+ R  I
  S:    18 LSGGLDSVVLLHLLVRAGKKGGFIPDALHIHHGLSPRADDWADFCQNYCDMLGVGLETVKVCVEKN--GLGIEAAARQKRYAAFAEKG----FDVLALAHHRDDQIETFMLAVARGGGLRALAAMPAVRPFGE-KGI-IWRPLLPFSRQDIWDYAQKHGLPNIEDESNTDTAYLRNRFRHRI 191
>gi|148238412|ref|YP_001223799.1| tRNA(Ile)-lysidine synthase [Synechococcus sp. WH 7803] >gi|147846951|emb|CAK22502.1| tRNA(Ile)-lysidine synthase [Synechococcus sp. WH 7803] (350 aa)
Score = 139, Expect = 7.7e-07, Identities = 47/177 (26%), Positives = 82/177 (46%)
  Q:     4 TQYIAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAA------SLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGI--KTR----GELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           T  +  +SGG DSM LL L      +H     + H ++     +      + ++C Q  +PL    V   T      +A AR  R+ +  + A             +L AH   D  E   MQL         G   ++R       +G ++ RP + + ++E  A+C++  +P   D +N+    +RN++RQE+
  S:    41 TTLLLALSGGQDSMALLGLLRDLQKHHHWTLQLWHGDHGWHPGSAAVADALAQWCDQQALPL---RVSRSTAAITGSEAAARAWRYSELSQTAQQLNEAGAAGACTVLTAHTASDRAETLLMQLSRGTDLAGLGSLRQSRPLQANSSHGPRLVRPLLDFTRDETAAICQDLHLPVWHDPSNSDLRIERNRIRQEV 232
>gi|34558077|ref|NP_907892.1| hypothetical protein WS1770 [Wolinella succinogenes DSM 1740] >gi|61217316|sp|Q7MR31|TILS_WOLSU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|34483795|emb|CAE10792.1| conserved hypothetical protein-Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Wolinella succinogenes] (326 aa)
Score = 139, Expect = 7.9e-07, Identities = 48/171 (28%), Positives = 78/171 (45%)
  Q:     7 IAGVSGGPDSM-LLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           + G SGG DS  L   L  ++I   +  VNY++R  A  ++   +E   + +      + P   +   NF+ QAR  R+  F+         +LLLAHH  D +E   M+L      +   G  +R    G ++ RP  +  K  +     +H++ Y  DE+N  P   RN+ R
  S:    19 LLGFSGGVDSTALFFLLLEREIPFDIALVNYHQRAQAKEEESYAKELAHRHQKRCFTLSCP---LGPSNFEHQARLERYRFFESLIHQEGYARLLLAHHLGDRLEWLLMRLAQGSSLSTLLGFSSREIRLGYELIRPLGEITKEALYDYLHQHQIRYFEDESNRDPKPLRNRFR 189
>gi|51473299|ref|YP_067056.1| cell cycle ATPase MesJ [Rickettsia typhi str. Wilmington] >gi|61216485|sp|Q68XR8|TILS_RICTY tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51459611|gb|AAU03574.1| probable cell cycle ATPase MesJ [Rickettsia typhi str. Wilmington] (430 aa)
Score = 138, Expect = 8.6e-07, Identities = 50/198 (25%), Positives = 96/198 (48%)
  Q:     9 GVSGGPDSMLLLKLYH-----KKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKL 206
            VSGG DS+ LL L +       I   ++ V++N R  + ++   ++     LK      +      +  N QA+AR+ R++          V  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     +K+ +  DE+N    Y+RN +RQ++       K E  +     N++I  +L
  S:    25 AVSGGSDSVALLYLANIWAEKNNIELFIISVDHNLRAQSKQENYYIQSISNNLKRKYYNLSFDHQNNFS-NLQARAREGRYDLMTNLCLELDVLVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNIHWYNNIQIIRPLYNIPKSELVKYLVTNKIKWFEDESNLSDKYRRNIIRQKLFKEENYIKAEISVQQLKTNKLIEDEL 227
>gi|115526688|ref|YP_783599.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisA53] >gi|115520635|gb|ABJ08619.1| tRNA(Ile)-lysidine synthetase [Rhodopseudomonas palustris BisA53] (343 aa)
Score = 138, Expect = 8.8e-07, Identities = 47/177 (26%), Positives = 90/177 (50%)
  Q:    10 VSGGPDSMLLLKLYHKKIACV--------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK-----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           VSGGPDS+ L+ L  +  A +        V +++  R  + R+ + V++    L +P   H   +   W+         A AR  R+    KAA       +  AH RDD  E   M+L      A    +  + E  G+++ RP +   K++++A   + ++ + +D +N+ P + R ++R+ +A +++E
  S:    31 VSGGPDSLALMVLAARWRAALKRGPELIAVTIDHGLREASAREARDVKKLAGNLGLP---H---KTLRWRGDKPTSGIPAAARAARYALLAKAARSTGATHIFTAHTRDDQAETVLMRLSRGSGLAGLAAMARQSERCGLQLARPLLGIAKSQLIATLAKARIEFAVDPSNSDPRFTRPRLRRLMAAFAEE 215
>gi|146296231|ref|YP_001180002.1| tRNA(Ile)-lysidine synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409807|gb|ABP66811.1| tRNA(Ile)-lysidine synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] (455 aa)
Score = 138, Expect = 9.0e-07, Identities = 53/174 (30%), Positives = 89/174 (51%)
  Q:     7 IAGVSGGPDSMLLLK-LYHKKIA-----CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTV---WKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + G SGG DSM+LL  +Y  K        V H+N+  R  A+ D+  V + CK+  +  I  ++    +    K + +   R  R+  F +  +   + K+LL H+++D +E   + L   + +   G+ +   +  + V RP I   + EI    EE+ + Y ID+TN    YKRN VR +I
  S:    24 LIGCSGGIDSMVLLDCIYRLKDEYELDITVAHLNHMLRQEAIEDELFVIDTCKRYNIKCITRSIDVRKIKEERKLSEEEAGRLARYNFFYELVNSLGLSKILLGHNKNDVVETFFLNL--FRGSGLDGLASIPPVRDI-VARPLIYMSREEIEEYAEENGIKYVIDKTNFSSKYKRNVVRNQI 203
>gi|170017773|ref|YP_001728692.1| ATPase [Leuconostoc citreum KM20] >gi|169804630|gb|ACA83248.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Leuconostoc citreum KM20] (435 aa)
Score = 138, Expect = 9.1e-07, Identities = 55/211 (26%), Positives = 96/211 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIA----CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYK-RNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWL 217
           I  VSGG DS++LL    + +      V HVNY+ R  +  D   V +     +         E   W        + QAR++R+  F + A  Y+   +++AHH +D  E   ++L    R     G+  +  L    V RPF+   K +++   ++H + +  D+TN    Y  RN +R  +    K    +    V +  + I ++   +  +AKQ+L
  S:    19 IVAVSGGVDSVVLLHALRQYLPDTKLVVAHVNYHLRKESDGDALFVRQLATTYQAAF------EQIDWSIMPSHAVEEQARELRYRFFARLAGQYRTKTIVVAHHANDQAETVLLKLIRGGRLEQLAGMSVKKRL----VLRPFLGITKQQLITYAQQHHLSWREDDTNFDATYTPRNLLRNIVIPELKTINPQVVNHVNSFAKQIAEQSELISFQAKQYL 229
>gi|152968782|ref|YP_001333891.1| tRNA(Ile)-lysidine synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953631|gb|ABR75661.1| tRNA(Ile)-lysidine synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (437 aa)
Score = 138, Expect = 9.1e-07, Identities = 52/176 (29%), Positives = 85/176 (48%)
  Q:     2 PKTQYIAGVSGGPDSMLLL----KLYHKKIACV---VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNF--QAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM----YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           P  Q +   SGG DS +LL    +L  +  A     VHV++     A +      + C+Q +VPL+VH V   T+ +     +A AR  R++ FQ+  +L   + L+ A H+DD   Q +  L A KR         +       G ++ RP +   +  +      H++ +  DE+N    Y RN +R
  S:    15 PHRQLLVAFSGGLDSTVLLHQLVQLREQDPALTLRAVHVHHGLSAHADQWVAHCRQVCQQWQVPLVVHHV---TLARGGLGVEAHARAARYQAFQE--TLNAGEVLVTAQHQDD---QCETLLLALKRGSGPTGLSAMAPSSAFAGSRLLRPLLNETRESLRQWALAHQLSWIEDESNQDDTYDRNFLR 195
>gi|182420057|ref|ZP_02951291.1| tRNA(Ile)-lysidine synthase [Clostridium butyricum 5521] >gi|182376094|gb|EDT73681.1| tRNA(Ile)-lysidine synthase [Clostridium butyricum 5521] (464 aa)
Score = 138, Expect = 9.9e-07, Identities = 59/199 (29%), Positives = 94/199 (47%)
  Q:     7 IAGVSGGPDSMLLLK-LYHKKIACVV-----HVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQK 205
           +  +SGGPDS+ LL  LY+ K    +     H+N+  R   A  D++ V+  CK L +P  V  V  +   K    + +   R  R+  F          K+  AH+ +D  E    +L  R   +    GIK R +    K+ RP +   + E+    E + +   ID+TN + IY RN++R ++  + KE   E  I       V+ QK
  S:    22 LVALSGGPDSVCLLNILYNLKAELNIEIGAAHLNHLLRDKDAFEDEEYVKILCKSLDIPCFVKRVDINKCSKDKKMSSEMAGRDARYNFFDDIVKDKGYTKIATAHNANDQAETILFRL-MRGSGIEGLCGIKVRRD----KIIRPILCLSRKEVEEYIEINNLKPRIDKTNFEKIYNRNKIRLDMIPYIKENFNEDIIQTLNRMSVLLQK 227
>gi|61216416|sp|Q5P9R1|TILS_ANAMM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (466 aa)
Score = 138, Expect = 1.1e-06, Identities = 52/176 (29%), Positives = 83/176 (47%)
  Q:     6 YIAGVSGGPDSMLLLKL---YHKKIAC----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           Y   VSGG DS+ LL L    HK  A     V+  N+  R  A  + + V++    L +        E   W ++      Q  AR+IR+    +  + + V  LL AH++ D  E   M L+ R   +    G+  R     + +YRP + + + EIL    + ++ +  D +N  P Y+R   R  IA
  S:    37 YAVAVSGGVDSITLLNLVAALHKTQATSRPVVLTGNHGFRAEADHETRFVQKRAVALGLDC------EILRWNRHRTSSKSQETAREIRYSLLHQWCTEHSVKFLLTAHNKSDQAETVLMHLE-RGSGIDGLSGMHERSVFGDITIYRPLLGFTRQEILEYATQKQLSWVEDPSNQDPKYRRTFFRNLIA 219
>gi|167754461|ref|ZP_02426588.1| hypothetical protein ALIPUT_02757 [Alistipes putredinis DSM 17216] >gi|167659086|gb|EDS03216.1| hypothetical protein ALIPUT_02757 [Alistipes putredinis DSM 17216] (448 aa)
Score = 138, Expect = 1.1e-06, Identities = 52/190 (27%), Positives = 89/190 (46%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKI--ACVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLI---VHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEF 191
           P+   +  VSGG DSM++L L+ +      V H N+  R   +  D+++V    ++  VP       T  E     ++ +  AR++R+  F + +  +    + +AHH DD IE   + L  R   +    GI T    +  K+ RP +   + +IL       +PY  D +N    Y RN++R  +    KE   +F
  S:    19 PEDFILLTVSGGVDSMVMLSLFVRSGYRVGVAHCNFQLRGVESEEDEELVRREAEKYGVPWYNKRFDTKGEMERTGESMEMAARRLRYAWFDELSREHGYTVVAIAHHIDDSIETFFINL-LRGTGLRGLTGITT----HAGKLIRPLMFASRKDILEYAVAQHIPYREDSSNRSTKYLRNKIRLGLVPRIKEISPKF 211
>gi|58582920|ref|YP_201936.1| cell cycle protein [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427514|gb|AAW76551.1| cell cycle protein [Xanthomonas oryzae pv. oryzae KACC10331] (434 aa)
Score = 137, Expect = 1.1e-06, Identities = 49/180 (27%), Positives = 82/180 (45%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +P    +   SGG DS  LL+L      Y +     +HV++     A       +  C  L+VPL +  V  +       +A AR  R   F  A +L   + L LAHHRDD  E   ++ L A        ++ +       ++RP + + + ++LA     +V +  D +NA P + RN +R ++
  S:    12 IPPGPVLLAYSGGMDSSALLQLLAATPRYRQAGLRALHVHHGLHADADAWAAHCQRSCDALQVPLQIVRVQVERDSGLGLEAAARNARHIAF--AHTLAAGEWLTLAHHRDDQAETFLLRALRASGPEGLAAMRPQRPFADGTLWRPLLAHSRADLLAYALAQEVRWIEDPSNADPRHDRNFLRSQV 196
>gi|166711443|ref|ZP_02242650.1| cell cycle protein [Xanthomonas oryzae pv. oryzicola BLS256] (434 aa)
Score = 137, Expect = 1.2e-06, Identities = 49/179 (27%), Positives = 81/179 (45%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P    +   SGG DS  LL+L      Y +     +HV++     A       +  C  L+VPL +  V  +       +A AR  R   F  A +L   + L LAHHRDD  E   ++ L A        ++ +       ++RP + + + ++LA     K+ +  D +NA P + RN +R ++
  S:    13 PPGPVLLAYSGGMDSSALLQLLAATPRYRQAGLRALHVHHGLHADADAWAAHCQRSCDALQVPLQIVRVQVERDSGLGLEAAARNARHIAF--AHTLAAGEWLTLAHHRDDQAETFLLRALRASGPEGLAAMRPQRPFANGTLWRPLLAHSRADLLAYALAQKLRWIEDPSNADPHHDRNFLRSQV 196
>gi|125716899|ref|YP_001034032.1| PP family ATPase [Streptococcus sanguinis SK36] >gi|166988067|sp|A3CJX7.1|TILS_STRSV tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|125496816|gb|ABN43482.1| Cell cycle control ATPase, PP-loop superfamily, putative [Streptococcus sanguinis SK36] (425 aa)
Score = 137, Expect = 1.2e-06, Identities = 51/171 (29%), Positives = 87/171 (50%)
  Q:     7 IAGVSGGPDSMLLLKLY---HKKIA---CVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNF-QAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           +  VSGG DSM LL+L     K++A    + HVN+ +R  + +++K + +  +QL V +   +      +  NF +  AR+ R++ F K         L+ AHH DD  E   M+L   AR R +  G+K        ++ RP + + K++         + +  D +N Q  Y RN++R
  S:    23 LIAVSGGLDSMTLLQLLIVSQKELAIELAIAHVNHKQRPESDQEEKALVKIAEQLGVKIFTSS------FSGNFSENAARQFRYDFFGKVMQEGHYTALVTAHHADDQAETVFMRLLRGARLRHL-SGMKAVQPFACGELIRPLLTFHKSDF------PDIQHFEDSSNFQNDYLRNRIR 189
>gi|170682716|ref|YP_001742316.1| tRNA(Ile)-lysidine synthase [Escherichia coli SMS-3-5] >gi|170520434|gb|ACB18612.1| tRNA(Ile)-lysidine synthase [Escherichia coli SMS-3-5] (432 aa)
Score = 137, Expect = 1.2e-06, Identities = 49/173 (28%), Positives = 87/173 (50%)
  Q:     5 QYIAGVSGGPDSMLLL------KLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY---GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           Q +   SGG DS +LL      +  +  +    +HV++     A    +  E  C+Q +VPL+V  V   ++ +     +AQAR++R++ F  A +L   + L+ A H DD  E   + L  ++ +   G+   GE+    G ++ RP +   + E+      H + +  DE+N    Y RN +R
  S:    14 QILVAFSGGLDSTVLLHQLVQWRTENPGVTLRAIHVHHGLSANADAWVRHCENICQQWQVPLVVERVQLAQEGL---GIEAQARQVRYQAF--ARTLLPGEVLVTAQHLDDQCETFLLAL--KRGSGPAGLSAMGEVSEFAGTQLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|46203193|ref|ZP_00208846.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Magnetospirillum magnetotacticum MS-1] (343 aa)
Score = 137, Expect = 1.2e-06, Identities = 44/157 (28%), Positives = 75/157 (47%)
  Q:    10 VSGGPDSMLLLKLY-------HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP--EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKR-AMYYGIKTRGELY-GMKVYRPFIKYWKNEILALCEEHKVPYGIDETN 166
           VSGGPDS  L+ +        H ++A +   ++  R  +  + + V     ++    + H +   E        Q  AR  R+      A+    D +L AH  DD  E   M+L A    A   G++    L  G+++ RPF+   K +++A CE H++P+  D +N
  S:    31 VSGGPDSTALMHVAVRAGTGAHLRVATI---DHGLRPGSAGEARAVGHLAGEMG---LTHAILAWESPRSGSRIQETARDARYRLLTDHAASLGADLVLTAHTLDDQAETVLMRLMAGSGPAGLAGMRHERPLAPGIRLARPFLAVPKADLVAYCEAHRLPFVRDPSN 192
>gi|157964107|ref|YP_001498931.1| tRNA(Ile)-lysidine synthetase [Rickettsia massiliae MTU5] >gi|166988065|sp|A8F0E8.1|TILS_RICM5 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157843883|gb|ABV84384.1| tRNA(Ile)-lysidine synthetase [Rickettsia massiliae MTU5] (477 aa)
Score = 137, Expect = 1.3e-06, Identities = 44/173 (25%), Positives = 86/173 (49%)
  Q:     9 GVSGGPDSMLLLKLYH-----KKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
            VSGG DS+ LL L +       I   V+ V++N R  + ++   ++     L       +      +  N Q +AR+ R++          +  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     H + +  DE+N+   Y+RN +RQ++A
  S:    25 AVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS-NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNVIRQKLA 202
>gi|56417150|ref|YP_154224.1| cell cycle protein [Anaplasma marginale str. St. Maries] >gi|56388382|gb|AAV86969.1| cell cycle protein [Anaplasma marginale str. St. Maries] (501 aa)
Score = 137, Expect = 1.3e-06, Identities = 52/176 (29%), Positives = 83/176 (47%)
  Q:     6 YIAGVSGGPDSMLLLKL---YHKKIAC----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN-----FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
           Y   VSGG DS+ LL L    HK  A     V+  N+  R  A  + + V++    L +        E   W ++      Q  AR+IR+    +  + + V  LL AH++ D  E   M L+ R   +    G+  R     + +YRP + + + EIL    + ++ +  D +N  P Y+R   R  IA
  S:    72 YAVAVSGGVDSITLLNLVAALHKTQATSRPVVLTGNHGFRAEADHETRFVQKRAVALGLDC------EILRWNRHRTSSKSQETAREIRYSLLHQWCTEHSVKFLLTAHNKSDQAETVLMHLE-RGSGIDGLSGMHERSVFGDITIYRPLLGFTRQEILEYATQKQLSWVEDPSNQDPKYRRTFFRNLIA 254
>gi|188577760|ref|YP_001914689.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188522212|gb|ACD60157.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Xanthomonas oryzae pv. oryzae PXO99A] (434 aa)
Score = 137, Expect = 1.3e-06, Identities = 49/180 (27%), Positives = 82/180 (45%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKL------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +P    +   SGG DS  LL+L      Y +     +HV++     A       +  C  L+VPL +  V  +       +A AR  R   F  A +L   + L LAHHRDD  E   ++ L A        ++ +       ++RP + + + ++LA     +V +  D +NA P + RN +R ++
  S:    12 IPPGPVLLAYSGGMDSSALLQLLAATPRYRQAGLRALHVHHGLHADADAWAAHCQRSCDALQVPLQIVRVQVERDSGLGLEAAARNARHIAF--AHTLAAGEWLTLAHHRDDQAETFLLRALRASGPEGLAAMRPQRPFADGTLWRPLLAHSRADLLAYALAQEVRWIEDPSNADPRHDRNFLRSQV 196
>gi|121634879|ref|YP_975124.1| hypothetical protein NMC1080 [Neisseria meningitidis FAM18] >gi|120866585|emb|CAM10336.1| hypothetical protein [Neisseria meningitidis FAM18] (445 aa)
Score = 137, Expect = 1.3e-06, Identities = 51/171 (29%), Positives = 81/171 (47%)
  Q:    10 VSGGPDSMLLLKLYHKK------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +SGG DS++LL L  +       +   +H+++     A       + YC  L V L  V    E        +A AR+ R+  F +       D L LAHHRDD IE   + +      R  A    ++  GE  G+ ++RP + + + +I    ++H +P   DE+N    Y RN+ R  I
  S:    37 LSGGLDSVVLLHLLVRAGKRAGFVPEALHIHHGLSPRADDWADFCQNYCDMLGVGLETVKVCVEKN--GLGIEAAARQKRYAAFAEKG----FDILALAHHRDDQIETFMLAVARGGGLRALAAMPAVRPFGE-KGI-IWRPLLPFSRQDIWDYAQKHGLPNIEDESNTDTAYLRNRFRHRI 210
>gi|87307758|ref|ZP_01089901.1| cell cycle protein mesJ-like [Blastopirellula marina DSM 3645] >gi|87289372|gb|EAQ81263.1| cell cycle protein mesJ-like [Blastopirellula marina DSM 3645] (328 aa)
Score = 137, Expect = 1.4e-06, Identities = 49/174 (28%), Positives = 84/174 (48%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKIACV----------VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGEL-YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DS+ LL+     +A +          VHV++N R  +  D + V +  +QL +  I+  V  +       +A AR  R+   +  A  +    ++ AH  DD IE    + L     A   GI    EL  G+ + RP +   ++E+ A   +    +  DETN +  + RN++R ++
  S:    23 MVAVSGGADSVALLR----SLAAIRESGPGRLIAVHVDHNLRKESDTDAQFVAQLAQQLGIEGILGRVDFELSGPDGIEAAARSARYGFLRTFAMDHGARYVVTAHTADDQIETVLHRILRGTSLAGLSGIPRARELELGISLLRPMLSIRRSEVEAYLADLGQTFRHDETNDESRFFRNRLRNDL 204
>gi|167368280|ref|ZP_02302420.1| tRNA(Ile)-lysidine synthetase [Rhodopseudomonas palustris TIE-1] >gi|192289726|ref|YP_001990331.1| tRNA(Ile)-lysidine synthetase [Rhodopseudomonas palustris TIE-1] >gi|192283475|gb|ACE99855.1| tRNA(Ile)-lysidine synthetase [Rhodopseudomonas palustris TIE-1] (346 aa)
Score = 136, Expect = 1.5e-06, Identities = 47/177 (26%), Positives = 78/177 (44%)
  Q:    10 VSGGPDSMLLL--------KLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRG---ELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           VSGGPDS+ L+         L       VV V++  R  A  + + V+     L +P        D       QA AR  R+     AA       ++ AH RDD  E   M+L   + +   G+       E  G+ + RP +   K  ++A   + ++ +  D +NA P + R ++R+ +   + E
  S:    31 VSGGPDSLALMWLAARWRKSLKQGPALAVVTVDHGLRPEAAAEARAVKRLAASLDLPHRTLRWSGDKP-STGIQAAARGARYRLLANAAKTLGASHVMTAHTRDDQAETVLMRLS--RGSGIAGLAAMAREIERDGVVLARPLLDVPKARLIATLAKARIAFATDPSNADPRFTRPRLRELMPQLAAE 215
>gi|161870026|ref|YP_001599195.1| hypothetical protein NMCC_1059 [Neisseria meningitidis 053442] >gi|161595579|gb|ABX73239.1| hypothetical protein NMCC_1059 [Neisseria meningitidis 053442] (436 aa)
Score = 136, Expect = 1.5e-06, Identities = 51/171 (29%), Positives = 82/171 (47%)
  Q:    10 VSGGPDSMLLLKLYHKK------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +SGG DS++LL L  +       +   +H+++     A       + YC  L V L  V    E        +A AR+ R+  F +       D L LAHHRDD IE   + +      R  A    ++  GE  G+ ++RP + + + +I    ++H +P   DE+N+   Y RN+ R  I
  S:    28 LSGGLDSVVLLHLLVRAGKRAGFVPEALHIHHGLSPRADDWADFCQNYCDMLGVGLETVKVCVEKN--GLGIEAAARQKRYAAFAEKG----FDVLALAHHRDDQIETFMLAVARGGGLRALAAMPTVRPFGE-KGI-IWRPLLPFSRQDIWDYAQKHGLPNIEDESNSDTAYLRNRFRHRI 201
>gi|165976971|ref|YP_001652564.1| cell-cycle protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150871|ref|YP_001969396.1| tRNA(Ile)-lysidine synthase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165877072|gb|ABY70120.1| probable cell-cycle protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916002|gb|ACE62254.1| tRNA(Ile)-lysidine synthase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (419 aa)
Score = 136, Expect = 1.5e-06, Identities = 52/175 (29%), Positives = 86/175 (49%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++ G+SGG DS++LL L  +    +  VH+++     A       E+ CK+LK+P I+  V  D    +  +A AR  R++   +     +V  L+ AHH DD   Q +  L A KR    GIK    +  +       ++RP +   K +I     + +  +  DE+N    Y RN +R E+
  S:    20 FVLGLSGGIDSIVLLHLLAELQLNLRAVHIHHGLSPNADNWAAFCEQVCKRLKIPFILQKVTVDR--SEGIEAGARAARYQAIGEIIQPNEV--LVTAHHLDD---QTETFLLALKRGS--GIKGLSAMQAVGFWQNFTIFRPLLNVSKAQIEQYALQQQFTWIEDESNHDSHYDRNFLRNEV 193
>gi|15603921|ref|NP_220436.1| cell cycle protein MESJ (mesJ) [Rickettsia prowazekii str. Madrid E] >gi|6226316|sp|Q9ZEA3|TILS_RICPR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3860612|emb|CAA14513.1| CELL CYCLE PROTEIN MESJ (mesJ) [Rickettsia prowazekii] (430 aa)
Score = 136, Expect = 1.6e-06, Identities = 56/185 (30%), Positives = 92/185 (49%)
  Q:     9 GVSGGPDSMLLLKLYH-----KKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK------------KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYI 193
            VSGG DS+ LL L +       I   V+ V++N     LR Q   E Y         +HT+  +   K             N Q +AR+ R++          V  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     HK+ +  DE+N    Y+RN +RQ++       KEE YI
  S:    25 AVSGGSDSISLLYLANIWARKNNIELFVISVDHN-----LRPQSKQENY--------YIHTISSNLNRKYYNLSFDHQNNFSNLQERAREGRYDLMTNLCLELDVLVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNIHWYNNIQIIRPLYNIPKSELVEYLVNHKIKWFEDESNLSDKYRRNIIRQKLF------KEENYI 208
>gi|32034944|ref|ZP_00135035.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209005|ref|YP_001054230.1| tRNA(Ile)-lysidine synthase [Actinobacillus pleuropneumoniae L20] >gi|126097797|gb|ABN74625.1| tRNA(Ile)-lysidine synthase [Actinobacillus pleuropneumoniae L20] (419 aa)
Score = 136, Expect = 1.6e-06, Identities = 52/175 (29%), Positives = 86/175 (49%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGM------KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           ++ G+SGG DS++LL L  +    +  VH+++     A       E+ CK+LK+P I+  V  D    +  +A AR  R++   +     +V  L+ AHH DD   Q +  L A KR    GIK    +  +       ++RP +   K +I     + +  +  DE+N    Y RN +R E+
  S:    20 FVLGLSGGIDSIVLLHLLAELQLNLRAVHIHHGLSPNADNWAAFCEQVCKRLKIPFILQKVTVDR--SEGIEAGARAARYQAIGEIIQPNEV--LVTAHHLDD---QTETFLLALKRGS--GIKGLSAMQAVGFWQNFTIFRPLLNVSKAQIEQYALQQQFTWIEDESNHDSHYDRNFLRNEV 193
>gi|194098553|ref|YP_002001615.1| tRNA(Ile)-lysidine synthase [Neisseria gonorrhoeae NCCP11945] >gi|193933843|gb|ACF29667.1| tRNA(Ile)-lysidine synthase [Neisseria gonorrhoeae NCCP11945] (445 aa)
Score = 136, Expect = 1.7e-06, Identities = 53/171 (30%), Positives = 81/171 (47%)
  Q:    10 VSGGPDSMLLLKLY---HKKIACV---VHVNYNKRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +SGG DS++LL L     K+   V   +H+++     A         YC  L V L  V    E        +A AR+ R+ +F +       D L LAHHRDD IE   + +      R  A    ++  GE  G+ ++RP + + + +I     +H +P   DE+N    Y RN+ R  I
  S:    37 LSGGLDSVVLLHLLVCAGKRAGFVPEALHIHHGLSPRADDWADFCRNYCDMLGVGLETVKVCVEKN--GLGIEAAARQKRYAEFAEKG----FDVLALAHHRDDQIETFMLAVARGGGLRALAAMPAVRPLGE-NGI-IWRPLLPFSRQDIWDYARKHGLPNIEDESNTDTAYLRNRFRHRI 210
>gi|15891990|ref|NP_359704.1| cell cycle protein MesJ [Rickettsia conorii str. Malish 7] >gi|20140671|sp|Q92JK0|TILS_RICCN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15619104|gb|AAL02605.1| cell cycle protein MesJ [Rickettsia conorii str. Malish 7] (478 aa)
Score = 136, Expect = 1.7e-06, Identities = 44/173 (25%), Positives = 86/173 (49%)
  Q:     9 GVSGGPDSMLLLKLYH-----KKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
            VSGG DS+ LL L +       I   V+ V++N R  + ++   ++     L       +      +  N Q +AR+ R++          +  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     H + +  DE+N+   Y+RN +RQ++A
  S:    25 AVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS-NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVRHNIKWFEDESNSSDKYRRNVIRQKLA 202
>gi|91209258|ref|YP_539244.1| tRNA(Ile)-lysidine synthetase [Escherichia coli UTI89] >gi|117622473|ref|YP_851386.1| tRNA(Ile)-lysidine synthetase [Escherichia coli APEC O1] >gi|91070832|gb|ABE05713.1| putative cell cycle protein MesJ [Escherichia coli UTI89] >gi|115511597|gb|ABI99671.1| putative cell cycle protein MesJ [Escherichia coli APEC O1] (432 aa)
Score = 136, Expect = 1.7e-06, Identities = 49/173 (28%), Positives = 82/173 (47%)
  Q:     5 QYIAGVSGGPDSMLLL------KLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           Q +   SGG DS +LL      +  +  +    +HV++     A    K  E  C+Q +VPL+V  V   ++ +     +AQAR+ R++ F  A +L   + L+ A H DD  E   + L      A    +    E  G ++ RP +   + E++     H + +  DE+N    Y RN +R
  S:    14 QILVAFSGGLDSTVLLHQLVQWRTENPGVTLRAIHVHHGLSANADAWVKHCENICQQWQVPLVVERVQLAQEGL---GIEAQARQARYQAF--ARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGELVQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|68171364|ref|ZP_00544759.1| PP-loop [Ehrlichia chaffeensis str. Sapulpa] >gi|67999214|gb|EAM85869.1| PP-loop [Ehrlichia chaffeensis str. Sapulpa] (442 aa)
Score = 136, Expect = 1.7e-06, Identities = 46/174 (26%), Positives = 86/174 (49%)
  Q:     5 QYIAGVSGGPDSMLLLKLY----HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHT----VPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
            +   VSGG DSM LL L     +K    V+ VN+  R  A ++   V ++ + L +   +      +PE      N Q+ AR+IR++   +  +  ++  L++AH ++D  E   ++L+ R   +    G++    L G+ + RP +   + E+L    ++ + +  D +N    YKR   R 
  S:    26 NFAIAVSGGIDSMTLLHLSARYCNKNTPIVLTVNHGLRPEAAQEALFVFQHSQNLNLKCHILNWHGKLPES-----NIQSSARRIRYKLLLQWCNENRIKYLMVAHQKNDQAETIMIRLE-RGSGLDGLAGMQEYTYLNGICILRPLLSASRTELLQYANKNNITWINDTSNNNKKYKRTLYRN 203
>gi|59801231|ref|YP_207943.1| hypothetical protein NGO0820 [Neisseria gonorrhoeae FA 1090] >gi|75432494|sp|Q5F8F6.1|TILS_NEIG1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|59718126|gb|AAW89531.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] (426 aa)
Score = 136, Expect = 1.8e-06, Identities = 53/171 (30%), Positives = 81/171 (47%)
  Q:    10 VSGGPDSMLLLKLY---HKKIACV---VHVNYNKRTTALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +SGG DS++LL L     K+   V   +H+++     A         YC  L V L  V    E        +A AR+ R+ +F +       D L LAHHRDD IE   + +      R  A    ++  GE  G+ ++RP + + + +I     +H +P   DE+N    Y RN+ R  I
  S:    18 LSGGLDSVVLLHLLVCAGKRAGFVPEALHIHHGLSPRADDWADFCRNYCDMLGVGLETVKVCVEKN--GLGIEAAARQKRYAEFAEKG----FDVLALAHHRDDQIETFMLAVARGGGLRALAAMPAVRPLGE-NGI-IWRPLLPFSRQDIWDYARKHGLPNIEDESNTDTAYLRNRFRHRI 191
>gi|88657904|ref|YP_507881.1| tRNA(Ile)-lysidine synthetase [Ehrlichia chaffeensis str. Arkansas] >gi|88599361|gb|ABD44830.1| tRNA(Ile)-lysidine synthetase [Ehrlichia chaffeensis str. Arkansas] (434 aa)
Score = 136, Expect = 1.8e-06, Identities = 46/174 (26%), Positives = 86/174 (49%)
  Q:     5 QYIAGVSGGPDSMLLLKLY----HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHT----VPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
            +   VSGG DSM LL L     +K    V+ VN+  R  A ++   V ++ + L +   +      +PE      N Q+ AR+IR++   +  +  ++  L++AH ++D  E   ++L+ R   +    G++    L G+ + RP +   + E+L    ++ + +  D +N    YKR   R 
  S:    18 NFAIAVSGGIDSMTLLHLSARYCNKNTPIVLTVNHGLRPEAAQEALFVFQHSQNLNLKCHILNWHGKLPES-----NIQSSARRIRYKLLLQWCNENRIKYLMVAHQKNDQAETIMIRLE-RGSGLDGLAGMQEYTYLNGICILRPLLSASRTELLQYANKNNITWINDTSNNNKKYKRTLYRN 195
>gi|83592433|ref|YP_426185.1| PP-loop protein [Rhodospirillum rubrum ATCC 11170] >gi|83575347|gb|ABC21898.1| PP-loop protein [Rhodospirillum rubrum ATCC 11170] (462 aa)
Score = 136, Expect = 1.8e-06, Identities = 49/170 (28%), Positives = 75/170 (44%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHKKIA-----C-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIV--HTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIY 171
           P+     GVSGG DS+ LL    +  A     C  V  ++  R  +  + ++VE   + L    +V     P  +      Q  AR+ R +      +   V  LLLAHHRDD  E    +L     A   A    + +RGE    ++ RPF++  +  I A      + +  D +N  P Y
  S:    30 PEPAIAVGVSGGVDSLTLLAFAARWAAERGGRCTAVCFDHGLRAASAGEARLVETTARSLGAEAVVLRWAGPPPS---SGVQEAARRARLDGLLGWCAGAGVLHLLLAHHRDDQAETVLQRLGRGSGADGLAAMAALSSRGE---ARILRPFLEVPRAAIEASARRIGLVWAEDPSNHDPHY 205
>gi|34580975|ref|ZP_00142455.1| cell cycle protein MesJ [Rickettsia sibirica 246] >gi|28262360|gb|EAA25864.1| cell cycle protein MesJ [Rickettsia sibirica 246] (478 aa)
Score = 136, Expect = 1.8e-06, Identities = 44/173 (25%), Positives = 86/173 (49%)
  Q:     9 GVSGGPDSMLLLKLYH-----KKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
            VSGG DS+ LL L +       I   V+ V++N R  + ++   ++     L       +      +  N Q +AR+ R++          +  LL AHH DD++E   ++L+  + +  +G+ +    +   +++ RP     K+E++     H + +  DE+N+   Y+RN +RQ++A
  S:    25 AVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS-NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVRHNIKWFEDESNSSDKYRRNVIRQKLA 202
>gi|110640407|ref|YP_668135.1| tRNA(Ile)-lysidine synthetase [Escherichia coli 536] >gi|191172763|ref|ZP_03034300.1| tRNA(Ile)-lysidine synthase [Escherichia coli F11] >gi|110341999|gb|ABG68236.1| putative cell cycle protein MesJ [Escherichia coli 536] >gi|190906913|gb|EDV66515.1| tRNA(Ile)-lysidine synthase [Escherichia coli F11] (437 aa)
Score = 135, Expect = 1.9e-06, Identities = 49/173 (28%), Positives = 82/173 (47%)
  Q:     5 QYIAGVSGGPDSMLLL------KLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           Q +   SGG DS +LL      +  +  +    +HV++     A    K  E  C+Q +VPL+V  V   ++ +     +AQAR+ R++ F  A +L   + L+ A H DD  E   + L      A    +    E  G ++ RP +   + E++     H + +  DE+N    Y RN +R
  S:    14 QILVAFSGGLDSTVLLHQLVQWRTENPGVTLRAIHVHHGLSANADAWVKHCENICQQWQVPLVVERVQLAQEGL---GIEAQARQARYQAF--ARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGELVQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|189189368|ref|XP_001931023.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187972629|gb|EDU40128.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) [Pyrenophora tritici-repentis Pt-1C-BFP] (570 aa)
Score = 135, Expect = 1.9e-06, Identities = 40/113 (35%), Positives = 64/113 (56%)
  Q:    71 KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD---------ARKRAMY-------YGIKTRG---------------ELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNA-QPIYKRNQVRQEIANW 183
            K F+ +AR +R++   +A    K+  L++ HH DD  E   M+L          A +R  +       YG+   G               E  G++V RP + + K  ++A CEE KV +  D+TN  Q +  RN +R    N+
  S:    19 SKRFETEARTLRYQALGRACRDMKITSLMVGHHADDQAETVMMRLSNYRLRSGLQAMQRVEWIPECEGIYGVYHSGRGQKPDPDLDIPFLVEQGGIQVLRPLLGFEKARLIATCEEKKVGWAEDQTNQIQSLTSRNAIRHLYKNY 163
>gi|77407669|ref|ZP_00784424.1| MesJ/Ycf62 family protein [Streptococcus agalactiae COH1] >gi|77173668|gb|EAO76782.1| MesJ/Ycf62 family protein [Streptococcus agalactiae COH1] (424 aa)
Score = 135, Expect = 2.0e-06, Identities = 55/172 (31%), Positives = 85/172 (49%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQA-----QARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           +  VSGG DS+ LL+    Y K+++    + H+N+ +R    ++ +  EEY +Q      +H VP   V+   FQ      +AR  R+  F K         L+ AHH DD  E   M++    R  Y  GIK        ++ RPF+ Y K E+L       + +  D +NA   Y RN++R 
  S:    22 LIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQR----KESEKEEEYIRQWGQ---IHDVP---VFISYFQGIFSEDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPY-KKELLP-----NIFHFEDASNASSDYLRNRIRN 189
>gi|157827938|ref|YP_001494180.1| cell cycle protein MesJ [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932627|ref|YP_001649416.1| tRNA(Ile)-lysidine synthetase [Rickettsia rickettsii str. Iowa] >gi|166988066|sp|A8GQJ7.1|TILS_RICRS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|189035969|sp|B0BVY4.1|TILS_RICRO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157800419|gb|ABV75672.1| cell cycle protein MesJ [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907714|gb|ABY72010.1| tRNA(Ile)-lysidine synthetase [Rickettsia rickettsii str. Iowa] (478 aa)
Score = 135, Expect = 2.0e-06, Identities = 44/173 (25%), Positives = 85/173 (49%)
  Q:     9 GVSGGPDSMLLLKLYH-----KKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIA 181
            VSGG DS+ LL L +       I   V+ V++N R  + ++   ++     L       +      +  N Q +AR+ R++          +  LL AHH DD++E   ++L+  + +  +G+ +    +   + + RP     K+E++     H + +  DE+N+   Y+RN +RQ++A
  S:    25 AVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS-NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLE--RNSGIFGLSSSNINWYNNIHIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNVIRQKLA 202
>gi|32266754|ref|NP_860786.1| hypothetical protein HH1255 [Helicobacter hepaticus ATCC 51449] >gi|61216602|sp|Q7VGR5|TILS_HELHP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|32262806|gb|AAP77852.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] (423 aa)
Score = 135, Expect = 2.0e-06, Identities = 64/236 (27%), Positives = 100/236 (42%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKKIAC-----VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-----------ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLA---HPDVRELKRYPLPDQRQL 236
           + +T+ + G S G DS  L  L    + C     +  V+Y+ R  A  +    +E          V   P    +  NF++ AR  RF+ FQ     +    LLLAH  +D +E   MQL            A +R  Y        L    + RP     KNE+   C+E  + Y  D +N    ++RN  R E  +   +   EF  G+         +  S ++R +Q L    + D  EL+   +   RQ+
  S:    33 IKQTRNLLGFSSGVDSTALFFLL---LECEIPFDIAIVHYHTRLQADDEVAYAKELAATYNKLCFVAHAPH---FNANFESNARSFRFDFFQSLIIKHHYTHLLLAHQLNDRLEWLLMQLTKGAGLGNLLGFADERYNY-----DKSLNNYTIVRPLESIPKNELYRFCKERGIKYFEDSSNQDKTFRRNYFRYEFCD---KLVNEFSAGI--------ARSLSYLQRDRQSLENMLYADTLELESLKMQILRQI 265
>gi|58584411|ref|YP_197984.1| ATPase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418727|gb|AAW70742.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control, MesJ [Wolbachia endosymbiont strain TRS of Brugia malayi] (431 aa)
Score = 135, Expect = 2.1e-06, Identities = 51/180 (28%), Positives = 92/180 (51%)
  Q:     8 AGVSGGPDSMLLLKL---YHKKIAC----VVHVNYNKRTTALRDQKMVEEYCKQLKV--PLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKT---RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEE 187
             VSGG DS++LL L   + +K  C     + VN+  R  +  + + V  Y K+L V    I++   ++   K N Q+QARK R+E   +      V  L +AHH+DD  E   ++L+  + +   G+ +   +  L G+ + RP + + ++ I    + +++ +  D +N    YKR   R  +     +E
  S:    23 VAVSGGIDSIVLLHLITSWAEKRQCPPPIALAVNHGLRPESQEEVEFVVSYAKELGVKKSFILNWKRQNI--KGNVQSQARKARYELLTEWCKNNDVKHLFIAHHKDDQAETFLLRLE--RGSGLDGLSSMDYKSSLNGVCMLRPLLSFSRSRIKKYADFYRLKWVEDRSNQSLKYKRTLYRNLLKASGNQE 210
>gi|22536199|ref|NP_687050.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 2603V/R] >gi|25010088|ref|NP_734483.1| hypothetical protein gbs0013 [Streptococcus agalactiae NEM316] >gi|76797982|ref|ZP_00780241.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 18RS21] >gi|77414471|ref|ZP_00790621.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 515] >gi|61217360|sp|Q8E2H4|TILS_STRA5 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217362|sp|Q8E7Y2|TILS_STRA3 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|22533016|gb|AAM98922.1|AE014191_14 MesJ/Ycf62 family protein [Streptococcus agalactiae 2603V/R] >gi|23094439|emb|CAD45658.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586662|gb|EAO63161.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 18RS21] >gi|77159481|gb|EAO70642.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 515] (424 aa)
Score = 135, Expect = 2.1e-06, Identities = 55/172 (31%), Positives = 85/172 (49%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQA-----QARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           +  VSGG DS+ LL+    Y K+++    + H+N+ +R    ++ +  EEY +Q      +H VP   V+   FQ      +AR  R+  F K         L+ AHH DD  E   M++    R  Y  GIK        ++ RPF+ Y K E+L       + +  D +NA   Y RN++R 
  S:    22 LIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQR----KESEKEEEYIRQWGQ---IHDVP---VFISYFQGIFSEDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPY-KKELLP-----NIFHFEDASNASSDYLRNRIRN 189
>gi|77411309|ref|ZP_00787658.1| MesJ/Ycf62 family protein [Streptococcus agalactiae CJB111] >gi|77162645|gb|EAO73607.1| MesJ/Ycf62 family protein [Streptococcus agalactiae CJB111] (424 aa)
Score = 135, Expect = 2.1e-06, Identities = 55/172 (31%), Positives = 85/172 (49%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQA-----QARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           +  VSGG DS+ LL+    Y K+++    + H+N+ +R  + ++    EEY +Q      +H VP   V+   FQ      +AR  R+  F K         L+ AHH DD  E   M++    R  Y  GIK        ++ RPF+ Y K E+L       + +  D +NA   Y RN++R 
  S:    22 LIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQRKESEKE----EEYIRQWGQ---IHDVP---VFISYFQGIFSEDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPY-KKELLP-----NIFHFEDASNASSDYLRNRIRN 189
>gi|187605610|ref|ZP_02991801.1| tRNA(Ile)-lysidine synthetase [Exiguobacterium sp. AT1b] >gi|187482307|gb|EDU20320.1| tRNA(Ile)-lysidine synthetase [Exiguobacterium sp. AT1b] (408 aa)
Score = 135, Expect = 2.2e-06, Identities = 50/174 (28%), Positives = 80/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHKKI--ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQA-----RKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DS++LL    K+     V HV++  R  +  +   V       +V    H        + +FQ  A     RK R+  F+   + +  D L  AHH DD +E   +QL  R      GI  R       + RP +K  K +++    ++++ +  D TN +  Y RN++R EI
  S:     5 LVAVSGGVDSIVLLDRLVKQGWDVGVAHVHHGLREASDEEYTFVAHVAASYQVAF--HGT------RLHFQEGASQAHYRKARYHFFEDVMNEHGYDTLATAHHADDVLETVLIQLH-RNVIEVKGIPERRVFGRGTLIRPLLKETKAQLIEYARKNELAWREDATNQEVTYLRNRIRHEI 176
>gi|76788050|ref|YP_328740.1| tRNA(Ile)-lysidine synthetase [Streptococcus agalactiae A909] >gi|77405606|ref|ZP_00782695.1| MesJ/Ycf62 family protein [Streptococcus agalactiae H36B] >gi|76563107|gb|ABA45691.1| tRNA(Ile)-lysidine synthetase [Streptococcus agalactiae A909] >gi|77175750|gb|EAO78530.1| MesJ/Ycf62 family protein [Streptococcus agalactiae H36B] (424 aa)
Score = 135, Expect = 2.2e-06, Identities = 55/172 (31%), Positives = 85/172 (49%)
  Q:     7 IAGVSGGPDSMLLLKL---YHKKIAC---VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQA-----QARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYY-GIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           +  VSGG DS+ LL+    Y K+++    + H+N+ +R    ++ +  EEY +Q      +H VP   V+   FQ      +AR  R+  F K         L+ AHH DD  E   M++    R  Y  GIK        ++ RPF+ Y K E+L       + +  D +NA   Y RN++R 
  S:    22 LIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQR----KESEKEEEYIRQWGQ---IHDVP---VFISYFQGIFSEDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPY-KKELLP-----NIFHFEDASNASSDYLRNRIRN 189
>gi|182680532|ref|YP_001834678.1| tRNA(Ile)-lysidine synthetase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182636415|gb|ACB97189.1| tRNA(Ile)-lysidine synthetase [Beijerinckia indica subsp. indica ATCC 9039] (400 aa)
Score = 135, Expect = 2.4e-06, Identities = 50/157 (31%), Positives = 78/157 (49%)
  Q:    10 VSGGPDSMLLLKL--------YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVP--EDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKT---RGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETN 166
           VSGGPDS+ L+ L        +      V  V++  R  +L + + V E+  +L +P   H +   E    K   Q +AR  R+      A     D L+ AHH DD  E    +L   +  R +  G+++   RGEL      RP +   K E+LA+C+  + P+  D +N
  S:    89 VSGGPDSVALMLLAAQWAEAVWKAPPLSVASVDHGLRPDSLAEAEQVAEWAARLGLP---HHILRWEGEKPKTRLQERARDARYGLLIAHAETIGADYLVTAHHADDQAETILFRLLRGSGPRGLK-GMESLFQRGELL---HARPLLGMTKAELLAICDTCRHPFFTDPSN 253
>gi|87301619|ref|ZP_01084459.1| possible MesJ-like protein [Synechococcus sp. WH 5701] >gi|87283836|gb|EAQ75790.1| possible MesJ-like protein [Synechococcus sp. WH 5701] (365 aa)
Score = 134, Expect = 2.4e-06, Identities = 44/171 (25%), Positives = 81/171 (47%)
  Q:    10 VSGGPDSMLL------LKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQA-RKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYG-MKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +SGG DSM L      L+  H     + H N+  R  A      +  +   L +P+ V   P       + + +A R+ R+E+  + A      +++  H   D  E     L AR   +     ++ R  L G +++ RP + + + E  + C++ ++P  +D  N  P + RN++RQE+
  S:    35 ISGGQDSMALTALLLELRRLHGWELHLWHGNHGWRKEAADQAGELAAWAGGLGLPIRVENAPAAPASSASGREEAGRRWRYERLNQQALSLGCTRVVTGHTGSDRAETLLFNL-ARGCGLRGLSSLRARRPLSGRIELVRPLLGFSRAETASFCKQQQLPLWLDPGNTDPRFSRNRLRQEV 214
>gi|89053469|ref|YP_508920.1| tRNA(Ile)-lysidine synthetase-like [Jannaschia sp. CCS1] >gi|88863018|gb|ABD53895.1| tRNA(Ile)-lysidine synthetase-like protein [Jannaschia sp. CCS1] (422 aa)
Score = 134, Expect = 2.5e-06, Identities = 51/171 (29%), Positives = 83/171 (48%)
  Q:    10 VSGGPDSMLLLKLYHKKIAC------VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL--DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGG DSM +L L H           VV V++  R+ + ++ +MV + C  L  P   HT  +   W+     N Q  AR+ R       A   ++  +L AH RDD  E   M+L   +    +    +TR ++ G +V RP +   + ++    +  +VPY  D +N    + R ++R  I
  S:    29 VSGGGDSMAMLTLAHGWARVYGVGLHVVTVDHGLRSASRQEAEMVAKECAVLGHP---HTTLK---WQWDNQGNLQDAARRARLSLI--GAWRGQIAHVLFAHTRDDQAETMLMRLLRGSGVDGLSAMAETR-DMDGWQVIRPLLSETRADLRHYADVLRVPYVDDPSNEDETFDRVRLRGTI 202
>gi|114332355|ref|YP_748577.1| tRNA(Ile)-lysidine synthetase [Nitrosomonas eutropha C91] >gi|114309369|gb|ABI60612.1| tRNA(Ile)-lysidine synthetase [Nitrosomonas eutropha C91] (418 aa)
Score = 134, Expect = 2.7e-06, Identities = 36/151 (23%), Positives = 74/151 (49%)
  Q:    30 VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
            +HV +   T + +     +  C  + +PL +H +      +++ +A AR+ R++ F++     + D +LLA H+DD +E   +QL      +  +    ++       +K+ RP +   ++EI+   + H + +  DE+N    Y RN +R  I
  S:    20 AIHVEHGISTYSGQWSAFCQTLCDSVAIPLSIHRLKISKQPQESLEAVAREARYQIFRQ----IQADYVLLAQHQDDQVETLLLQLLRGAGVKGLSAMPTVRLFESGKAIKLLRPLLNVPRSEIMKYAKLHGLSWVTDESNLDVSYDRNFLRHRI 170
>gi|16128181|ref|NP_414730.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K-12 substr. MG1655] >gi|89107068|ref|AP_000848.1| tRNA(Ile)-lysidine synthetase [Escherichia coli W3110] >gi|170079824|ref|YP_001729144.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K12 substr. DH10B] >gi|1708989|sp|P52097.1|TILS_ECOLI tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|971394|emb|CAA90751.1| mesJ [Escherichia coli] >gi|1122208|dbj|BAA08428.1| YaeN [Escherichia coli W3110] >gi|1552765|gb|AAB08617.1| hypothetical [Escherichia coli] >gi|1786386|gb|AAC73299.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K-12 substr. MG1655] >gi|4902929|dbj|BAA77863.1| tRNA(Ile)-lysidine synthetase [Escherichia coli W3110] >gi|47230786|tpd|FAA00003.1| TPA: tRNA-Ile lysidine synthetase [Escherichia coli] >gi|169887659|gb|ACB01366.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K12 substr. DH10B] (432 aa)
Score = 134, Expect = 2.7e-06, Identities = 48/173 (27%), Positives = 83/173 (47%)
  Q:     5 QYIAGVSGGPDSMLLL------KLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           Q +   SGG DS +LL      +  +  +A   +HV++     A       E  C+Q +VPL+V  V   ++ +     +AQAR+ R++ F  A +L   + L+ A H DD  E   + L      A    +    E  G ++ RP +   + E++    ++ + +  DE+N    Y RN +R
  S:    14 QILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGL---GIEAQARQARYQAF--ARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSYDRNFLR 191
>gi|163783225|ref|ZP_02178219.1| cell cycle protein MesJ [Hydrogenivirga sp. 128-5-R1-1] >gi|159881559|gb|EDP75069.1| cell cycle protein MesJ [Hydrogenivirga sp. 128-5-R1-1] (317 aa)
Score = 134, Expect = 3.0e-06, Identities = 48/179 (26%), Positives = 85/179 (47%)
  Q:     2 PKTQYIAGVSGGPDSMLLLK--------LYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P +  +   SGG DS+ L+         L  KK++ + H N+  R  A  +++   E+ +  ++ + V       V ++   N +  AR++R+   +K  +    D +  AHH +D +E A + L   + A   G        G  V RP     + EIL+  E   + +  D +N  P + RN+VR E+
  S:    23 PGSSLLVAFSGGVDSVSLVDALLELRDFLNLKKLS-LAHFNHRLRKEADEEEEFCREFARSRELDIFVGAEDVGEVARREGRNLEEVARELRYAFLRKVKNERGYDLIATAHHLNDLVETALIWLS--RGAGLEGFLAFEPREG-DVVRPLYGVKREEILSYAEARGLRWVEDTSNTDPRFFRNRVRMEV 208
>gi|148244290|ref|YP_001218984.1| cell cycle protein MesJ [Candidatus Vesicomyosocius okutanii HA] >gi|146326117|dbj|BAF61260.1| cell cycle protein MesJ [Candidatus Vesicomyosocius okutanii HA] (390 aa)
Score = 134, Expect = 3.1e-06, Identities = 48/174 (27%), Positives = 85/174 (48%)
  Q:     7 IAGVSGGPDSMLLLKL----YHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLL-AHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKV-YRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           + G+SGG DS++LL      Y  KI  V+H N++      +  K  +  C  L +  +   +  D     N +  ARK R+      ++L K +++L  AHH++D  E   +QL     +       + +  G  + YRPF+   K+++      HK+ +  D++N    ++RN +R EI
  S:    17 VLGLSGGIDSIVLLHYLNTHYPNKIR-VIHCNHHLSQFCNKWDKFCKTTCLNLNIVYLSINLSFDNT--SNIEENARKKRYHSL---SNLLKENEVLCTAHHKNDQAETLLLQLFRGSGSAGLAAMPKEKPLGKGIHYRPFLTINKSQVSDYANNHKLNWIEDDSNKNTYFRRNFLRLEI 190
>gi|110639392|ref|YP_679602.1| tRNA(Ile)-lysidine synthetase [Cytophaga hutchinsonii ATCC 33406] >gi|110282073|gb|ABG60259.1| tRNA(Ile)-lysidine synthetase [Cytophaga hutchinsonii ATCC 33406] (450 aa)
Score = 134, Expect = 3.1e-06, Identities = 45/171 (26%), Positives = 82/171 (47%)
  Q:    10 VSGGPDSMLLLKLYHKKIAC--VVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKN---FQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           VSGG DS++L  L+ K      V H N++ R + +  D++ V +   +  + + V           N    Q  AR++R+  F++ A  Y    +  AH  +D IE   + L      A  +GI  +      ++ RP +   +++I +  EE+ + +  D +N +  Y RN +R +I
  S:    25 VSGGIDSIVLFDLFVKAGFSFGVAHCNFSLRGSESDGDEQFVSDLAIKQGISIHVKRFDTSAFASNNALSIQMAARELRYTWFKELARQYGYAAIATAHQLNDIIETTLINLSRGTGIAGLHGIPEKNG----EIIRPLLFAGRDKIRSYAEENNLKWREDSSNMEEKYARNLIRHKI 198
>gi|76664790|emb|CAJ17834.1| MesJ protein [Candidatus Phytoplasma solani] (75 aa)
Score = 133, Expect = 3.2e-06, Identities = 29/57 (50%), Positives = 40/57 (70%)
  Q:     2 PKTQYIAGVSGGPDSMLLLK-LYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVP 58
           PK  YI  VSGG DSM LL  L+ +K+   VVH N+ KR  + +D+++V+ YC QLK+P
  S:     9 PKLTYIISVSGGVDSMALLDFLWSQKLDLKVVHFNHLKRLDSFKDKELVKNYCLQLKIP 67
>gi|194476912|ref|YP_002049091.1| possible MesJ-like protein [Paulinella chromatophora] >gi|171191919|gb|ACB42881.1| possible MesJ-like protein [Paulinella chromatophora] (343 aa)
Score = 133, Expect = 3.4e-06, Identities = 45/180 (25%), Positives = 90/180 (50%)
  Q:     1 MPK-TQYIAGVSGGPDSMLLLKLYH--KKI----ACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +PK +  +  +SGG DSM L+KL +  K+I      + H N+  R  + +    +  +  Q  +P    +         N +A+AR+ R+E  ++ A      K++ AH   D  E   + L+  + +  +GI +   +        + + RP + + + +  A+C++ K+P   D +N    + RN++R +I
  S:    34 LPKRSTLLVAISGGQDSMALIKLLNDLKRIYKWNLHLWHGNHRWRLESDKITCELSRWASQELLPFYTDSAQPP----PNSEAKARQWRYESLKQLAEKLNCHKIVTAHTGSDRAE--TLLLNIARGSNRHGIASLPHIRYLVNSNNLSLVRPLLNFSRLDTAAICQKWKLPIWYDPSNESLYFSRNRIRHQI 220
>gi|56552554|ref|YP_163393.1| ATPase [Zymomonas mobilis subsp. mobilis ZM4] >gi|61217187|sp|Q5NLX8|TILS_ZYMMO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56544128|gb|AAV90282.1| ATPase [Zymomonas mobilis subsp. mobilis ZM4] (329 aa)
Score = 133, Expect = 3.7e-06, Identities = 48/169 (28%), Positives = 77/169 (45%)
  Q:    10 VSGGPDSMLLLKLYHKKIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTR------GELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
           VSGG DS+ LL L       V  V V++  R  A  + + V + C+Q+ VP  + T   +    +  QA AR  R+    + A    V  L+ AHH DD  E   M+  AR   +      R       E   +++ RP + + ++ +  + E+    +  D +N  P Y R   R+
  S:    36 VSGGSDSLALLLLGAVSDFPVEAVTVDHGMRPEAAEEARFVAQICQQIGVPHQILTTKIEAN-GEGMQAAARIRRYALMAEWAKEKNVGALMTAHHADDQAETFLMR-AARGSGLNGLAAIRPDVVITAEGQKLRLLRPLLGFTRSALAEIVEKAGFTFVSDPSNDNPHYDRTHFRR 210
>gi|83857097|ref|ZP_00950625.1| putative cell-cycle protein [Croceibacter atlanticus HTCC2559] >gi|83848464|gb|EAP86333.1| putative cell-cycle protein [Croceibacter atlanticus HTCC2559] (436 aa)
Score = 133, Expect = 3.7e-06, Identities = 50/180 (27%), Positives = 85/180 (47%)
  Q:     1 MPKTQYIAGVSGGPDSMLLLKLYHKK--IACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPLIVHTVPEDTVW---KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGE----LYGM-----KVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +   + +  VSGG DSM+LL L         + H N+N R   +  D  +V+E   +L++   V     ++     K + Q  AR++R++ F +    +  + +L AHH +D +E   + L            TRG     L G+      + RP + + + EI       K+ +  D +NA   Y RN +R  I
  S:    16 LNSNKLLLAVSGGLDSMVLLHLCKASGLNIAIAHCNFNLRGKESDADTLLVKEEADRLQITCHVEHFNTESYAADIKVSIQIAARELRYQWFDEVIKEFDYNYVLTAHHLNDDVETFIINL------------TRGTGLDGLSGIPKVNNTIIRPLLPFSREEIHTYALAEKIIWREDASNASDKYLRNSIRHHI 198
>gi|171463663|ref|YP_001797776.1| tRNA(Ile)-lysidine synthetase [Polynucleobacter necessarius STIR1] >gi|171193201|gb|ACB44162.1| tRNA(Ile)-lysidine synthetase [Polynucleobacter necessarius STIR1] (438 aa)
Score = 133, Expect = 4.0e-06, Identities = 52/214 (24%), Positives = 109/214 (50%)
  Q:     2 PKTQYIAGVSGGPDSMLLL----KLYHKKIA------CVVHVNYNKRTTALRDQKMVEEYCKQLKVPL---IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGEL----YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQ 215
           P  +     SGG DS++LL    K + K ++         H+++  +  A       E+  K+ K+     ++H   +++    N +++AR  R+E        Y ++ LLLAHH++D  E   +QL      A   G+    ++    + + ++RP +   + E+ A  +EHK+ +  D +N    Y+RN +R+++    ++ + E  + +    +++G+    L + A+Q
  S:    13 PGKRIAVAFSGGLDSVVLLDTVCKAHAKNLSQSQNQIFAFHIHHGLQRLADDWLIFCEKLAKKYKIHFDFRLLHL--DNSQGLGNVESRARAGRYEALSDLCEEYGIEDLLLAHHQNDQAETVLLQLLRGSGVAGLAGMPINRDMQRHNHRITLWRPLLNQSRQELEAYAKEHKLKWIEDPSNQDTKYRRNALRKKVIPVLEKIQPEALVNIARSAQLLGEAQSLLNRLAQQ 242
>gi|53712709|ref|YP_098701.1| putative cell-cycle protein [Bacteroides fragilis YCH46] >gi|61216469|sp|Q64WF9|TILS_BACFR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|52215574|dbj|BAD48167.1| putative cell-cycle protein [Bacteroides fragilis YCH46] (435 aa)
Score = 133, Expect = 4.0e-06, Identities = 53/180 (29%), Positives = 83/180 (46%)
  Q:     7 IAGVSGGPDSMLLLKLY-HKKIAC-VVHVNYNKRT-TALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKK--NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +SGG DS+ LL+L       C   H N++ R   + RD+  V   C +  V L I H        KK  + +  AR++R+E F+      +   +  AHH+DD +E   + L  R   +    GI+ R       + RP +   + EI+A  +     Y  D TN    Y RN++R  +    KE
  S:    23 LVTLSGGADSVALLRLLLSMGYTCEAAHCNFHLRDKESDRDEAFVRRLCHESGVLLHIEHFDTTQYATKKHISIEMAARELRYEWFETLRKQREASVIATAHHKDDSVETVLLNL-IRGTGINGLLGIRPR----NGNIVRPLLCLSREEIIAYLQYIDQDYVTDSTNLLDEYTRNKIRLNLLPLMKE 205
>gi|91792927|ref|YP_562578.1| tRNA(Ile)-lysidine synthetase-like protein [Shewanella denitrificans OS217] >gi|91714929|gb|ABE54855.1| tRNA(Ile)-lysidine synthetase-like protein [Shewanella denitrificans OS217] (476 aa)
Score = 132, Expect = 4.2e-06, Identities = 52/179 (29%), Positives = 87/179 (48%)
  Q:     2 PKTQYIAGVSGGPDS------MLLLKLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQ----LKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVY---RPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           P  + +   SGG DS      + L   +H +I C ++HV++     A        E+C++      +PLIV  V      +++ +A+AR  R+     A  L++ D LL AHH DD +E   + L  ++     G+   GE      Y   RP +   + +I AL     + +  D++N    + RN +R EI
  S:    25 PAAKLVLAYSGGVDSEVLAAGLSLFSQFHPEIDCRLLHVHHGLSAHA----DSWTEHCRKRAAFYGLPLIVEKVSVQKGKRESLEAKARAARYHAI--AQHLHQNDILLTAHHEDDQLETLLLAL--KRGQGPKGLAAMGECQRKDHYWLLRPLLSVSRQQIEALAASEALVHIEDDSNQDDSFDRNFLRLEI 209
>gi|60680868|ref|YP_211012.1| putative ATP-binding PP-loop protein [Bacteroides fragilis NCTC 9343] >gi|60492302|emb|CAH07067.1| putative ATP-binding PP-loop protein [Bacteroides fragilis NCTC 9343] (435 aa)
Score = 132, Expect = 4.3e-06, Identities = 53/180 (29%), Positives = 83/180 (46%)
  Q:     7 IAGVSGGPDSMLLLKLY-HKKIAC-VVHVNYNKRT-TALRDQKMVEEYCKQLKVPL-IVHTVPEDTVWKK--NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKE 186
           +  +SGG DS+ LL+L       C   H N++ R   + RD+  V   C +  V L I H        KK  + +  AR++R+E F+      +   +  AHH+DD +E   + L  R   +    GI+ R       + RP +   + EI+A  +     Y  D TN    Y RN++R  +    KE
  S:    23 LVTLSGGADSVALLRLLLSMGYTCEAAHCNFHLRDKESDRDEAFVRRLCHESGVLLHIEHFDTTQYAAKKHISIEMAARELRYEWFETLRRQREASVIATAHHKDDSVETVLLNL-IRGTGINGLLGIRPRNG----NIVRPLLCLSREEIIAYLQYIDQDYVTDSTNLLDEYTRNKIRLNLLPLMKE 205
>gi|188996043|ref|YP_001930294.1| tRNA(Ile)-lysidine synthetase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931110|gb|ACD65740.1| tRNA(Ile)-lysidine synthetase [Sulfurihydrogenibium sp. YO3AOP1] (457 aa)
Score = 132, Expect = 4.5e-06, Identities = 47/174 (27%), Positives = 84/174 (48%)
  Q:     7 IAGVSGGPDSMLLLKLYHK-----KIACV--VHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQ-LDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +   SGGPDS++L  L  K      IA +   H+N+  R  + +DQ+  E++   L + + V       V ++   + +   R  R++ F +      ++K+   HH  D  E   +  +   KR +  G + +       + RP     K EI   C+++ + Y ID++N    Y RNQVR ++
  S:    25 LIAFSGGPDSLVLTNLLLKFQKTLNIAKIQLAHLNHTLRKESDQDQEFCEKFASSLGLKIHVKKADVKKVAREQKISVEEAGRLERYKFFNEILQKENLNKIATGHHLSDLTESIVLWFIQGNKRGLK-GFRPKEN----NIIRPLYLITKEEIEEYCQKNGLEYLIDQSNFSRKYLRNQVRLDV 204
>gi|15639364|ref|NP_218813.1| hypothetical protein TP0373 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025606|ref|YP_001933378.1| hypothetical protein TPASS_0373 [Treponema pallidum subsp. pallidum SS14] >gi|6136519|sp|O83388|TILS_TREPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3322651|gb|AAC65358.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018181|gb|ACD70799.1| hypothetical protein TPASS_0373 [Treponema pallidum subsp. pallidum SS14] (477 aa)
Score = 132, Expect = 4.7e-06, Identities = 51/174 (29%), Positives = 80/174 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYHK------KIACVVHVNYNKRT-TALRDQKMVEEYCKQLKVPL----------IVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIK-TRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +  VSGG DS+ LL   H+        AC V V+++ R      D + V   C +   PL           VH   +  +  +  Q  AR +R++ F   A+      +L AH RDD  E   M+L      +   GI+  RG     +  RP +K  +  +    +   V +  D +N    Y RN++R E+
  S:    32 LVAVSGGADSLALLYAAHELAPDFGVCACAVTVDHSLRAQEGALDARFVRALCARFSPPLPCFVQQISAGAVHACAK--IRGRGVQDAARALRYKVFDHVAARCGAQVVLTAHTRDDQYETLLMRLFQGAAASALQGIRAARG-----RYVRPLLKVSRTCVEDFLQTRGVRWREDASNTCRKYVRNRIRHEL 217
>gi|118588322|ref|ZP_01545731.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Stappia aggregata IAM 12614] >gi|118439028|gb|EAV45660.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Stappia aggregata IAM 12614] (461 aa)
Score = 132, Expect = 4.8e-06, Identities = 47/168 (27%), Positives = 81/168 (48%)
  Q:    10 VSGGPDSMLLLKLYH--------KKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELY--------GMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           VSGG DS+ LL L+         +  A V+ V++  R  + ++ + V    +   +   V     D     N Q +AR  R+          + + L+L HH DD   QA+  LD   R    G+     +         G+++ RP +   K++++A  E+   P+  D +N  P YKR+++R
  S:    40 VSGGSDSLCLLVLFDEWRKRTGWQGAAEVLCVDHQLRPESGQEAEFVAMNARACGLDCTVLRWSGDKP-SANVQEEARLARYRLMAGRMRDTEAEALVLGHHLDD---QAETFLDRLTRG--SGVSGLSGMAADEGCGPEGLRLLRPLLSVSKSDLIAALEQRGRPWCTDPSNRNPKYKRSRLR 217
>gi|138893739|ref|YP_001124192.1| cell cycle protein MesJ [Geobacillus thermodenitrificans NG80-2] >gi|134265252|gb|ABO65447.1| Cell cycle protein MesJ [Geobacillus thermodenitrificans NG80-2] (464 aa)
Score = 132, Expect = 4.9e-06, Identities = 51/186 (27%), Positives = 84/186 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTTALRDQ-KMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           I GVSGGPDS+ LL L        K      HV++  R     ++ + V+ +C + ++      +      ++     Q  AR  R+  F +    Y+   + L HH DD +E   M+L        Y GI  +   +G  + RPF+   + EI   C++  +    D +N +  Y RN+ R  I    K+E    +
  S:    22 IVGVSGGPDSLALLHLLSSLRDEWKLQLVAAHVDHMFRGRESEEEMEFVKHFCAEHRILCEAVQIDVPAFQRRTGLGAQEAARNCRYHFFAELVKKYQAQYVALGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGSYLIRPFLAVSRAEIEDYCKKEGLTPRRDPSNEKDDYTRNRFRHHIVPLLKQENPRLH 218
>gi|196250781|ref|ZP_03149468.1| tRNA(Ile)-lysidine synthetase [Geobacillus sp. G11MC16] >gi|196209731|gb|EDY04503.1| tRNA(Ile)-lysidine synthetase [Geobacillus sp. G11MC16] (464 aa)
Score = 132, Expect = 5.2e-06, Identities = 51/186 (27%), Positives = 84/186 (45%)
  Q:     7 IAGVSGGPDSMLLLKLYH------KKIACVVHVNYNKRTTALRDQ-KMVEEYCKQLKVPLIVHTVPEDTVWKK---NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL-DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFY 192
           I GVSGGPDS+ LL L        K      HV++  R     ++ + V+ +C + ++      +      ++     Q  AR  R+  F +    Y+   + L HH DD +E   M+L        Y GI  +   +G  + RPF+   + EI   C++  +    D +N +  Y RN+ R  I    K+E    +
  S:    22 IVGVSGGPDSLALLHLLSSLRDEWKLQLVAAHVDHMFRGRESEEEMEFVKHFCAEHRILCEAVQIDVPAFQRRTGLGAQEAARNCRYHFFAELVKKYQAQYVALGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGSYLIRPFLAVSRAEIEDYCKKEGLTPRRDPSNEKDDYTRNRFRHHIVPLLKQENPRLH 218
>gi|58617611|ref|YP_196810.1| hypothetical protein ERGA_CDS_08840 [Ehrlichia ruminantium str. Gardel] >gi|58417223|emb|CAI28336.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel] (442 aa)
Score = 131, Expect = 5.4e-06, Identities = 48/174 (27%), Positives = 86/174 (49%)
  Q:     5 QYIAGVSGGPDSMLLLKLY----HKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVW-----KKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAM--YYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQ 178
            Y   VSGG DSM+LL L      K    ++ VN+  R+ A ++   V ++ + L   L  H +     W     + N Q+ AR+IR+    +  +  +V+ L++AH ++D  E   M+L+ R   +    G++    L G+ + RP +   + E++   +   + +  D +N    YKR   R 
  S:    25 NYAIAVSGGIDSMVLLHLSAICNTKFTPTILTVNHGLRSEAAQEALFVYQHSQNLN--LKCHILN----WHGEKPQSNIQSSARQIRYSLLLQWCNQNQVNYLMVAHQKNDQAETIMMRLE-RGSGLDGLAGMQECTYLNGICILRPLLAISREELIHYADTKNITWVHDISNDNKKYKRTLYRN 202
>gi|26246135|ref|NP_752174.1| tRNA(Ile)-lysidine synthetase [Escherichia coli CFT073] >gi|61216659|sp|Q8FL00|TILS_ECOL6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|26106532|gb|AAN78718.1|AE016755_218 Putative cell cycle protein mesJ [Escherichia coli CFT073] (437 aa)
Score = 131, Expect = 5.4e-06, Identities = 49/173 (28%), Positives = 81/173 (46%)
  Q:     5 QYIAGVSGGPDSMLLL------KLYHKKIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTV--PEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLD-ARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVR 177
           Q +   SGG DS +LL      +  +  +    +HV++     A    K  E  C+Q +VPL+V  V   ++ +     +AQAR+ R++ F  A +L   + L+ A H DD  E   + L      A    +    E  G ++ RP +   + E+      H + +  DE+N    Y RN +R
  S:    14 QILVAFSGGLDSTVLLHQLVQWRTENPGVTLRAIHVHHGLSANADAWVKHCENICQQWQVPLVVERVQLAQEGL---GIEAQARQARYQAF--ARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|170717655|ref|YP_001784732.1| tRNA(Ile)-lysidine synthetase [Haemophilus somnus 2336] >gi|168825784|gb|ACA31155.1| tRNA(Ile)-lysidine synthetase [Haemophilus somnus 2336] (427 aa)
Score = 131, Expect = 5.6e-06, Identities = 45/177 (25%), Positives = 86/177 (48%)
  Q:     4 TQYIAGVSGGPDSMLLLKLYHK------KIAC-VVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYG-IKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           T+ + G SGG DS +LL L  K       ++   +H+++     A        + C+QL +  +   V  +   +K  +A AR+ R++    A  L   + L+ AHH+ D  E   + L         G ++ +  ++ + ++RP +   K ++    +  K+ +  DE+NA   Y+RN +R +I
  S:    18 TKLLLGFSGGLDSTVLLSLLAKLRKKQPHLSLRAIHIHHGLSQNADNWAIHCRQICQQLDISFLCEKVTINP--RKGIEADAREARYQAI--ANHLQDNEILVTAHHQQDQTETFLLALKRGSGLQGLGAMQIQSVVFNLPIFRPLLHCTKQQLEQYAKTEKLSWIEDESNADNRYERNFLRNDI 198
>gi|157165572|ref|YP_001467030.1| ATP/GTP hydrolase [Campylobacter concisus 13826] >gi|112800063|gb|EAT97407.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter concisus 13826] (330 aa)
Score = 131, Expect = 6.0e-06, Identities = 57/185 (30%), Positives = 90/185 (48%)
  Q:    11 SGGPDSMLL---LKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMK---------VYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGV 195
           S G DS  L   LK    K   V+ V++N R  +  + +  +E   +    + V +V    +   NF+  AR+ R+E F +    +  + L+LAH  DD  E   MQL         G+K   EL+GM          + RP +   K E+    +E  + Y +DETN +   KR+ VR    N+S+   +E++ GV
  S:    20 SHGIDSTALFYILKETGVKFDLVI-VDHNVREQSKFEVESAKELASKFGKKIYVKSV---NLAGSNFEKNAREARYEFFSEICQKFGYENLILAHQFDDKFEWFLMQLGKGA-----GLK---ELFGMSELEKREHFWLVRPLLNLRKKELQNYLDERGLRYFVDETNLEGKLKRSFVR---LNFSEPFLDEYFSGV 201
>gi|94967093|ref|YP_589141.1| tRNA(Ile)-lysidine synthetase-like [Acidobacteria bacterium Ellin345] >gi|94549143|gb|ABF39067.1| tRNA(Ile)-lysidine synthetase-like [Acidobacteria bacterium Ellin345] (464 aa)
Score = 131, Expect = 6.2e-06, Identities = 70/266 (26%), Positives = 121/266 (45%)
  Q:     2 PKTQYIAGVSGGPDSMLLLKLYHK-----KIA-CVVHVNYNKRTT-ALRDQKMVEEYCKQLKVPLIVH--TVPEDTVWKK-NFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQL----DARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQV----------------RQEIANWSK-EEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKH 267
           P  +    VSGG DS+ LL+   +      IA  VVH+++  R   A  D++ V +   Q  + L +    VP  +  +K + +  AR +R+  F++       DK+  AH  DD  E   +++      R  A     +         + RP +   + E+    +    P+  D TN  P + RN++                RQ +AN ++    EE Y G       I ++ F  +     + A  D   L   P   +R+++ +      + V+ D +D  LDFI+  Q+ H
  S:    17 PGDRVGVAVSGGADSVALLRGLLELRSELGIALSVVHLHHGIRGAEADADEQFVADLAGQFDLSLHLERVDVPSHSSQEKLSLETAARDLRYAFFRRLLESSACDKVATAHTLDDQAETVLLRILRGTGTRGLAAIPPFRDASPELAACIVRPLLGTERTEVETYLKSLNQPWREDSTNTDPKHLRNRIRHELLPMLEAEYNPALRQSLANLAEIARAEEEYWG------PIVERHFDQIVTMTNFGAVLDRSRLSELPQAFRRRVLLALHDRLDMPVSFDGVDFELDFIEGNQKGH 307
>gi|77360937|ref|YP_340512.1| lysidine forming enzyme [Pseudoalteromonas haloplanktis TAC125] >gi|76875848|emb|CAI87069.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Pseudoalteromonas haloplanktis TAC125] (467 aa)
Score = 131, Expect = 6.8e-06, Identities = 44/175 (25%), Positives = 86/175 (49%)
  Q:     6 YIAGVSGGPDSMLLLKLYHKK-------IACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGEL-------YGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEI 180
           +   +SGG DS++LL L H             +++++     A   Q   +  C +L VP     V  +   + + +AQAR  R++   + +    +  +LL  H +D IE   ++L   KR    G+K  G +        G   +RP +   +++I A   ++ + +  D++N    ++RN +RQ++
  S:    57 FTVALSGGVDSVVLLHLMHALRVQDPALQVSAIYIHHGLSQYADDWQVFCQTLCNELNVPFQTAKVNIEQQSRTSLEAQARDARYQALDELSPHGSI--ILLGQHLNDQIETFLLRL---KRG--SGLKGLGAMQRERTLTSGRLCFRPLLAVKRSDIEAFAAQYALNHVTDDSNTDERFERNFMRQQV 238