>gi|13507966|ref|NP_109915.1| elongation factor G [Mycoplasma pneumoniae M129] >gi|2494252|sp|P75544|EFG_MYCPN Elongation factor G (EF-G) >gi|1674306|gb|AAB96252.1| elongation factor G [Mycoplasma pneumoniae M129] (688 aa)
Score = 3659, Expect = 0.0e+00, Identities = 688/688 (100%), Positives = 688/688 (100%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK
  S:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
>gi|12044941|ref|NP_072751.1| elongation factor G [Mycoplasma genitalium G37] >gi|1352348|sp|P47335|EFG_MYCGE Elongation factor G (EF-G) >gi|3844676|gb|AAC71307.1| translation elongation factor G [Mycoplasma genitalium G37] >gi|166078644|gb|ABY79262.1| translation elongation factor G [synthetic Mycoplasma genitalium JCVI-1.0] (688 aa)
Score = 3339, Expect = 0.0e+00, Identities = 623/688 (90%), Positives = 651/688 (94%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M+RTVDL NFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPR+IFVNKMDKTGANFERSV SIQQRLGVKAVPIQ PIGAENDFNGIID+I +K YFFDG KEE A EKPIP+Q+ DQV+++  +LVEEVA+ DDQLMADYL+GK I I  IK  IR GVI C+FFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVP AKA   +  E+ I ASDDA F+GLAFKVATDPFVGRLTF+RVY+GVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEI+EIRAGDICA+IGLKDTTTGETL DDK+DVQLEAMQFA+PVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTF+DPETGQTIIAGMGELHLDILVDRM+REFKVEVN+GAPQVSFRETF   SEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQ GLENAM SGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGK C+PVLLEPIMAIEVTVPEQYFGDTMGDISSRRG+IEGTEQRDNVQ+IKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA KK
  S:     1 MSRTVDLKNFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRVIFVNKMDKTGANFERSVLSIQQRLGVKAVPIQFPIGAENDFNGIIDIITKKAYFFDGNKEENAIEKPIPEQYVDQVEKLYNNLVEEVASLDDQLMADYLDGKPIEIDAIKNAIRNGVIHCKFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPPAKAIDANNKEISIKASDDANFIGLAFKVATDPFVGRLTFIRVYAGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIDEIRAGDICAVIGLKDTTTGETLTDDKLDVQLEAMQFAEPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAGMGELHLDILVDRMKREFKVEVNIGAPQVSFRETFKSTSEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQTGLENAMNSGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKQCNPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGIIEGTEQRDNVQLIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIANKK 688
>gi|31544736|ref|NP_853314.1| elongation factor G [Mycoplasma gallisepticum R] >gi|31541582|gb|AAP56882.1| FusA [Mycoplasma gallisepticum R] (695 aa)
Score = 2959, Expect = 0.0e+00, Identities = 544/687 (79%), Positives = 608/687 (88%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTTSERILFHSG+ HKIGETHDG SVMDWM QEKERGITITSAATSV+WK+C LNLIDTPGHVDFTVEVERSLRVLDGA+AVLDAQMGVEPQTETVWRQASRYEVPRI+FVNKMDKTGANF+RSV SI  RLGVK+VPIQLPIGAENDF GIIDL+E K YFFDGG+ E  E K IP ++ ++ K+   H+++E+  FD+ +M  YL+G+EIS A+IK CIRKGV+    FPVLCG+AFKNKG+K LLDAVVD+LPSP+DVP AK Y + G EV I  SDDAPFVGLAFKVATDPFVGRLTFVRVYSG+L SGSYV N  K+KKERVSR+VKMHAQ R+EI EIRAGDICAI+GLKDTTTG+T+  +  ++ LE+M FAQPVISLAVEPKTKADQEKM I+LSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDILVDR+RREFKV+VNVGAPQVS+RET   +++VEGKYIKQSGGRGQYGHV I FEPN DKGFEF DKIVGG+IP+EYIK V+AGLE AM +GPLAGYPMIDIKA+LFDGS+H+VDS+EMA+KIAAS+ALKEAGK C P LLEPIMAIEVTVPEQYFGDTMGDISSRRG+IEGTE RDNVQVIKAKVPL EMFGYATDLRSF+QGRGNY+MQFSHYAE PKSVV ++I  K
  S:     3 MARQYPLEKFRNFGIMAHIDAGKTTTSERILFHSGKTHKIGETHDGASVMDWMAQEKERGITITSAATSVTWKDCQLNLIDTPGHVDFTVEVERSLRVLDGAVAVLDAQMGVEPQTETVWRQASRYEVPRIVFVNKMDKTGANFQRSVDSIHSRLGVKSVPIQLPIGAENDFVGIIDLVEMKAYFFDGGENENYETKEIPAEYLEEAKKAHNHMLDEIVTFDEAVMEKYLDGQEISKAEIKSCIRKGVVSSTLFPVLCGTAFKNKGVKPLLDAVVDYLPSPIDVPPAKGY-KVGEEVQIPTSDDAPFVGLAFKVATDPFVGRLTFVRVYSGILTSGSYVINTTKDKKERVSRIVKMHAQQRDEINEIRAGDICAIVGLKDTTTGDTIASENQNLTLESMTFAQPVISLAVEPKTKADQEKMGISLSKLAEEDPTFRTYTDEETGQTIIAGMGELHLDILVDRLRREFKVDVNVGAPQVSYRETLKAKADVEGKYIKQSGGRGQYGHVVITFEPNHDKGFEFEDKIVGGKIPKEYIKSVKAGLEAAMNNGPLAGYPMIDIKASLFDGSYHDVDSNEMAYKIAASMALKEAGKRCKPALLEPIMAIEVTVPEQYFGDTMGDISSRRGMIEGTESRDNVQVIKAKVPLSEMFGYATDLRSFTQGRGNYIMQFSHYAEAPKSVVEKVIEDK 688
>gi|46576252|sp|Q7NAV3|EFG_MYCGA Elongation factor G (EF-G) (693 aa)
Score = 2959, Expect = 0.0e+00, Identities = 544/687 (79%), Positives = 608/687 (88%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTTSERILFHSG+ HKIGETHDG SVMDWM QEKERGITITSAATSV+WK+C LNLIDTPGHVDFTVEVERSLRVLDGA+AVLDAQMGVEPQTETVWRQASRYEVPRI+FVNKMDKTGANF+RSV SI  RLGVK+VPIQLPIGAENDF GIIDL+E K YFFDGG+ E  E K IP ++ ++ K+   H+++E+  FD+ +M  YL+G+EIS A+IK CIRKGV+    FPVLCG+AFKNKG+K LLDAVVD+LPSP+DVP AK Y + G EV I  SDDAPFVGLAFKVATDPFVGRLTFVRVYSG+L SGSYV N  K+KKERVSR+VKMHAQ R+EI EIRAGDICAI+GLKDTTTG+T+  +  ++ LE+M FAQPVISLAVEPKTKADQEKM I+LSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDILVDR+RREFKV+VNVGAPQVS+RET   +++VEGKYIKQSGGRGQYGHV I FEPN DKGFEF DKIVGG+IP+EYIK V+AGLE AM +GPLAGYPMIDIKA+LFDGS+H+VDS+EMA+KIAAS+ALKEAGK C P LLEPIMAIEVTVPEQYFGDTMGDISSRRG+IEGTE RDNVQVIKAKVPL EMFGYATDLRSF+QGRGNY+MQFSHYAE PKSVV ++I  K
  S:     1 MARQYPLEKFRNFGIMAHIDAGKTTTSERILFHSGKTHKIGETHDGASVMDWMAQEKERGITITSAATSVTWKDCQLNLIDTPGHVDFTVEVERSLRVLDGAVAVLDAQMGVEPQTETVWRQASRYEVPRIVFVNKMDKTGANFQRSVDSIHSRLGVKSVPIQLPIGAENDFVGIIDLVEMKAYFFDGGENENYETKEIPAEYLEEAKKAHNHMLDEIVTFDEAVMEKYLDGQEISKAEIKSCIRKGVVSSTLFPVLCGTAFKNKGVKPLLDAVVDYLPSPIDVPPAKGY-KVGEEVQIPTSDDAPFVGLAFKVATDPFVGRLTFVRVYSGILTSGSYVINTTKDKKERVSRIVKMHAQQRDEINEIRAGDICAIVGLKDTTTGDTIASENQNLTLESMTFAQPVISLAVEPKTKADQEKMGISLSKLAEEDPTFRTYTDEETGQTIIAGMGELHLDILVDRLRREFKVDVNVGAPQVSYRETLKAKADVEGKYIKQSGGRGQYGHVVITFEPNHDKGFEFEDKIVGGKIPKEYIKSVKAGLEAAMNNGPLAGYPMIDIKASLFDGSYHDVDSNEMAYKIAASMALKEAGKRCKPALLEPIMAIEVTVPEQYFGDTMGDISSRRGMIEGTESRDNVQVIKAKVPLSEMFGYATDLRSFTQGRGNYIMQFSHYAEAPKSVVEKVIEDK 686
>gi|26553483|ref|NP_757417.1| elongation factor G [Mycoplasma penetrans HF-2] >gi|34395603|sp|Q8EX19|EFG_MYCPE Elongation factor G (EF-G) >gi|26453489|dbj|BAC43821.1| elongation factor G [Mycoplasma penetrans HF-2] (682 aa)
Score = 2784, Expect = 0.0e+00, Identities = 501/680 (73%), Positives = 589/680 (86%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVV 680
           MAR  D+  FRNFGIMAHIDAGKTTTSERILFHSGR HKIGE HDG + MDWMEQEKERGITITSAAT V+WK+C LNLIDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQAS+Y+VPRI++VNKMDKTGA+F+  ++S+ +RL   AV IQLPIGAE +FNGII+L+  + Y +DG ++E+ +   IP   K + ++MR H++EEV NFDD++M  YL G E+S  DIK+CIRKGV+  +FFPV+CG++FKNKG+K LLDAVVD+LPSPVDVP  K Y +DG+E+LI   DD P   LAFK+ATDP+VG+LTF+RVYSGVLK GSYV N  K  KERVSRLVKMH+ NR EI+EIRAGDICA+IGLKDT TG +L  ++ ++ LEAM FA+PVISLAVEPKTKADQEKM+IALSKL+EEDPTF+T+TD ET QTII+GMGELHL+I+VDR+RREFKVEVNVGAPQVS+RETF KE++ EGKYIKQSGGRGQYGHV I+FEPN +KGFEFVDKIVGG+IP+EYIKP++AGLE+AM +GPL+G+PMID+KATL+DGS+H+VDSSEMA+KIAAS+ALKEA K    VLLEPIMA+EVTVPEQYFGD MGDISSRRG IEG EQR N QVIKAKVPLKEMFGYATDLRSF+QGRGNYV  FSHY + PKS++
  S:     1 MARKFDIQKFRNFGIMAHIDAGKTTTSERILFHSGRTHKIGEVHDGGATMDWMEQEKERGITITSAATYVTWKDCELNLIDTPGHVDFTVEVERSLRVLDGAVAVLDAQNGVEPQTETVWRQASKYKVPRIVYVNKMDKTGADFKMCLESLNERLAAHAVAIQLPIGAEANFNGIINLVTMQAYMYDGKQDEEFKVVEIPADMKKEAEEMRHHMIEEVVNFDDEIMEKYLNGNELSEDDIKKCIRKGVLTAEFFPVVCGTSFKNKGVKALLDAVVDYLPSPVDVPPIKGYKDDGSEILIKNEDDGPLAALAFKIATDPYVGKLTFIRVYSGVLKKGSYVLNATKGIKERVSRLVKMHSNNREEIDEIRAGDICAVIGLKDTVTGNSLSSEEKELHLEAMNFAEPVISLAVEPKTKADQEKMAIALSKLSEEDPTFRTYTDDETNQTIISGMGELHLEIIVDRLRREFKVEVNVGAPQVSYRETFTKEADSEGKYIKQSGGRGQYGHVFIKFEPNPEKGFEFVDKIVGGKIPKEYIKPIKAGLEDAMKAGPLSGFPMIDVKATLYDGSYHDVDSSEMAYKIAASMALKEASKTAGLVLLEPIMAVEVTVPEQYFGDAMGDISSRRGSIEGQEQRGNTQVIKAKVPLKEMFGYATDLRSFTQGRGNYVYAFSHYEKAPKSLL 680
>gi|171920723|ref|ZP_02695845.2| translation elongation factor G [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179002|ref|ZP_02964752.1| translation elongation factor G [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188023993|ref|ZP_02996754.1| translation elongation factor G [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039190|ref|ZP_02998002.1| translation elongation factor G [Ureaplasma urealyticum serovar 8] >gi|188518357|ref|ZP_03003866.1| translation elongation factor G [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524289|ref|ZP_03004330.1| translation elongation factor G [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530649|ref|ZP_03004994.1| translation elongation factor G [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568899|ref|ZP_03005611.1| translation elongation factor G [Ureaplasma urealyticum serovar 2] >gi|188592716|ref|ZP_03006002.1| translation elongation factor G [Ureaplasma urealyticum serovar 10] >gi|195867933|ref|ZP_03079931.1| translation elongation factor G [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903468|gb|EDT49757.1| translation elongation factor G [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209089|gb|EDU06132.1| translation elongation factor G [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019018|gb|EDU57058.1| translation elongation factor G [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997992|gb|EDU67089.1| translation elongation factor G [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659783|gb|EDX53163.1| translation elongation factor G [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660410|gb|EDX53669.1| translation elongation factor G [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (688 aa)
Score = 2639, Expect = 0.0e+00, Identities = 479/678 (70%), Positives = 566/678 (83%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           FRNFGIMAHIDAGKTTTSERIL+H+G+ HKIGETHDG + MDWM QEKERGITITSAAT   WK  SLNLIDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA++Y VPRI+FVNKMDKTGA+F  S+++++ RLGVKA  IQ+PIGAE DF G IDLIE K Y +DG  +E+ + + IP  +  + + MR+ ++++VA FDD++M  YL G+E+S  DIK+CIRKGVI  + +PVLCG+AFKNKG+K LLDAVVDFLPSP+DVP  K   + GN +        PF  LAFKVATDPFVGRLT++RVYSG L  G+YV N  K+KKER+SRLVKMH+ NR+EI+ I AGDICA+IGLKDTTTG+T+ D+K  V LE M FA+PVISL+VEPKTKADQEKMS+ALSKLAEEDPTF+T+T+ ETGQTIIAGMGELHLD+LVDRMRREF V+VNVGAPQVS+RETF + ++ EGKYIKQSGGRGQYGHV I+FEPN DKGFEFVD IVGG++P+EYIK V+ GL  A+ SGP+AGY  ID+KAT+FDGS+H+VDSS MA+KIAASLA KEA KVC PVLLEPIM+++VT P+ YFG  MGDIS RRG+IEG EQR N Q IKAKVPL EMFGYATDLRS +QGRG Y+MQFSHYA+ PKSV  E++A +
  S:     8 FRNFGIMAHIDAGKTTTSERILYHTGKNHKIGETHDGAATMDWMAQEKERGITITSAATYAKWKGHSLNLIDTPGHVDFTVEVERSLRVLDGAVAVLDGQNGVEPQTETVWRQATKYNVPRIVFVNKMDKTGADFYYSIETMKNRLGVKATAIQIPIGAEADFVGSIDLIEMKAYIYDGQADEEYKIEDIPADYVTKAQVMRSQMIDDVAIFDDEVMEKYLSGEELSHEDIKKCIRKGVISTELYPVLCGTAFKNKGVKKLLDAVVDFLPSPIDVPPIKGVDDHGNPIEYHNDPSEPFAALAFKVATDPFVGRLTYIRVYSGKLDKGTYVYNATKDKKERISRLVKMHSNNRDEIDSISAGDICAVIGLKDTTTGDTICDEKKPVILEQMVFAEPVISLSVEPKTKADQEKMSLALSKLAEEDPTFRTYTNEETGQTIIAGMGELHLDVLVDRMRREFNVQVNVGAPQVSYRETFTEIADAEGKYIKQSGGRGQYGHVWIKFEPNHDKGFEFVDNIVGGKVPKEYIKEVENGLIEALTSGPIAGYQTIDVKATIFDGSYHDVDSSGMAYKIAASLAFKEAAKVCKPVLLEPIMSVDVTTPDDYFGTVMGDISKRRGVIEGQEQRGNAQAIKAKVPLSEMFGYATDLRSNTQGRGQYIMQFSHYAQAPKSVTEEVMAAR 685
>gi|13358087|ref|NP_078361.1| translation elongation factor G [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762042|ref|YP_001752608.1| translation elongation factor G [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920432|ref|ZP_02931746.1| translation elongation factor G [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508644|ref|ZP_02958144.1| translation elongation factor G [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701720|ref|ZP_02971412.1| translation elongation factor G [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189027978|sp|B1AJG4.1|EFG_UREP2 Elongation factor G (EF-G) >gi|11132010|sp|Q9PPW7|EFG_UREPA Elongation factor G (EF-G) >gi|11277728|pir||G82879 translation elongation factor G UU523 [imported] - Ureaplasma urealyticum >gi|6899526|gb|AAF30936.1|AE002151_2 translation elongation factor G [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827619|gb|ACA32881.1| translation elongation factor G [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902880|gb|EDT49169.1| translation elongation factor G [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676110|gb|EDT88015.1| translation elongation factor G [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700987|gb|EDU19269.1| translation elongation factor G [Ureaplasma parvum serovar 6 str. ATCC 27818] (688 aa)
Score = 2637, Expect = 0.0e+00, Identities = 477/678 (70%), Positives = 566/678 (83%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           FRNFGIMAHIDAGKTTTSERIL+H+G+ HKIGETHDG + MDWM QEKERGITITSAAT   WK  SLNLIDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA++Y VPRI+FVNKMDKTGA+F  S+++++ RLGVKA  IQ+PIGAE DF G IDLIE K Y +DG  +E+ + + IP  +  + + MR+ ++++VA FDD++M  YL G+E+S  DIK+CIRKGVI  + +PVLCG+AFKNKG+K LLDAVVDFLPSP+DVP  K   + GN +      + PF  LAFKVATDPFVGRLT++RVYSG L  G+Y+ N  K+KKER+SRLVKMH+ NR+EI+ I AGDICA+IGLKDTTTG+T+ D+K  V LE M FA+PVISL+VEPKTKADQEKMS+ALSKLAEEDPTF+T+T+ ETGQTIIAGMGELHLD+LVDRMRREF V+VNVGAPQVS+RETF + ++ EGKYIKQSGGRGQYGHV I+FEPN DKGFEFVD IVGG++P+EYIK V+ GL  A+ SGP+AGY  ID+KAT+FDGS+H+VDSS MA+KIAASLA KEA KVC PVLLEPIM+++VT P+ YFG  MGDIS RRG+IEG EQR N Q IKAKVPL EMFGYATDLRS +QGRG Y+MQFSHYA+ PKSV  E++  +
  S:     8 FRNFGIMAHIDAGKTTTSERILYHTGKNHKIGETHDGAATMDWMAQEKERGITITSAATYAKWKGHSLNLIDTPGHVDFTVEVERSLRVLDGAVAVLDGQNGVEPQTETVWRQATKYNVPRIVFVNKMDKTGADFYYSIETMKNRLGVKATAIQIPIGAEADFVGSIDLIEMKAYIYDGKADEEYKIEDIPADYLTKAQVMRSQMIDDVAVFDDEVMEKYLSGEELSHEDIKKCIRKGVISTELYPVLCGTAFKNKGVKKLLDAVVDFLPSPIDVPPIKGVDDHGNPIEYHNDPNEPFAALAFKVATDPFVGRLTYIRVYSGKLDKGTYIYNATKDKKERISRLVKMHSNNRDEIDSISAGDICAVIGLKDTTTGDTICDEKKPVILEQMVFAEPVISLSVEPKTKADQEKMSLALSKLAEEDPTFRTYTNEETGQTIIAGMGELHLDVLVDRMRREFNVQVNVGAPQVSYRETFTEVADAEGKYIKQSGGRGQYGHVWIKFEPNHDKGFEFVDNIVGGKVPKEYIKEVENGLIEALTSGPIAGYQTIDVKATIFDGSYHDVDSSGMAYKIAASLAFKEAAKVCKPVLLEPIMSVDVTTPDDYFGTVMGDISKRRGVIEGQEQRGNAQAIKAKVPLSEMFGYATDLRSNTQGRGQYIMQFSHYAQAPKSVTEEVMVAR 685
>gi|110003984|emb|CAK98324.1| translation elongation factor ef-g protein [Spiroplasma citri] (692 aa)
Score = 2608, Expect = 0.0e+00, Identities = 477/684 (69%), Positives = 557/684 (81%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L N RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWM QE+ERGITITSAAT+  WKN  LN+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV++I  RL   A P+Q+PIGAE+ F GIID++E K Y +DG   E+A+E  IPD  KD V++ R  L+E   NF+++LM  YL+G +ISI +IK  IR   +   FFPV CGSAFKNKG+KL+LD V+D+LPSP+D+P  K   EDG EV   A D  PF  LAFK+ TDPFVG+LTF RVYSGVLK GS V N  K+K ER+ RL+KMHA NR EIE + AGDI A +GLK TTTG+TL D+K +V LE+M F +PVI+LA+EPKTKADQEKMS+AL KLAEEDPTF+T+TD ETGQTIIAGMGELHLDILVDRM+REFKVE NVGAPQVS+RETF   +EVEGKYIKQSGGRGQYGHV I+FEPN DKGFEFVD IVGG+IP+E+I  V+ GLE +M +G LAGYPMIDIK+TL+DGS+H+VDSS+MA++ AASLALKEA K C PV+LEPIMA+EVTVPE+Y+GD MG++SSRRG IEG +Q  N QV+KAKVPL EMFGYATDLRSF+QGRG Y M FSHY E PKS+  EII
  S:     1 MAREYSLENTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGASQMDWMAQEQERGITITSAATTAFWKNMRLNIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVKTIHDRLQANAHPVQIPIGAEDQFTGIIDIVERKAYHYDGAANEEAKEISIPDDLKDLVEEYRMKLIEAAVNFNEELMLKYLDGNDISIPEIKSAIRAATLTGDFFPVFCGSAFKNKGVKLMLDGVIDYLPSPLDIPSIKGVLEDGTEVERHADDSEPFSALAFKIMTDPFVGKLTFFRVYSGVLKKGSSVLNSTKDKTERIGRLLKMHANNREEIEAVYAGDIAAAVGLKLTTTGDTLCDEKNEVILESMVFPEPVINLALEPKTKADQEKMSLALQKLAEEDPTFRTWTDEETGQTIIAGMGELHLDILVDRMKREFKVETNVGAPQVSYRETFKDSAEVEGKYIKQSGGRGQYGHVWIKFEPNHDKGFEFVDAIVGGKIPKEFIGSVKKGLEESMQTGKLAGYPMIDIKSTLYDGSYHDVDSSQMAYEFAASLALKEAAKKCKPVILEPIMAVEVTVPEEYYGDVMGNLSSRRGQIEGNDQHGNAQVVKAKVPLSEMFGYATDLRSFTQGRGTYTMLFSHYQEAPKSITEEII 684
>gi|83319565|ref|YP_424144.1| elongation factor G [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|119368744|sp|Q2SSW9|EFG_MYCCT Elongation factor G (EF-G) >gi|83283451|gb|ABC01383.1| translation elongation factor G [Mycoplasma capricolum subsp. capricolum ATCC 27343] (689 aa)
Score = 2605, Expect = 0.0e+00, Identities = 475/684 (69%), Positives = 561/684 (82%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L+N RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WKN   N+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA+ Y VPRI+FVNKMDKTGA+F  SV++I  RLG KA PIQLPIGAE +F GIIDL+E K Y FDG  EE  +E  IP    +Q K++RAHLVE    +D++L+  +L+G EISI+++K  IRKGVI   FFPVL GSAFKNKG+KLLLDAVVD+LPSP+D+P  K     G EV   ASD  PF  LAFKV TDPFVG+LTF RVYSG+L  GSY+ N  K +KERV R+++MHA NR EIEE+ +GDI A +GLK+TTTG+TL D+K ++ LE+M F +PVI LA+EPKTKADQEKMSIALSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDI+VDRM+REF V  NVGAPQVS+RET     + EGKYIKQSGGRG YGHV I FEPNKDKGFE+VDKI GGR+ +EYI   + GLENA+ +G +AGYPMID+KAT+ DGS HEVDS+EMA+KIAAS+ALKEA +  +PV+LEPIM +EVTVP++Y+GD MG+ISS+RG+IEG+EQR N Q IK+KVPL EMFGYAT+LRSF+QGRGNY M FSHYAE PK++ +EII
  S:     1 MAREYSLLNTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAFWKNTRFNIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQSGVEPQTETVWRQATNYRVPRIVFVNKMDKTGADFIYSVKTIGDRLGAKAAPIQLPIGAEENFTGIIDLVEMKAYEFDGKPEENYKEIEIPSNLLEQAKELRAHLVEVAVEYDEELLMKFLDGGEISISELKSAIRKGVINADFFPVLAGSAFKNKGVKLLLDAVVDYLPSPIDIPSIKGILPTGEEVERHASDTEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYILNSTKQQKERVGRILQMHANNRTEIEEVYSGDIAAAVGLKNTTTGDTLCDEKHEIILESMVFPEPVIQLALEPKTKADQEKMSIALSKLAEEDPTFRTYTDDETGQTIIAGMGELHLDIIVDRMKREFNVATNVGAPQVSYRETIKLPGKAEGKYIKQSGGRGSYGHVVIEFEPNKDKGFEWVDKITGGRVSKEYINSARVGLENALRNGVIAGYPMIDVKATIVDGSMHEVDSNEMAYKIAASMALKEAARKMNPVVLEPIMNVEVTVPDEYYGDVMGNISSKRGMIEGSEQRGNAQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEAPKAIADEII 684
>gi|50365438|ref|YP_053863.1| elongation factor G [Mesoplasma florum L1] >gi|62286667|sp|Q6F0J4|EFG_MESFL Elongation factor G (EF-G) >gi|50363994|gb|AAT75979.1| translation elongation factor G [Mesoplasma florum L1] (689 aa)
Score = 2604, Expect = 0.0e+00, Identities = 479/684 (70%), Positives = 563/684 (82%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R   L N RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WKN   N+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA+ Y VPRI+FVNKMDKTGA+F  SV+SI  RLG KA PIQLPIGAE++F GIIDL+E K Y FDG  EE A+E  IP   KDQ + +R+ LVE    +D++LM  +L+G+EI+I ++K+ IRKGVIG +FFPVL GSAFKNKG+KLLLDAVVD+LPSP+DVP  K    +G E    A D+ PF  LAFKV TDPFVG+LTF RVYSG+L  GSYV N  K  KERV R+++MHA NRNEIEE+ AGDI A +GLK+TTTG+TLVD+K ++ LE+M F +PVI LA+EPKTKADQEKM +ALSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQVS+RET    ++ EGKY+KQSGGRG YGHV I FEPN DKGFE+VDKI GGR+ +EYI   + GLENA+ +G +AGYPMID+KAT+ DGS H+VDS+EMA+KIAAS ALKEA K  +PV+LEPIM +EVTVP++Y+GD MG+ISS+RGLIEG+EQR N Q IK+KVPL EMFGYAT+LRSF+QGRGNY M FSHYAE P+S+  EII
  S:     1 MPREFSLENTRNLGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAFWKNNRFNIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQSGVEPQTETVWRQATTYRVPRIVFVNKMDKTGADFIYSVKSIGDRLGAKAAPIQLPIGAEDNFTGIIDLVEMKAYEFDGKAEEIAKEIEIPADLKDQAEILRSELVEAAVEYDEELMMKFLDGEEITIPELKQAIRKGVIGAEFFPVLAGSAFKNKGVKLLLDAVVDYLPSPLDVPSIKGVLPNGEEAERHADDNEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYVLNSTKGDKERVGRILQMHANNRNEIEEVYAGDIAAAVGLKNTTTGDTLVDEKHEIILESMVFPEPVIQLALEPKTKADQEKMGLALSKLAEEDPTFRTYTDEETGQTIIAGMGELHLDIIVDRMRREFKVETNVGAPQVSYRETIKLPAKAEGKYVKQSGGRGSYGHVVIEFEPNVDKGFEWVDKITGGRVSKEYINAARVGLENALTNGVVAGYPMIDVKATIVDGSMHDVDSNEMAYKIAASFALKEACKKMNPVILEPIMNVEVTVPDEYYGDVMGNISSKRGLIEGSEQRGNAQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEAPRSIAEEII 684
>gi|66880320|ref|ZP_00405302.1| COG0480: Translation elongation factors (GTPases) [Mycoplasma genitalium G-37] (552 aa)
Score = 2602, Expect = 0.0e+00, Identities = 490/552 (88%), Positives = 516/552 (93%)
  Q:   137 MDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MDKTGANFERSV SIQQRLGVKAVPIQ PIGAENDFNGIID+I +K YFFDG KEE A EKPIP+Q+ DQV+++  +LVEEVA+ DDQLMADYL+GK I I  IK  IR GVI C+FFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVP AKA   +  E+ I ASDDA F+GLAFKVATDPFVGRLTF+RVY+GVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEI+EIRAGDICA+IGLKDTTTGETL DDK+DVQLEAMQFA+PVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTF+DPETGQTIIAGMGELHLDILVDRM+REFKVEVN+GAPQVSFRETF   SEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQ GLENAM SGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGK C+PVLLEPIMAIEVTVPEQYFGDTMGDISSRRG+IEGTEQRDNVQ+IKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA KK
  S:     1 MDKTGANFERSVLSIQQRLGVKAVPIQFPIGAENDFNGIIDIITKKAYFFDGNKEENAIEKPIPEQYVDQVEKLYNNLVEEVASLDDQLMADYLDGKPIEIDAIKNAIRNGVIHCKFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPPAKAIDANNKEISIKASDDANFIGLAFKVATDPFVGRLTFIRVYAGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIDEIRAGDICAVIGLKDTTTGETLTDDKLDVQLEAMQFAEPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAGMGELHLDILVDRMKREFKVEVNIGAPQVSFRETFKSTSEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQTGLENAMNSGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKQCNPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGIIEGTEQRDNVQLIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIANKK 552
>gi|188159790|ref|ZP_02512899.2| elongation factor G [Mycoplasma mycoides subsp. mycoides LC str. GM12] (689 aa)
Score = 2599, Expect = 0.0e+00, Identities = 476/684 (69%), Positives = 561/684 (82%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L+N RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WKN   N+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA+ Y+VPRI+FVNKMDKTGA+F  SV++I  RLG KA PIQLPIGAE +F GIIDL+E K Y FDG  EE  +E  IP    +Q K++RAHLVE    +D++L+  +L+G EISI+++K  IRKGVI   FFPVL GSAFKNKG+KLLLDAVVD+LPSP+D+P  K     G EV   A D  PF  LAFKV TDPFVG+LTF RVYSG+L  GSYV N  K +KERV R+++MHA NR EIEE+ +GDI A +GLK+TTTG+TL D+K ++ LE+M F +PVI LA+EPKTKADQEKMSIALSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDI+VDRM+REF V  NVGAPQVS+RET     + EGKYIKQSGGRG YGHV I FEPNKDKGFE+VDKI GGR+ +EYI   + GLENA+ +G +AGYPMID+KAT+ DGS HEVDS+EMA+KIAAS+ALKEA K  +PV+LEPIM +EVTVP++Y+GD MG+ISS+RG+IEG+EQR N Q IK+KVPL EMFGYAT+LRSF+QGRGNY M FSHYAE PK++ +EII
  S:     1 MAREYSLLNTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAFWKNTRFNIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQSGVEPQTETVWRQATNYKVPRIVFVNKMDKTGADFIYSVKTIGDRLGAKAAPIQLPIGAEENFTGIIDLVEMKAYEFDGKPEENYKEIEIPTNLLEQAKELRAHLVEVAVEYDEELLMKFLDGGEISISELKSAIRKGVINADFFPVLAGSAFKNKGVKLLLDAVVDYLPSPLDIPSIKGILPTGEEVERHADDTEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYVLNSTKQQKERVGRILQMHANNRTEIEEVYSGDIAAAVGLKNTTTGDTLCDEKGEIILESMVFPEPVIQLALEPKTKADQEKMSIALSKLAEEDPTFRTYTDDETGQTIIAGMGELHLDIIVDRMKREFNVATNVGAPQVSYRETIKLPGKAEGKYIKQSGGRGSYGHVVIEFEPNKDKGFEWVDKITGGRVSKEYINSARVGLENALRNGVIAGYPMIDVKATIVDGSMHEVDSNEMAYKIAASMALKEASKKMNPVVLEPIMNVEVTVPDEYYGDVMGNISSKRGIIEGSEQRGNAQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEAPKAIADEII 684
>gi|42560711|ref|NP_975162.1| elongation factor G [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|62286670|sp|Q6MU82|EFG_MYCMS Elongation factor G (EF-G) >gi|42492207|emb|CAE76804.1| Translation elongation factor G [Mycoplasma mycoides subsp. mycoides SC str. PG1] (689 aa)
Score = 2595, Expect = 0.0e+00, Identities = 475/684 (69%), Positives = 560/684 (81%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L+N RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WKN   N+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA+ Y+VPRI+FVNKMDKTGA+F  SV++I  RLG KA PIQLPIGAE +F GIIDL+E K Y FDG  EE  +E  IP    +Q K++RAHLVE    +D++L+  +L+G EISI+++K  IRKGVI   FFPVL GSAFKNKG+KLLLDAVVD+LPSP+D+P  K     G EV   A D  PF  LAFKV TDPFVG+LTF RVYSG+L  GSYV N  K +KERV R+++MHA NR EIEE+ +GDI   +GLK+TTTG+TL D+K ++ LE+M F +PVI LA+EPKTKADQEKMSIALSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDI+VDRM+REF V  NVGAPQVS+RET     + EGKYIKQSGGRG YGHV I FEPNKDKGFE+VDKI GGR+ +EYI   + GLENA+ +G +AGYPMID+KAT+ DGS HEVDS+EMA+KIAAS+ALKEA K  +PV+LEPIM +EVTVP++Y+GD MG+ISS+RG+IEG+EQR N Q IK+KVPL EMFGYAT+LRSF+QGRGNY M FSHYAE PK++ +EII
  S:     1 MAREYSLLNTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAFWKNTRFNIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQSGVEPQTETVWRQATNYKVPRIVFVNKMDKTGADFIYSVKTIGDRLGAKAAPIQLPIGAEENFTGIIDLVEMKAYEFDGKPEENYKEIEIPTNLLEQAKELRAHLVEVAVEYDEELLMKFLDGGEISISELKSAIRKGVINADFFPVLAGSAFKNKGVKLLLDAVVDYLPSPLDIPSIKGILPTGEEVERHADDTEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYVLNSTKQQKERVGRILQMHANNRTEIEEVYSGDIATAVGLKNTTTGDTLCDEKGEIILESMVFPEPVIQLALEPKTKADQEKMSIALSKLAEEDPTFRTYTDDETGQTIIAGMGELHLDIIVDRMKREFNVATNVGAPQVSYRETIKLPGKAEGKYIKQSGGRGSYGHVVIEFEPNKDKGFEWVDKITGGRVSKEYINSARVGLENALRNGVIAGYPMIDVKATIVDGSMHEVDSNEMAYKIAASMALKEASKKMNPVVLEPIMNVEVTVPDEYYGDVMGNISSKRGIIEGSEQRGNAQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEAPKAIADEII 684
>gi|18077332|emb|CAC87987.1| elongation gactor G [Mycoplasma mycoides subsp. mycoides] >gi|19171203|emb|CAD21853.1| translation elongation factor G [Mycoplasma mycoides subsp. mycoides] (689 aa)
Score = 2590, Expect = 0.0e+00, Identities = 474/684 (69%), Positives = 559/684 (81%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L+N RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WKN   N+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQA+ Y+VPRI+FVNKMDKTGA+F  SV++I  RLG KA PIQLPIGAE +F GIIDL+E K Y FDG  EE  +E  IP    +Q K++RAHLVE    +D++L+  +L+G EISI+++K  IRKGVI   FFPVL GSAFKNKG+KLLLDAVVD+LPSP+D+P  K     G EV   A D  PF  LAFKV TDPFVG+LTF RVYSG+L  GSYV N  K +KERV R+++MHA NR  IEE+ +GDI   +GLK+TTTG+TL D+K ++ LE+M F +PVI LA+EPKTKADQEKMSIALSKLAEEDPTF+T+TD ETGQTIIAGMGELHLDI+VDRM+REF V  NVGAPQVS+RET     + EGKYIKQSGGRG YGHV I FEPNKDKGFE+VDKI GGR+ +EYI   + GLENA+ +G +AGYPMID+KAT+ DGS HEVDS+EMA+KIAAS+ALKEA K  +PV+LEPIM +EVTVP++Y+GD MG+ISS+RG+IEG+EQR N Q IK+KVPL EMFGYAT+LRSF+QGRGNY M FSHYAE PK++ +EII
  S:     1 MAREYSLLNTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAFWKNTRFNIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQSGVEPQTETVWRQATNYKVPRIVFVNKMDKTGADFIYSVKTIGDRLGAKAAPIQLPIGAEENFTGIIDLVEMKAYEFDGKPEENYKEIEIPTNLLEQAKELRAHLVEVAVEYDEELLMKFLDGGEISISELKSAIRKGVINADFFPVLAGSAFKNKGVKLLLDAVVDYLPSPLDIPSIKGILPTGEEVERHADDTEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYVLNSTKQQKERVGRILQMHANNRTGIEEVYSGDIATAVGLKNTTTGDTLCDEKGEIILESMVFPEPVIQLALEPKTKADQEKMSIALSKLAEEDPTFRTYTDDETGQTIIAGMGELHLDIIVDRMKREFNVATNVGAPQVSYRETIKLPGKAEGKYIKQSGGRGSYGHVVIEFEPNKDKGFEWVDKITGGRVSKEYINAARVGLENALRNGVIAGYPMIDVKATIVDGSMHEVDSNEMAYKIAASMALKEASKKMNPVVLEPIMNVEVTVPDEYYGDVMGNISSKRGIIEGSEQRGNAQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEAPKAIADEII 684
>gi|15612694|ref|NP_240997.1| elongation factor G [Bacillus halodurans C-125] >gi|12643262|sp|Q9Z9L7|EFG_BACHD Elongation factor G (EF-G) >gi|10172743|dbj|BAB03850.1| translation elongation factor G (EF-G) [Bacillus halodurans C-125] (692 aa)
Score = 2468, Expect = 0.0e+00, Identities = 456/684 (66%), Positives = 550/684 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L N RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDKTGA+F  SV ++  RL   A PIQLPIGAE++F GIIDL++   YF++     + E K IPD++K+Q ++    LVE  A  D++LM  YLEG+E++  ++K  IRKG    +F+PVLCGSAFKNKG++L+LDAV+D+LPSP+DVP  K +  D  E  +    DD PF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K+K+ERV R+++MHA +R EI  + +GDI A +GLKDT+TG+TL D+K  V LE+M+F +PVI L+VEPK+KADQ+KM +AL+KLAEEDPTFKT TD ETGQTIIAGMGELHLDI+VDR+RREFKVE NVGAPQVS+RET  + ++VEGK+++QSGGRGQYGHV I F PN++  GFEFV+ IVGG +PREYI  VQAGLE A+ +G LAGYP+IDIKA LFDGS+H+VDSSEMAFKIAAS+ALK A   C+PVLLEP+M +EV VPE+Y GD MGDI+SRRG +EG E R N QV+KA VPL EMFGYAT LRS +QGRG Y M F HY E PKS+  EII
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKNNRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKTGADFLYSVSTLHDRLQANAHPIQLPIGAEDNFEGIIDLVDMVAYFYEDDLGTRTEAKEIPDEYKEQAQEYHEKLVEAAAELDEELMMKYLEGEELTKDELKAAIRKGTCNVEFYPVLCGSAFKNKGVQLMLDAVLDYLPSPLDVPAIKGHVPDTEEEAVRKPGDDQPFAALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSTKDKRERVGRILQMHANHREEISTVYSGDIAAAVGLKDTSTGDTLCDEKNLVILESMEFPEPVIHLSVEPKSKADQDKMGLALAKLAEEDPTFKTHTDEETGQTIIAGMGELHLDIIVDRLRREFKVEANVGAPQVSYRETIRQAAQVEGKFVRQSGGRGQYGHVWIEFSPNEEGAGFEFVNGIVGGVVPREYIPSVQAGLEEALENGLLAGYPVIDIKAKLFDGSYHDVDSSEMAFKIAASMALKNAKSKCNPVLLEPMMKVEVVVPEEYMGDVMGDITSRRGRVEGMEARGNAQVVKAFVPLAEMFGYATSLRSRTQGRGTYTMFFDHYEEVPKSISEEII 686
>gi|4512401|dbj|BAA75268.1| fus homologue (identity of 87% to B. subtilis ) [Bacillus halodurans] (692 aa)
Score = 2463, Expect = 0.0e+00, Identities = 455/684 (66%), Positives = 549/684 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L N RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEP TETVWRQA+ Y VPR++FVNKMDKTGA+F  SV ++  RL   A PIQLPIGAE++F GIIDL++   YF++     + E K IPD++K+Q ++    LVE  A  D++LM  YLEG+E++  ++K  IRKG    +F+PVLCGSAFKNKG++L+LDAV+D+LPSP+DVP  K +  D  E  +    DD PF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K+K+ERV R+++MHA +R EI  + +GDI A +GLKDT+TG+TL D+K  V LE+M+F +PVI L+VEPK+KADQ+KM +AL+KLAEEDPTFKT TD ETGQTIIAGMGELHLDI+VDR+RREFKVE NVGAPQVS+RET  + ++VEGK+++QSGGRGQYGHV I F PN++  GFEFV+ IVGG +PREYI  VQAGLE A+ +G LAGYP+IDIKA LFDGS+H+VDSSEMAFKIAAS+ALK A   C+PVLLEP+M +EV VPE+Y GD MGDI+SRRG +EG E R N QV+KA VPL EMFGYAT LRS +QGRG Y M F HY E PKS+  EII
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKNNRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPHTETVWRQATTYGVPRVVFVNKMDKTGADFLYSVSTLHDRLQANAHPIQLPIGAEDNFEGIIDLVDMVAYFYEDDLGTRTEAKEIPDEYKEQAQEYHEKLVEAAAELDEELMMKYLEGEELTKDELKAAIRKGTCNVEFYPVLCGSAFKNKGVQLMLDAVLDYLPSPLDVPAIKGHVPDTEEEAVRKPGDDQPFAALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSTKDKRERVGRILQMHANHREEISTVYSGDIAAAVGLKDTSTGDTLCDEKNLVILESMEFPEPVIHLSVEPKSKADQDKMGLALAKLAEEDPTFKTHTDEETGQTIIAGMGELHLDIIVDRLRREFKVEANVGAPQVSYRETIRQAAQVEGKFVRQSGGRGQYGHVWIEFSPNEEGAGFEFVNGIVGGVVPREYIPSVQAGLEEALENGLLAGYPVIDIKAKLFDGSYHDVDSSEMAFKIAASMALKNAKSKCNPVLLEPMMKVEVVVPEEYMGDVMGDITSRRGRVEGMEARGNAQVVKAFVPLAEMFGYATSLRSRTQGRGTYTMFFDHYEEVPKSISEEII 686
>gi|52078606|ref|YP_077397.1| elongation factor G [Bacillus licheniformis ATCC 14580] >gi|52783968|ref|YP_089797.1| elongation factor G [Bacillus licheniformis ATCC 14580] >gi|62286474|sp|Q65PB0|EFG_BACLD Elongation factor G (EF-G) >gi|52001817|gb|AAU21759.1| elongation factor G [Bacillus licheniformis ATCC 14580] >gi|52346470|gb|AAU39104.1| FusA [Bacillus licheniformis DSM 13] (692 aa)
Score = 2454, Expect = 0.0e+00, Identities = 449/684 (65%), Positives = 554/684 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDKTGA+F  SV +++ RL   A  IQLPIGAE++F GIIDL+E   Y+++     ++E + IP ++KD+ +++RA L+E VA  D++LM  YLEG+EI++ ++K  IRKG    +F+PVLCGSAFKNKG++L+LDAV+D+LP+P DVP  K    D + EV   +SDDAPF  LAFKV TDP+VG+LTF RVYSG L SGSYV+N  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVI +A+EPK+KADQ+KMS AL+KLAEEDPTF+  TDPETGQTII GMGELHLDI+VDRM+REFKVE NVGAPQV++RETF   ++VEGK+++QSGGRGQ+GHV I F PN++ KGFEF + IVGG +PREYI  VQAGLE+A+ +G +AGYP+IDIKA LFDGS+H+VDS+EMAFKIAAS+ALK A   C+PV+LEPI  +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKS+ +EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKTGADFLYSVGTLRDRLEANAHAIQLPIGAEDNFEGIIDLVENVAYYYEDDLGTRSEAREIPAEYKDKAEELRASLIEAVAELDEELMMKYLEGEEITVDELKAAIRKGTCNVEFYPVLCGSAFKNKGVQLVLDAVLDYLPAPTDVPAIKGTLPDSDEEVTRESSDDAPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVRNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVILESMEFPEPVIHVAIEPKSKADQDKMSTALAKLAEEDPTFRAHTDPETGQTIIGGMGELHLDIIVDRMKREFKVEANVGAPQVAYRETFRASAQVEGKFVRQSGGRGQFGHVWIEFSPNEEGKGFEFENAIVGGVVPREYIPAVQAGLEDALQNGVVAGYPVIDIKAKLFDGSYHDVDSNEMAFKIAASMALKNAASKCNPVILEPISKVEVVIPEEYMGDIMGDITSRRGRVEGMEGRGNAQVVRAMVPLSEMFGYATALRSNTQGRGTFTMVFDHYEEVPKSIADEII 686
>gi|56418638|ref|YP_145956.1| elongation factor G [Geobacillus kaustophilus HTA426] >gi|62286463|sp|Q5L400|EFG_GEOKA Elongation factor G (EF-G) >gi|56378480|dbj|BAD74388.1| translation elongation factor G (EF-G) [Geobacillus kaustophilus HTA426] (692 aa)
Score = 2449, Expect = 0.0e+00, Identities = 451/688 (65%), Positives = 543/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE H+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGAI VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV+++  RL   A P+QLPIGAE+ F+GIIDL+E   Y +     +  E   IP++++D  ++    L+E VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPV CGSAFKNKG++LLLD VVD+LPSPVD+P  +    D   EV   ASDDAPF  LAFK+ TDP+VG+LTF+RVYSG L SGSYV N  K K+ER+ RL++MHA +R EI ++ AGDI A +GLKDTTTG+TL D+K  V LE+MQF +PVIS+A+EPK+KADQ+KMS AL KL EEDPTF+  TDPETGQTII+GMGELHLDI+VDRMRREFKVE NVGAPQV++RETF K ++VEGK+I+QSGGRGQYGHV I F PN + KGFEF + IVGG +P+EY+  VQAGLE AM +G LAGYP++DIKA LFDGS+H+VDSSEMAFKIAASLALK A   C PVLLEPIM +EV +PE+Y GD MGDI+SRRG IEG E R N QV++A VP+ EMFGYAT LRS +QGRG + M F HY E PK++ +EII   K
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHEGAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAITVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVKTLHDRLQANAHPVQLPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIDIPEEYRDMAEEYHNKLIEAVAELDEELMMKYLEGEEITTEELKAAIRKATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSPVDIPAIRGVVPDTEEEVTREASDDAPFAALAFKIMTDPYVGKLTFIRVYSGTLDSGSYVMNTTKGKRERIGRLLQMHANHRQEISKVYAGDIAAAVGLKDTTTGDTLCDEKHPVILESMQFPEPVISVAIEPKSKADQDKMSQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNERGKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSSEMAFKIAASLALKNAATKCDPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRIEGMEARGNAQVVRAMVPMAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNK 690
>gi|157690896|ref|YP_001485358.1| elongation factor G [Bacillus pumilus SAFR-032] >gi|166919587|sp|A8F981.1|EFG_BACP2 Elongation factor G (EF-G) >gi|157679654|gb|ABV60798.1| elongation factor EF2 [Bacillus pumilus SAFR-032] (692 aa)
Score = 2438, Expect = 0.0e+00, Identities = 445/688 (64%), Positives = 555/688 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDKTGA+F  SV +++ RL   A  IQLPIGAE+ F GIIDL++   YF++     +++ + IP ++KD+ +++R  L+E VA  D++LM  YLEG+EI+I ++K  IRKG +  +F+PVL GSAFKNKG++L+LDAV+D+LP+P DV   K    D N EV+  ++DDAPF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  KNK+ERV R+++MHA +R EI  + AGDI A +GLKDT+TG+TL D+K  V LE+M+F +PVI +A+EPK+KADQ+KM IAL+KLAEEDPTF+T T+PETGQTII+GMGELHLDI+VDRM+REFKVE NVGAPQV++RETF   ++VEGK+++QSGGRGQ+GHV I FEPN++  GFEF + IVGG +PREYI  +QAGLE+++ +G LAG+P+IDIKA LFDGS+H+VDS+EMAFKIAAS+ALK A   C+PVLLEP+M +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M   HY E PKS+  EII   K
  S:     1 MAREFSLDKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKTGADFLYSVSTLRDRLQANAHAIQLPIGAEDQFEGIIDLVDNVAYFYEDDLGTRSDAQEIPAEYKDKAEELRNSLIEAVAELDEELMEKYLEGEEITIPELKAAIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAPTDVAAIKGILPDSNEEVVRESTDDAPFSALAFKVMTDPYVGKLTFFRVYSGTLASGSYVKNSSKNKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTSTGDTLCDEKDTVILESMEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKREFKVEANVGAPQVAYRETFRSGAKVEGKFVRQSGGRGQFGHVWIEFEPNEEGAGFEFENAIVGGVVPREYIPAIQAGLEDSLENGVLAGFPLIDIKAKLFDGSYHDVDSNEMAFKIAASMALKNAVSKCNPVLLEPMMKVEVVIPEEYMGDIMGDITSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFTMHMDHYEEVPKSISEEIIKKNK 690
>gi|194017623|ref|ZP_03056234.1| translation elongation factor G [Bacillus pumilus ATCC 7061] >gi|194010895|gb|EDW20466.1| translation elongation factor G [Bacillus pumilus ATCC 7061] (693 aa)
Score = 2435, Expect = 0.0e+00, Identities = 444/684 (64%), Positives = 554/684 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDKTGA+F  SV +++ RL   A  IQLPIGAE+ F GIIDL++   YF++     +++ + IP ++KD+ +++R  L+E VA  D++LM  YLEG+EI+I ++K  IRKG +  +F+PVL GSAFKNKG++L+LDAV+D+LP+P DV   K    D N EV+  ++DDAPF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  KNK+ERV R+++MHA +R EI  + AGDI A +GLKDT+TG+TL D+K  V LE+M+F +PVI +A+EPK+KADQ+KM IAL+KLAEEDPTF+T T+PETGQTII+GMGELHLDI+VDRM+REFKVE NVGAPQV++RETF   ++VEGK+++QSGGRGQ+GHV I FEPN++  GFEF + IVGG +PREYI  +QAGLE+++ +G LAG+P+IDIKA LFDGS+H+VDS+EMAFKIAAS+ALK A   C+PVLLEP+M +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M   HY E PKS+  EII
  S:     1 MAREFSLDKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKTGADFLYSVGTLRDRLQANAHAIQLPIGAEDQFEGIIDLVDNVAYFYEDDLGTRSDAQEIPAEYKDKAEELRNSLIEAVAELDEELMEKYLEGEEITIPELKAAIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAPTDVAAIKGILPDSNEEVVRESTDDAPFAALAFKVMTDPYVGKLTFFRVYSGTLASGSYVKNSSKNKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTSTGDTLCDEKDTVILESMEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKREFKVEANVGAPQVAYRETFRSGAKVEGKFVRQSGGRGQFGHVWIEFEPNEEGAGFEFQNAIVGGVVPREYIPAIQAGLEDSLENGVLAGFPLIDIKAKLFDGSYHDVDSNEMAFKIAASMALKNAVSKCNPVLLEPMMKVEVVIPEEYMGDIMGDITSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFTMHMDHYEEVPKSISEEII 686
>gi|167757664|ref|ZP_02429791.1| hypothetical protein CLORAM_03214 [Clostridium ramosum DSM 1402] >gi|167702661|gb|EDS17240.1| hypothetical protein CLORAM_03214 [Clostridium ramosum DSM 1402] (691 aa)
Score = 2434, Expect = 0.0e+00, Identities = 436/684 (63%), Positives = 547/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M+R   L   RN GIMAHIDAGKTTT+ER+L+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+ VLD++ GVEPQTETVWRQA+ Y VPRI+F NKMD TGA+F  S++S+++RLGV  V +QLPIGAE+ F GIIDLI+ K  +F+G K E    K IP+++ DQ  +  A +++  A++DD LM   LE +E +  ++K  IRKGV+  + FPVLCGSA+K+KG++ +LDAV+DFLP+P D+P  K   EDGNE+   ASD+ PF  LAFK+  DPFVGRLTF RVYSG + SGSYV N  K+KKER+ R+++MHA  RNEI+ + AGDI A +G K+TTTG+T+ D+K  V LE M+F +PVI LA+EPKTK DQ+K+ + LSKLAEEDPTF+TFT+PETG T+IAGMGELHLD++VDR+RRE+KVE NVGAPQV++RET    +E EGKY+KQSGGRGQYGHV I+FEPN+ KGFEFVD IVGG +PREYI  V+ GLE+A+A+G +AGYP++D+KATLFDGS+H+VDSSEMA+K+AAS+ALK AGK C PV+LEPIMA+EVT P +Y G  MGD+SSRRG+IEG E+R N   ++A +PL EMFGYATDLRSF+QGRGNY M F  Y   PKS+  EII
  S:     1 MSREFSLEKTRNIGIMAHIDAGKTTTTERVLYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNGYRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDSKAGVEPQTETVWRQATTYGVPRIVFCNKMDATGADFIMSLESLEKRLGVHGVALQLPIGAEDTFEGIIDLIKMKAVYFEGTKGENVIYKDIPEEYLDQANEYHAKMLDAAASYDDDLMMKVLEEEEPTEEEVKAAIRKGVLAVELFPVLCGSAYKDKGVQPMLDAVIDFLPAPTDIPSIKGIDEDGNEIEKHASDEEPFAALAFKIMADPFVGRLTFFRVYSGTVDSGSYVLNSTKDKKERLGRILQMHANKRNEIQTVYAGDIAAAVGFKNTTTGDTICDEKNFVILEKMEFPEPVIELAIEPKTKQDQDKLGVGLSKLAEEDPTFRTFTNPETGDTVIAGMGELHLDVIVDRLRREYKVEANVGAPQVAYRETIKTAAECEGKYVKQSGGRGQYGHVWIKFEPNEGKGFEFVDAIVGGSVPREYINSVKVGLEDALATGMIAGYPVLDVKATLFDGSYHDVDSSEMAYKVAASMALKAAGKKCDPVILEPIMAVEVTAPAEYLGSVMGDVSSRRGMIEGQEERGNAVTVQASIPLSEMFGYATDLRSFTQGRGNYTMIFDRYEPVPKSIREEII 684
>gi|10279668|emb|CAC09927.1| translation elongation factor G, EF-G [Geobacillus stearothermophilus] (692 aa)
Score = 2431, Expect = 0.0e+00, Identities = 449/688 (65%), Positives = 541/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ERILF++GR+HKIGE H+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGAI VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  +V+++  RL   A P+QLPIGAE+ F+GIIDL+E   Y +     +  E   IP++++D  ++    LVE VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPV CGSAFKNKG++LLLD VVD+LPSPVD+P  +    D   EV   A DDAPF  LAFK+ TDP+VG+LTF RVYSG L SGSYV N  K K+ER+ RL++MHA +R EI ++ AGDI A +GLKDTTTG+TL D+K  V LE+MQF +PVIS+A+EPK+KADQ+KM  AL KL EEDPTF+  TDPETGQTII+GMGELHLDI+VDRMRREFKVE NVGAPQV++RETF K ++VEGK+++QSGGRGQYGHV I F PN + KGFEF + IVGG +P+EY+  VQAGLE AM +G LAGYP++DIKA LFDGS+H+VDSSEMAFKIAASLALK A   C PVLLEPIM +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PK++ +EII   K
  S:     1 MARQFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHEGAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAITVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYAVKTLHDRLQANAHPVQLPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIEIPEEYRDMAEEYHNKLVEAVAELDEELMMKYLEGEEITKEELKAAIRKATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSPVDIPPIRGVIPDTEEEVTREARDDAPFAALAFKIMTDPYVGKLTFFRVYSGTLDSGSYVMNSTKRKRERIGRLLQMHANHREEISKVYAGDIAAAVGLKDTTTGDTLCDEKNLVILESMQFPEPVISVAIEPKSKADQDKMGQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFVRQSGGRGQYGHVWIEFSPNERGKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPIVDIKAKLFDGSYHDVDSSEMAFKIAASLALKNAATKCDPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRVEGMEARGNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNK 690
>gi|30018377|ref|NP_830008.1| elongation factor G [Bacillus cereus ATCC 14579] >gi|34395588|sp|Q814C5|EFG_BACCR Elongation factor G (EF-G) >gi|29893917|gb|AAP07209.1| Protein Translation Elongation Factor G (EF-G) [Bacillus cereus ATCC 14579] (692 aa)
Score = 2429, Expect = 0.0e+00, Identities = 450/688 (65%), Positives = 547/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +I  RL   A PIQLPIGAE++FNGIIDL+EE  Y +        +   IP++ K+  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK     +FFPV+CGSAFKNKG+++LLDAV+D+LPSP+DVP  K    D + EV   +SD+ PF  LAFK+ TDP+VG+LTF RVYSGVL SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  ALSKL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +KIVGG +PREYI  V AGLE+A+ +G LAGYP++DIKA L DGS+H+VDSSEMAFKIAAS+ALK A   CSPV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKSV  EII   K
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQLPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELDEEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSPLDVPAIKGTLPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILESMEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPLVDIKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCSPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNK 690
>gi|163938115|ref|YP_001642999.1| elongation factor G [Bacillus weihenstephanensis KBAB4] >gi|163860312|gb|ABY41371.1| translation elongation factor G [Bacillus weihenstephanensis KBAB4] (692 aa)
Score = 2428, Expect = 0.0e+00, Identities = 448/688 (65%), Positives = 545/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL-ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +I  RL   A PIQLPIGAE++FNGIIDL+EE  Y +        E   IP++ K+  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK     +FFPV+CGSAFKNKG+++LLDAV+D+LPSP+DVP  K    D  E +   +SD+ PF  LAFK+ TDP+VG+LTF RVYSGVL SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  ALSKL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +K+VGG +PREYI  V AGLE+A+ +G LAGYP++DIKA L DGS+H+VDSSEMAFKIAAS+ALK A   CSPV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKSV  EII   K
  S:     1 MTREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQLPIGAEDEFNGIIDLVEECAYMYSNDLGTDIERVEIPEEHKELAEEYRGKLIEAVAELDEEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSPLDVPAIKGTLPDTEEAIERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILESMEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFQNKVVGGVVPREYIPAVGAGLEDALKNGVLAGYPLVDIKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCSPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATALRSNTQGRGTFSMTFDHYEEVPKSVSEEIIKKNK 690
>gi|30260298|ref|NP_842675.1| elongation factor G [Bacillus anthracis str. Ames] >gi|47525363|ref|YP_016712.1| elongation factor G [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183141|ref|YP_026393.1| elongation factor G [Bacillus anthracis str. Sterne] >gi|49478969|ref|YP_034459.1| elongation factor G [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|170709471|ref|ZP_02899873.1| translation elongation factor G [Bacillus anthracis str. A0389] >gi|34395589|sp|Q81VT3|EFG_BACAN Elongation factor G (EF-G) >gi|62286479|sp|Q6HPR1|EFG_BACHK Elongation factor G (EF-G) >gi|30253619|gb|AAP24161.1| translation elongation factor G [Bacillus anthracis str. Ames] >gi|47500511|gb|AAT29187.1| translation elongation factor G [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177068|gb|AAT52444.1| translation elongation factor G [Bacillus anthracis str. Sterne] >gi|49330525|gb|AAT61171.1| protein-synthesizing GTPase (translation elongation factor G (EF-G)) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|170125620|gb|EDS94545.1| translation elongation factor G [Bacillus anthracis str. A0389] (692 aa)
Score = 2424, Expect = 0.0e+00, Identities = 449/688 (65%), Positives = 547/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +I  RL   A PIQLPIGAE++FNGIIDL+EE  Y +        +   IP++ K+  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK     +FFPV+CGSAFKNKG+++LLDAV+D+LPSP+DVP  K    D + EV   +SD+ PF  LAFK+ TDP+VG+LTF RVYSGVL SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  ALSKL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +KIVGG +PREYI  V AGLE+A+ +G LAGYP++DIKA L DGS+H+VDSSEMAFKIAAS+ALK A   C+PV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKSV  EII   K
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQLPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELDEEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSPLDVPAIKGIVPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILESMEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNK 690
>gi|118475876|ref|YP_893027.1| elongation factor G [Bacillus thuringiensis str. Al Hakam] >gi|118415101|gb|ABK83520.1| translation elongation factor 2 (EF-2/EF-G) [Bacillus thuringiensis str. Al Hakam] (699 aa)
Score = 2422, Expect = 0.0e+00, Identities = 449/688 (65%), Positives = 547/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +I  RL   A PIQLPIGAE++FNGIIDL+EE  Y +        +   IP++ K+  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK     +FFPV+CGSAFKNKG+++LLDAV+D+LPSP+DVP  K    D + EV   +SD+ PF  LAFK+ TDP+VG+LTF RVYSGVL SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  ALSKL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +KIVGG +PREYI  V AGLE+A+ +G LAGYP++DIKA L DGS+H+VDSSEMAFKIAAS+ALK A   C+PV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKSV  EII   K
  S:     8 MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQLPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELDEEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSPLDVPAIKGIVPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILESMEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNK 697
>gi|52145111|ref|YP_081718.1| elongation factor G [Bacillus cereus E33L] >gi|62286471|sp|Q63H93|EFG_BACCZ Elongation factor G (EF-G) >gi|51978580|gb|AAU20130.1| protein-synthesizing GTPase (translation elongation factor G (EF-G)) [Bacillus cereus E33L] (692 aa)
Score = 2421, Expect = 0.0e+00, Identities = 449/688 (65%), Positives = 547/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +I  RL   A PIQLPIGAE++FNGIIDL+EE  Y +        +   IP++ K+  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK     +FFPV+CGSAFKNKG+++LLDAV+D+LPSP+DVP  K    D + EV   +SD+ PF  LAFK+ TDP+VG+LTF RVYSGVL SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  ALSKL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +KIVGG +PREYI  V AGLE+A+ +G LAGYP++DIKA L DGS+H+VDSSEMAFKIAAS+ALK A   C+PV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKSV  EII   K
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQLPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELDEEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSPLDVPAIKGTLPDTDEEVERKSSDEEPFSALAFKIMTDPYVGKLTFFRVYSGVLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILESMEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNK 690
>gi|16077180|ref|NP_387993.1| elongation factor G [Bacillus subtilis subsp. subtilis str. 168] >gi|2494250|sp|P80868|EFG_BACSU Elongation factor G (EF-G) (Vegetative protein 19) (VEG19) >gi|1644223|dbj|BAA11003.1| elongation factor G [Bacillus subtilis] >gi|2632379|emb|CAB11888.1| elongation factor G [Bacillus subtilis subsp. subtilis str. 168] (692 aa)
Score = 2418, Expect = 0.0e+00, Identities = 446/688 (64%), Positives = 552/688 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +++ RL   A  IQLPIGAE++F GIIDL+E   YF++     +++ K IP+++K+Q +++R  L+E V   D++LM  YLEG+E++I ++K  IRKG +  +F+PVL GSAFKNKG++L+LDAV+D+LP+P DV   K    D N E+   +SD+ PF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVI +A+EPK+KADQ+KM IAL+KLAEEDPTF+T T+PETGQTII+GMGELHLDI+VDRM+REFKVE NVGAPQV++RETF   ++VEGK+++QSGGRGQ+GHV I FEPN++  GFEF + IVGG +PREYI  VQAGLE+A+ +G LAG+P+IDIKA LFDGS+H+VDS+EMAFK+AAS+ALK A   C+PVLLEPIM +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M   HY E PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQLPIGAEDNFEGIIDLVENVAYFYEDDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELDEELMDKYLEGEELTIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAPTDVAAIKGTRPDTNEEIERHSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKDLVILESMEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKREFKVEANVGAPQVAYRETFRTGAKVEGKFVRQSGGRGQFGHVWIEFEPNEEGAGFEFENAIVGGVVPREYIPAVQAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSNEMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMGDITSRRGRVEGMEARGNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMHMDHYGEVPKSVAEEIIKKNK 690
>gi|196251027|ref|ZP_03149709.1| translation elongation factor G [Geobacillus sp. G11MC16] >gi|196209499|gb|EDY04276.1| translation elongation factor G [Geobacillus sp. G11MC16] (692 aa)
Score = 2418, Expect = 0.0e+00, Identities = 445/688 (64%), Positives = 539/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ERILF++GR+HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGAI VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  +V+++  RL   A P+QLPIGAE+ F GIIDL+E   Y +     +  E   IP+ ++D  ++    L+E VA  D++LM  YLEG+EI+  ++K  IRK  I  +F+PV CGSAFKNKG++LLLD VVD+LPSP+D+P  +    D   EV   A DDAPF  LAFK+ TDP+VG+LTF RVYSG L SGSYV N  K K+ER+ RL++MHA +R EI  + AGDI A +GLK+TTTG+TL D+K  V LE+MQF +PVIS+A+EPK+KADQ+KM  AL KL EEDPTF+  TDPETGQTII+GMGELHLDI+VDRMRREFKVE NVGAPQV++RETF + ++VEGK+I+QSGGRGQYGHV I F PN + KGFEF + IVGG +P+EY+  VQAGLE AM +G LAGYP++DIKA LFDGS+H+VDSSEMAFKIAAS+ALK A   C PVLLEPIM +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PK++ +EII   K
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGSATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAITVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYAVKTLHDRLQANAYPVQLPIGAEDQFTGIIDLVEMCAYHYHDDLGKNIERIEIPEDYRDLAEEYHGKLIEAVAELDEELMMKYLEGEEITKEELKAAIRKATINVEFYPVFCGSAFKNKGVQLLLDGVVDYLPSPLDIPAIRGIIPDTEEEVAREARDDAPFSALAFKIMTDPYVGKLTFFRVYSGTLDSGSYVMNSTKRKRERIGRLLQMHANHRQEISTVYAGDIAAAVGLKETTTGDTLCDEKNLVILESMQFPEPVISVAIEPKSKADQDKMGQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRQSAQVEGKFIRQSGGRGQYGHVWIEFTPNERGKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSSEMAFKIAASMALKNAAAKCEPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRVEGMEARGNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNK 690
>gi|154684630|ref|YP_001419791.1| elongation factor G [Bacillus amyloliquefaciens FZB42] >gi|166201581|sp|A7Z0N4.1|EFG_BACA2 Elongation factor G (EF-G) >gi|154350481|gb|ABS72560.1| FusA [Bacillus amyloliquefaciens FZB42] (692 aa)
Score = 2416, Expect = 0.0e+00, Identities = 442/688 (64%), Positives = 555/688 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F  SV +++ RL   A  IQLPIGAE++F GIIDL+E   YF++     +++ K IP+++K+Q +++R+ L+E VA  D++LM  YLEG+EI+I ++K  IRKG +  +F+PVL GSAFKNKG++L+LDAV+D+LP+P DV   K    D +E ++  +SD+ PF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDT+TG+TL D+K  V LE+M+F +PVI +A+EPK+KADQ+KM IAL+KLAEEDPTF+T T+PETGQTII+GMGELHLDI+VDRM+REFKVE NVGAPQV++RETF   ++VEGK+++QSGGRGQ+GHV I FEPN++  GFEF + IVGG +PREYI  VQAGLE+++ +G LAG+P+IDIKA LFDGS+H+VDS+EMAFK+AAS+ALK A   C+PVLLEPIM +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M   HY E PKS+  EII   K
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQLPIGAEDNFEGIIDLVENVAYFYEDDLGTRSDAKEIPEEYKEQAEELRSSLIEAVAELDEELMEKYLEGEEITIPELKAAIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAPTDVAAIKGVRPDTDEEIVRHSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTSTGDTLCDEKDLVILESMEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKREFKVEANVGAPQVAYRETFRTGAKVEGKFVRQSGGRGQFGHVWIEFEPNEEGAGFEFENAIVGGVVPREYIPAVQAGLEDSLENGVLAGFPLIDIKAKLFDGSYHDVDSNEMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMFMDHYEEVPKSIAEEIIKKNK 690
>gi|138893782|ref|YP_001124235.1| elongation factor G [Geobacillus thermodenitrificans NG80-2] >gi|166201604|sp|A4IJI6.1|EFG_GEOTN Elongation factor G (EF-G) >gi|134265295|gb|ABO65490.1| Translation elongation factor G, EF-G [Geobacillus thermodenitrificans NG80-2] (692 aa)
Score = 2416, Expect = 0.0e+00, Identities = 444/688 (64%), Positives = 539/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ERILF++GR+HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGAI VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  +V+++  RL   A P+QLPIGAE+ F GIIDL+E   Y +     +  E   IP+ ++D  ++    L+E VA  D++LM  YLEG+EI+  ++K  IRK  I  +F+PV CGSAFKNKG++LLLD VVD+LPSP+D+P  +    D   EV   A DDAPF  LAFK+ TDP+VG+LTF RVYSG L SGSYV N  K K+ER+ RL++MHA +R EI  + AGDI A +GLK+TTTG+TL D+K  V LE+MQF +PVIS+A+EPK+KADQ+KM  AL KL EEDPTF+  TDPETGQTII+GMGELHLDI+VDRMRREFKVE NVGAPQV++RETF + ++VEGK+I+QSGGRGQYGHV I F PN + KGFEF + IVGG +P+EY+  VQAGLE AM +G LAGYP++DIKA LFDGS+H+VDSSEMAFKIAAS+ALK A   C PVLLEPIM +EV +PE+Y GD MGDI+SRRG +EG E R N QV++A VP+ EMFGYAT LRS +QGRG + M F HY E PK++ +EII   K
  S:     1 MAREFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGSATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAITVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYAVKTLHDRLQANAYPVQLPIGAEDQFTGIIDLVEMCAYHYHDDLGKNIERIEIPEDYRDLAEEYHGKLIEAVAELDEELMMKYLEGEEITKEELKAAIRKATINVEFYPVFCGSAFKNKGVQLLLDGVVDYLPSPLDIPAIRGIIPDTEEEVAREARDDAPFSALAFKIMTDPYVGKLTFFRVYSGTLDSGSYVMNSTKRKRERIGRLLQMHANHRQEISTVYAGDIAAAVGLKETTTGDTLCDEKNLVILESMQFPEPVISVAIEPKSKADQDKMGQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRQSAQVEGKFIRQSGGRGQYGHVWIEFTPNERGKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSSEMAFKIAASMALKNAAAKCEPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRVEGMEARGNAQVVRAMVPMAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNK 690
>gi|42779188|ref|NP_976435.1| elongation factor G [Bacillus cereus ATCC 10987] >gi|62286484|sp|Q73F99|EFG_BACC1 Elongation factor G (EF-G) >gi|42735103|gb|AAS39043.1| translation elongation factor G [Bacillus cereus ATCC 10987] (692 aa)
Score = 2414, Expect = 0.0e+00, Identities = 447/688 (64%), Positives = 546/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +I  RL   A PIQLPIGAE++FNGIIDL+EE  Y +        +   IP++ K+  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK     +FFPV+CGSAFKNKG+++LLDAV+D+LPSP+DVP  K    D + EV   +SD+ PF  LAFK+ TDP+VG+LTF RVYSGVL SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  AL+KL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +KIVGG +PREYI  V AGLE+A+ +G LAGYP++DIKA L DGS+H+VDSSEMAFKIAAS+ALK A   C+PV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKSV  EII   K
  S:     1 MGREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQLPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELDEEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSPLDVPAIKGIVPDTDEEVERKSSDEEPFSALAFKIMTDPYVGKLTFFRVYSGVLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILESMEFPEPVISVAIEPKSKADQDKMGTALAKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETFRSAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNK 690
>gi|163764745|ref|ZP_02171799.1| Translation elongation factors (GTPase)-like protein [Bacillus selenitireducens MLS10] >gi|160354771|gb|EDP81430.1| Translation elongation factors (GTPase)-like protein [Bacillus selenitireducens MLS10] (692 aa)
Score = 2405, Expect = 0.0e+00, Identities = 441/684 (64%), Positives = 543/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTT +ERILF+SGRIHKIGETHDG S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  S+ +++ RLG  A  +QLPIGAE+DF GIIDLI  + YF+      ++E + IPD++KDQ ++ R  L+E+V+ FD+  M  YLEG+EI+  ++KR IR   +  +F+PV CGSAFKNKG++LLLD V+D+LP+P DV        D   EV+    D+ PF  LAFKVATDPFVG+LTF RVYSG++ +GSYVKN  K K+ER+ R+++MHA +R EI    +GDI A +GLKDT TG+TL  +K ++ LE+M+F  PVISL+VEPK+KADQ+KM +AL+KLAEEDPTFKT TD ETGQTIIAGMGELHLDI+VDRMRREFKV+ NVGAPQVS+RET  + +  EGK+++QSGGRGQYGHV I F PN +  GFEFVD IVGG +PREYI  V+AG+++A+ +G LAGYP++D+KA L+DGS+H+VDS+EMAFK+AAS+ALKEA K C+PVLLEPIM +EV +PE+Y GD MGD++SRRG +EG E R N Q++KA VPL EMFGYAT LRS +QGRGNY M F HY E PKS+  EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTATERILFYSGRIHKIGETHDGGSQMDWMEQEQERGITITSAATTAQWNEHRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGADFIYSLGTLEDRLGANAAAVQLPIGAEDDFEGIIDLINMQAYFYLDDLGTRSEAREIPDEYKDQAEEYRDKLMEKVSEFDEDFMMKYLEGEEITTDELKRAIRAATVSVEFYPVFCGSAFKNKGVQLLLDGVIDYLPAPTDVAAITGIDLDTEEEVVRKPGDNEPFSALAFKVATDPFVGKLTFFRVYSGMVNAGSYVKNSTKGKRERMGRILQMHANHREEIPTCFSGDIAAGVGLKDTGTGDTLCGEKENIILESMEFPDPVISLSVEPKSKADQDKMGMALAKLAEEDPTFKTHTDDETGQTIIAGMGELHLDIIVDRMRREFKVDANVGAPQVSYRETLRQAANCEGKFVRQSGGRGQYGHVWIEFMPNDEGAGFEFVDNIVGGVVPREYIGSVEAGVKDALDNGLLAGYPLVDVKARLYDGSYHDVDSNEMAFKVAASMALKEAKKKCNPVLLEPIMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQIVKAMVPLSEMFGYATSLRSNTQGRGNYSMHFDHYEEVPKSISEEII 686
>gi|169351748|ref|ZP_02868686.1| hypothetical protein CLOSPI_02529 [Clostridium spiroforme DSM 1552] >gi|169291970|gb|EDS74103.1| hypothetical protein CLOSPI_02529 [Clostridium spiroforme DSM 1552] (691 aa)
Score = 2404, Expect = 0.0e+00, Identities = 431/684 (63%), Positives = 545/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ER+L+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+ VLD++ GVEPQTETVWRQA+ Y VPRI+F NKMD TGA+F  S++S+++RLGV  V IQLPIGAE+ F G+IDLI+ K  +F+G K E    K IP+++  Q ++ RA +++  A++DD LM   LE +E +  +IK  IRKGV+  + FPVLCGSA+K+KG++ +LDAV+D+LP+P D+P  K   E+ NE+   ASD+ PF  LAFK+  DPFVG+LTF RVYSG  ++GSYV N  K KKER+ R+++MHA  RNEI  + AGDI A +G K+TTTG+T+ D+K  V LE M+F +PVI LA+EPKTK DQ+K+   L+KLAEEDPTFKT+T+PETG T+IAGMGELHLD++VDR++REFKVE NVGAPQV++RET  + ++ EGKY+KQSGGRGQYGHV I+FEPN+ KGFEFVD IVGG +PREYI  V+ GLE+A+ +G +AGYP++D+KATLFDGS+H+VDSSEMA+K+AASLALK AGK C+PV+LEPIMA+EV  P +Y G  MGD+SSRRG+IEG E+R N   ++A VPL EMFGYATDLRSF+QGRGNY M+F  Y   PKS+  EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERVLYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNGYRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDSKAGVEPQTETVWRQATTYGVPRIVFCNKMDATGADFIMSLESLEKRLGVHGVAIQLPIGAEDTFEGVIDLIKMKAVYFEGDKGENVVYKDIPEEYVAQAQEYRAKMLDSAASYDDDLMMKVLEEEEPTEEEIKAAIRKGVLAVELFPVLCGSAYKDKGVQPMLDAVIDYLPAPTDIPSIKGIDENENEIERHASDEEPFAALAFKIMADPFVGKLTFFRVYSGTAEAGSYVLNSTKGKKERLGRILQMHANKRNEISTVYAGDIAAAVGFKNTTTGDTICDEKNFVILEKMEFPEPVIELAIEPKTKQDQDKLGTGLAKLAEEDPTFKTYTNPETGDTVIAGMGELHLDVIVDRLKREFKVEANVGAPQVAYRETITQAADCEGKYVKQSGGRGQYGHVWIKFEPNEGKGFEFVDAIVGGAVPREYINSVKVGLEDALETGMIAGYPVLDVKATLFDGSYHDVDSSEMAYKVAASLALKAAGKKCAPVILEPIMAVEVVAPAEYLGSVMGDVSSRRGMIEGQEERGNAVSVQASVPLSEMFGYATDLRSFTQGRGNYTMRFDRYEPVPKSIREEII 684
>gi|152973953|ref|YP_001373470.1| elongation factor G [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189027835|sp|A7GK17.1|EFG_BACCN Elongation factor G (EF-G) >gi|152022705|gb|ABS20475.1| translation elongation factor G [Bacillus cereus subsp. cytotoxis NVH 391-98] (692 aa)
Score = 2403, Expect = 0.0e+00, Identities = 444/688 (64%), Positives = 544/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L N RN GIMAHIDAGKTT +ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV ++  RL   A P+QLPIGAE++FNGIIDL+EE  Y +        E   IP++ ++   + R  L+E VA  D++LM  YLEG+EIS  ++K  IRK     +FFPV+CGSAFKNKG++L+LDAV+D+LPSP+DVP  K    D + EV   +SD+ PF  LAFK+ TDP+VG+LTF RVYSG L SGSYVKN  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVIS+A+EPK+KADQ+KM  AL+KL+EEDPTF+  TD ETGQTIIAGMGELHLDI+VDR+RREFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I FEPN++ KGFEF +KIVGG +PREYI  VQAGLE+A+ +G LAGYP+ID+KA L DGS+H+VDSSEMAFKIAAS+ALK A   C+PV+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E P+S+  EII   K
  S:     1 MTREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLHDRLQANAHPLQLPIGAEDEFNGIIDLVEECAYMYANDLGTDIERIEIPEEHQELAAEYRGKLIEAVAELDEELMMKYLEGEEISKEELKAAIRKATTSVEFFPVICGSAFKNKGVQLMLDAVIDYLPSPLDVPAIKGIVPDTDEEVERHSSDEEPFSALAFKIMTDPYVGKLTFFRVYSGTLNSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVILESMEFPEPVISVAIEPKSKADQDKMGTALAKLSEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRLRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEEGKGFEFENKIVGGVVPREYIPAVQAGLEDALQNGVLAGYPVIDVKAALVDGSYHDVDSSEMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVRAMVPLSEMFGYATALRSNTQGRGTFSMVFDHYEEVPRSISEEIIKKNK 690
>gi|124524127|ref|ZP_01697843.1| translation elongation factor G [Bacillus coagulans 36D1] >gi|124495170|gb|EAY42919.1| translation elongation factor G [Bacillus coagulans 36D1] (692 aa)
Score = 2400, Expect = 0.0e+00, Identities = 439/688 (63%), Positives = 540/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L   RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV ++  RL   A P+QLPIGAE++F GIIDLIE    F+      K E + IPD+++DQ ++    L+E VA  D+ +M  YL G+EIS  ++K  IRK     +FFPVLCGSAFKNKG++L+LDAVVD+LP+P DVP  K    D G EV   +SDD PF  LAFKV TDPFVG+LTF RVYSG L +GSYVKN  K+K+ER+ R+++MHA +R EI+++ AGDI A +GLKDTTTG+TL D+   V LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF+  TDPETGQTII GMGELHLDI+VDRM+REFKVE N+GAPQV++RETF K ++V+GK+++QSGGRGQYG V I F PN++ KGFEF + IVGG +PREYI  +QAGLE+AM  G +AGYP++DIKA L+DGS+H+VDSSEMAFK+AASLAL+ A   C PVLLEP+M +E+ +PE+Y GD MG +++RRG +EG E R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKS+  EII   K
  S:     1 MPREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNDHRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVSTLHDRLQANAHPVQLPIGAEDNFVGIIDLIEMNATFYGDDLGTKIEVREIPDEYRDQAEEYHEKLLEAVAEVDEDIMEKYLGGEEISKEELKAAIRKATCNVEFFPVLCGSAFKNKGVQLMLDAVVDYLPAPTDVPSIKGTLPDTGEEVFRHSSDDEPFAALAFKVMTDPFVGKLTFFRVYSGTLSAGSYVKNSTKDKRERIGRILQMHANHRKEIDKVYAGDIAAAVGLKDTTTGDTLCDENNPVILESMEFPEPVIQLSVEPKSKADQDKMTTALQKLQEEDPTFRAHTDPETGQTIIEGMGELHLDIIVDRMKREFKVEANIGAPQVAYRETFRKSAQVQGKFVRQSGGRGQYGDVWIEFSPNEEGKGFEFENAIVGGVVPREYIPAIQAGLEDAMQRGVIAGYPLVDIKAKLYDGSYHDVDSSEMAFKVAASLALRNAASKCDPVLLEPVMKVEIVIPEEYLGDIMGQVTARRGRVEGMEARGNAQVVRAMVPLSEMFGYATALRSSTQGRGVFTMTFDHYEEVPKSIAEEIIKKNK 690
>gi|116874019|ref|YP_850800.1| elongation factor G [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458743|sp|A0ALY9.1|EFG_LISW6 Elongation factor G (EF-G) >gi|116742897|emb|CAK22021.1| fusA [Listeria welshimeri serovar 6b str. SLCC5334] (695 aa)
Score = 2394, Expect = 0.0e+00, Identities = 441/684 (64%), Positives = 536/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F  SV ++ +RL   A PIQLPIGAE+ F GIIDLIE    +++         K IP   KD   + R  LVE VA  D++LM  YLEG+EI+  ++K  IRKG +  +F+PV+CG+AFKNKG++ +LDAV+D+LP+P DVP       DG E    A D  PF  LAFKV TDP+VGRLTF RVYSG L SGSYV+N  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  + LE+M+F +PVI +A+EPK+KADQ+KM  AL+KLAEEDPTF+  TD ETGQT+I+GMGELHLDILVDRMRREF+VE NVG PQVS+RETF K ++VEGK+++QSGGRGQYGHV I F PN++ KGFEF + IVGG +PREYI  VQAGLE A+ +G LAGYP+IDIKA L+DGS+H+VDS+EMAFK+AAS+AL+ A K C PV+LEP+MA+EV +PE+Y GD MG+I+SRRG ++G E R N QV++A VPL  MFGYAT LRS +QGRG Y MQF HY E PKS+  EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFLYSVGTLHERLAANAHPIQLPIGAEDTFEGIIDLIEMNALYYEDDLGNDPHVKEIPADLKDLADEYRGKLVEAVAELDEELMMKYLEGEEITKEELKAGIRKGTLNVEFYPVVCGTAFKNKGVQPMLDAVLDYLPAPTDVPAINGVLPDGEEAARHADDSEPFSSLAFKVMTDPYVGRLTFFRVYSGTLNSGSYVQNSTKGKRERVGRILQMHANHREEISIVYAGDIAAAVGLKDTTTGDTLCDEKEQIILESMEFPEPVIQVAIEPKSKADQDKMGQALAKLAEEDPTFRAETDQETGQTLISGMGELHLDILVDRMRREFRVEANVGDPQVSYRETFRKSAQVEGKFVRQSGGRGQYGHVWIEFGPNEEGKGFEFENAIVGGVVPREYIPAVQAGLEGALDNGVLAGYPLIDIKAKLYDGSYHDVDSNEMAFKVAASMALRNAAKKCDPVILEPMMAVEVVIPEEYLGDIMGNITSRRGRVDGMEARGNAQVVRAFVPLANMFGYATHLRSGTQGRGVYTMQFDHYEEVPKSIAEEII 685
>gi|16804691|ref|NP_466176.1| elongation factor G [Listeria monocytogenes EGD-e] >gi|46908832|ref|YP_015221.1| elongation factor G [Listeria monocytogenes str. 4b F2365] >gi|47092275|ref|ZP_00230066.1| translation elongation factor G [Listeria monocytogenes str. 4b H7858] >gi|153168817|ref|ZP_01928578.1| translation elongation factor G [Listeria monocytogenes FSL N1-017] >gi|153175961|ref|ZP_01931220.1| translation elongation factor G [Listeria monocytogenes FSL N3-165] >gi|153180818|ref|ZP_01933814.1| translation elongation factor G [Listeria monocytogenes F6900] >gi|153185587|ref|ZP_01936137.1| translation elongation factor G [Listeria monocytogenes J0161] >gi|153192412|ref|ZP_01939404.1| translation elongation factor G [Listeria monocytogenes J2818] >gi|153197683|ref|ZP_01941910.1| translation elongation factor G [Listeria monocytogenes 10403S] >gi|153204302|ref|ZP_01945099.1| translation elongation factor G [Listeria monocytogenes HPB2262] >gi|167015746|ref|ZP_02278279.1| elongation factor G [Listeria monocytogenes FSL J1-194] >gi|167213270|ref|ZP_02283577.1| elongation factor G [Listeria monocytogenes LO28] >gi|167215315|ref|ZP_02285622.1| elongation factor G [Listeria monocytogenes FSL R2-503] >gi|167405456|ref|ZP_02310212.1| elongation factor G [Listeria monocytogenes FSL J2-003] >gi|167455116|ref|ZP_02321339.1| elongation factor G [Listeria monocytogenes FSL J2-064] >gi|168266865|ref|ZP_02688830.1| elongation factor G [Listeria monocytogenes FSL J2-071] >gi|21263514|sp|Q8Y421|EFG_LISMO Elongation factor G (EF-G) >gi|62286674|sp|Q71WB8|EFG_LISMF Elongation factor G (EF-G) >gi|16412154|emb|CAD00867.1| fus [Listeria monocytogenes] >gi|46882105|gb|AAT05398.1| translation elongation factor G [Listeria monocytogenes str. 4b F2365] >gi|47019254|gb|EAL09996.1| translation elongation factor G [Listeria monocytogenes str. 4b H7858] >gi|126941723|gb|EBA19602.1| translation elongation factor G [Listeria monocytogenes J0161] >gi|127632856|gb|EBA22290.1| translation elongation factor G [Listeria monocytogenes 10403S] >gi|127763916|gb|EBA24734.1| translation elongation factor G [Listeria monocytogenes J2818] >gi|133726051|gb|EBA27749.1| translation elongation factor G [Listeria monocytogenes FSL N1-017] >gi|133728674|gb|EBA30372.1| translation elongation factor G [Listeria monocytogenes FSL N3-165] >gi|133731765|gb|EBA33463.1| translation elongation factor G [Listeria monocytogenes F6900] >gi|133734082|gb|EBA35780.1| translation elongation factor G [Listeria monocytogenes HPB2262] (695 aa)
Score = 2393, Expect = 0.0e+00, Identities = 441/684 (64%), Positives = 536/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F  SV ++ +RL   A PIQLPIGAE+ F GIIDLIE    +++         K IP   KD   + R  LVE VA  D++LM  YLEG+EI+  ++K  IRKG +  +F+PV+CG+AFKNKG++ +LDAV+D+LP+P DVP       DG E    A D  PF  LAFKV TDP+VGRLTF RVYSG L SGSYV+N  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  + LE+M+F +PVI +A+EPK+KADQ+KM  AL+KLAEEDPTF+  TD ETGQT+I+GMGELHLDILVDRMRREF+VE NVG PQVS+RETF K ++VEGK+++QSGGRGQYGHV I F PN++ KGFEF + IVGG +PREYI  VQAGLE A+ +G LAGYP+IDIKA L+DGS+H+VDS+EMAFK+AAS+AL+ A K C PV+LEP+MA+EV +PE+Y GD MG+I+SRRG ++G E R N QV++A VPL  MFGYAT LRS +QGRG Y MQF HY E PKS+  EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFLYSVGTLHERLAANAHPIQLPIGAEDTFEGIIDLIEMNALYYEDDLGNDPHIKEIPADLKDLADEYRGKLVEAVAELDEELMMKYLEGEEITKEELKAGIRKGTLNVEFYPVVCGTAFKNKGVQPMLDAVLDYLPAPTDVPAINGVLPDGEEAARHADDSEPFSSLAFKVMTDPYVGRLTFFRVYSGTLNSGSYVQNSTKGKRERVGRILQMHANHREEISIVYAGDIAAAVGLKDTTTGDTLCDEKEQIILESMEFPEPVIQVAIEPKSKADQDKMGQALAKLAEEDPTFRAETDQETGQTLISGMGELHLDILVDRMRREFRVEANVGDPQVSYRETFRKSAQVEGKFVRQSGGRGQYGHVWIEFGPNEEGKGFEFENAIVGGVVPREYIPAVQAGLEGALDNGVLAGYPLIDIKAKLYDGSYHDVDSNEMAFKVAASMALRNAAKKCDPVILEPMMAVEVVIPEEYLGDIMGNITSRRGRVDGMEARGNAQVVRAFVPLANMFGYATHLRSGTQGRGVYTMQFDHYEEVPKSIAEEII 685
>gi|16801864|ref|NP_472132.1| elongation factor G [Listeria innocua Clip11262] >gi|21263528|sp|Q927I5|EFG_LISIN Elongation factor G (EF-G) >gi|16415339|emb|CAC98029.1| fus [Listeria innocua] (695 aa)
Score = 2389, Expect = 0.0e+00, Identities = 440/684 (64%), Positives = 536/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F  SV ++ +RL   A PIQLPIGAE+ F GIIDLIE    +++         K IP   KD   + R  LVE VA  D++LM  YLEG+EI+  ++K  IRKG +  +F+PV+CG+AFKNKG++ +LDAV+D+LP+P DVP       DG E    A D  PF  LAFKV TDP+VGRLTF RVYSG L SGSYV+N  K K+ERV R+++MHA +R EI  + AGDI A +GLKDTTTG+TL D+K  + LE+M+F +PVI +A+EPK+KADQ+KM  AL+KLAEEDPTF+  TD ETGQT+I+GMGELHLDILVDRM+REF+VE NVG PQVS+RETF K ++VEGK+++QSGGRGQYGHV I F PN++ KGFEF + IVGG +PREYI  VQAGLE A+ +G LAGYP+IDIKA L+DGS+H+VDS+EMAFK+AAS+AL+ A K C PV+LEP+MA+EV +PE+Y GD MG+I+SRRG ++G E R N QV++A VPL  MFGYAT LRS +QGRG Y MQF HY E PKS+  EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFLYSVGTLHERLAANAHPIQLPIGAEDTFEGIIDLIEMNALYYEDDLGNDPHIKEIPADLKDLADEYRGKLVEAVAELDEELMMKYLEGEEITKEELKAGIRKGTLNVEFYPVVCGTAFKNKGVQPMLDAVLDYLPAPTDVPAINGVLPDGEEAARHADDSEPFSSLAFKVMTDPYVGRLTFFRVYSGTLNSGSYVQNSTKGKRERVGRILQMHANHREEISIVYAGDIAAAVGLKDTTTGDTLCDEKEQIILESMEFPEPVIQVAIEPKSKADQDKMGQALAKLAEEDPTFRAETDQETGQTLISGMGELHLDILVDRMKREFRVEANVGDPQVSYRETFRKSAQVEGKFVRQSGGRGQYGHVWIEFGPNEEGKGFEFENAIVGGVVPREYIPAVQAGLEGALDNGVLAGYPLIDIKAKLYDGSYHDVDSNEMAFKVAASMALRNAAKKCDPVILEPMMAVEVVIPEEYLGDIMGNITSRRGRVDGMEARGNAQVVRAFVPLANMFGYATHLRSGTQGRGVYTMQFDHYEEVPKSIAEEII 685
>gi|89100353|ref|ZP_01173218.1| elongation factor EF-2 [Bacillus sp. NRRL B-14911] >gi|89084974|gb|EAR64110.1| elongation factor EF-2 [Bacillus sp. NRRL B-14911] (692 aa)
Score = 2387, Expect = 0.0e+00, Identities = 439/688 (63%), Positives = 542/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ER+L+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F  S+ ++  RL   A  IQLPIGAE+ F GIIDLIE K  F+        E++ IP+++K Q ++ R  L+E VA  D++LM  YL G+EI+  ++K  IRKG +  +F+PV+CGSAFKNKG++ +LDAV+D+LPSP+DVP  K    D   EV   +SD+ PF  LAFKV TDP+VG+LTF RVYSG L SGSYV+N  K K+ERV R+++MHA +R EI ++ AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVI L++EPK+KADQ+KM+ AL KL EEDPTF+  TD ETGQ IIAGMGELHLDILVDRM+REFKVE NVGAPQV++RETF   ++VEGK+ +QSGGRGQ+GHV I F PN++ KGFEF + IVGG +PREYI  VQAGLE+++  G LAGYP++DIKA LFDGS+H+VDSSEMAFKIAAS+ALK A   C+PV+LEP+M IEV +PE+Y GD MG+++SRRG +EG + R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKS+  EII   K
  S:     1 MAREFSLDNTRNIGIMAHIDAGKTTTTERVLYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKLGADFLYSLGTLHDRLQANAAAIQLPIGAEDQFEGIIDLIEMKATFYGNDLGTDIEDREIPEEYKAQAEEYREKLIEAVAELDEELMEKYLGGEEITNDELKAAIRKGTVNVEFYPVICGSAFKNKGVQKMLDAVIDYLPSPLDVPAIKGTLPDSEEEVTRPSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLSSGSYVQNSTKGKRERVGRILQMHANSREEISQVYAGDIAAAVGLKDTTTGDTLCDEKNLVILESMEFPEPVIQLSIEPKSKADQDKMTTALQKLQEEDPTFRAHTDQETGQVIIAGMGELHLDILVDRMKREFKVEANVGAPQVAYRETFRASAKVEGKFARQSGGRGQFGHVWIEFSPNEEGKGFEFENGIVGGVVPREYIPAVQAGLEDSLDRGVLAGYPLVDIKARLFDGSYHDVDSSEMAFKIAASMALKNAASKCNPVILEPVMRIEVIIPEEYLGDIMGNVTSRRGRVEGMDARGNAQVVRAMVPLSEMFGYATSLRSSTQGRGVFSMHFDHYEEVPKSISEEIIKKNK 690
>gi|15828899|ref|NP_326259.1| elongation factor G [Mycoplasma pulmonis UAB CTIP] >gi|14089842|emb|CAC13601.1| ELONGATION FACTOR G (EF-G) [Mycoplasma pulmonis] (695 aa)
Score = 2383, Expect = 0.0e+00, Identities = 441/684 (64%), Positives = 545/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKI-DVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M+R  DL ++RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG S MD+M QEKERGITITSAAT+  W+   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y+VPRI+FVNKMDK GAN E S++S++ RL   AV IQL +G+E+D+ G IDL+E K + FDG  EE  +E  IP ++ +  +  R+ L+E V++FDD++M   LE +EI +  +K  IRK  +  +FFPV+CG+AFKNKG+K ++DAVVD+LPSP+DVP  K Y ++  EVL++ASD+  F  LAFK+  DPFVG LTF RVYSG+L  GSYV N  K+KKER+ R+++MHA +R EI+E+R GDI A +GLKDTTTG+T+V DK   + LE M F +PVIS A+EP++KA  EK+S+ L KLA EDPTF+TFTD ETGQTIIAGMGELHLDI+VDR+RREF V+V VGAPQVS+RET   +++VEGKYIKQSGG+GQYGHV I FEPN + GFEFVDKIVGG+IP+EYIK +Q GLE  MASG LAGYPMID+KATLFDGS+HEVDSSEMA+KIAAS+AL +A  V   VLLEPIM + V  P++Y+GD +GD+S RRG I   E R D   VIK+ VPL EMFGYATDLRS ++GRG Y M F HY  TP+++ +EII
  S:     4 MSREYDLKDYRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGGSQMDFMAQEKERGITITSAATTAFWRGKRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYKVPRIVFVNKMDKAGANLEESIKSVKTRLNGNAVAIQLNMGSESDYRGHIDLVEMKAWEFDGKPEENGKEIEIPAEYLEAAQIERSKLIEAVSSFDDEVMMLALEEQEIPVDLLKSAIRKATLTSEFFPVVCGTAFKNKGVKAMIDAVVDYLPSPLDVPAIKGYFQE-KEVLVTASDENDFSALAFKIMNDPFVGSLTFFRVYSGILSKGSYVYNTTKDKKERIGRILQMHANSREEIDEVRTGDIAAAVGLKDTTTGDTIVGDKSKHIILEKMVFPEPVISQALEPESKAATEKLSLGLQKLAAEDPTFRTFTDTETGQTIIAGMGELHLDIIVDRLRREFGVQVKVGAPQVSYRETITAKADVEGKYIKQSGGKGQYGHVWITFEPNPNNGFEFVDKIVGGKIPKEYIKTIQKGLEEKMASGILAGYPMIDLKATLFDGSYHEVDSSEMAYKIAASMALTKAKDVVKTVLLEPIMDVSVVFPKEYYGDVVGDLSRRRGQIINDETRSDGASVIKSHVPLSEMFGYATDLRSMTKGRGTYQMHFDHYERTPRNIADEII 688
>gi|21263541|sp|Q98QD8|EFG_MYCPU Elongation factor G (EF-G) (692 aa)
Score = 2382, Expect = 0.0e+00, Identities = 441/684 (64%), Positives = 545/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKI-DVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M+R  DL ++RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG S MD+M QEKERGITITSAAT+  W+   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y+VPRI+FVNKMDK GAN E S++S++ RL   AV IQL +G+E+D+ G IDL+E K + FDG  EE  +E  IP ++ +  +  R+ L+E V++FDD++M   LE +EI +  +K  IRK  +  +FFPV+CG+AFKNKG+K ++DAVVD+LPSP+DVP  K Y ++  EVL++ASD+  F  LAFK+  DPFVG LTF RVYSG+L  GSYV N  K+KKER+ R+++MHA +R EI+E+R GDI A +GLKDTTTG+T+V DK   + LE M F +PVIS A+EP++KA  EK+S+ L KLA EDPTF+TFTD ETGQTIIAGMGELHLDI+VDR+RREF V+V VGAPQVS+RET   +++VEGKYIKQSGG+GQYGHV I FEPN + GFEFVDKIVGG+IP+EYIK +Q GLE  MASG LAGYPMID+KATLFDGS+HEVDSSEMA+KIAAS+AL +A  V   VLLEPIM + V  P++Y+GD +GD+S RRG I   E R D   VIK+ VPL EMFGYATDLRS ++GRG Y M F HY  TP+++ +EII
  S:     1 MSREYDLKDYRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGGSQMDFMAQEKERGITITSAATTAFWRGKRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYKVPRIVFVNKMDKAGANLEESIKSVKTRLNGNAVAIQLNMGSESDYRGHIDLVEMKAWEFDGKPEENGKEIEIPAEYLEAAQIERSKLIEAVSSFDDEVMMLALEEQEIPVDLLKSAIRKATLTSEFFPVVCGTAFKNKGVKAMIDAVVDYLPSPLDVPAIKGYFQE-KEVLVTASDENDFSALAFKIMNDPFVGSLTFFRVYSGILSKGSYVYNTTKDKKERIGRILQMHANSREEIDEVRTGDIAAAVGLKDTTTGDTIVGDKSKHIILEKMVFPEPVISQALEPESKAATEKLSLGLQKLAAEDPTFRTFTDTETGQTIIAGMGELHLDIIVDRLRREFGVQVKVGAPQVSYRETITAKADVEGKYIKQSGGKGQYGHVWITFEPNPNNGFEFVDKIVGGKIPKEYIKTIQKGLEEKMASGILAGYPMIDLKATLFDGSYHEVDSSEMAYKIAASMALTKAKDVVKTVLLEPIMDVSVVFPKEYYGDVVGDLSRRRGQIINDETRSDGASVIKSHVPLSEMFGYATDLRSMTKGRGTYQMHFDHYERTPRNIADEII 685
>gi|56961929|ref|YP_173651.1| elongation factor G [Bacillus clausii KSM-K16] >gi|62286469|sp|Q5WLR5|EFG_BACSK Elongation factor G (EF-G) >gi|56908163|dbj|BAD62690.1| translation elongation factor G [Bacillus clausii KSM-K16] (692 aa)
Score = 2380, Expect = 0.0e+00, Identities = 439/684 (64%), Positives = 540/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVP--QAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L + RN GIMAHIDAGKTTT+ERILF++GR+HKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+F+NKMDKTGA+F  SV +++ RL   A PIQLPIGAE+DF G +DLIE + +       +  E   +P  +KD+ + +R  LVE VA  D+ LM  YLEG+E++  ++K  IRKG    +F+PV+CG+AFKNKG++ LLDAV+D+LPSP+DV   + +  G D  EV     DD PF  LAFKV TDPFVG+LTF RVYSG L SGSYV+N  K+K+ER+ R+++MHA +R EI  + +GDI A +GLKDTTTG+TL D+K  V LE+M+F +PVI L+VEPK+KADQ+KM IAL+KLAEEDPTFKTFTD ETG+T+I GMGELHLDI+VDR+RREFKVE NVGAPQVS+RET    ++VEGK+++QSGGRGQ+GHV + F PN++  GFEF + IVGG +PREYI  VQAG+E A+ +G +AGYP+IDIKA L+DGS+H+VDSSEMAFKIAAS+ALK A   C PVLLEPI  +E+ VPE+Y GD MGD+++RRG +EG E R N QV+KA VPL EMFGYAT LRS +QGRG Y M F HY E PKS+  EII
  S:     1 MAREFSLKDTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFINKMDKTGADFMYSVSTLRDRLQANAHPIQLPIGAEDDFVGFVDLIEMQAHISKDDLGQDWEVTEVPADYKDEAESLRESLVEAVAELDEDLMMKYLEGEELTKDELKAAIRKGTCNVEFYPVVCGTAFKNKGVQALLDAVLDYLPSPLDVAAIRGQVPGTD-EEVTREPGDDQPFAALAFKVMTDPFVGKLTFFRVYSGTLNSGSYVRNATKDKRERIGRILQMHANSREEISTVYSGDIAAAVGLKDTTTGDTLCDEKNLVILESMEFPEPVIHLSVEPKSKADQDKMGIALAKLAEEDPTFKTFTDEETGETVIGGMGELHLDIIVDRLRREFKVEANVGAPQVSYRETIRTAAQVEGKFVRQSGGRGQFGHVWVEFSPNEEGAGFEFENAIVGGVVPREYIPSVQAGIEEALQNGMIAGYPVIDIKAKLYDGSYHDVDSSEMAFKIAASMALKNAKSKCDPVLLEPISKVEIVVPEEYMGDIMGDVTARRGRVEGMEARGNAQVVKAFVPLAEMFGYATSLRSRTQGRGTYSMVFDHYEEVPKSIAEEII 686
>gi|167465343|ref|ZP_02330432.1| translation elongation factor G [Paenibacillus larvae subsp. larvae BRL-230010] (691 aa)
Score = 2369, Expect = 0.0e+00, Identities = 430/688 (62%), Positives = 545/688 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L + RN GIMAHIDAGKTTT+ERILF++GR HKIGE H+G + MDWMEQE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+ETVWRQA +Y VPRI +VNKMD  GA++   V+S+ ++LG  AV IQLPIGAENDF GIIDLIE+K Y +  D GKE   E   +P +F D+V+++R  L+E+VA  D+ L   YLEG+EI++ ++K+ +RKGV   + FPV+CGS+++NKG++L+LDAV+D+LPSPVDVP  K   EDG E +  +SDD PF  LAFK+ TDP+VG+LTF RVYSG+L+SGSYV N  K K+ER+ R+++MHA +R EI E+ +GDI A +GLKDT TG+TL D+K  V LE+M F  PVI +AVEPKTKADQ+K+ +AL+KL EEDPT +  T+ ETGQTI++GMGELHLDI+VDR+RREFKV+ NVG PQV++RETF   ++VEGK+++QSGGRGQYGH  + FEP     GF+F  KIVGG IPREYI P+QAG+E +M +G LAGYP++DIKAT+ DGS+H+VDSSEMAFKIA S+ALK A   C PV+LEP+M +EVTVPE+Y GD MGD++SRRG IEG + R   Q+I+AKVPL EMFGY+T LRS +QGRG + M+ SHY E PKS+ +EII+  K
  S:     1 MKREFSLKDTRNIGIMAHIDAGKTTTTERILFYTGRTHKIGEVHEGAATMDWMEQEQERGITITSAATTAQWKNHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFSAKEGVEPQSETVWRQADKYGVPRIAYVNKMDIIGADYLAVVESMHEKLGANAVAIQLPIGAENDFRGIIDLIEQKAYMYKDDLGKE--MEIIDVPAEFADKVEELRMELIEKVAELDEDLTMKYLEGEEITVDELKKALRKGVCEVKIFPVVCGSSYRNKGVQLMLDAVIDYLPSPVDVPDIKGQLEDGTETVRKSSDDEPFAALAFKIMTDPYVGKLTFFRVYSGILQSGSYVLNATKGKRERIGRILQMHANSRQEISEVFSGDIAAAVGLKDTGTGDTLCDEKNPVILESMNFPDPVIDIAVEPKTKADQDKLGVALAKLTEEDPTLRAKTNEETGQTILSGMGELHLDIIVDRLRREFKVDTNVGKPQVAYRETFRASAKVEGKFVRQSGGRGQYGHCWVEFEPLEPGTGFQFESKIVGGAIPREYIAPIQAGIEESMQNGVLAGYPVVDIKATVVDGSYHDVDSSEMAFKIAGSMALKAAKDKCQPVILEPMMKVEVTVPEEYMGDVMGDLNSRRGRIEGMDNRAGAQIIRAKVPLSEMFGYSTTLRSRTQGRGVFSMELSHYEEVPKSIADEIISKNK 689
>gi|192813597|ref|ZP_03042257.1| translation elongation factor G [Geobacillus sp. Y412MC10] >gi|192797572|gb|EDV74092.1| translation elongation factor G [Geobacillus sp. Y412MC10] (693 aa)
Score = 2365, Expect = 0.0e+00, Identities = 430/686 (62%), Positives = 537/686 (78%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           R   L N RN GIMAHIDAGKTTT+ERILF++GR HKIGE H+G + MDWMEQE+ERGITITSAAT+ SWK   +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+ETVWRQA RY VPRI +VNKMD  GA++   V+ +++RL   AV IQLPIGAENDF GIID+IEEK Y +     +  EE  IP +FKDQV+++R  LVE+VA  D+ L   YLEG+EI+IA++K  +RKGV+  + FPV+CGS+++NKG++L+LDAV+D+LP+P DVP  K   EDG E +  +SD+ PF  LAFK+ATDP+VG+LTF RVYSGVL+SGSYV N  K K+ER+ R+++MHA +R EI E+ AGDI A +GLKDT TG+TL D+K  V LE+M F  PVI +AVEPKTKADQ+KM +AL KL EEDPT +  TD ETGQTI+AGMGELHLDI++DRMRREFKVE NVG PQV++RETF   + VEGK+++QSGGRGQYGHV + FEP     G +F  K+VGG +PREYI P Q G+E  M +G LAG+P++D+KAT+ DGS+H+VDS+EMAFKIA S+ALK A   C PVLLEPIM +EVTVPE+Y GD MG ++SRRG IEG + R   Q+I+AKVPL EMFGY+T LRS +QGRG + M+ SHY E PK++ +EI++  K
  S:     4 REFSLKNTRNIGIMAHIDAGKTTTTERILFYTGRTHKIGEVHEGAATMDWMEQEQERGITITSAATTASWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVGVFSAKEGVEPQSETVWRQADRYGVPRIAYVNKMDIIGADYLNVVKDMRERLQANAVAIQLPIGAENDFVGIIDIIEEKAYMYKDDLGQNIEETEIPAEFKDQVEELRNELVEKVAELDEDLTMKYLEGEEITIAELKAALRKGVVEVKIFPVICGSSYRNKGVQLMLDAVIDYLPAPTDVPDIKGTLEDGTEAIRHSSDEEPFSALAFKIATDPYVGKLTFFRVYSGVLQSGSYVLNATKGKRERIGRILQMHANSRQEISEVFAGDIAAAVGLKDTGTGDTLCDEKNPVILESMNFPDPVIEIAVEPKTKADQDKMGVALGKLTEEDPTLRAHTDEETGQTILAGMGELHLDIIIDRMRREFKVETNVGKPQVAYRETFRAPARVEGKFVRQSGGRGQYGHVWVEFEPLEPGSGNQFDSKVVGGSVPREYIGPAQQGIEEQMKNGVLAGFPLVDVKATIVDGSYHDVDSNEMAFKIAGSMALKAAKDKCKPVLLEPIMKVEVTVPEEYMGDVMGMLNSRRGRIEGMDSRGGTQIIRAKVPLSEMFGYSTTLRSGTQGRGVFSMELSHYEEVPKNISDEIVSKIK 690
>gi|23097571|ref|NP_691037.1| elongation factor G [Oceanobacillus iheyensis HTE831] >gi|34395602|sp|Q8ETY5|EFG_OCEIH Elongation factor G (EF-G) >gi|22775794|dbj|BAC12072.1| translation elongation factor EF-G [Oceanobacillus iheyensis HTE831] (692 aa)
Score = 2364, Expect = 0.0e+00, Identities = 442/684 (64%), Positives = 553/684 (80%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+ +W++  +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F+NKMDKTGA+F  S  ++++RLG  A PIQ+PIGAE++F+GIIDLI    YF+     +++E + IP ++KD+ +++RA L+E VA  D++LM  YLEG+EIS  ++K  IR+  +   F+PVLCGSAFKNKG++L+LDAV+D+LP+P DVP  +       E V   +SDD PF  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K+K+ERV R+++MHA +R EI    +G+I A +GLKDT+TG+TL D+K  V LE+M F +PVIS+A+EP+TKADQ+KM+IALSKLAEEDPTF+T T+PETGQTII+GMGELHLDI+VDR++REFKV   VGAPQVS+RETF   +EVEGK+++QSGGRGQ+GHV ++FEPN++  GFEF +KIVGG +PREYI  VQ G++ +M +G LAGYP+IDIKATL+DGS+H+VDS+EMAFK+AAS+ALK A   C PVLLEP+M +EV VPE+Y GD MGD++SRRG +EG E R   QV+KA VPL EMFGYAT LRS +QGRG Y M F HY ETPKS+  EII
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAAWRDHRINIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFINKMDKTGADFLYSTGTLKERLGANAHPIQMPIGAEDEFHGIIDLITMDAYFYLDDLGQRSETREIPAEYKDEAEELRASLIEAVAETDEELMMKYLEGEEISNDELKTAIRQATLNVDFYPVLCGSAFKNKGVQLMLDAVLDYLPAPTDVPPIEGIIPGTEEKVTRPSSDDEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSVKDKRERVGRILQMHANSREEISRAYSGEIAAAVGLKDTSTGDTLCDEKNLVILESMDFPEPVISVAIEPETKADQDKMAIALSKLAEEDPTFRTETNPETGQTIISGMGELHLDIIVDRLKREFKVGAQVGAPQVSYRETFRGSAEVEGKFVRQSGGRGQFGHVWVKFEPNEEGAGFEFENKIVGGVVPREYIPAVQQGIQESMENGVLAGYPLIDIKATLYDGSYHDVDSNEMAFKVAASMALKAAKNKCKPVLLEPMMRVEVVVPEEYMGDIMGDVTSRRGRVEGMEARGTAQVVKAFVPLSEMFGYATALRSNTQGRGVYTMHFDHYEETPKSITEEII 686
>gi|71894071|ref|YP_278179.1| elongation factor G [Mycoplasma synoviae 53] >gi|90110700|sp|Q4A703|EFG_MYCS5 Elongation factor G (EF-G) >gi|71850859|gb|AAZ43468.1| elongation factor EF-G [Mycoplasma synoviae 53] (696 aa)
Score = 2359, Expect = 0.0e+00, Identities = 438/684 (64%), Positives = 538/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKI-DVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR  DL ++RN GIMAHIDAGKTTT+ERIL+H+G+IHKIGETHDG S MDWMEQEKERGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y+VPRI++VNKMDK GA+FE +V S++ RLG  AV IQ PIG+E++FNGIIDL+      ++G   E+     IP    D  K  R  L+E  ANFD+++M   LEG ++ I   K  IRK  +  +FFPV+CG++FKNKG+K ++DAVVD+LPSP+D+P  KAY  D  E  + A+DD  F  LAFKV TDPFVG LTF RVY GVL+ GSYV N  K +KER+ R+++MHA NR EI+E RAGDI A +GLK TTTG+TLV +K   V LE M F +PVIS A+EP++KA  EK+S+ L KL+ EDPTF+T+TD ETGQTII+GMGELHLDI+VDR++REF V+V VGAPQVS+RET  K +EVEGK+IKQSGG+GQYGHV ++FEPN D+GFEF+DKIVGG+IP+EYIKP+Q GLE  MA G LAGYPMID+KATLFDGS+H+VDSSE+A+KIAAS AL +A  +   VLLEPIM + V VP  + GD +GD+S RRGLI   EQR D   +++AKVPL EMFGY+T+LRS + GRG Y MQF HY + PK++ +EII
  S:     1 MARDYDLKDYRNIGIMAHIDAGKTTTTERILYHTGKIHKIGETHDGVSQMDWMEQEKERGITITSAATTAYWKNKRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYKVPRIVYVNKMDKAGADFEAAVASVKSRLGGNAVAIQWPIGSESNFNGIIDLVTMTATTYNGESAEEEFPMEIPTDLLDVAKAKRQELLEAAANFDEEVMMMVLEGADVDIDTFKNTIRKATLTSEFFPVVCGTSFKNKGVKKMIDAVVDYLPSPLDIPPIKAYLND-QETDVVATDDGEFAALAFKVMTDPFVGSLTFFRVYRGVLEKGSYVYNSTKEQKERIGRILQMHANNRVEIDECRAGDIAAAVGLKFTTTGDTLVGEKSPKVVLEKMVFPEPVISQALEPESKAANEKLSLGLQKLSAEDPTFRTYTDEETGQTIISGMGELHLDIIVDRLKREFGVKVKVGAPQVSYRETITKSAEVEGKHIKQSGGKGQYGHVWLKFEPNHDQGFEFIDKIVGGKIPKEYIKPIQKGLEEKMAVGILAGYPMIDVKATLFDGSYHDVDSSELAYKIAASKALTKAKDLIGTVLLEPIMDVSVVVPSDHMGDVIGDLSRRRGLISDQEQRNDGAVIVRAKVPLSEMFGYSTELRSMTSGRGTYQMQFDHYEKCPKNISDEII 685
>gi|148377855|ref|YP_001256731.1| elongation factor G [Mycoplasma agalactiae PG2] >gi|148291901|emb|CAL59292.1| Elongation factor G [Mycoplasma agalactiae PG2] (697 aa)
Score = 2357, Expect = 0.0e+00, Identities = 432/684 (63%), Positives = 540/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKI-DVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L ++RN GIMAHIDAGKTTT+ERIL H+G+IHKIGETHDG S MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPR+I+VNKMDK GA+F  SV+S++ RL   AV IQ+PIG E+DF GI+DL+E K Y +DG  EE A+E  IP   +   K+ R  L+E VA +D++ M   L+G E ++ ++K  IRK  +  +FFP +CG++FKNKG+K ++DAVVD+LPSP+D+P AKA+  +  EV + A+DD PF GLAFKV TDPFVG LTF+R+Y+G L+ GSYV N  K  KER+ RL+ MHA +R+EI+E  AGDI A +GLK TTTG+TL+ +K  ++ LE M F +PVIS A+EP++K   EK+++ L KLA EDPTF+T+TD ETGQTIIAGMGELHLDI+VDR++RE  V+  VGAPQVS+RET  K ++VEGK+IKQSGG+GQYGHV I+FEPN DKGFEFVDKIVGG+IP+EYIKP+Q GLE+ MASG LAGYPMIDIKATLFDGS+H+VDSSE+A+KIAAS AL +A  +   VLLEPIM + V +P+ Y+GD MGDI+ RRG I+ +E R D   +++   PL EMFGYATDLRS + GRGNY MQF HY + PK++ +EII
  S:     1 MARQHKLEDYRNIGIMAHIDAGKTTTTERILLHTGKIHKIGETHDGASQMDWMAQEQERGITITSAATTAFWKGKRINIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYRVPRLIYVNKMDKAGADFFASVKSVKTRLNANAVAIQIPIGQESDFKGIVDLVEMKAYEYDGKPEENAKEIEIPFDLQALAKEKRQELIEAVATYDEEFMMKVLDGVEPTLDELKAMIRKATLTSEFFPAVCGTSFKNKGVKKMIDAVVDYLPSPLDIPAAKAHKGENEEVDVPATDDYPFTGLAFKVMTDPFVGSLTFIRLYAGTLQKGSYVYNSTKGTKERIGRLILMHANSRSEIDEANAGDIVAAVGLKGTTTGDTLIAEKAPEIVLERMVFPEPVISQALEPESKDAMEKLALGLQKLAAEDPTFRTYTDEETGQTIIAGMGELHLDIIVDRLKREHGVKAKVGAPQVSYRETITKSADVEGKHIKQSGGKGQYGHVWIKFEPNPDKGFEFVDKIVGGKIPKEYIKPIQKGLEDKMASGILAGYPMIDIKATLFDGSYHDVDSSELAYKIAASKALTKAKDLVGTVLLEPIMDVSVIIPDDYYGDVMGDITRRRGQIQESELRNDGDHILRCLTPLSEMFGYATDLRSMTAGRGNYQMQFHHYEKCPKNIADEII 686
>gi|112456144|gb|ABI19005.1| translation elongation factor G [Staphylococcus lugdunensis] (693 aa)
Score = 2355, Expect = 0.0e+00, Identities = 435/688 (63%), Positives = 533/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG--NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANF+ SV ++  RL   A PIQLPIGAE+DF  IIDL+E K + ++     + EE  IPD  K++ ++ RA L+E VA   D+LM  YL  +EI++ ++K  IR+     +F+PVLCG+AFKNKG++L+LDAV+D+LPSP+DV     +  +    EV+  A DDA F  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K K+ERV RL++MHA +R EI  + +GDI A +GLKDT TG+TL  +K D+ LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF   TD ETGQ II GMGELHLDILVDRM++EF VE NVGAP VS+RETF K ++V+GK+ +QSGGRGQYG V I F PN+   GFEF + IVGG +PREYI  V+AGL++AM +G LAGYP+ID+KA LFDGS+H+VDSSEMAFKIAASLALKEA K C PV+LEP+M + + +PE+Y GD MGD+++RRG ++G E R N QV+ A VPL EMFGYAT LRS +QGRG Y M F HYAE PKS+  EII   K
  S:     1 MARDFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAQWNGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFDYSVSTLHDRLQANAQPIQLPIGAEDDFEAIIDLVEMKCFKYNNDLGTEIEEIEIPDSHKEKAEEARATLIEAVAETSDELMEKYLGDEEITVPELKEAIREATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRSENPDEEVIAKADDDAEFAALAFKVMTDPYVGKLTFFRVYSGTLSSGSYVKNSTKGKRERVGRLLQMHANSRQEISTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTTALVKLQEEDPTFHAHTDDETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKKAAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLFDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTARRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSISEEIIKKNK 691
>gi|47459202|ref|YP_016064.1| elongation factor G [Mycoplasma mobile 163K] >gi|62286668|sp|Q6KHS5|EFG_MYCMO Elongation factor G (EF-G) >gi|47458531|gb|AAT27853.1| elongation factor G [Mycoplasma mobile 163K] (694 aa)
Score = 2354, Expect = 0.0e+00, Identities = 437/684 (63%), Positives = 538/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDV-QLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR  +L ++RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y+VPRI+FVNKMDK GANF+ +V+S++ RLG  AVPIQ  IGAE++F G IDL+  + + FDG  EE  ++  IP       K+ R  L++ VAN+++ +M   LEG+++    +K+ IRK  +  +FFP +CGSAFKNKG+K ++DAV+D+LPSP+DVP  +A+ GE  N + +  SDD  F  LAFKV TDP+VG LTF RVYSG+L  GSYV N  K KKER+ R+++MHA +R EIEE+R GDI A +GLKDTTTG+TL+ +K  +  LE M F +PVIS A+EP TKA  EK+S+ L KL+ EDPTFKT+T+ ETGQTIIAGMGELHLDI+VDR+RREF VEVNVGAPQVS+RET    +E+EGK+IKQSGG+GQYGHV I+FEPN DKGFEFVDKIVGG+IP+EYIK VQ GLE  M  G LAGYP+ID+KATLFDGS+H+VDSSE+A+KIAAS AL +        LLEPIM ++V +PE YFGD MGD+S RRG I+ T+ R D    IKA VPL EMFGYATDLRS + GRGNY M F+HY + PK++ +EII
  S:     4 MAREFELKDYRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMPQEQERGITITSAATTAFWKGKRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYKVPRIVFVNKMDKAGANFDEAVKSVRTRLGGNAVPIQWNIGAESEFQGFIDLVNMEAWIFDGKAEENGQKIAIPTNLVKIAKEKRQELIDAVANYEEDIMMLALEGQDVDNETLKKAIRKATLTSEFFPAVCGSAFKNKGVKAMIDAVIDYLPSPLDVPAIEAHQGE--NIITVKPSDDGDFSALAFKVMTDPYVGTLTFFRVYSGILNKGSYVINSTKEKKERIGRILQMHANSRTEIEEVRTGDIAAAVGLKDTTTGDTLIGEKAKMFILEKMIFPEPVISQALEPATKAATEKLSLGLQKLSGEDPTFKTYTNEETGQTIIAGMGELHLDIIVDRLRREFGVEVNVGAPQVSYRETITATAEIEGKHIKQSGGKGQYGHVWIKFEPNHDKGFEFVDKIVGGKIPKEYIKHVQKGLEEKMEIGILAGYPLIDVKATLFDGSYHDVDSSELAYKIAASKALTDGKSKLGATLLEPIMNVDVVIPEDYFGDIMGDLSRRRGQIKETKTRSDGASTIKANVPLSEMFGYATDLRSMTAGRGNYQMIFNHYEKAPKNISDEII 688
>gi|169830041|ref|YP_001700199.1| elongation factor G (EF-G) [Lysinibacillus sphaericus C3-41] >gi|168994529|gb|ACA42069.1| Elongation factor G (EF-G) [Lysinibacillus sphaericus C3-41] (692 aa)
Score = 2353, Expect = 0.0e+00, Identities = 436/688 (63%), Positives = 540/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL-ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L N RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F+NKMDKTGA+F  SV ++  RL   A PIQLPIGAE+ F+ IIDL+E K  F+   K     E  IP++++ Q ++ R  L++ VA+ D+ +M  YLEG+EI++A++K  IR+  I  +F+PV+CG+AFK+KG++ +L+AV+D+LPSPVDVP  K    DG+E L   +SDD PF  LAFKV TDPFVG+LTF RVYSG L SGSYV+N  K K+ERV R+++MHA +R EI ++ AGDI A +GLKDTTTG+TL D+K  V LE+M+F +PVISL+VEPK+KADQ+KM  AL KL EEDPTF+  TD ETGQTII+GMGELHLDILVDRMRREFKVE NVGAP VS+RETF   ++V+GK+ +QSGGRGQYG V I F PN++ KGFEF + IVGG IPREYI  V+AGL +++  G +AGYP+IDIKA L  GS+H+VDS+EMAFKIAAS+ALKEA K C  V+LEP+M +EV +PE+Y GD MG+I+SRRG +EG + R N QV++A VPL EMFGYAT LRS +QGRG + M F HY E PKS+  EII   K
  S:     1 MKREFSLENTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWAGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFINKMDKTGADFLYSVGTLHDRLQANAHPIQLPIGAEDQFSAIIDLVEMKATFYGDEKGTAVTEGEIPEEYRAQAEEYREKLIDAVASVDEDIMEKYLEGEEITVAELKAAIRRATIAVEFYPVICGTAFKHKGVRPMLNAVIDYLPSPVDVPAIKGTSVDGDEELERKSSDDEPFSALAFKVMTDPFVGKLTFFRVYSGTLDSGSYVQNSSKGKRERVGRILQMHANSREEISKVFAGDIAAAVGLKDTTTGDTLCDEKNLVILESMEFPEPVISLSVEPKSKADQDKMGQALQKLQEEDPTFRAHTDTETGQTIISGMGELHLDILVDRMRREFKVEANVGAPMVSYRETFRSSAKVQGKFTRQSGGRGQYGDVTIEFSPNEEGKGFEFENAIVGGVIPREYIPAVEAGLRDSLDRGVVAGYPLIDIKAKLVFGSYHDVDSNEMAFKIAASMALKEASKQCDAVILEPMMKVEVVIPEEYLGDIMGNITSRRGRVEGMDARGNSQVVRAMVPLAEMFGYATTLRSATQGRGVFSMTFDHYEEVPKSIAAEIIKKNK 690
>gi|54020328|ref|YP_115597.1| elongation factor G [Mycoplasma hyopneumoniae 232] >gi|62286660|sp|Q601W8|EFG_MYCH2 Elongation factor G (EF-G) >gi|148840405|sp|Q4A8T7|EFG_MYCH7 Elongation factor G (EF-G) >gi|148840406|sp|Q4AAQ6|EFG_MYCHJ Elongation factor G (EF-G) >gi|53987501|gb|AAV27702.1| GTP-binding protein chain elongation factor ef-g [Mycoplasma hyopneumoniae 232] >gi|144227452|gb|AAZ44165.2| elongation factor EF-G [Mycoplasma hyopneumoniae J] >gi|144575268|gb|AAZ53452.2| elongation factor EF-G [Mycoplasma hyopneumoniae 7448] (694 aa)
Score = 2348, Expect = 0.0e+00, Identities = 439/684 (64%), Positives = 532/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDV-QLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR  +L ++RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWMEQEKERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI++VNKMDK GANFE S++S++ +L   AV IQL IGAE DF+G+IDL+E K Y +DG KEE   E PIP+   ++  QMR  L E VA++D+++  + LE KEI    +K  IR   I   FFPV+CGS+FKNKG+K ++DAV+D+LPSPVDVP  KA+  D  E+ I ASDD  F  LAFK+  DPFVG LTF RVYSGVLK G+Y+ N  K KKERV R++ MHA +R EI+E+R GDI A +GLKDTTTG++L+ +K     LE M F +PVIS ++EP +KA+ EK++ AL KLA EDPTFKT+TD ETGQTIIAGMGELHLDI+VDR++REF V+  VG PQVS+RET  K +EVEGKYIKQSGGRGQYGHV I+FEPN ++GF+F+DKIVGG+IP+EYIK +Q GLE  M +G LAGYP+I+++ATLFDGSFHEVDSSEMAFKIAAS AL  A      VLLEPIM + V  P +Y GD MGD+S RRGL+   E R D   VI+  VPL EMFGY+T LRS + GRG Y MQF+HY   PK++ + I+
  S:     1 MARKFELKDYRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGVSQMDWMEQEKERGITITSAATTAFWKGKRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYSVPRIVYVNKMDKAGANFEASIESVRTKLNGNAVAIQLNIGAEADFSGLIDLVEMKAYNYDGQKEEIEYEIPIPEDLFEKASQMRLALAEAVADYDEEIFNNLLEEKEILPEQLKAAIRAATITGNFFPVVCGSSFKNKGVKKMIDAVIDYLPSPVDVPPIKAF-RDEEEITIEASDDQEFSALAFKIMNDPFVGSLTFFRVYSGVLKKGTYIINSTKGKKERVGRILAMHANSREEIDEVRTGDIGAFVGLKDTTTGDSLISEKAKTFVLERMNFPEPVISQSLEPFSKAEIEKLATALQKLANEDPTFKTWTDIETGQTIIAGMGELHLDIIVDRLKREFNVQARVGKPQVSYRETITKSAEVEGKYIKQSGGRGQYGHVWIKFEPNPEEGFDFIDKIVGGKIPKEYIKSIQKGLEEKMQAGILAGYPLINLRATLFDGSFHEVDSSEMAFKIAASKALSRARDAVGTVLLEPIMDVSVFAPSEYAGDVMGDLSRRRGLVREQETRSDGANVIRGHVPLAEMFGYSTQLRSMTSGRGTYQMQFNHYEIVPKNISDVIV 685
>gi|71893430|ref|YP_278876.1| elongation factor G [Mycoplasma hyopneumoniae J] >gi|72080417|ref|YP_287475.1| elongation factor G [Mycoplasma hyopneumoniae 7448] (695 aa)
Score = 2348, Expect = 0.0e+00, Identities = 439/684 (64%), Positives = 532/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDV-QLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR  +L ++RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWMEQEKERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI++VNKMDK GANFE S++S++ +L   AV IQL IGAE DF+G+IDL+E K Y +DG KEE   E PIP+   ++  QMR  L E VA++D+++  + LE KEI    +K  IR   I   FFPV+CGS+FKNKG+K ++DAV+D+LPSPVDVP  KA+  D  E+ I ASDD  F  LAFK+  DPFVG LTF RVYSGVLK G+Y+ N  K KKERV R++ MHA +R EI+E+R GDI A +GLKDTTTG++L+ +K     LE M F +PVIS ++EP +KA+ EK++ AL KLA EDPTFKT+TD ETGQTIIAGMGELHLDI+VDR++REF V+  VG PQVS+RET  K +EVEGKYIKQSGGRGQYGHV I+FEPN ++GF+F+DKIVGG+IP+EYIK +Q GLE  M +G LAGYP+I+++ATLFDGSFHEVDSSEMAFKIAAS AL  A      VLLEPIM + V  P +Y GD MGD+S RRGL+   E R D   VI+  VPL EMFGY+T LRS + GRG Y MQF+HY   PK++ + I+
  S:     2 MARKFELKDYRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGVSQMDWMEQEKERGITITSAATTAFWKGKRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYSVPRIVYVNKMDKAGANFEASIESVRTKLNGNAVAIQLNIGAEADFSGLIDLVEMKAYNYDGQKEEIEYEIPIPEDLFEKASQMRLALAEAVADYDEEIFNNLLEEKEILPEQLKAAIRAATITGNFFPVVCGSSFKNKGVKKMIDAVIDYLPSPVDVPPIKAF-RDEEEITIEASDDQEFSALAFKIMNDPFVGSLTFFRVYSGVLKKGTYIINSTKGKKERVGRILAMHANSREEIDEVRTGDIGAFVGLKDTTTGDSLISEKAKTFVLERMNFPEPVISQSLEPFSKAEIEKLATALQKLANEDPTFKTWTDIETGQTIIAGMGELHLDIIVDRLKREFNVQARVGKPQVSYRETITKSAEVEGKYIKQSGGRGQYGHVWIKFEPNPEEGFDFIDKIVGGKIPKEYIKSIQKGLEEKMQAGILAGYPLINLRATLFDGSFHEVDSSEMAFKIAASKALSRARDAVGTVLLEPIMDVSVFAPSEYAGDVMGDLSRRRGLVREQETRSDGANVIRGHVPLAEMFGYSTQLRSMTSGRGTYQMQFNHYEIVPKNISDVIV 686
>gi|193216663|ref|YP_001999905.1| translation elongation factor G (EF-G) [Mycoplasma arthritidis 158L3-1] >gi|193001986|gb|ACF07201.1| translation elongation factor G (EF-G) [Mycoplasma arthritidis 158L3-1] (697 aa)
Score = 2342, Expect = 0.0e+00, Identities = 433/684 (63%), Positives = 535/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKI-DVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L ++RN GIMAHIDAGKTTT+ER+LFH+G+IHKIGETH+GES MDWM QE+ERGITITSAAT+  W    LN+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI++VNKMDK GANF+ S +S+++ LG  A PIQL IG E  F GIIDL+E K Y FDG  EE  +E PIP    D+   MR+ L+E VA+FD+++M   LE KE+SI  IK  IRK  +   +FPV+CG++FKNKG+KL+L+A+VD+LPSP+D+P  KAY  +G E+ I ASDD  F  LAFKV  DP+VG LTF RVYSG+L  G+Y+ N  K +KER+ R++ MHA +R +I+E+R GDI A +GLK TTTG+TL+D+K  D+ LE M F +PVIS A+EP +K   EK+S+AL +LA EDPTFK +TD ETGQTIIAGMGELHLDI+VDR++REFKV  NVGAPQVS+RET  K +EVEG + KQSGG+GQYGHV I++EPN DKGFEFVDKIVGG+IP+EYIK ++ GL+  M  G LAGYP+ID+KATLFDGS+HEVDSSE+A+KIAAS +L +  ++   VLLEPIM + V +PE +FGD MGDIS RRG +   E R D   VIKA +PL EMFGYAT+LRS + GRG Y M F HY + P+++ +EII
  S:     1 MAREYKLEDYRNIGIMAHIDAGKTTTTERVLFHTGKIHKIGETHEGESQMDWMVQEQERGITITSAATTAYWGGKRLNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATNYNVPRIVYVNKMDKAGANFKASTESLRKLLGANAHPIQLNIGEEAQFTGIIDLVEMKAYEFDGKPEENMKEIPIPAHLLDEATLMRSSLIESVADFDEEIMEALLEEKEVSIEKIKAAIRKATLSATYFPVVCGTSFKNKGVKLMLNAIVDYLPSPLDIPPMKAYKGEG-EISIPASDDEFFSSLAFKVMNDPYVGNLTFFRVYSGILNKGTYLYNSTKGEKERIGRILLMHANSRTDIDEVRTGDIGAAVGLKFTTTGDTLIDEKHKDIVLENMNFPEPVISQALEPASKDASEKLSLALQRLAAEDPTFKYYTDEETGQTIIAGMGELHLDIIVDRLKREFKVAANVGAPQVSYRETITKSAEVEGIHKKQSGGKGQYGHVWIKYEPNPDKGFEFVDKIVGGKIPKEYIKSIEKGLKEKMEIGILAGYPLIDVKATLFDGSYHEVDSSELAYKIAASKSLTKGREMLGTVLLEPIMDVAVVIPEDFFGDVMGDISRRRGQVRDNETRNDGAHVIKAYIPLSEMFGYATELRSMTTGRGTYQMWFDHYEKLPRNLADEII 685
>gi|162447057|ref|YP_001620189.1| translation elongation factor EF-G [Acholeplasma laidlawii PG-8A] >gi|189028029|sp|A9NEN3.1|EFG_ACHLI Elongation factor G (EF-G) >gi|161985164|gb|ABX80813.1| translation elongation factor EF-G [Acholeplasma laidlawii PG-8A] (690 aa)
Score = 2340, Expect = 0.0e+00, Identities = 433/684 (63%), Positives = 528/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R   L   RN GIMAHIDAGKTTT+ERILFH+G+IHK GETHDG S MDWM QE+ERGITITSAAT+  W++  +N+IDTPGHVDFTVEV RSLRVLDGA+ V+DAQ GVEPQTETVWRQA+ Y+VPRI++VNKMDK GA+F  +++++ +RLGVKA  IQLPIG E DF+GIIDL+      + G   E  +E PIP   ++Q   MR  L+E VA FDD+LM  YLEG+E+S+  +KR IRKGV+  +FFPV+ GS+FKNKG++ +LDAV+D+LPSP+D+P    +  +G EV   A D+ PF  LAFKV TDPFVG+LTF RVYSG +KSGSYV+N  K ++ER  R+++MHA  R EI+E+ AGDI A +GLK TTTG TL     D+ LE+M F +PVI +AVEPKTK DQ+KM  AL+KLAEEDPTFKT+T+ ETGQTIIAGMGELHLDILVDRM+REFKVE NV  PQVS+RET    +E+E K+I+QSGGRGQYGHV I FEPN  KGFEFVDKIVGG IPREYI  VQ GLE A+  G LAG+P++DIKATL  GS+H+VDSSEMA+KIAAS+ALK+A    + V+LEPIM +EV  P  Y G+ +GDI+SRRG +E  E R N   I+A VPL EMFGYAT LRS +QGR  +VMQF H+ + PKS+  EII
  S:     1 MPRQYSLKMTRNIGIMAHIDAGKTTTTERILFHTGKIHKTGETHDGASQMDWMAQEQERGITITSAATTSVWRDHRVNIIDTPGHVDFTVEVSRSLRVLDGAVTVIDAQAGVEPQTETVWRQATEYKVPRIVYVNKMDKIGADFNNAIKTLHRRLGVKANAIQLPIGTELDFSGIIDLVTMTAVEYSGDALETTKEIPIPAHLEEQAIDMRNELIEAVAEFDDELMVTYLEGEEVSVELLKRAIRKGVLAVEFFPVVAGSSFKNKGVRKVLDAVIDYLPSPLDIPPVLGHTSEGVEVYRHADDEEPFTALAFKVMTDPFVGKLTFFRVYSGKIKSGSYVQNTTKGERERFGRILQMHANTRQEIDEVYAGDIAAAVGLKVTTTGNTLATQNDDIILESMNFPEPVIEVAVEPKTKNDQDKMGQALAKLAEEDPTFKTYTNTETGQTIIAGMGELHLDILVDRMKREFKVEANVTEPQVSYRETLTVPNEIEAKFIRQSGGRGQYGHVVIDFEPNPGKGFEFVDKIVGGVIPREYIPSVQKGLEEALGGGILAGFPVVDIKATLKFGSYHDVDSSEMAYKIAASMALKDAKNKANAVILEPIMDVEVVTPNDYVGNVIGDITSRRGRLESQEGRGNAISIRAFVPLSEMFGYATSLRSNTQGRATFVMQFDHFDKVPKSIQEEII 684
>gi|70727459|ref|YP_254375.1| elongation factor G [Staphylococcus haemolyticus JCSC1435] >gi|90110713|sp|Q4L3K8|EFG_STAHJ Elongation factor G (EF-G) >gi|68448185|dbj|BAE05769.1| translation elongation factor G [Staphylococcus haemolyticus JCSC1435] (693 aa)
Score = 2334, Expect = 0.0e+00, Identities = 430/688 (62%), Positives = 539/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANF+ SV ++  RL   A PIQLPIGAE++F  IIDL+E K + +      + +E  IP+  K++ ++ R++L+E VA  +D+LM  YL  +EIS+A++K  IR+     +F+PVLCG+AFKNKG++L+L+AV+D+LPSP+DV P      E+  E +I+  DD A F  LAFKV TDP+VG+LTF RVYSG L SGSY+KN  K+K+ERV RL++MHA +R EI+ + +GDI A +GLKDT TG+TL  +K D+ LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF   TD ETGQ II GMGELHLDILVDRM++EF VE NVGAP VS+RETF + ++V+GK+ +QSGGRGQYG V I F PN+   GFEF + IVGG +PREYI  V+AGL++AM +G LAGYP+ID+KA LFDGS+H+VDSSEMAFKIAASLALKEA K C PV+LEP+M + + +PE+Y GD MGD+++RRG ++G E R N QV+ A VPL EMFGYAT LRS +QGRG Y M F HYAE PKS+ ++II   K
  S:     1 MARDFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAQWDGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFDYSVSTLHDRLDANAAPIQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIDEIEIPEDHKERAEEARSNLIEAVAETNDELMEKYLGDEEISVAELKNAIRQATTDVEFYPVLCGTAFKNKGVQLMLNAVIDYLPSPLDVKPIVGHRAENPEEEVIAKPDDSAEFAALAFKVMTDPYVGKLTFFRVYSGTLTSGSYIKNSTKDKRERVGRLLQMHANSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKQSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENSIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLFDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTARRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIADDIIKKNK 691
>gi|28377830|ref|NP_784722.1| elongation factor G [Lactobacillus plantarum WCFS1] >gi|34395595|sp|Q88XY8|EFG_LACPL Elongation factor G (EF-G) >gi|28270663|emb|CAD63569.1| elongation factor G [Lactobacillus plantarum WCFS1] (698 aa)
Score = 2324, Expect = 0.0e+00, Identities = 434/682 (63%), Positives = 533/682 (78%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETHDG S MDWM QE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGAIAVLDAQ GVEPQTETVWRQAS Y VPRI+FVNKMDK GA+F+ SV +I  RL   A  IQLPIGAE++F G+IDLIE K   +D  +   + +   +PD++K++ +  R  L+E +A+ DD +M  YL G+EIS  +IK  IRKG +  +FFPVL GSAFKNKG+++L+DAVVD+LPSP+DV   KA   E   EV + A DD PF  LAFKVATDPFVGRLTF+RVY G L+SGSYV N  K+K+ERV RL++MH+  R EI E+ +GDI A IGLK+TTTG++L   +    LE+M+F  PVI +AVEPKTKADQ+KM++AL KL+EEDPTFK  T+PETG+T+IAGMGELHLDI+VDRMRREF VE  VGAPQVS+RETF K ++V+GK++ QSGG+GQYG V + F PN++ KGFEF D IVGG +PREYI  V+ GL+ AMA+G LAGYP++D+KA L+DGS+H+VDSSE AFKIAASLAL+ A K   PV+LEPIM +++  PE Y GD MG +++RRG IEG E+R N Q + A VPL EMFGYAT LRS +QGRG + M F HY + PKSV  +II
  S:     5 REFSLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHDGASQMDWMAQEQERGITITSAATTAQWKNHRINIIDTPGHVDFTVEVERSLRVLDGAIAVLDAQSGVEPQTETVWRQASTYNVPRIVFVNKMDKIGADFKYSVSTIHDRLQANAHAIQLPIGAEDNFEGVIDLIEMKADLYDEDQLGTEWDTVDVPDEYKEEAQAARDDLIEALADIDDGIMEKYLGGEEISKEEIKAAIRKGTLALEFFPVLAGSAFKNKGVQMLMDAVVDYLPSPLDVKPYKATDPETEEEVDLIAGDDKPFAALAFKVATDPFVGRLTFIRVYQGTLESGSYVLNATKDKRERVGRLLQMHSNQRKEIPEVFSGDIAAAIGLKNTTTGDSLTSIEHPYHLESMEFPDPVIQVAVEPKTKADQDKMNVALQKLSEEDPTFKAETNPETGETLIAGMGELHLDIIVDRMRREFNVEATVGAPQVSYRETFTKSTQVQGKFVHQSGGKGQYGDVWVEFTPNEEGKGFEFEDAIVGGVVPREYIPSVEQGLKEAMANGVLAGYPLVDVKAKLYDGSYHDVDSSEAAFKIAASLALRNAVKTAGPVILEPIMKVDIVAPEDYLGDVMGHVTARRGNIEGMEERGNAQEVHAYVPLAEMFGYATTLRSATQGRGTFTMTFDHYEKVPKSVQEDII 689
>gi|187605181|ref|ZP_02991382.1| translation elongation factor G [Exiguobacterium sp. AT1b] >gi|187482750|gb|EDU20753.1| translation elongation factor G [Exiguobacterium sp. AT1b] (692 aa)
Score = 2324, Expect = 0.0e+00, Identities = 426/684 (62%), Positives = 536/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAE-EKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L N RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F  SV+++  RL   A  IQLPIGAE+DF GIIDL+E K Y ++       E     P    DQ +++R  L+E VA+F+++LM  YLEG+EISI ++K  IR+  +  +F+PVL GSAFKNKG++L+L+AVVD+LPSPVDV   K    D  E +    SD+APF  LAFKV TDP+VG+LTF RVYSG  ++GSYVKN  K K+ER+ R+++MHA +R EI  + AGDI A +G KDTTTG+TL  +K ++ LE+M F +PVIS+A+EPK+KADQ+KM  AL+KLAEEDPTF+T T+PETGQTII+GMGELHLDILVDRMRREFKVE NVGAPQV++RET    ++++ K+++QSGGRGQYGHV + FEPN++  GFEF +KIVGG +PREY+  VQ G+E A+ +G LAGYP++D+KA L  GS+H+VDS+EMAFK+AAS+A+K+       V+LEP+M +EV +PE+Y GD MGD++SRRG +EG E R N QV+KA +PL EMFGYAT LRS +QGRG Y M F HY E PKS+  EI+
  S:     1 MAREFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFLYSVKTLHDRLQANAYAIQLPIGAEDDFKGIIDLVEMKTYMYNNDLGTDIEVTDGFPADMADQAEELRGQLIEGVADFNEELMMKYLEGEEISIDELKAAIRQATLSVEFYPVLVGSAFKNKGVQLMLNAVVDYLPSPVDVESIKGINLDTEEEITREPSDEAPFSALAFKVMTDPYVGKLTFFRVYSGTAEAGSYVKNSTKGKRERLGRILQMHANSREEIPMVFAGDIAAAVGFKDTTTGDTLCSEKDNIVLESMTFPEPVISVAIEPKSKADQDKMGQALAKLAEEDPTFRTETNPETGQTIISGMGELHLDILVDRMRREFKVEANVGAPQVAYRETIRGAAKIDSKFVRQSGGRGQYGHVVVEFEPNEEGAGFEFENKIVGGVVPREYVPAVQNGIEEALENGILAGYPVVDVKARLVFGSYHDVDSNEMAFKVAASMAVKQLKDQAKAVILEPMMRVEVVIPEEYMGDIMGDVTSRRGRVEGMEARGNAQVVKAMIPLSEMFGYATSLRSRTQGRGTYSMHFDHYEEVPKSIAEEIV 687
>gi|169190351|ref|ZP_02850323.1| translation elongation factor G [Paenibacillus sp. JDR-2] >gi|169002958|gb|EDS49833.1| translation elongation factor G [Paenibacillus sp. JDR-2] (691 aa)
Score = 2323, Expect = 0.0e+00, Identities = 419/688 (60%), Positives = 541/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M+R   L N RN GIMAHIDAGKTTT+ERILF++GR HKIGE H+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+ETVWRQA RY VPRI ++NKMD  GA+F   ++ +++RL   AV IQLPIGAE+DF G+ID++E   Y +     +  E+  IP ++ DQV+++R  L+E+VA  D++L   YLEG+EI+I +IK  +RKGV   + FPV+ GS+++NKG++++LDAVVD+LPSP+DVP  K   EDG E +  +SD+ PF  LAFK+ TDP+VG+LTF RVYSG+LKSGSYV N  KNK+ER+ R+++MHA +R EI E+ +GDI A +GLKDT TG+TL D+K  + LE+M F  PVIS+A+EPKTKADQ+K+ IA+SKLAEEDPTF+  TD ET QTII+GMGELHL+ILVDRM REFKVE NVG PQV++RETF   ++VEGK+++QSGG+GQYGH  + F P +  +GF F +K+VGG IPRE+I P+QAG+E +M +G +AG+P++D+KAT+ DGS+H+VDSSEMAFKIA S+ALK A   C+PVLLEPIM +EVTVPE+Y GD MG ++SRRG IEG + R   Q+I+AKVPL EMFGY+T LRS +QGRG + M+ SHY E P+S+  EII+  K
  S:     1 MSREFSLNNTRNIGIMAHIDAGKTTTTERILFYTGRTHKIGEVHEGAATMDWMEQEQERGITITSAATTAQWKGNRINIIDTPGHVDFTVEVERSLRVLDGAVGVFSAKEGVEPQSETVWRQADRYGVPRIAYINKMDIIGADFLNVIKDMRERLQANAVAIQLPIGAESDFLGVIDIVERVAYKYKDDLGKDPEQVEIPAEYADQVEELRTELIEKVAELDEELTMKYLEGEEITIPEIKAALRKGVCEVKIFPVIAGSSYRNKGVQMMLDAVVDYLPSPLDVPAIKGTLEDGEESVRHSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGILKSGSYVLNATKNKRERIGRILQMHANSRQEISEVYSGDIAAAVGLKDTITGDTLCDEKEPIILESMNFPDPVISVAIEPKTKADQDKLGIAISKLAEEDPTFRAHTDEETNQTIISGMGELHLEILVDRMLREFKVETNVGKPQVAYRETFRTAAKVEGKFVRQSGGKGQYGHCWVEFTPQEPGQGFVFENKVVGGSIPREFIGPIQAGIEESMKNGVIAGFPLVDVKATVVDGSYHDVDSSEMAFKIAGSMALKAAKDKCNPVLLEPIMKVEVTVPEEYMGDVMGMLNSRRGRIEGMDTRAGAQIIRAKVPLAEMFGYSTTLRSGTQGRGVFSMELSHYEEVPRSISEEIISKNK 689
>gi|194246786|ref|YP_002004425.1| Elongation factor G [Candidatus Phytoplasma mali] >gi|193807143|emb|CAP18581.1| Elongation factor G [Candidatus Phytoplasma mali] (688 aa)
Score = 2321, Expect = 0.0e+00, Identities = 419/684 (61%), Positives = 537/684 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R   L   RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG+S MDWM+QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEV RSLRVLDGA+AV+DA+ GVEPQTETVWRQA+ Y+VPRIIFVNKMDK GA+F+ +V+++ QRLG+ A PIQLPIG+EN+F GI+DL+E     F G  +EK +   IP+  K+  +  R  L+E++AN+D++LM DYL GKEI++  +K  IR+  +   FFPVLCGSAFKNKG+K +LDA++D+LPSP+DV        +  E++   SD+ PF  LAFKV TDP+VG+LTF RVY+G +K+GSYV N  K  KER+ RL++MHA +R EI+E+ AGDI A +GLK+TTTG+TL     D+ LE+M F +PVI +A+EPKTKADQ+K+ IALSKL+EEDPTFK +T+ ETGQTIIAGMGELHL+I++DR++ EFKVE NV  PQV++RET  K S  EGK+I+QSGGRGQYGHV IRFEPN DKG EF++KIVGG IP+EYI  V+ GLE ++++G LAG+P+ID+KATL DGS+H+VDSSE+AFKIAAS+ALK+     + V+LEPIM +E+  P  Y G+ +GD++SRRG +E  + R+N  +IKA VPL EMFGYAT LRS +QGR +++MQF  Y   PK++  EII
  S:     1 MPRKFPLEKTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGDSQMDWMKQEQERGITITSAATTAFWKEHRINIIDTPGHVDFTVEVSRSLRVLDGAVAVIDAKAGVEPQTETVWRQATEYKVPRIIFVNKMDKIGASFDYAVKTLYQRLGINASPIQLPIGSENEFKGIVDLLEMTGVEFLGTSDEKFKTIEIPEYMKELAQNKRIELIEKMANYDEELMMDYLNGKEITVEKLKNVIRQATLKADFFPVLCGSAFKNKGVKKILDAIIDYLPSPMDVSSIVGCNFENKEIIRKTSDNEPFTALAFKVMTDPYVGKLTFFRVYAGTIKTGSYVTNATKQVKERLGRLLQMHANSREEIKEVYAGDIVAAVGLKNTTTGDTLTSINDDIILESMNFPEPVIEIAIEPKTKADQDKIGIALSKLSEEDPTFKIYTNRETGQTIIAGMGELHLEIILDRLKTEFKVEANVNQPQVAYRETLTKISTTEGKFIRQSGGRGQYGHVIIRFEPNSDKGNEFINKIVGGVIPKEYIPAVKKGLEESLSNGILAGFPLIDVKATLIDGSYHDVDSSEIAFKIAASMALKQTKNEGNLVILEPIMEVEIITPNDYIGNVIGDLTSRRGKLENQDSRENTVIIKALVPLSEMFGYATILRSNTQGRASFIMQFLKYERAPKNIAEEII 684
>gi|55821761|ref|YP_140203.1| elongation factor G [Streptococcus thermophilus LMG 18311] >gi|55823680|ref|YP_142121.1| elongation factor G [Streptococcus thermophilus CNRZ1066] >gi|116628478|ref|YP_821097.1| elongation factor G [Streptococcus thermophilus LMD-9] >gi|122266927|sp|Q03IS1.1|EFG_STRTD Elongation factor G (EF-G) >gi|62286650|sp|Q5LY21|EFG_STRT1 Elongation factor G (EF-G) >gi|62286651|sp|Q5M2M6|EFG_STRT2 Elongation factor G (EF-G) >gi|55737746|gb|AAV61388.1| translation elongation factor G, EF-G [Streptococcus thermophilus LMG 18311] >gi|55739665|gb|AAV63306.1| translation elongation factor G, EF-G [Streptococcus thermophilus CNRZ1066] >gi|116101755|gb|ABJ66901.1| translation elongation factor 2 (EF-2/EF-G) [Streptococcus thermophilus LMD-9] (693 aa)
Score = 2315, Expect = 0.0e+00, Identities = 423/684 (61%), Positives = 531/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIGAE+DF GIIDLI+ K   +         E+ IP ++ DQ  + R  L+E VA  D+ LM  YLEG+EI+  ++K  IR+  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D G E    ASD+APF  LAFK+ TDPFVGRLTF+RVYSG+L+SGSYV N  K K+ER+ R+++MHA +R EIE++ AGDI A IGLKDTTTG++L D+K  V LE+++  +PVI L VEPKTKADQ+KM+I L KLAEEDPTF+  T+PETG+T+I+GMGELHLD+LVDR++RE KVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GLE +MA+G LAGYPM+DIKA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYVDQANEYREKLIEAVAETDEDLMMKYLEGEEITNDELKAAIRRATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTGEEETRPASDEAPFAALAFKIMTDPFVGRLTFIRVYSGILQSGSYVMNTSKGKRERIGRILQMHANSRQEIEQVYAGDIAAAIGLKDTTTGDSLTDEKAKVILESIEVPEPVIQLMVEPKTKADQDKMAIGLQKLAEEDPTFRVETNPETGETVISGMGELHLDVLVDRLKREHKVEANVGAPQVSYRETFRAATQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLEESMANGVLAGYPMVDIKAKLYDGSYHDVDSSETAFKIAASLALKEAAKTAQPTILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNTQIVRAYVPLAEMFGYATTLRSATQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|73663517|ref|YP_302298.1| elongation factor G [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90110714|sp|Q49V57|EFG_STAS1 Elongation factor G (EF-G) >gi|72496032|dbj|BAE19353.1| translation elongation factor G [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (696 aa)
Score = 2314, Expect = 0.0e+00, Identities = 435/684 (63%), Positives = 530/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG--NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+  W N  +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANFE SV +I  RL   A PIQLPIGAE++F  IIDL+E   + +      + EE  IP+  K++ ++ RA LVE VA  DD+LM  YL  +EISI ++K  IRK     +F+PVL G+AFKNKG++L+L+AV+D+LPSP+DV     +  D    EV+  A D+A F  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  KNK+ERV RL++MHA +R E+  + +GDI A +GLKDT TG+TL  +K D+ LE+M F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF   TD ETGQ II GMGELHLDILVDRM++EF VE NVGAP VS+RETF   +EV+GK+ +QSGGRGQYG VKI F PN+   GFEF + IVGG +PREYI  V+AGL+++M +G LAGYP+ID+KA LFDGS+H+VDSSEMAFK+AASLALKEA K C PV+LEP+M + + +PE+Y GD MGD++SRRG ++G E R N QV+ A VPL EMFGYAT LRS +QGRG Y M F HYAE PKS+  +II
  S:     1 MARDFSLDRTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAEWDNHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTIHDRLQANAQPIQLPIGAEDEFEAIIDLVEMTCFKYTNDLGTEIEEIEIPEDHKERAEEARAALVEAVAETDDELMEKYLGDEEISIPELKAAIRKATTDVEFYPVLVGTAFKNKGVQLMLNAVIDYLPSPLDVKPIIGHRADNPDEEVIAKADDNAEFAALAFKVMTDPYVGKLTFFRVYSGTLSSGSYVKNSTKNKRERVGRLLQMHANSRQELNTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMDFPEPVIHLSVEPKSKADQDKMTTALVKLQEEDPTFHAHTDDETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKSSAEVQGKFARQSGGRGQYGDVKIEFSPNETGGGFEFENAIVGGVVPREYIPSVEAGLKDSMENGVLAGYPLIDVKARLFDGSYHDVDSSEMAFKVAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIAEDII 687
>gi|27467229|ref|NP_763866.1| elongation factor G [Staphylococcus epidermidis ATCC 12228] >gi|57866147|ref|YP_187784.1| elongation factor G [Staphylococcus epidermidis RP62A] >gi|32129503|sp|Q8CQ82|EFG_STAES Elongation factor G (EF-G) >gi|62286648|sp|Q5HRK5|EFG_STAEQ Elongation factor G (EF-G) >gi|27314772|gb|AAO03908.1|AE016745_7 elongation factor EF-G [Staphylococcus epidermidis ATCC 12228] >gi|57636805|gb|AAW53593.1| translation elongation factor G [Staphylococcus epidermidis RP62A] (693 aa)
Score = 2309, Expect = 0.0e+00, Identities = 428/688 (62%), Positives = 535/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L N RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+  W+   +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANFE SV ++  RL   A PIQLPIGAE++F  IIDL+E K + +      + +E  IP+  K++ ++ RA L+E VA  +D LM  YL  +EIS+ ++K  IR+     +F+PVLCG+AFKNKG++L+L+AV+D+LPSP+DV P       + +E +++  DD A F  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K+K+ERV RL++MHA +R EI+ + +G+I A +GLK+T TG+TL  +K D+ LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF   TD ETGQ II GMGELHLDILVDRM++EF VE NVGAP VS+RETF + ++V+GK+ +QSGGRGQYG V I F PN+   GFEF + IVGG +PREYI  V+ GL++AM +G LAGYP+ID+KA LFDGS+H+VDSSEMAFKIAASLALKEA K C PV+LEP+M + + +PE+Y GD MGD+++RRG ++G E R N QV+ A VPL EMFGYAT LRS +QGRG Y M F HYAE PKS+  EII   K
  S:     1 MARDFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAQWQGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIDEIEIPEDHKERAEEARAQLIEAVAENNDDLMEKYLGDEEISVDELKDAIRQATTDVEFYPVLCGTAFKNKGVQLMLNAVIDYLPSPLDVKPIIGHRANNPDEEVVAKPDDSAEFAALAFKVMTDPYVGKLTFFRVYSGTLSSGSYVKNSSKDKRERVGRLLQMHANSRQEIDTVYSGEIAAAVGLKETGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKQPAQVQGKFSRQSGGRGQYGDVHIEFTPNETGGGFEFENAIVGGVVPREYIPSVEQGLKDAMENGVLAGYPLIDVKAKLFDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTARRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIAEEIIKKNK 691
>gi|172056137|ref|YP_001812597.1| translation elongation factor G [Exiguobacterium sibiricum 255-15] >gi|171988658|gb|ACB59580.1| translation elongation factor G [Exiguobacterium sibiricum 255-15] (692 aa)
Score = 2299, Expect = 0.0e+00, Identities = 424/684 (61%), Positives = 543/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEE-KPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L N RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GA+F  SV +++ RL   A  IQ+PIGAE++F GIIDL+E+K Y +        EE +  P +F ++ +++RA L+E VA++++++M  YLEG+EI+I ++K  IRK  +   F+PVL GSAFKNKG++L+LDAV+D+LPSPVDV        D +E ++  ++D+APF  LAFKV TDP+VG+LTF RVYSG   +GSYVKN  K K+ER+ R+++MHA +R EI  + AGDI A +GLKDTTTG+TL  +K +V LE+M F +PVIS+A+EPKTKADQ+KM  AL+KLAEEDPTF+T T+PETGQTII+GMGELHLDI+VDRMRREFKVE NVGAPQV++RET  + ++++ K+ +QSGGRGQYGHV + FEPN++  GFEF +KIVGG +PREYI  V+ G+E A+ +G LAGYP++D+KA L  GS+H+VDS+EMAFKIAAS+A+K+       V+LEP+M +E+ +P++Y GD MGD++SRRG +EG E R N QV+++ +PL EMFGYAT LRS +QGRG Y M F HY E PKSV  EII
  S:     1 MAREFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGNRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQIPIGAEDEFKGIIDLVEKKTYMYGNDLGTDIEETEGFPAEFAEEAEELRASLIEAVADYEEEMMMKYLEGEEITIEELKAGIRKATLTVDFYPVLVGSAFKNKGVQLMLDAVLDYLPSPVDVKAITGINMDTDEEIVRESTDEAPFSALAFKVMTDPYVGKLTFFRVYSGTASAGSYVKNSTKGKRERLGRILQMHANSREEIPMVFAGDIAAAVGLKDTTTGDTLCAEKDNVVLESMTFPEPVISVAIEPKTKADQDKMGQALAKLAEEDPTFRTETNPETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETIRQSAKIDSKFARQSGGRGQYGHVVVEFEPNEEGAGFEFNNKIVGGVVPREYIPAVEHGIEEALQNGILAGYPVVDVKAALVFGSYHDVDSNEMAFKIAASMAVKQLKDKSGAVILEPMMKVEIVIPDEYMGDIMGDVTSRRGRVEGMEARGNAQVVRSMIPLSEMFGYATGLRSRTQGRGTYSMHFDHYEEVPKSVAEEII 687
>gi|71151857|sp|Q5U8S9|EFG_STAIN Elongation factor G (EF-G) >gi|54777951|gb|AAV39278.1| translation elongation factor G [Staphylococcus intermedius] (693 aa)
Score = 2297, Expect = 0.0e+00, Identities = 425/688 (61%), Positives = 531/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG--NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L N RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANF+ +V ++  RL   A PIQLPIGAE++F+ IIDL+  K + ++     + EE  IP+ ++++ ++ R  L+E VA  ++ LM    + +EI++ ++K  IR+     +F+PVLCG+AFKNKG++L+LDAV+D+LPSP+DV     +  D    EV+  A DDA F  LAFKV TDP+VG+LTF RVYSG L SGSYVKN  K K+ERV R+++MHA +R EI  + +GDI A +GLKDT TG+TL  +K D+ LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTFK  TD ETGQ II GMGELHLDI+VDRM++EF VE NVGAP VS+RETF   + V+GK+ +QSGGRGQYG V I F PN+   GFEF + IVGG +PREYI  V+ GL++AM +G LAGYP+ID+KA LFDGS+H+VDSSEMAFKIAASLALKEA K C PV+LEP+M + + +PE+Y GD MGD+++RRG ++G E R N QV+ A VPL EMFGYAT LRS +QGRG Y M F HYAE PKS+  EII   K
  S:     1 MGRDFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAEWKNHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGANFDYAVSTLHDRLQANAAPIQLPIGAEDEFSAIIDLVTMKCFKYNNDLGTEIEEVEIPEDYRERAEEAREALIEAVAETNESLMEKIFDEQEITVDELKDAIRQATTDVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIVGHRADNPDEEVIAKADDDAEFAALAFKVMTDPYVGKLTFFRVYSGTLTSGSYVKNSTKGKRERVGRILQMHANSREEISSVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFKAHTDEETGQVIIGGMGELHLDIIVDRMKKEFNVEANVGAPMVSYRETFKTSAAVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPSVEQGLKDAMENGVLAGYPLIDVKAKLFDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTARRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSISEEIIKKNK 691
>gi|83591279|ref|YP_431288.1| elongation factor G [Moorella thermoacetica ATCC 39073] >gi|119368743|sp|Q2RFP4|EFG_MOOTA Elongation factor G (EF-G) >gi|83574193|gb|ABC20745.1| translation elongation factor 2 (EF-2/EF-G) [Moorella thermoacetica ATCC 39073] (692 aa)
Score = 2296, Expect = 0.0e+00, Identities = 423/688 (61%), Positives = 536/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+H++GE HDG + MDWM QE+ERGITITSAAT+  W+N  +N+IDTPGHVDFTVEVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI ++NKMD+ GA+F R V+ I +RLG   VPIQLPIGAE+ F G++DLI  K  ++        +E+PIP + +D V++ R  L+E VA  D++LM  YLEG+E++  +IK  IRK  I  +  PVLCGS+FKNKG++ LLDA+VDFLP+P DVP  +    E G+E    +SD+ PF  LAFK+  DP+VG+LTF RVYSG LKSGSYV N  K ++ER+ R+++MHA +R EI+E  AGDI A +GLK+TTTG+TL D++  + LEAM+F +PVIS+A+EPKTKADQEKMSIAL KLAEEDPTF+ +TD ETGQTII+GMGELHL+I+VDR+ REFKV   VG PQV+++ET  +  + EGK+I+Q+GG GQYGHV I  EP +  KG+EFV+KIVGG IP+EYI  V AG++ AMA+G LAGYP++D++ATL DGS+HEVDSSEMAFKIA SLA K+A K   PVLLEP+M +EV VP++Y GD +GD++SRRG +EG E R   QVI+A VPL EMFGYATDLRS +QGRG YVMQF HY E PK++  EII+ ++
  S:     1 MAREYPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHRMGEVHDGNATMDWMIQEQERGITITSAATTCFWRNHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRVGADFFRGVRMIAERLGANPVPIQLPIGAEDSFQGMVDLINMKAIYYTDELGTTLDEEPIPAEMEDLVQEYREKLLEAVAESDEELMIKYLEGEELTPEEIKAGIRKATIAVKMVPVLCGSSFKNKGVQPLLDAIVDFLPAPTDVPAIQGVDPETGDEDERHSSDNEPFAALAFKIMADPYVGKLTFFRVYSGTLKSGSYVYNSTKGRRERIGRILRMHANHREEIDEAYAGDIAAAVGLKETTTGDTLCDEQHPIVLEAMEFPEPVISVAIEPKTKADQEKMSIALQKLAEEDPTFRMYTDQETGQTIISGMGELHLEIIVDRLLREFKVGAKVGRPQVAYKETIRRPVKAEGKFIRQTGGHGQYGHVIIEIEPQEPGKGYEFVNKIVGGVIPKEYIPAVDAGIQEAMANGVLAGYPVVDVRATLVDGSYHEVDSSEMAFKIAGSLAFKDAAKKAQPVLLEPVMRVEVVVPDEYMGDVIGDLNSRRGRVEGMEPRAGAQVIRAHVPLAEMFGYATDLRSRTQGRGTYVMQFDHYEEVPKNIAEEIISKRQ 690
>gi|160914564|ref|ZP_02076779.1| hypothetical protein EUBDOL_00570 [Eubacterium dolichum DSM 3991] >gi|158433722|gb|EDP12011.1| hypothetical protein EUBDOL_00570 [Eubacterium dolichum DSM 3991] (692 aa)
Score = 2296, Expect = 0.0e+00, Identities = 441/684 (64%), Positives = 542/684 (79%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGETHDG S MDWMEQE+ERGITITSAAT+ +WK   +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA+ Y VPRI+F NKMD TGA+F  S  +I  RLG K+ PIQLPIGAE+ F GI+D+IE K  +Y  D G + K EE  +P+  KD  ++ R+ L++ +A++D+  M   LEG+E S+ +IKR +R  V    FFPVLCGSA+KNKG++++LDAVVD+LPSP+D+P  K   EDG+EV   ASDD PF  LAFK+ATDPFVG+L+F RVYSG   +GSYV N  K KKER  R+V+MHA  R EI+++ AGDI A +GLK TTTG+TL  +   + LE+M+F +PVI L++EPKTKADQ+KM +AL+KLAEEDPTFKT+TD ETGQTIIAG+GELHLDI+VDR++REFKVE NVG P V++RET    +E EGKYIKQSGGRGQYGHV I+FEP ++ KGFEFVD  VGG +PREYIKP   GLE+A+ +G +AGYP+IDIKATLFDGS+H+VDSSEMA+KIAAS+ALK A K C PV+LEPIM +EVT P +Y G  MGD+SSRRG I   ++R N  +++A +PL EMFGY TDLRSF+QGRGNY M+F HYAE PKS+  +II
  S:     1 MARQYSLEKTRNIGIMAHIDAGKTTTTERILYYTGVNHKIGETHDGASTMDWMEQEQERGITITSAATTAAWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKAGVEPQTETVWRQATTYGVPRIVFCNKMDATGADFLMSCGTIVDRLGAKSCPIQLPIGAESTFTGIVDIIERKAEIYTNDLGTDIKEEE--VPEDLKDLCEEYRSKLLDYLADYDEDFMMQILEGEEPSVEEIKRVLRIAVCSGDFFPVLCGSAYKNKGVQMVLDAVVDYLPSPLDIPAIKGTLEDGSEVERHASDDEPFSALAFKIATDPFVGKLSFFRVYSGTADAGSYVLNSTKGKKERFGRIVQMHANARKEIDKVYAGDIAAAVGLKVTTTGDTLCAENAPIVLESMEFPEPVIELSLEPKTKADQDKMGLALAKLAEEDPTFKTYTDQETGQTIIAGVGELHLDIIVDRLKREFKVEANVGQPMVAYRETIRTTAECEGKYIKQSGGRGQYGHVWIKFEPQEEGKGFEFVDATVGGSVPREYIKPTAEGLEDALQNGIIAGYPVIDIKATLFDGSYHDVDSSEMAYKIAASMALKAAAKKCDPVILEPIMMVEVTAPNEYLGSVMGDVSSRRGSIVNQDERGNAIIVQAHIPLSEMFGYVTDLRSFTQGRGNYSMKFDHYAEVPKSIAEKII 685
>gi|171779186|ref|ZP_02920157.1| hypothetical protein STRINF_01034 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282242|gb|EDT47669.1| hypothetical protein STRINF_01034 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (692 aa)
Score = 2295, Expect = 0.0e+00, Identities = 422/684 (61%), Positives = 530/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+ F GIIDL+  K   +         E+ IP ++ DQ  + R  L+E VA  D++LM  YLEG+EI+ A++K  IRK  I  +FFPVLCGSAFKNKG++++LDAV+D+LPSP+D+P  K    D + E    ASDD PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +RNEIE + AGDI A +GLKDTTTG++L D+K  V LE++   +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF + ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL+ +MA+G LAGYPM+DIKA L+DGS+H+VDSSE AFKIAASLALKEA K   PV+LEP+M + +T PE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKDYRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFSNKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDSFRGIIDLVRMKAEIYTNDLGTDILEEDIPAEYVDQANEYREKLIEAVAETDEELMMKYLEGEEITEAELKAAIRKATINVEFFPVLCGSAFKNKGVQMMLDAVIDYLPSPLDIPAIKGVNPDTDEEEERPASDDEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANHRNEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILESIDVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNAETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRQATQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLQESMANGVLAGYPMVDIKAKLYDGSYHDVDSSETAFKIAASLALKEAAKTAHPVILEPMMLVTITAPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAFVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|146295991|ref|YP_001179762.1| translation elongation factor G [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166201587|sp|A4XI36.1|EFG_CALS8 Elongation factor G (EF-G) >gi|145409567|gb|ABP66571.1| translation elongation factor 2 (EF-2/EF-G) [Caldicellulosiruptor saccharolyticus DSM 8903] (691 aa)
Score = 2294, Expect = 0.0e+00, Identities = 424/687 (61%), Positives = 538/687 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R   L   RN GIMAHIDAGKTTT+ERILF++G+++K+GE H+G + MDWMEQE+ERGITITSAAT+  W+   +N+IDTPGHVDFTVEVERSLRVLDGAIAV  A+ GVEPQ+ETVWRQA +Y VPRI +VNKMD  GANF   ++ +++RLG   V IQ+PIG E+ F G++DL+  K  +Y  D GK   ++E  IPD+ KD  ++ R  L+E VA  D+++M  YLEG+EI++ ++K  IRK  I  Q  PVLCGS+++NKG++ LLDAVVD+LPSPVD+   K +  D G E+    S+D PF  LAFK+ +DP+VG+LTF+RVYSGVL++GSYV N  KNKKERV RL++MHA +R +I+ + AGDICA IGL +TTTG+TL D+   + LE+M+F +PVI +A+EPKTKADQEKM IAL +LAEEDPTFK  T+ ETGQT+IAGMGELHL+I+VDRM+REFKVEVNVG PQV+++ET  K  +VEGKYI+QSGGRGQYGHV +  EP  +  G+EFV+KIVGG IP+E+I  V AG++ AM SG LAGYP++D++ TLFDGS+HEVDSS+MAF+IAA+ A +E  K   PVLLEPIM +EV VPE+Y GD MGDI++RRG IEG E R N QVI+A VPL EMFGYATDLRS +QGRG Y MQF HY E PK++ ++I+  K
  S:     1 MPRQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGKVYKMGEVHEGTATMDWMEQEQERGITITSAATTCEWRGHRINIIDTPGHVDFTVEVERSLRVLDGAIAVFCAKGGVEPQSETVWRQADKYRVPRIAYVNKMDIMGANFFNVIEMMKERLGANPVAIQVPIGKEDTFKGVVDLLTMKAIIYVDDLGK--VSQETEIPDEVKDIAEEYRIKLLEAVAETDEEIMMKYLEGEEITVEELKAAIRKATINMQMTPVLCGSSYRNKGVQPLLDAVVDYLPSPVDIAAVKGFSPDTGEEIERKTSEDEPFCALAFKIMSDPYVGKLTFLRVYSGVLQAGSYVYNSTKNKKERVGRLLQMHANHREDIDAVYAGDICAAIGLSNTTTGDTLCDENHPIILESMEFPEPVIQVAIEPKTKADQEKMGIALQRLAEEDPTFKISTNHETGQTLIAGMGELHLEIIVDRMKREFKVEVNVGKPQVAYKETIKKSVKVEGKYIRQSGGRGQYGHVWLELEPLERGGGYEFVNKIVGGVIPKEFIPSVDAGVQEAMQSGVLAGYPVVDVRVTLFDGSYHEVDSSDMAFRIAAAQAFREGMKKAEPVLLEPIMKVEVVVPEEYMGDVMGDINARRGRIEGMELRGNAQVIRAYVPLAEMFGYATDLRSKTQGRGTYTMQFDHYEEVPKNIADKILEMK 689
>gi|111073865|dbj|BAF02540.1| translation elongation factor G [Streptococcus bovis] (692 aa)
Score = 2291, Expect = 0.0e+00, Identities = 421/684 (61%), Positives = 530/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+ F GIIDL+  K   +         E+ IP ++ DQ  + R  L+E VA  D++LM  YLEG+EI+ A++K  IRK  I  +FFPVLCGSAFKNKG++++LDAV+D+LPSP+D+P  K    D + E    ASDD PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +RNEIE + AGDI A +GLKDTTTG++L D+K  V LE++   +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF + ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL+ +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   PV+LEP+M + +T PE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKDYRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFSNKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDSFRGIIDLVRMKAEIYTNDLGTDILEEDIPAEYVDQANEYREKLIEAVAETDEELMMKYLEGEEITEAELKAAIRKATINVEFFPVLCGSAFKNKGVQMMLDAVIDYLPSPLDIPAIKGVNPDTDEEEERPASDDEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANHRNEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILESIDVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRQATQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLQESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKTAHPVILEPMMLVTITAPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAFVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|125718894|ref|YP_001036027.1| elongation factor G [Streptococcus sanguinis SK36] >gi|166220178|sp|A3CQM2.1|EFG_STRSV Elongation factor G (EF-G) >gi|125498811|gb|ABN45477.1| Elongation factor G, putative [Streptococcus sanguinis SK36] (693 aa)
Score = 2288, Expect = 0.0e+00, Identities = 421/688 (61%), Positives = 528/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ +Q ++ R  LVE VA  D+ LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D  E     ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +RNEIE + AGDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM +AL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYP++D+KA L+DGS+H+VDSSE AFK+AASLALKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAQEYREKLVEAVAETDEDLMMKYLEGEEITNEELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTEEEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANSRNEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILESINVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRAPTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSSETAFKVAASLALKEAAKTAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|169832443|ref|YP_001693800.1| translation elongation factor G [Streptococcus pneumoniae Hungary19A-6] >gi|168994945|gb|ACA35557.1| translation elongation factor G [Streptococcus pneumoniae Hungary19A-6] (693 aa)
Score = 2287, Expect = 0.0e+00, Identities = 422/688 (61%), Positives = 529/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS-ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ DQ ++ R  LVE VA  D+ LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D +E     ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL+SGSYV N  K K+ER+ R+++MHA +R EI+ + +GDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLVEAVAETDEDLMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDEEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYVLNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKAKIILESINVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|157151182|ref|YP_001449526.1| elongation factor G [Streptococcus gordonii str. Challis substr. CH1] >gi|189027973|sp|A8AUR6.1|EFG_STRGC Elongation factor G (EF-G) >gi|157075976|gb|ABV10659.1| translation elongation factor G [Streptococcus gordonii str. Challis substr. CH1] (693 aa)
Score = 2286, Expect = 0.0e+00, Identities = 421/688 (61%), Positives = 529/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS-ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIGAE+DF GIIDLI+ K   +         E+ IP ++ +Q ++ R  LVE VA  D+ LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D +E     ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL+SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM +AL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYP++D+KA L+DGS+H+VDSSE AFK+AASLALKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAQEYREKLVEAVAETDEDLMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDEEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILESINVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSSETAFKVAASLALKEAAKTAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKHK 690
>gi|15900207|ref|NP_344811.1| elongation factor G [Streptococcus pneumoniae TIGR4] >gi|15902294|ref|NP_357844.1| elongation factor G [Streptococcus pneumoniae R6] >gi|111658315|ref|ZP_01409004.1| hypothetical protein SpneT_02000505 [Streptococcus pneumoniae TIGR4] >gi|116516752|ref|YP_815771.1| elongation factor G [Streptococcus pneumoniae D39] >gi|148983679|ref|ZP_01816998.1| elongation factor G [Streptococcus pneumoniae SP3-BS71] >gi|148996697|ref|ZP_01824415.1| elongation factor G [Streptococcus pneumoniae SP11-BS70] >gi|149001611|ref|ZP_01826584.1| elongation factor G [Streptococcus pneumoniae SP14-BS69] >gi|168490798|ref|ZP_02714941.1| translation elongation factor G [Streptococcus pneumoniae CDC0288-04] >gi|168576300|ref|ZP_02722183.1| translation elongation factor G [Streptococcus pneumoniae MLV-016] >gi|194398605|ref|YP_002036971.1| translation elongation factor G [Streptococcus pneumoniae G54] >gi|122279343|sp|Q04MH7.1|EFG_STRP2 Elongation factor G (EF-G) >gi|54037016|sp|P64023|EFG_STRR6 Elongation factor G (EF-G) >gi|54040751|sp|P64022|EFG_STRPN Elongation factor G (EF-G) >gi|14971744|gb|AAK74451.1| translation elongation factor G [Streptococcus pneumoniae TIGR4] >gi|15457799|gb|AAK99054.1| Elongation factor G [Streptococcus pneumoniae R6] >gi|116077328|gb|ABJ55048.1| translation elongation factor G [Streptococcus pneumoniae D39] >gi|147757272|gb|EDK64311.1| elongation factor G [Streptococcus pneumoniae SP11-BS70] >gi|147760069|gb|EDK67058.1| elongation factor G [Streptococcus pneumoniae SP14-BS69] >gi|147923826|gb|EDK74938.1| elongation factor G [Streptococcus pneumoniae SP3-BS71] >gi|183575015|gb|EDT95543.1| translation elongation factor G [Streptococcus pneumoniae CDC0288-04] >gi|183577860|gb|EDT98388.1| translation elongation factor G [Streptococcus pneumoniae MLV-016] >gi|194358272|gb|ACF56720.1| translation elongation factor G [Streptococcus pneumoniae G54] (693 aa)
Score = 2286, Expect = 0.0e+00, Identities = 420/688 (61%), Positives = 531/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ DQ ++ R  L+E VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D + E +  ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL+SGSYV N  K K+ER+ R+++MHA +R EI+ + +GDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASL+LKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETDEELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDAEEIRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYVLNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKAKIILESINVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|81177225|ref|ZP_00876082.1| Translation elongation factor G:Small GTP-binding protein domain [Streptococcus suis 89/1591] >gi|80976102|gb|EAP39754.1| Translation elongation factor G:Small GTP-binding protein domain [Streptococcus suis 89/1591] (693 aa)
Score = 2285, Expect = 0.0e+00, Identities = 419/684 (61%), Positives = 530/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++ +RL   A PIQLPIG+E++F GIIDLI+ K   +         E+ IP ++ +Q ++ R  LVE VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM IALSKLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYP++D+KA L+DGS+H+VDSSE AFK+AASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E R N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV +EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHERLQANAHPIQLPIGSEDEFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAEEYREKLVEAVAETDEELMMKYLEGEEITNEELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGVNPDTDAEEERHASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILESIHVPEPVIQLMVEPKSKADQDKMGIALSKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSSETAFKVAASLALKEAAKSAQPTILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEARGNTQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQDEII 686
>gi|146317810|ref|YP_001197522.1| elongation factor G [Streptococcus suis 05ZYH33] >gi|146320004|ref|YP_001199715.1| elongation factor G [Streptococcus suis 98HAH33] >gi|166220177|sp|A4VYX6.1|EFG_STRS2 Elongation factor G (EF-G) >gi|166220179|sp|A4VSN3.1|EFG_STRSY Elongation factor G (EF-G) >gi|145688616|gb|ABP89122.1| Translation elongation factor (GTPases) [Streptococcus suis 05ZYH33] >gi|145690810|gb|ABP91315.1| Translation elongation factor (GTPases) [Streptococcus suis 98HAH33] (693 aa)
Score = 2284, Expect = 0.0e+00, Identities = 419/684 (61%), Positives = 530/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++ +RL   A PIQLPIG+E++F GIIDLI+ K   +         E+ IP ++ +Q ++ R  LVE VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM IALSKLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYP++D+KA L+DGS+H+VDSSE AFK+AASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E R N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV +EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHERLQANAHPIQLPIGSEDEFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAEEYREKLVEAVAETDEELMMKYLEGEEITNDELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGVNPDTDAEEERHASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILESIHVPEPVIQLMVEPKSKADQDKMGIALSKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSSETAFKVAASLALKEAAKSAQPTILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEARGNTQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQDEII 686
>gi|6919880|sp|Q9ZEU4|EFG_APPPP Elongation factor G (EF-G) >gi|4127381|emb|CAA09487.1| elongation factor G [Candidatus Phytoplasma mali] (688 aa)
Score = 2284, Expect = 0.0e+00, Identities = 414/684 (60%), Positives = 531/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R   L   RN GIMAHIDAGKTTT+ERILFH+G+IHKIGETHDG+S MDWM+QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEV RSLRVLDGA+AV+DA+ GVEPQTETVWRQA+ Y+VPRIIFVNKMDK GA+F+ +V+++ QRLG+ A PIQLPIG+EN+F GI+DL+E     F G  +EK +   IP+  K+  +  R  L+E+  N+D++LM DYL GKEI++  +K  IR+  +   FFPVLCGSAFKNKG+K +LDA++D+LPSP+DV        +  E++   SD+ PF  LAFKV TDP+VG+LTF RVY+G +K+GSYV N  K  KER+ RL++MHA +R EI+E+ AGDI A +GLK+TT G+TL     D+ LE+M F +PVI +A+EPKTKADQ+K+ IALSKL+EE PTFK +T+ ET QTIIA MGELHL+I++DR++ EFKVE NV  PQV++RET  K S  EGK+I+QSGGRGQYGHV IRFEPN DKG EF++KIVGG IP+EYI  V+ GLE ++++G LAG+P+ID+KATL DGS+H+VDSSE+AFKIAAS+ALK+     + V+LEPIM +E+  P  Y G+ +GD++SRRG +E  + R+N  +IKA VPL EMFGYAT LRS +QGR +++MQF  Y   PK++  EII
  S:     1 MPRKFPLEKTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHDGDSQMDWMKQEQERGITITSAATTAFWKEHRINIIDTPGHVDFTVEVSRSLRVLDGAVAVIDAKAGVEPQTETVWRQATEYKVPRIIFVNKMDKIGASFDYAVKTLYQRLGINASPIQLPIGSENEFKGIVDLLEMTGVEFLGTSDEKFKTIEIPEYMKEFAQNKRIELIEKWHNYDEELMMDYLNGKEITVEKLKNVIRQATLKADFFPVLCGSAFKNKGVKKILDAIIDYLPSPMDVSSIVGCNFENKEIIRKTSDNEPFTALAFKVMTDPYVGKLTFFRVYAGTIKTGSYVTNATKQVKERLGRLLQMHANSREEIKEVYAGDIVAAVGLKNTTPGDTLTSINDDIILESMNFPEPVIEIAIEPKTKADQDKIGIALSKLSEEHPTFKIYTNRETAQTIIAAMGELHLEIILDRLKTEFKVEANVNQPQVAYRETLTKISTTEGKFIRQSGGRGQYGHVIIRFEPNSDKGNEFINKIVGGVIPKEYIPAVKKGLEESLSNGILAGFPLIDVKATLIDGSYHDVDSSEIAFKIAASMALKQTKNEGNLVILEPIMEVEIITPNDYIGNVIGDLTSRRGKLENQDSRENTVIIKALVPLSEMFGYATILRSNTQGRASFIMQFLKYERAPKNIAEEII 684
>gi|148988014|ref|ZP_01819477.1| elongation factor G [Streptococcus pneumoniae SP6-BS73] >gi|149011143|ref|ZP_01832448.1| elongation factor G [Streptococcus pneumoniae SP19-BS75] >gi|168485960|ref|ZP_02710468.1| translation elongation factor G [Streptococcus pneumoniae CDC1087-00] >gi|147764779|gb|EDK71709.1| elongation factor G [Streptococcus pneumoniae SP19-BS75] >gi|147926478|gb|EDK77551.1| elongation factor G [Streptococcus pneumoniae SP6-BS73] >gi|183570858|gb|EDT91386.1| translation elongation factor G [Streptococcus pneumoniae CDC1087-00] (693 aa)
Score = 2284, Expect = 0.0e+00, Identities = 420/688 (61%), Positives = 530/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ DQ ++ R  L+E VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL+SGSYV N  K K+ER+ R+++MHA +R EI+ + +GDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASL+LKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETDEELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDAEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYVLNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKAKIILESINVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|39938750|ref|NP_950516.1| elongation factor G [Onion yellows phytoplasma OY-M] >gi|62286673|sp|Q6YQV9|EFG_ONYPE Elongation factor G (EF-G) >gi|39721859|dbj|BAD04349.1| translation elongation factor EF-G [Onion yellows phytoplasma OY-M] (688 aa)
Score = 2284, Expect = 0.0e+00, Identities = 420/684 (61%), Positives = 527/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GI+AHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEV RSLRVLDGA+ V+DAQ GVEPQTETVWRQAS Y+VPR+IFVNKMDK GA+F  ++++++QRLGV A  IQ PIG+ENDFNGIIDL+E   + +D    E  +  PIP   +   +  R  L+E ++  D++LM  YLE K IS   +K  IRK  +   FFPVLCGS+FKNKG+  +LDA+VD+LP+P DV     +  D  E++ +  D+ PF+ LAFKV TDP+VG+LTF R+YSG +K+GSYV N  K  KER  RL++MHA +R E++E   GDI A++GLK TTTG+TL  +   + LE+M F +PVI +AVEPKTKADQ+KM IAL+KLAEEDPTFK F++ ETGQTIIAGMGELHLDI+++R++REFKV+ NV  PQV++RET  +E+E EGK+I+QSGGRGQYGHV +RFEPN  KGFEFV+KIVGG +PREY+  VQ G++ A+A G LAGY +ID+KATLFDGS+H+VDSSEMAFKIAAS+ALKE     +PV+LEPIM +EV  P  Y G+ +GD++SRRG +E  E R N   I+A VPL EMFGYAT LRS +QGR  ++MQF+ Y + PKS+  EII
  S:     1 MARQFSLEKTRNIGIIAHIDAGKTTTTERILFHTGKIHKIGETHDGASQMDWMEQEQERGITITSAATTAFWKDHRINIIDTPGHVDFTVEVSRSLRVLDGAVTVIDAQAGVEPQTETVWRQASEYKVPRVIFVNKMDKVGADFAYAIETLKQRLGVHASAIQWPIGSENDFNGIIDLVEMNAFEYDNTSPETGKVVPIPSDLESITQTKRNELIETLSTLDEELMMYYLEEKPISSEMLKNSIRKATLQASFFPVLCGSSFKNKGVVKMLDAIVDYLPAPCDVAAIVGFDSDNQEIVRTGLDEEPFIALAFKVMTDPYVGKLTFFRIYSGSVKAGSYVTNTTKGTKERFGRLLQMHANSREEVKEAYTGDILAVVGLKATTTGDTLASEGQTIVLESMNFPEPVIEIAVEPKTKADQDKMGIALAKLAEEDPTFKVFSNHETGQTIIAGMGELHLDIIIERLKREFKVQANVTEPQVAYRETITQETETEGKFIRQSGGRGQYGHVWMRFEPNPGKGFEFVNKIVGGVVPREYVPAVQKGIQEALAGGILAGYQIIDVKATLFDGSYHDVDSSEMAFKIAASMALKETKTKGNPVILEPIMDVEVVTPNDYVGNVIGDLTSRRGRLENQESRANAVAIRAFVPLSEMFGYATVLRSNTQGRATFIMQFAKYEKAPKSITEEII 684
>gi|22537908|ref|NP_688759.1| elongation factor G [Streptococcus agalactiae 2603V/R] >gi|76788704|ref|YP_330388.1| elongation factor G [Streptococcus agalactiae A909] >gi|76798254|ref|ZP_00780503.1| translation elongation factor G [Streptococcus agalactiae 18RS21] >gi|34395600|sp|Q8DXS7|EFG_STRA5 Elongation factor G (EF-G) >gi|90110715|sp|Q3JZB5|EFG_STRA1 Elongation factor G (EF-G) >gi|22534806|gb|AAN00632.1|AE014272_3 translation elongation factor G [Streptococcus agalactiae 2603V/R] >gi|76563761|gb|ABA46345.1| translation elongation factor G [Streptococcus agalactiae A909] >gi|76586407|gb|EAO62916.1| translation elongation factor G [Streptococcus agalactiae 18RS21] (692 aa)
Score = 2282, Expect = 0.0e+00, Identities = 423/684 (61%), Positives = 526/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS-ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SVQS+  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ DQ  + R  LVE VA+ D+ LM  YLEG+EI+  ++   IRK  I  +F+PVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D +E     ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  V LE+++  +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E R N QV++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDAQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQSLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYVDQANEYREKLVEAVADTDEDLMMKYLEGEEITNEELMAAIRKATINVEFYPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDEEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKSKVILESIEVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEARGNTQVVRAFVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|148994616|ref|ZP_01823758.1| elongation factor G [Streptococcus pneumoniae SP9-BS68] >gi|149006026|ref|ZP_01829755.1| elongation factor G [Streptococcus pneumoniae SP18-BS74] >gi|149017967|ref|ZP_01834426.1| elongation factor G [Streptococcus pneumoniae SP23-BS72] >gi|168484147|ref|ZP_02709099.1| translation elongation factor G [Streptococcus pneumoniae CDC1873-00] >gi|168489749|ref|ZP_02713948.1| translation elongation factor G [Streptococcus pneumoniae SP195] >gi|168493968|ref|ZP_02718111.1| translation elongation factor G [Streptococcus pneumoniae CDC3059-06] >gi|182683254|ref|YP_001835001.1| elongation factor EF-2 [Streptococcus pneumoniae CGSP14] >gi|147762382|gb|EDK69343.1| elongation factor G [Streptococcus pneumoniae SP18-BS74] >gi|147927146|gb|EDK78184.1| elongation factor G [Streptococcus pneumoniae SP9-BS68] >gi|147931531|gb|EDK82509.1| elongation factor G [Streptococcus pneumoniae SP23-BS72] >gi|172042574|gb|EDT50620.1| translation elongation factor G [Streptococcus pneumoniae CDC1873-00] >gi|182628588|gb|ACB89536.1| elongation factor EF-2 [Streptococcus pneumoniae CGSP14] >gi|183571857|gb|EDT92385.1| translation elongation factor G [Streptococcus pneumoniae SP195] >gi|183576085|gb|EDT96613.1| translation elongation factor G [Streptococcus pneumoniae CDC3059-06] (693 aa)
Score = 2282, Expect = 0.0e+00, Identities = 420/688 (61%), Positives = 530/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W N  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ DQ ++ R  L+E VA  D++LM  YLEG+EI+  ++K  IRK  I  +FFPVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL+SGSYV N  K K+ER+ R+++MHA +R EI+ + +GDI A +GLKDTTTG++L D+K  + LE++   +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASL+LKEA K   P +LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETDEELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDAEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYVLNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKSKIILESINVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|119368713|sp|Q2NJ19|EFG_AYWBP Elongation factor G (EF-G) (688 aa)
Score = 2280, Expect = 0.0e+00, Identities = 420/684 (61%), Positives = 526/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GI+AHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWMEQE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEV RSLRVLDGA+ V+DAQ GVEPQTETVWRQAS Y+VPR+IFVNKMDK GA+F  ++++++QRLGV A  IQ PIG+ENDFNGIIDL+E   + +D   +E  +   IP   +   +  R  L+E ++  D++LM  YLE K IS   +K  IRK  +   FFPVLCGS+FKNKG+  +LDAVVD+LP+P DV     +  D  E++ +  D+ PF  LAFKV TDP+VG+LTF R+YSG +K+GSYV N  K  KER  RL++MHA +R E++E   GDI A++GLK TTTG+TL  +   + LE+M F +PVI +AVEPKTKADQ+KM IAL+KLAEEDPTFK F++ ETGQTIIAGMGELHLDI+++R++REFKV+ NV  PQV++RET  +E+E EGK+I+QSGGRGQYGHV +RFEPN  KGFEFV+KIVGG +PREY+  VQ G++ A+A G LAGY +ID+KATLFDGS+H+VDSSE+AFKIAAS+ALKE     +PV+LEPIM +EV  P  Y G+ +GD++SRRG +E  E R N   I+A VPL EMFGYAT LRS +QGR  ++MQF+ Y + PKS+  EII
  S:     1 MARQFSLEKTRNIGIIAHIDAGKTTTTERILFHTGKIHKIGETHDGASQMDWMEQEQERGITITSAATTAFWKNHRINIIDTPGHVDFTVEVSRSLRVLDGAVTVIDAQAGVEPQTETVWRQASEYKVPRVIFVNKMDKVGADFAYAIETLKQRLGVHASAIQWPIGSENDFNGIIDLVEMNAFEYDNTSQETGKVVSIPSDLESITQTKRKELIETLSTLDEELMIYYLEEKPISSEMLKNSIRKATLQASFFPVLCGSSFKNKGVVKMLDAVVDYLPAPCDVAAIVGFDSDNQEIVRTGLDEEPFTALAFKVMTDPYVGKLTFFRIYSGSVKAGSYVTNTTKGTKERFGRLLQMHANSREEVKEAYTGDILAVVGLKATTTGDTLASEGQTIILESMNFPEPVIEIAVEPKTKADQDKMGIALAKLAEEDPTFKVFSNHETGQTIIAGMGELHLDIIIERLKREFKVQANVTEPQVAYRETITQETETEGKFIRQSGGRGQYGHVWMRFEPNPGKGFEFVNKIVGGVVPREYVPAVQKGIQEALAGGILAGYQIIDVKATLFDGSYHDVDSSEIAFKIAASMALKETKTKGNPVILEPIMDVEVVTPNDYVGNVIGDLTSRRGRLENQESRTNAVAIRAFVPLSEMFGYATVLRSNTQGRATFIMQFAKYEKAPKSITEEII 684
>gi|25011851|ref|NP_736246.1| elongation factor G [Streptococcus agalactiae NEM316] >gi|77414964|ref|ZP_00791056.1| translation elongation factor G [Streptococcus agalactiae 515] >gi|34395601|sp|Q8E3E7|EFG_STRA3 Elongation factor G (EF-G) >gi|24413392|emb|CAD47471.1| translation elongation factor G [Streptococcus agalactiae NEM316] >gi|77158986|gb|EAO70205.1| translation elongation factor G [Streptococcus agalactiae 515] (692 aa)
Score = 2280, Expect = 0.0e+00, Identities = 422/684 (61%), Positives = 526/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS-ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SVQS+  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IP ++ DQ  + R  LVE VA+ D+ LM  YLEG+EI+  ++   IR+  I  +F+PVLCGSAFKNKG++L+LDAV+D+LPSP+D+P  K    D +E     ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  V LE+++  +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E R N QV++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDAQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQSLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYVDQANEYREKLVEAVADTDEDLMMKYLEGEEITNEELMAAIRRATINVEFYPVLCGSAFKNKGVQLMLDAVIDYLPSPLDIPAIKGINPDTDEEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKSKVILESIEVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEARGNTQVVRAFVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|85057737|ref|YP_456653.1| elongation factor G [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789842|gb|ABC65574.1| protein translation elongation factor G [Aster yellows witches'-broom phytoplasma AYWB] (699 aa)
Score = 2279, Expect = 0.0e+00, Identities = 420/684 (61%), Positives = 526/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GI+AHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWMEQE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEV RSLRVLDGA+ V+DAQ GVEPQTETVWRQAS Y+VPR+IFVNKMDK GA+F  ++++++QRLGV A  IQ PIG+ENDFNGIIDL+E   + +D   +E  +   IP   +   +  R  L+E ++  D++LM  YLE K IS   +K  IRK  +   FFPVLCGS+FKNKG+  +LDAVVD+LP+P DV     +  D  E++ +  D+ PF  LAFKV TDP+VG+LTF R+YSG +K+GSYV N  K  KER  RL++MHA +R E++E   GDI A++GLK TTTG+TL  +   + LE+M F +PVI +AVEPKTKADQ+KM IAL+KLAEEDPTFK F++ ETGQTIIAGMGELHLDI+++R++REFKV+ NV  PQV++RET  +E+E EGK+I+QSGGRGQYGHV +RFEPN  KGFEFV+KIVGG +PREY+  VQ G++ A+A G LAGY +ID+KATLFDGS+H+VDSSE+AFKIAAS+ALKE     +PV+LEPIM +EV  P  Y G+ +GD++SRRG +E  E R N   I+A VPL EMFGYAT LRS +QGR  ++MQF+ Y + PKS+  EII
  S:    12 MARQFSLEKTRNIGIIAHIDAGKTTTTERILFHTGKIHKIGETHDGASQMDWMEQEQERGITITSAATTAFWKNHRINIIDTPGHVDFTVEVSRSLRVLDGAVTVIDAQAGVEPQTETVWRQASEYKVPRVIFVNKMDKVGADFAYAIETLKQRLGVHASAIQWPIGSENDFNGIIDLVEMNAFEYDNTSQETGKVVSIPSDLESITQTKRKELIETLSTLDEELMIYYLEEKPISSEMLKNSIRKATLQASFFPVLCGSSFKNKGVVKMLDAVVDYLPAPCDVAAIVGFDSDNQEIVRTGLDEEPFTALAFKVMTDPYVGKLTFFRIYSGSVKAGSYVTNTTKGTKERFGRLLQMHANSREEVKEAYTGDILAVVGLKATTTGDTLASEGQTIILESMNFPEPVIEIAVEPKTKADQDKMGIALAKLAEEDPTFKVFSNHETGQTIIAGMGELHLDIIIERLKREFKVQANVTEPQVAYRETITQETETEGKFIRQSGGRGQYGHVWMRFEPNPGKGFEFVNKIVGGVVPREYVPAVQKGIQEALAGGILAGYQIIDVKATLFDGSYHDVDSSEIAFKIAASMALKETKTKGNPVILEPIMDVEVVTPNDYVGNVIGDLTSRRGRLENQESRTNAVAIRAFVPLSEMFGYATVLRSNTQGRATFIMQFAKYEKAPKSITEEII 695
>gi|148544699|ref|YP_001272069.1| elongation factor G [Lactobacillus reuteri F275] >gi|184154051|ref|YP_001842392.1| translation elongation factor G [Lactobacillus reuteri F275] >gi|194466956|ref|ZP_03072943.1| translation elongation factor G [Lactobacillus reuteri 100-23] >gi|166919590|sp|A5VLK8.1|EFG_LACRF Elongation factor G (EF-G) >gi|148531733|gb|ABQ83732.1| translation elongation factor 2 (EF-2/EF-G) [Lactobacillus reuteri F275] >gi|183225395|dbj|BAG25912.1| translation elongation factor G [Lactobacillus reuteri F275] >gi|194453992|gb|EDX42889.1| translation elongation factor G [Lactobacillus reuteri 100-23] (695 aa)
Score = 2276, Expect = 0.0e+00, Identities = 415/682 (60%), Positives = 531/682 (77%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTT +ERIL+++G+IHKIGETHDG S MDWM++EKERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVER+LRVLDGA+ VLDAQ GVEPQTETVWRQA ++ VPRI+F NKMDK GANF+ SVQ+I+ RL V  +PIQ+PIGAE+DF G++DL++   Y +D  K     +   IPD  K++ ++    +VE +A+ DD LM  YLEG+EIS+ +IK  IRKG +  Q FPVL GSA+K+KGI+++LDAV+D+LPSP+DV    A+  DGNE+ ++A DD PF  LAFK+ATDPFVGRLTF+RVY+G L+SGSYV N  K+K+ER+ RL++MH+  + EI E+ +GDI A IGLK+TTTG++L D    +QLE+M F +PVI ++VEPK+KADQ+KM   L KLAEEDPTFK  T+PETG+T+IAGMGELHLDI+V+R+RREF  EV VG PQVS+RE F K +  +GK+++QSGG+GQYG V I F P K+ +GFEF D IVGG +PRE+I  V+ GL+ AM +G LAGYP++D+ A L+DGS+HEVDSSE AFK+AASLALK A K   PV+LEPIM +++ VP+   GD MG +++RRG I+G E+R N Q+I + VPL EMFGYAT LRS +QGRG + M F HY+  PKSV  +II
  S:     5 REYPLAKTRNIGIMAHIDAGKTTATERILYYTGKIHKIGETHDGASQMDWMDEEKERGITITSAATTAVWKDNRINIIDTPGHVDFTVEVERALRVLDGAVTVLDAQAGVEPQTETVWRQADQFNVPRIVFANKMDKIGANFDYSVQTIKDRLNVTPLPIQMPIGAEDDFIGLVDLVKMVAYVYDEDKLGTNWDTVEIPDDMKEEAQKRHDEMVETLADIDDNLMEKYLEGEEISVDEIKAAIRKGTLEEQIFPVLAGSAYKDKGIQMMLDAVIDYLPSPIDVKPFVAHDADGNEIELTAGDDKPFAALAFKIATDPFVGRLTFLRVYTGSLQSGSYVLNATKDKRERIGRLLQMHSNQQQEIPEVFSGDIAAAIGLKNTTTGDSLTDPDHPLQLESMDFPEPVIQVSVEPKSKADQDKMDKGLQKLAEEDPTFKAETNPETGETLIAGMGELHLDIIVERLRREFHAEVTVGKPQVSYREAFTKTASAQGKFVRQSGGKGQYGDVWIEFTPLKEGEGFEFEDAIVGGVVPREFIPAVEQGLKEAMQNGVLAGYPLVDMHAKLYDGSYHEVDSSEAAFKVAASLALKNAAKKADPVILEPIMKVDIVVPQDNMGDVMGQVTARRGTIDGMEERGNAQLIHSFVPLSEMFGYATALRSATQGRGTFTMTFDHYSAVPKSVQEDII 688
>gi|24378856|ref|NP_720811.1| elongation factor G [Streptococcus mutans UA159] >gi|34395599|sp|Q8DVV4|EFG_STRMU Elongation factor G (EF-G) >gi|24376734|gb|AAN58117.1|AE014883_3 translation elongation factor G (EF-G) [Streptococcus mutans UA159] (693 aa)
Score = 2275, Expect = 0.0e+00, Identities = 424/684 (61%), Positives = 532/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SV ++  RL   A PIQLPIGAE+DF GIIDL+  K  +Y  D G +   E+  IP  + DQ K+ R  L+E VA  D+ LM  YLEG+EI+  ++K  IRK  I  +FFPVL GSAFKNKG++++LDAVVD+LPSP+D+P  K    D + E    ASDD PF  LAFK+ TDPFVGRLTF RVYSG+L SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLK+TTTG++L D+K  V LE+++  +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF + ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE++  V+ GL  +MA+G LAGYP++D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   PV+LEP+M + +TVPE+  GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS SQGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKDHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDAQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQLPIGAEDDFEGIIDLVTMKAEIYTNDLGTDILIED--IPADYLDQAKEYREKLIEAVAETDEDLMMKYLEGEEITETELKAAIRKATINVEFFPVLAGSAFKNKGVQMMLDAVVDYLPSPLDIPPIKGVNPDTDEEEERPASDDEPFAALAFKIMTDPFVGRLTFFRVYSGILNSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKETTTGDSLTDEKAKVILESIEVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRQATQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFVPAVEKGLIESMANGVLAGYPIVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKTAKPVILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAHGNSQIVRAFVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|125975211|ref|YP_001039121.1| translation elongation factor 2 (EF-2/EF-G) [Clostridium thermocellum ATCC 27405] >gi|166201595|sp|A3DIZ9.1|EFG_CLOTH Elongation factor G (EF-G) >gi|125715436|gb|ABN53928.1| translation elongation factor 2 (EF-2/EF-G) [Clostridium thermocellum ATCC 27405] (697 aa)
Score = 2275, Expect = 0.0e+00, Identities = 419/687 (60%), Positives = 533/687 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R   L N RN GIMAHIDAGKTTT+ERILF++GR+HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A+ GVEPQ+ETVWRQA +Y+VPR+ +VNKMD  GA+F   ++ +++RL    VPIQLPIG E++F GIIDLIE K Y++     +  E++ IP+  ++  ++ R +L+E VA +D++LM  YLEG+EI+ A+IK  +RKG I  +  PVLCGS++KNKG++ LLDA+VD++PSPVD+   K    DG  E+   ASDD PF  LAFK+ +DP+VG+L F RVYSG L SGSYV N  K K+ER+ RL+ MHA +R E++ + AGDI A +GLK+TTTG+TL D+   V LE+M F +PVI +A+EPKTKA QEKM++AL KLAEEDPTF+T+TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGKYI+QSGG+GQYGH  I  EP  +  G+EFV+KIVGG IP+EYI  V AG+++AM +G LAGYP++D+K TL+DGS+HEVDSSEMAFK+AAS+A KE  K   PV+LEPIM + VTVPE Y GD +GD++SRRG IEG E R   QVI A VPL EMFGYAT LRS SQGRG + M+ SH+ E PK++  +II+ +
  S:     1 MPRQFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGSATMDWMEQEQERGITITSAATTAQWKGTRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCAKGGVEPQSETVWRQADKYKVPRMAYVNKMDIMGADFFNCIKMMKERLQANPVPIQLPIGKEDNFQGIIDLIEMKAYYYMDDLGKVIEQRDIPEDMRELAEEYRTNLLENVAEYDEELMMKYLEGEEITEAEIKAALRKGTIAVKAIPVLCGSSYKNKGVQRLLDAIVDYMPSPVDIEAIKGVSVDGETEIERHASDDEPFSALAFKIMSDPYVGKLCFFRVYSGKLSSGSYVLNATKGKRERIGRLLMMHANHREEVDMVYAGDIAAAVGLKETTTGDTLCDEANPVILESMNFPEPVIHVAIEPKTKAGQEKMALALQKLAEEDPTFRTYTDQETGQTIIAGMGELHLEIIVDRLLREFKVEANVGNPQVAYKETIRKSVKSEGKYIRQSGGKGQYGHCWIEIEPKERGTGYEFVNKIVGGVIPKEYIPAVDAGIQSAMNNGVLAGYPVVDVKVTLYDGSYHEVDSSEMAFKVAASMAFKEGMKKADPVILEPIMKVVVTVPEDYMGDVIGDLNSRRGRIEGMEARAGAQVIHAYVPLAEMFGYATALRSRSQGRGVFSMEISHFEEVPKNIQEQIISGR 689
>gi|86158371|ref|YP_465156.1| translation elongation factor 2 (EF-2/EF-G) [Anaeromyxobacter dehalogenans 2CP-C] >gi|119368667|sp|Q2IJ93|EFG1_ANADE Elongation factor G 1 (EF-G 1) >gi|85774882|gb|ABC81719.1| translation elongation factor 2 (EF-2/EF-G) [Anaeromyxobacter dehalogenans 2CP-C] (697 aa)
Score = 2272, Expect = 0.0e+00, Identities = 418/688 (60%), Positives = 522/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART  L  +RNFGIMAHIDAGKTTT+ERILF++G  HKIGE H+G +VMDWMEQE+ERGITITSAAT+  W++  LN+IDTPGHVDFT+EVERSLRVLDGA AV DA  GV+PQ+ETVWRQA +YEVPRI F+NKMD+ GA++  +V +I+++LG + +P+ +PIGAE+ F G++DL++ K + F D     K +E  IP     Q K+ RA L E VA  DD+LMA YL+GK +S  ++ R IR+G +  +FFPVLCG+AFKNKG++ +LDAVVDFLPSPVD+P  K     GN+V+   SD  PF  LAFK+  DPFVG LTF RVYSG L++GSYV N  K+KKER+ RL++MHA  R EI+E+ AGDI A +GL+ +TTG+TL  +   V LE M+F +PVI +A+EPKTK DQ+KM +AL +L  EDP+F+  TD ETGQTII GMGELHL+ILVDRM REFKVE NVG PQV++RET  +  E EG+YI+Q+GGRGQYGH  +R  P +  KGFEF + IVGG IP+E+I P+Q G+E AM SG LAGYPM+D+K  LFDGS+H+VDSSEMAFKIA S+  KE     SPVLLEPIMA+EVT P+ Y GD +GD++SRRG I     R  VQVI+A VPL EMFGYATDLRS +QGR  Y MQF+HYA+ P S+   I+   K
  S:     1 MARTTPLERYRNFGIMAHIDAGKTTTTERILFYTGVTHKIGEVHEGTTVMDWMEQERERGITITSAATTAFWRDHRLNIIDTPGHVDFTIEVERSLRVLDGACAVFDAVQGVQPQSETVWRQADKYEVPRICFINKMDRVGADYFHAVDTIREKLGARPLPLHVPIGAEDKFRGMVDLLKMKGITFDDETMGAKYQEVEIPADLAAQAKEYRAKLEETVAEIDDELMAKYLDGKPLSNDELMRGIRRGTLEMKFFPVLCGTAFKNKGVQQILDAVVDFLPSPVDIPAMKGVDAKGNDVVRKTSDAEPFSALAFKIMNDPFVGNLTFFRVYSGRLEAGSYVYNSTKDKKERIGRLLQMHANKREEIKEVYAGDIAAAVGLRASTTGDTLCAEDAPVILERMEFPEPVIHIAIEPKTKGDQDKMGVALQRLQMEDPSFRVHTDEETGQTIIGGMGELHLEILVDRMFREFKVEANVGKPQVAYRETITRTVEAEGRYIRQTGGRGQYGHCWLRLHPQEPGKGFEFENAIVGGVIPKEFISPIQKGIEEAMTSGVLAGYPMVDLKVELFDGSYHDVDSSEMAFKIAGSMGFKEGAAKASPVLLEPIMAVEVTTPDDYMGDVIGDLNSRRGKIHAMNPRAGVQVIEAHVPLAEMFGYATDLRSKTQGRATYSMQFAHYAQVPASIAETIVTKAK 690
>gi|116334272|ref|YP_795799.1| elongation factor G [Lactobacillus brevis ATCC 367] >gi|122269046|sp|Q03PV4.1|EFG_LACBA Elongation factor G (EF-G) >gi|116099619|gb|ABJ64768.1| translation elongation factor 2 (EF-2/EF-G) [Lactobacillus brevis ATCC 367] (699 aa)
Score = 2272, Expect = 0.0e+00, Identities = 416/682 (60%), Positives = 532/682 (78%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL-ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETHDG S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AVLD Q GVEPQTETVWRQAS ++VPRI+FVNKMDK GA+F+ SV SI +RL   A+ +Q+ IGAE++F G++DL+E K Y +D    G   +  E   IP   K++ ++    ++E VA+ DD++M  YLEG+EI+  ++K  IR+  +    FPV  GSAFK+KG+++L+DAVVD+LPSP+DV    A   D +E + + A DDAPF  LAFKVATDPFVGRLT++RVYSG L++GSYV N  K+K+ERV RL++MH+ +R EI E+ +GDI   IGLK+TTTG++L D    + LE+M F  PVI +AVEPKTKADQ+KM+ AL KL+EEDPTFK  T+PETG+T+I+GMGELHLDI++DRM+REFKVE N+GAPQV++RE F K + V+GK+++QSGG+GQYG V I F PN + KG+EF D IVGG +PRE+I  V  GL+ AMA+G LAGYP++D+KA L+DGS+H+VDSSE AFK+AASLAL+ A K   PV+LEPIM +++ VPE+Y GD MG +++RRG ++G E R N Q+I + VPL EMFGYAT LRS SQGRG + M F HY  TPKSV  +II
  S:     5 REFPLEKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHDGASQMDWMEQEQERGITITSAATTAEWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDGQAGVEPQTETVWRQASDFDVPRIVFVNKMDKLGADFDFSVNSIHERLQANALALQMAIGAEDEFEGVVDLVEMKAYVYDKDDLGSSWDTVE---IPADMKEEAEKRHEAMIESVADVDDEIMEKYLEGEEITKDELKAAIRRATLKLDLFPVFAGSAFKDKGVQMLMDAVVDYLPSPLDVKPYNATDPDTDEAIQLRADDDAPFAALAFKVATDPFVGRLTYIRVYSGTLEAGSYVLNSTKDKRERVGRLLQMHSNHRQEIPEVFSGDIAGAIGLKNTTTGDSLTDPDHPLHLESMDFPDPVIQVAVEPKTKADQDKMNTALQKLSEEDPTFKAETNPETGETLISGMGELHLDIIIDRMKREFKVEANIGAPQVAYREAFTKSTSVQGKFVRQSGGKGQYGDVWIEFTPNERGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMANGVLAGYPLVDVKAKLYDGSYHDVDSSEAAFKVAASLALRNAVKSAGPVILEPIMKVDILVPEEYMGDIMGQVTARRGKVDGMEARGNAQMIHSYVPLSEMFGYATTLRSASQGRGTFTMTFDHYEPTPKSVQADII 689
>gi|171854022|emb|CAM11995.1| Elongation factor G [Candidatus Phytoplasma australiense] (688 aa)
Score = 2271, Expect = 0.0e+00, Identities = 429/684 (62%), Positives = 530/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GI+AHIDAGKTTT+ERILFH+G+IHKIGETHDG S MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEV RSLRVLDGA+ V+DAQ GVEPQTETVWRQA+ Y+ PRIIFVNKMDK GANFE +V+++ QRLGV A PIQ PIGAENDF GIIDL+    + +DG  EEK +  PIP   +D  +  R  L+E ++N D++LM  YLE K IS   +K+ IRK  +   FFPVLCGS+FKNKG+  +LDA+VD+LP+P DV       E   E+    SD+ PF  LAFKV TDP+VG+LTF R+Y+G + SGSYV N  K  KER  RL++MHA +R E++E  AGDI A++GLK TTTG+TL  +   + LE+M F +PVI +AVEPKTKADQ+KM IALSKLAEEDPTF+ F++ ETGQTIIAGMGELHLDI+++R++REFK++ N  APQV++RET  +E+E EGK+I+QSGGRGQYGHV +RFEPN  KGFEFV+KIVGG +PREY+  VQ G++ A+A G LAGYP++DIKATLFDGS+H+VDSSEMAFKIAAS++LKE     +PV+LEPIM +EV  P  Y G+ +GD++SRRG +E  E R N   IKA VPL EMFGYAT LRS +QGR  ++MQF+ Y +TPKS+  EII
  S:     1 MARQFTLEKTRNIGIIAHIDAGKTTTTERILFHTGKIHKIGETHDGASQMDWMEQEQERGITITSAATTAFWKDHRVNIIDTPGHVDFTVEVSRSLRVLDGAVTVIDAQAGVEPQTETVWRQATEYKAPRIIFVNKMDKIGANFEYAVETLNQRLGVHANPIQWPIGAENDFTGIIDLVTLTAFEYDGSPEEKGKPIPIPSSLQDVAELKRNELIESLSNLDEELMLLYLEEKPISAEVLKKAIRKATLQASFFPVLCGSSFKNKGVVKMLDAIVDYLPAPCDVAPIVGIDEKNKEITRLNSDEEPFTALAFKVMTDPYVGKLTFFRIYAGKVNSGSYVFNTTKGTKERFGRLLQMHANSREEVKEAYAGDILAVVGLKGTTTGDTLAAEGQTIVLESMNFPEPVIEIAVEPKTKADQDKMGIALSKLAEEDPTFRVFSNHETGQTIIAGMGELHLDIIMERLKREFKIQANTTAPQVAYRETITQETETEGKFIRQSGGRGQYGHVWMRFEPNPGKGFEFVNKIVGGVVPREYVPAVQKGIQEALAGGILAGYPIVDIKATLFDGSYHDVDSSEMAFKIAASMSLKETKTKGNPVILEPIMNVEVVTPNDYVGNVIGDLTSRRGRLENQETRANAIAIKALVPLSEMFGYATVLRSNTQGRATFIMQFAKYEKTPKSITEEII 684
>gi|121534756|ref|ZP_01666577.1| translation elongation factor G [Thermosinus carboxydivorans Nor1] >gi|121306776|gb|EAX47697.1| translation elongation factor G [Thermosinus carboxydivorans Nor1] (692 aa)
Score = 2269, Expect = 0.0e+00, Identities = 426/688 (61%), Positives = 529/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE HDG + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GVEPQ+ETVWRQA +Y VPRI +VNKMD  GA+F R ++ ++ RLG   VPIQLPIG E+ F GIIDLIE K  VY  D GK  +A +  IP+  ++Q +  R +L++ VA  DD+LM  YLEG+E+++ +IK  IRK  I C+  PVLCGS+++NKG++ LLDAVVD+LP+P D+P  +    D G E    A DD PF  LAFK+  DP+VG+LTF RVYSG L SGSYV N  K KKER+ R+++MHA +R EI+E+  GDI A +GLKDTTTG+TL D+K  + LE+M F +PVIS+AVEPKTKADQEKMSIAL +LAEEDPTF+ +TD ETGQTII GMGELHL+I+VDRM REFKV+ NVG PQV++RET  K  + EGK+++QSGGRGQYGH  +  EP    KGF F +KIVGG IP+EYI  +++G++ AM +G LAGYPM+DIK T++DGS+H+VDSSEMAFKIA S+  K   +   PVLLEP M +EVTVPE+Y GD +GD++SRRG IEG E R  VQ I+A VPL EMFGYATDLRS +QGRGNY M+F HY E PK++ + I+A  K
  S:     1 MARQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHDGAATMDWMVQEQERGITITSAATTCQWKGHRINIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVEPQSETVWRQADKYGVPRIAYVNKMDIIGADFYRVIEMMKTRLGANPVPIQLPIGFEDTFKGIIDLIEMKAIVYTDDLGKTSEATD--IPEDMREQAELYRQNLLDAVAESDDELMMKYLEGEELTVEEIKAGIRKATIACKMTPVLCGSSYRNKGVQPLLDAVVDYLPAPTDIPAIRGINPDTGAEDYREAKDDLPFSALAFKIMADPYVGKLTFFRVYSGKLTSGSYVYNSTKGKKERIGRILQMHANHREEIDEVCTGDIAAAVGLKDTTTGDTLCDEKNPIILESMVFPEPVISVAVEPKTKADQEKMSIALQRLAEEDPTFRMYTDQETGQTIIQGMGELHLEIIVDRMLREFKVDCNVGKPQVAYRETIRKAVKAEGKFVRQSGGRGQYGHCWLEIEPLEPGKGFIFENKIVGGVIPKEYIPAIESGVKEAMENGVLAGYPMVDIKVTVYDGSYHDVDSSEMAFKIAGSMGFKAGAQKADPVLLEPYMKVEVTVPEEYMGDVIGDLNSRRGRIEGMEARAGVQAIRAFVPLAEMFGYATDLRSKTQGRGNYSMEFDHYEEVPKNIADAIVAKVK 690
>gi|167456827|ref|ZP_02323044.1| translation elongation factor G [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417117|gb|EDR83826.1| translation elongation factor G [Anaeromyxobacter dehalogenans 2CP-1] (697 aa)
Score = 2267, Expect = 0.0e+00, Identities = 417/688 (60%), Positives = 522/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M RT  L  +RNFGIMAHIDAGKTTT+ERILF++G  HKIGE H+G +VMDWMEQE+ERGITITSAAT+  W++  LN+IDTPGHVDFT+EVERSLRVLDGA AV DA  GV+PQ+ETVWRQA +YEVPRI F+NKMD+ GA++  +V +I+++LG + +P+ +PIGAE+ F G++DL++ K + F D     K +E  IP    +Q K+ RA L E VA  DD+LMA YL+GK +S  ++ R IR+G +  +FFPVLCG+AFKNKG++ +LDAVVDFLPSPVD+P  K     GN+V+   SD  PF  LAFK+  DPFVG LTF RVYSG L++GSYV N  K+KKER+ RL++MHA  R EI+E+ AGDI A +GL+ +TTG+TL  +   V LE M+F +PVI +A+EPKTK DQ+KM +AL +L  EDP+F+  TD ETGQTII GMGELHL+ILVDRM REFKVE NVG PQV++RET  K  E EG+YI+Q+GGRGQYGH  +R  P +  KGFEF + IVGG IP+E+I P+Q G+E AM SG LAGYPM+D+K  +FDGS+H+VDSSEMAFKIA S+  KE     SPVLLEPIMA+EVT P+ Y GD +GD++SRRG I     R  VQVI+A VPL EMFGYATDLRS +QGR  Y MQF+HYA+ P S+   I+   K
  S:     1 MPRTTPLERYRNFGIMAHIDAGKTTTTERILFYTGVTHKIGEVHEGTTVMDWMEQERERGITITSAATTAFWRDHRLNIIDTPGHVDFTIEVERSLRVLDGACAVFDAVQGVQPQSETVWRQADKYEVPRICFINKMDRVGADYFHAVDTIREKLGARPLPLHVPIGAEDKFRGMVDLLKMKGITFDDETMGAKYQEVEIPADLAEQAKEYRAKLEETVAEIDDELMAKYLDGKALSNDELMRGIRRGTLEMKFFPVLCGTAFKNKGVQQILDAVVDFLPSPVDIPAMKGVDAKGNDVVRKTSDAEPFSALAFKIMNDPFVGNLTFFRVYSGKLEAGSYVYNSTKDKKERIGRLLQMHANKREEIKEVYAGDIAAAVGLRASTTGDTLCAEDSPVILERMEFPEPVIHIAIEPKTKGDQDKMGVALQRLQMEDPSFRVHTDEETGQTIIGGMGELHLEILVDRMFREFKVEANVGKPQVAYRETITKTVEAEGRYIRQTGGRGQYGHCWLRLHPQEPGKGFEFDNVIVGGVIPKEFISPIQKGIEEAMTSGVLAGYPMVDLKVEVFDGSYHDVDSSEMAFKIAGSMGFKEGAAKASPVLLEPIMAVEVTTPDDYMGDVIGDLNSRRGKIHAMNPRAGVQVIEAHVPLAEMFGYATDLRSKTQGRATYSMQFAHYAQVPTSIAETIVTKAK 690
>gi|195977415|ref|YP_002122659.1| elongation factor G [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974120|gb|ACG61646.1| elongation factor G [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (692 aa)
Score = 2266, Expect = 0.0e+00, Identities = 419/688 (60%), Positives = 525/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SVQ++  RL   A PIQLPIG+E+DF GIIDLI+ K   +         E+ IPD++ +Q ++ R  L+E VA  D+ LM  YLEG+EI+  ++   IRK  I  +FFPVLCGSAFKNKG++L+LDAV+ +LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  + LE+++  +PVI L VEPK+KADQ+KM IAL KLAEEDPTF+  T+ ETG+T+IAGMGELHLD+LVDRMRREFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E     Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPDEYLEQAQEYREKLIEAVAETDEDLMMKYLEGEEITNEELVAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSPLDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVMNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILESIEVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVIAGMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKTAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAHGTSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|15674452|ref|NP_268626.1| elongation factor G [Streptococcus pyogenes M1 GAS] >gi|19745405|ref|NP_606541.1| elongation factor G [Streptococcus pyogenes MGAS8232] >gi|21909736|ref|NP_664004.1| elongation factor G [Streptococcus pyogenes MGAS315] >gi|28895118|ref|NP_801468.1| elongation factor G [Streptococcus pyogenes SSI-1] >gi|50913610|ref|YP_059582.1| elongation factor G [Streptococcus pyogenes MGAS10394] >gi|71902892|ref|YP_279695.1| elongation factor G [Streptococcus pyogenes MGAS6180] >gi|71910046|ref|YP_281596.1| elongation factor G [Streptococcus pyogenes MGAS5005] >gi|94987865|ref|YP_595966.1| elongation factor G [Streptococcus pyogenes MGAS9429] >gi|94989741|ref|YP_597841.1| elongation factor G [Streptococcus pyogenes MGAS10270] >gi|94993623|ref|YP_601721.1| elongation factor G [Streptococcus pyogenes MGAS10750] >gi|57012632|sp|Q5XDW4|EFG_STRP6 Elongation factor G (EF-G) >gi|57013825|sp|P69946|EFG_STRP1 Elongation factor G (EF-G) >gi|57013826|sp|P69947|EFG_STRP3 Elongation factor G (EF-G) >gi|57013827|sp|P69948|EFG_STRP8 Elongation factor G (EF-G) >gi|90110716|sp|Q48VB6|EFG_STRPM Elongation factor G (EF-G) >gi|119368771|sp|Q1JNH7|EFG_STRPC Elongation factor G (EF-G) >gi|119368772|sp|Q1JIM6|EFG_STRPD Elongation factor G (EF-G) >gi|119368773|sp|Q1J8I4|EFG_STRPF Elongation factor G (EF-G) >gi|13621548|gb|AAK33347.1| translation elongation factor G, EF-G [Streptococcus pyogenes M1 GAS] >gi|19747514|gb|AAL97040.1| elongation factor G [Streptococcus pyogenes MGAS8232] >gi|21903920|gb|AAM78807.1| elongation factor G [Streptococcus pyogenes MGAS315] >gi|28810363|dbj|BAC63301.1| putative translation elongation factor G, EF-G [Streptococcus pyogenes SSI-1] >gi|50902684|gb|AAT86399.1| Translation Elongation Factor G [Streptococcus pyogenes MGAS10394] >gi|71801987|gb|AAX71340.1| protein translation elongation factor G [Streptococcus pyogenes MGAS6180] >gi|71852828|gb|AAZ50851.1| protein translation elongation factor G [Streptococcus pyogenes MGAS5005] >gi|94541373|gb|ABF31422.1| translation elongation factor G (EF-G) [Streptococcus pyogenes MGAS9429] >gi|94543249|gb|ABF33297.1| translation elongation factor G (EF-G) [Streptococcus pyogenes MGAS10270] >gi|94547131|gb|ABF37177.1| translation elongation factor G (EF-G) [Streptococcus pyogenes MGAS10750] (692 aa)
Score = 2264, Expect = 0.0e+00, Identities = 419/688 (60%), Positives = 526/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SVQ++  RL   A PIQLPIGAE+DF GIIDLI+ K   +         E+ IP+++ +Q ++ R  L+E VA  D+ LM  YLEG+EI+  ++   IRK  I  +FFPVLCGSAFKNKG++L+LDAV+ +LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + AGDI A +GLKDTTTG++L D+K  V LE+++  +PVI L VEPK+KADQ+KM +AL KLAEEDPTF+  T+ ETG+T+IAGMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQLPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETDEDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSPLDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVMNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILESIEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|163768750|ref|ZP_02175733.1| translation elongation factor G [Anaeromyxobacter sp. K] >gi|196172186|gb|ACG73159.1| translation elongation factor G [Anaeromyxobacter sp. K] (697 aa)
Score = 2262, Expect = 0.0e+00, Identities = 416/688 (60%), Positives = 521/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M RT  L  +RNFGIMAHIDAGKTTT+ERILF++G  HKIGE H+G +VMDWMEQE+ERGITITSAAT+  W++  LN+IDTPGHVDFT+EVERSLRVLDGA AV DA  GV+PQ+ETVWRQA +YEVPRI F+NKMD+ GA++  +V +I+++LG + +P+ +PIGAE+ F G++DL++ K + F D     K +E  IP    +Q K+ RA L E VA  DD+LMA YL+GK +   ++ R IR+G +  +FFPVLCG+AFKNKG++ +LDAVVDFLPSPVD+P  K     GN+V+   SD  PF  LAFK+  DPFVG LTF RVYSG L++GSYV N  K+KKER+ RL++MHA  R EI+E+ AGDI A +GL+ +TTG+TL  +   V LE M+F +PVI +A+EPKTK DQ+KM +AL +L  EDP+F+  TD ETGQTII GMGELHL+ILVDRM REFKVE NVG PQV++RET  K  E EG+YI+Q+GGRGQYGH  +R  P +  KGFEF + IVGG IP+E+I P+Q G+E AM SG LAGYPM+D+K  +FDGS+H+VDSSEMAFKIA S+  KE     SPVLLEPIMA+EVT P+ Y GD +GD++SRRG I     R  VQVI+A VPL EMFGYATDLRS +QGR  Y MQF+HYA+ P S+   I+   K
  S:     1 MPRTTPLERYRNFGIMAHIDAGKTTTTERILFYTGVTHKIGEVHEGTTVMDWMEQERERGITITSAATTAFWRDHRLNIIDTPGHVDFTIEVERSLRVLDGACAVFDAVQGVQPQSETVWRQADKYEVPRICFINKMDRVGADYFHAVDTIREKLGARPLPLHVPIGAEDKFRGMVDLLKMKGITFDDETMGAKYQEVEIPADLAEQAKEYRAKLEETVAEIDDELMAKYLDGKPLGNDELMRGIRRGTLEMKFFPVLCGTAFKNKGVQQILDAVVDFLPSPVDIPAMKGVDAKGNDVVRKTSDAEPFSALAFKIMNDPFVGNLTFFRVYSGKLEAGSYVYNSTKDKKERIGRLLQMHANKREEIKEVYAGDIAAAVGLRASTTGDTLCAEDSPVILERMEFPEPVIHIAIEPKTKGDQDKMGVALQRLQMEDPSFRVHTDEETGQTIIGGMGELHLEILVDRMFREFKVEANVGKPQVAYRETITKTVEAEGRYIRQTGGRGQYGHCWLRLHPQEPGKGFEFDNAIVGGVIPKEFISPIQKGIEEAMTSGVLAGYPMVDLKVEVFDGSYHDVDSSEMAFKIAGSMGFKEGAAKASPVLLEPIMAVEVTTPDDYMGDVIGDLNSRRGKIHAMNPRAGVQVIEAHVPLAEMFGYATDLRSKTQGRATYSMQFAHYAQVPTSIAETIVTKAK 690
>gi|139473090|ref|YP_001127805.1| elongation factor G [Streptococcus pyogenes str. Manfredo] >gi|166220176|sp|A2RCI2.1|EFG_STRPG Elongation factor G (EF-G) >gi|134271336|emb|CAM29554.1| elongation factor G (EF-G) [Streptococcus pyogenes str. Manfredo] (692 aa)
Score = 2257, Expect = 0.0e+00, Identities = 417/688 (60%), Positives = 526/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  W    +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  SVQ++  RL   A PIQLPIGAE+DF GIIDLI+ K   +         E+ IP+++ +Q ++ R  L+E VA  D+ LM  YLEG++I+  ++   IRK  I  +FFPVLCGSAFKNKG++L+LDAV+ +LPSP+D+P  K    D + E    ASD+ PF  LAFK+ TDPFVGRLTF RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EIE + +GDI A +GLKDTTTG++L D+K  V LE+++  +PVI L VEPK+KADQ+KM +AL KLAEEDPTF+  T+ ETG+T+IAGMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF   ++  G + +QSGG+GQ+G V I F PN++ KGFEF + IVGG +PRE+I  V+ GL  +MA+G LAGYPM+D+KA L+DGS+H+VDSSE AFKIAASLALKEA K   P +LEP+M + +T PE   GD MG +++RRG ++G E   N Q+++A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII   K
  S:     1 MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQLPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETDEDLMMKYLEGEKITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSPLDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVMNTSKGKRERIGRILQMHANSRQEIETVYSGDIAAAVGLKDTTTGDSLTDEKAKVILESIEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNK 690
>gi|15923537|ref|NP_371071.1| elongation factor G [Staphylococcus aureus subsp. aureus Mu50] >gi|15926225|ref|NP_373758.1| elongation factor G [Staphylococcus aureus subsp. aureus N315] >gi|21282231|ref|NP_645319.1| elongation factor G [Staphylococcus aureus subsp. aureus MW2] >gi|49482777|ref|YP_040001.1| elongation factor G [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485412|ref|YP_042633.1| elongation factor G [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651423|ref|YP_185479.1| elongation factor G [Staphylococcus aureus subsp. aureus COL] >gi|82750255|ref|YP_415996.1| elongation factor G [Staphylococcus aureus RF122] >gi|87161750|ref|YP_493235.1| elongation factor G [Staphylococcus aureus subsp. aureus USA300] >gi|88194309|ref|YP_499101.1| elongation factor G [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267007|ref|YP_001245950.1| elongation factor G [Staphylococcus aureus subsp. aureus JH9] >gi|150393054|ref|YP_001315729.1| elongation factor G [Staphylococcus aureus subsp. aureus JH1] >gi|156978876|ref|YP_001441135.1| elongation factor G [Staphylococcus aureus subsp. aureus Mu3] >gi|166220175|sp|A7WYX4.1|EFG_STAA1 Elongation factor G (EF-G) >gi|189027971|sp|A6TZ24.1|EFG_STAA2 Elongation factor G (EF-G) >gi|189027972|sp|A5IQA1.1|EFG_STAA9 Elongation factor G (EF-G) >gi|56748915|sp|Q6GBU0|EFG_STAAS Elongation factor G (EF-G) >gi|56748926|sp|Q6GJC1|EFG_STAAR Elongation factor G (EF-G) >gi|56749829|sp|P68788|EFG_STAAM Elongation factor G (EF-G) >gi|56749830|sp|P68789|EFG_STAAN Elongation factor G (EF-G) >gi|56749831|sp|P68790|EFG_STAAU Elongation factor G (EF-G) (85 kDa vitronectin-binding protein) >gi|56749832|sp|P68791|EFG_STAAW Elongation factor G (EF-G) >gi|62286647|sp|Q5HIC8|EFG_STAAC Elongation factor G (EF-G) >gi|119368768|sp|Q2FJ93|EFG_STAA3 Elongation factor G (EF-G) >gi|119368769|sp|Q2G0N1|EFG_STAA8 Elongation factor G (EF-G) >gi|119368770|sp|Q2YSB4|EFG_STAAB Elongation factor G (EF-G) >gi|4582216|emb|CAB40191.1| elongation factor G (EF-G) [Staphylococcus aureus] >gi|13700438|dbj|BAB41736.1| translational elongation factor G [Staphylococcus aureus subsp. aureus N315] >gi|14246315|dbj|BAB56709.1| translational elongation factor G [Staphylococcus aureus subsp. aureus Mu50] >gi|21203667|dbj|BAB94367.1| translational elongation factor G [Staphylococcus aureus subsp. aureus MW2] >gi|49240906|emb|CAG39573.1| translation elongation factor G [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243855|emb|CAG42280.1| translation elongation factor G [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285609|gb|AAW37703.1| translation elongation factor G [Staphylococcus aureus subsp. aureus COL] >gi|82655786|emb|CAI80186.1| translation elongation factor G (EF-G) [Staphylococcus aureus RF122] >gi|87127724|gb|ABD22238.1| translation elongation factor G [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201867|gb|ABD29677.1| translation elongation factor G [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740076|gb|ABQ48374.1| translation elongation factor 2 (EF-2/EF-G) [Staphylococcus aureus subsp. aureus JH9] >gi|149945506|gb|ABR51442.1| translation elongation factor G [Staphylococcus aureus subsp. aureus JH1] >gi|156721011|dbj|BAF77428.1| translational elongation factor G [Staphylococcus aureus subsp. aureus Mu3] (693 aa)
Score = 2256, Expect = 0.0e+00, Identities = 430/688 (62%), Positives = 531/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG--NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+ +W+   +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANFE SV ++  RL   A PIQLPIGAE++F  IIDL+E K + +      + EE  IP+   D+ ++ RA L+E VA   D+LM  YL  +EIS++++K  IR+     +F+PVLCG+AFKNKG++L+LDAV+D+LPSP+DV     +       EV+  A D A F  LAFKV TDP+VG+LTF RVYSG + SGSYVKN  K K+ERV RL++MHA +R EI+ + +GDI A +GLKDT TG+TL  +K D+ LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF   TD ETGQ II GMGELHLDILVDRM++EF VE NVGAP VS+RETF   ++V+GK+ +QSGGRGQYG V I F PN+   GFEF + IVGG +PREYI  V+AGL++AM +G LAGYP+ID+KA L+DGS+H+VDSSEMAFKIAASLALKEA K C PV+LEP+M + + +PE+Y GD MGD++SRRG ++G E R N QV+ A VPL EMFGYAT LRS +QGRG Y M F HYAE PKS+  +II   K
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSELKEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVIAKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHANSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIAEDIIKKNK 691
>gi|151220721|ref|YP_001331543.1| elongation factor G [Staphylococcus aureus subsp. aureus str. Newman] >gi|172048781|sp|A6QEJ9.1|EFG_STAAE Elongation factor G (EF-G) >gi|150373521|dbj|BAF66781.1| translation elongation factor G (EF-G) [Staphylococcus aureus subsp. aureus str. Newman] (693 aa)
Score = 2251, Expect = 0.0e+00, Identities = 429/688 (62%), Positives = 530/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG--NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERIL+++GRIHKIGETH+G S MDWMEQE++RGITITSAAT+ +W+   +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+FVNKMDK GANFE SV ++  RL   A PIQLPIGAE++F  IIDL+E K + +      + EE  IP+   D+ ++ RA L+E VA   D+LM  YL  +EIS++++K  IR+     +F+PVLCG+AFKNKG++L+LDAV+D+LPSP+DV     +       EV+  A D A F  LAFKV TDP+VG+LTF RVYSG + SGSYVKN  K K+ERV RL++MHA +R EI+ + +GDI A +GLKDT TG+TL  +K D+ LE+M+F +PVI L+VEPK+KADQ+KM+ AL KL EEDPTF   TD ETGQ II GMGELHLDILVDRM++EF VE NVGAP VS+RETF   ++V+GK+ +QSGGRGQYG V I F PN+   GFEF + IVGG +PREYI  V+AGL++AM +G LAGYP+ID+KA L+DGS+H+VDSSEMAFKIAASLALKEA K C PV+LEP+M + + +PE+Y GD MGD++SRRG ++G E R N QV+ A VPL EM GYAT LRS +QGRG Y M F HYAE PKS+  +II   K
  S:     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSELKEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVIAKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHANSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMLGYATSLRSHTQGRGTYTMYFDHYAEIPKSIAEDIIKKNK 691
>gi|167749854|ref|ZP_02421981.1| hypothetical protein EUBSIR_00822 [Eubacterium siraeum DSM 15702] >gi|167657166|gb|EDS01296.1| hypothetical protein EUBSIR_00822 [Eubacterium siraeum DSM 15702] (692 aa)
Score = 2249, Expect = 0.0e+00, Identities = 419/687 (60%), Positives = 536/687 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR V L   RN GIMAHIDAGKTTT+ERILF++G  HKIGETHDG + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDG++ VL A+ GVEPQ+ETVWRQA +Y VPR+ ++NKMD  GA+F   V  ++ RL   AVPIQLPIGAE+ F GI+DLIE K  +Y+ D GK+ + EE  IPD  K++ ++    L+E VA  D++LM  YLEG+EI++ +IK  +RK  I  +  PV CG+++KNKG++ LLDA+VD++PSP+DVP  K    E G EV   A DD PF  LAFK+ATDPFVG+L F RVYSG++ +GS V N  K+KKER+ R+++MHA +R ++E    GDI A +G+K+TTTG+TL D+   V LE+M+F +PVISLA+EPKTKA QEKM+IAL+KLAEEDPTF+T+T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++ET    ++V+ KY +QSGG+GQYGHVK+   PN+  KG+EF++ IVGG IP+EYI  V AG++ A+ SG LAGY  +D+K  L+DGS+HEVDSSEMAFKIA S+A+KEA +  +PV+LEPIM + VTVPE+Y GD +GD+SSRRG I+G E R+ V+ I A VPL EMFGY+ DLRS SQGRG YVM+ SHY + PKS+ + II+ +
  S:     1 MARDVTLEMTRNIGIMAHIDAGKTTTTERILFYTGINHKIGETHDGSATMDWMEQEQERGITITSAATTAYWKKHRINIIDTPGHVDFTVEVERSLRVLDGSVTVLCAKGGVEPQSETVWRQADKYHVPRMAYINKMDIMGADFYNVVSMMKDRLKCNAVPIQLPIGAEDTFRGIVDLIEMKADIYYDDLGKDMRVEE--IPDDMKEKAQEYHDALIEAVAEQDEELMNKYLEGEEITVEEIKAVLRKATIDNEIVPVTCGTSYKNKGVQKLLDAIVDYMPSPLDVPSIKGVNPETGEEVERHAGDDQPFSALAFKIATDPFVGKLCFFRVYSGIVAAGSTVLNATKDKKERMGRILQMHANHRADLEVCYCGDIAAAVGVKNTTTGDTLCDENNPVILESMEFPEPVISLAIEPKTKAGQEKMAIALAKLAEEDPTFRTYTNEETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKETITTNADVDTKYARQSGGKGQYGHVKLHVYPNESGKGYEFINAIVGGSIPKEYIPAVDAGIQGALQSGVLAGYQTVDVKVELYDGSYHEVDSSEMAFKIAGSMAIKEACRKANPVILEPIMKVVVTVPEEYMGDVIGDLSSRRGEIQGMEDRNGVKQINAFVPLSEMFGYSNDLRSKSQGRGQYVMEPSHYIQVPKSIADGIISKR 689
>gi|104773540|ref|YP_618520.1| elongation factor G [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|119368736|sp|Q1GBM0|EFG_LACDA Elongation factor G (EF-G) >gi|103422621|emb|CAI97229.1| Translation elongation factor G (EF-G) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (694 aa)
Score = 2247, Expect = 0.0e+00, Identities = 407/682 (59%), Positives = 523/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G+S MDWME+EKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA  Y VPRI+FVNKMDK GANF+ SV+S+ +RL   A+ +Q+PIGAE+ F G+IDL +     +D  K   K E  P+PD++K++ +  R  ++EE+A  DD +M  +L G+EIS  ++K  +R+  +  + FPV  GSAFKNKG++++LD VVD+LPSP+DV    A+ ++GNEV + A D+ PF  LAFK+ATDPFVGRLTF+RVY+G LKSGSYV N  KN++ERV RL++MHA +R EI E+ +GDI   IGLKDTTTG++L D    + LE++    PVI ++VEPK+KAD++KM +AL KL EEDPTF+  T+PETG+T+I+GMGELHLDI+V+RM+REF VE  +G PQV++RETF   ++ +GK+++QSGG+GQYG V I F PN+ KG+EF D IVGG +PREYI  V AGL+ AM +G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AASLALK A      V+LEPIM ++V  PE+Y GD MG I++RRG +EG E R   +VI A VPL EMFGYAT LRS +QGRG + M   HY+  PKS+  EII
  S:     5 REFSLEKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGDSQMDWMEEEKERGITITSAATTAQWKDHRINIIDTPGHVDFTIEVERSLRVLDGAVTVLDAQSGVEPQTENVWRQAENYGVPRIVFVNKMDKIGANFDFSVKSLHERLNANAIAVQMPIGAEDQFEGVIDLFDMVADVYDEDKLGAKWETIPVPDEYKEEAESRREEMIEEIAEVDDDIMEKFLGGEEISNEELKAALRRATLDLKAFPVFAGSAFKNKGVQMMLDGVVDYLPSPLDVKPYIAHDKEGNEVELLADDNKPFAALAFKIATDPFVGRLTFIRVYTGSLKSGSYVLNASKNQRERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKDTTTGDSLTDPAHPLILESLDIPAPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGETLISGMGELHLDIMVERMKREFNVEATIGEPQVAYRETFTVPTQAQGKFVRQSGGKGQYGDVWIEFTPNEGKGYEFEDAIVGGVVPREYIPSVDAGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASLALKNAASKAGAVILEPIMKVQVIAPEEYLGDVMGSITARRGQMEGMEDRAGAKVINAMVPLSEMFGYATTLRSSTQGRGTFTMVMDHYSPCPKSIQAEII 687
>gi|116513537|ref|YP_812443.1| elongation factor G [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275693|sp|Q04C17.1|EFG_LACDB Elongation factor G (EF-G) >gi|116092852|gb|ABJ58005.1| translation elongation factor 2 (EF-2/EF-G) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (694 aa)
Score = 2244, Expect = 0.0e+00, Identities = 406/682 (59%), Positives = 523/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G+S MDWME+EKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA  Y VPRI+FVNKMDK GANF+ SV+S+ +RL   A+ +Q+PIGAE+ F G+IDL +     +D  K   K E  P+PD++K++ +  R  ++EE+A  DD +M  +L G+EIS  ++K  +R+  +  + FPV  GSAFKNKG++++LD VVD+LPSP+DV    A+ ++GNEV + A D+ PF  LAFK+ATDPFVGRLTF+RVY+G L+SGSYV N  KN++ERV RL++MHA +R EI E+ +GDI   IGLKDTTTG++L D    + LE++    PVI ++VEPK+KAD++KM +AL KL EEDPTF+  T+PETG+T+I+GMGELHLDI+V+RM+REF VE  +G PQV++RETF   ++ +GK+++QSGG+GQYG V I F PN+ KG+EF D IVGG +PREYI  V AGL+ AM +G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AASLALK A      V+LEPIM ++V  PE+Y GD MG I++RRG +EG E R   +VI A VPL EMFGYAT LRS +QGRG + M   HY+  PKS+  EII
  S:     5 REFSLEKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGDSQMDWMEEEKERGITITSAATTAQWKDHRINIIDTPGHVDFTIEVERSLRVLDGAVTVLDAQSGVEPQTENVWRQAENYGVPRIVFVNKMDKIGANFDFSVKSLHERLNANAIAVQMPIGAEDQFEGVIDLFDMVADVYDEDKLGAKWETIPVPDEYKEEAESRREEMIEEIAEVDDDIMEKFLGGEEISNEELKAALRRATLDLKAFPVFAGSAFKNKGVQMMLDGVVDYLPSPLDVKPYIAHDKEGNEVELLADDNKPFAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNQRERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKDTTTGDSLTDPAHPLILESLDIPAPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGETLISGMGELHLDIMVERMKREFNVEATIGEPQVAYRETFTVPTQAQGKFVRQSGGKGQYGDVWIEFTPNEGKGYEFEDAIVGGVVPREYIPSVDAGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASLALKNAASKAGAVILEPIMKVQVIAPEEYLGDVMGSITARRGQMEGMEDRAGAKVINAMVPLSEMFGYATTLRSSTQGRGTFTMVMDHYSPCPKSIQAEII 687
>gi|116624205|ref|YP_826361.1| translation elongation factor 2 (EF-2/EF-G) [Solibacter usitatus Ellin6076] >gi|122253080|sp|Q01W89.1|EFG_SOLUE Elongation factor G (EF-G) >gi|116227367|gb|ABJ86076.1| translation elongation factor 2 (EF-2/EF-G) [Solibacter usitatus Ellin6076] (697 aa)
Score = 2244, Expect = 0.0e+00, Identities = 414/685 (60%), Positives = 519/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE--VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  L   RN GI AHIDAGKTTT+ERILF++G+ HKIGE H+G +VMDWMEQE+ERGITITSAAT+  W++  +N+IDTPGHVDFT EVERSLRVLDGA+AV DA  GV+PQ+ETVWRQA +Y VPRI F+NKMD+ GA+F  SV +I  RL  + VPIQLPIGAE  F GI+DL+E + + + D     K +   IPD  KD+ K+ R H++E ++  D+ LM  ++EG+ IS  +I+  IRK  I  Q FPV+CG+AFKNKG++ +LDAVVD+LPSP+DVP  +    D  E  ++  ASD+ PF  L FK+ TDP+VG+L F RVYSG +KSG  V NV K + ERV RL++MHA  R EI+EI AGDICA +GLK  +TG+T+ DD   + LEA+ F  PVI LAVEPKTKADQEKM +A+ KLA+EDPTF+ +TDPETGQTI++GMGELHL+I+VDRM REF V  NVG PQV++RET  K SE EG+++KQ+GG GQYGHVKIR EP     GFEFV+ + GGRIP+EYI P + G++ A+  G LAGYPM D+K TL+DGS+H+VDSSEMAFKIA S+A+KEA K   PVLLEPIMA+EV VPE Y GD +GD+  RRG IEGTE R N ++IK+ VPL  MFGYATD+RS +QGRG++ M F  Y E P +   EI++
  S:     1 MARTTPLERMRNIGIAAHIDAGKTTTTERILFYTGKSHKIGEVHEGTAVMDWMEQEQERGITITSAATTCEWRDIQINIIDTPGHVDFTAEVERSLRVLDGAVAVFDAVAGVQPQSETVWRQADKYSVPRICFINKMDRVGADFYHSVDTIVDRLKCRPVPIQLPIGAEEKFLGIVDLVEMRGIIWRDETMGAKYDVIEIPDDLKDKAKEYREHMIEAISEHDEALMHKFIEGQPISNDEIRAGIRKATIALQIFPVICGTAFKNKGVQTMLDAVVDYLPSPLDVPAIEGLDVDDPEKTLIRHASDNEPFSALVFKIMTDPYVGQLAFFRVYSGSMKSGGSVFNVAKRRNERVGRLLRMHANKREEIQEIFAGDICAAVGLKTISTGDTICDDAHPIVLEAIDFPMPVIQLAVEPKTKADQEKMGMAIQKLAQEDPTFRVYTDPETGQTILSGMGELHLEIIVDRMMREFGVGANVGKPQVAYRETIRKNSEAEGRHVKQTGGHGQYGHVKIRVEPLPSGTGFEFVNDVTGGRIPKEYINPTEMGIKEALEGGILAGYPMSDVKVTLYDGSYHDVDSSEMAFKIAGSMAIKEAAKRAKPVLLEPIMAVEVVVPEDYMGDVIGDLYGRRGRIEGTELRGNTRIIKSMVPLSAMFGYATDIRSRTQGRGSFTMHFGKYEEVPAAQAEEIVS 689
>gi|78043084|ref|YP_361122.1| elongation factor G [Carboxydothermus hydrogenoformans Z-2901] >gi|90110688|sp|Q3A9R2|EFG_CARHZ Elongation factor G (EF-G) >gi|77995199|gb|ABB14098.1| translation elongation factor G [Carboxydothermus hydrogenoformans Z-2901] (692 aa)
Score = 2243, Expect = 0.0e+00, Identities = 421/688 (61%), Positives = 529/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L   RN GIMAHIDAGKTTT+ERILF++G++HK+GE HDG + MDWM QE+ERGITITSAAT+  WKN  +N+IDTPGHVDFTVEVERSLRVLDGA+A+  A  GVEPQ+ETVWRQA +Y VPRI +VNKMD+ GANF   V+ I++RLG   VPIQLPIG E+ F G+IDLIE K   +      +  E  IP +  D V + R  ++E  A  D++LM  YL+G+E++  +I+  +RK  I  +  PVLCGS+FKNKG++ LLDA+V +LPSPVD+P  +    E G+E    ASD  PF  LAFK+  DP+VG+LTF RVYSGVLK+GSYV N  K KKER+ RL++MHA +R EI+E+ +GDI A +GLKDT TG+T+ D+K  + LE+M+F +PVI++A+EPKTK DQEKMSIAL +LAEEDPTFK +TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET    ++ EGKYI+Q+GGRGQYGHV I  EP    KG+EFV+KIVGG IP+EYI  V AG+  A+ SG LAGYP+ID++ TLFDGSFHEVDSSEMAFKIA S+A K+A    +PVLLEPIM +EV VPE+Y G+ +GD++SRRG IEG E R+N+QV++  VPL EMFGYATDLRS +QGRG Y M FSHY E PK++ ++II  ++
  S:     1 MPREYPLERTRNIGIMAHIDAGKTTTTERILFYTGKVHKMGEVHDGAATMDWMVQEQERGITITSAATTCFWKNHRINIIDTPGHVDFTVEVERSLRVLDGAVAIFCAVGGVEPQSETVWRQADKYGVPRIAYVNKMDRMGANFFEVVRQIKERLGANPVPIQLPIGNEDTFQGVIDLIENKAIIYTDDLGTQLAEAEIPAEMLDLVAEYREKVMEAAAEADEELMLKYLDGEELTPEEIRAGLRKATIAVKVVPVLCGSSFKNKGVQPLLDAIVYYLPSPVDIPAVRGINPETGDEDFRKASDSEPFAALAFKIMADPYVGKLTFFRVYSGVLKAGSYVLNSTKGKKERIGRLLRMHANHREEIDEVCSGDIAAAVGLKDTHTGDTICDEKHPIVLESMEFPEPVINVAIEPKTKQDQEKMSIALQRLAEEDPTFKMWTDQETGQTIIAGMGELHLEIIVDRLMREFKVEANVGKPQVAYKETVRGTAKAEGKYIRQTGGRGQYGHVWIEIEPLEPGKGYEFVNKIVGGVIPKEYIPAVDAGVREALESGVLAGYPVIDVRVTLFDGSFHEVDSSEMAFKIAGSMAAKQAVLKANPVLLEPIMKVEVVVPEEYMGEVIGDLNSRRGRIEGMEARNNMQVVRGYVPLAEMFGYATDLRSKTQGRGTYTMHFSHYEEVPKNLADQIIQKRQ 690
>gi|160946125|ref|ZP_02093336.1| hypothetical protein PEPMIC_00073 [Peptostreptococcus micros ATCC 33270] >gi|158447648|gb|EDP24643.1| hypothetical protein PEPMIC_00073 [Peptostreptococcus micros ATCC 33270] (691 aa)
Score = 2243, Expect = 0.0e+00, Identities = 400/687 (58%), Positives = 525/687 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L N RN GIMAHIDAGKTT +ER+L+++G+IHKIG+TH+G + MDWMEQEKERGITI SAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDG++A+ DA+ GVEPQ+ETVWRQA +Y VPRI F+NKMD TGAN+  S+++I+ +L    VP+Q+PIGAE++F G+IDL+      +        EE  IPD +KD+ ++ R +L+E +A  D+ +M  YLEG+ IS ++++  IR+  I     PVLCGSA+KNKG++ LL+A+V ++PSP+D+P  +   ++   V   ASD+ PF  LAFK+  DP+VG+L + RVYSG L +GSYV N  K KKER+ R++ MHA  R E++ + AGDI A +GLKDTTTG+TL D    V LE M+F +PVIS+A+EPKTKA QEKMSIAL KLAEEDPTF+T+TD ETGQTII+GMGELHL+I+VDR+ REFKVE N+G PQVS+RE+ ++ +E EGKYI+QSGG GQYGH KI+ EP +  KGFEFV+ IVGG IP+EYI PVQ G+E A  +G LAGYP++D+K TL+DGS+HEVDSSEMAFKIA S+A ++A    +PVLLEP+M +E+T P++Y GD MGD+SSRRG I+G   ++ V V+ A +PL EMFGYATDLRS +QGR  Y MQF HY + P+++  ++I  +
  S:     1 MARQYSLENTRNIGIMAHIDAGKTTVTERMLYYTGKIHKIGDTHEGAAQMDWMEQEKERGITICSAATTCVWNDTRINIIDTPGHVDFTVEVERSLRVLDGSVALFDAKSGVEPQSETVWRQADKYGVPRICFINKMDATGANYYDSIETIKDKLKANPVPVQIPIGAESEFVGVIDLVSMHAIIYKNDLGTDIEETDIPDAYKDKAEEYRQNLLEALAETDEFIMEKYLEGEAISPSELREAIRRATINLSINPVLCGSAYKNKGVQPLLNAIVAYMPSPLDIPAIEGVDDNEEPVERHASDEEPFSALAFKIVADPYVGKLAYFRVYSGTLSAGSYVYNSTKGKKERIGRILMMHANKREEVDSVSAGDIAAAVGLKDTTTGDTLCDMNSHVILEKMEFPEPVISVAIEPKTKASQEKMSIALHKLAEEDPTFRTYTDEETGQTIISGMGELHLEIIVDRLLREFKVEANIGNPQVSYRESISQGAEAEGKYIRQSGGSGQYGHCKIKIEPQEAGKGFEFVNNIVGGAIPKEYIGPVQKGIEEATQAGVLAGYPVLDVKVTLYDGSYHEVDSSEMAFKIAGSMAFRQAVAKAAPVLLEPMMKVEITTPDEYLGDVMGDVSSRRGRIQGMNPKNGVHVLDAYIPLAEMFGYATDLRSNTQGRATYSMQFDHYEKVPQAISEKVIGER 688
>gi|15896387|ref|NP_349736.1| elongation factor G [Clostridium acetobutylicum ATCC 824] >gi|21263535|sp|Q97EH4|EFG_CLOAB Elongation factor G (EF-G) >gi|15026204|gb|AAK81076.1|AE007809_2 Translation elongation factor EF-G [Clostridium acetobutylicum ATCC 824] (687 aa)
Score = 2238, Expect = 0.0e+00, Identities = 410/688 (59%), Positives = 522/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L  FRN GIMAHIDAGKTTT+ERILF++G+ HKIGE H+G + MDWM QE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+AV DA+ GVEPQ+ETVWRQA +Y VPR+ ++NKMD  GA+F RSVQ ++ RL   AVPIQ+PIG E++F G+IDLI  +   +        EE+ IP   K+  ++ R+ ++E +   D++LM  YLEG+EIS+ +I   +RKGVI  +  PV CGS++KNKG++ +LDAVV++LPSP+D+P  K   EDGN+    A D  P   LAFK+ATDPFVG+L F RVYSGV+K+GSYV N  K KKER+ RLVKMH+ +R E+EE+ AG++ AI+GLK TTTG+TL  +   + LE M+F  PVI +A+EPKTKA QEKM IAL+KLAEEDPTFKT+T+ ETGQTIIAGMGELHL+I+VDR++REFKVE NVG PQV+++ET  K  + EGK+++QSGGRGQYGH  I   P + + +EF + IVGG +P+EYI+P+  G++ A  SG +AGYP ++ K  L DGS+H+VDSSEMAFKIA S+A K A     PV+LEPIM +EVTVPE+Y GD MGD++SRRG IEG EQR   +VI+A VPL EMFGYAT LRS +QGRG + MQF H  E PK++  +II  KK
  S:     1 MARKYPLEKFRNIGIMAHIDAGKTTTTERILFYTGKTHKIGEVHEGAATMDWMVQEQERGITITSAATTCYWKDHEINIIDTPGHVDFTVEVERSLRVLDGAVAVFDAKGGVEPQSETVWRQAEKYNVPRMAYINKMDILGADFYRSVQMMRDRLSANAVPIQIPIGKEDNFLGLIDLIRNEAIVYTDDLGTTMEEQEIPADMKELAEKYRSEMIEAIVELDEELMNKYLEGEEISVEEINAALRKGVIANEIVPVTCGSSYKNKGVQQMLDAVVEYLPSPLDIPPVKGVDEDGNDDERKADDSEPLAALAFKIATDPFVGKLAFTRVYSGVMKAGSYVLNSTKGKKERIGRLVKMHSNHRQEVEELEAGELGAIVGLKLTTTGDTLSSEDNPIILEKMEFPDPVIEVAIEPKTKASQEKMGIALAKLAEEDPTFKTYTNQETGQTIIAGMGELHLEIIVDRLQREFKVECNVGKPQVAYKETIRKPVKAEGKFVRQSGGRGQYGHAVIEMTPTEGE-YEFENAIVGGAVPKEYIQPIDNGIQEASLSGIIAGYPTVNFKVRLVDGSYHDVDSSEMAFKIAGSMAFKNAMTKADPVILEPIMKVEVTVPEEYMGDIMGDVNSRRGRIEGMEQRAGAEVIRAFVPLSEMFGYATSLRSRTQGRGVFTMQFDHNEEVPKNIQEKIIGEKK 687
>gi|90961184|ref|YP_535100.1| elongation factor G [Lactobacillus salivarius UCC118] >gi|119368737|sp|Q1WVA0|EFG_LACS1 Elongation factor G (EF-G) >gi|90820378|gb|ABD99017.1| Protein Translation Elongation Factor G [Lactobacillus salivarius UCC118] (697 aa)
Score = 2238, Expect = 0.0e+00, Identities = 415/682 (60%), Positives = 523/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GI+AHIDAGKTTT+ERIL+++G+IHKIGETHDG S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA+ Y VPRI+FVNKMDK GANF+ SV +I+ RL    +P+Q+PIGAE+ F G+IDLIE K   +D    G K +  +   +PD++K+  +  R  ++E +A+ ++ +M  YLEG+EIS  +I+  IR+  +    FPV  GSAFKNKG++++LD V D+LPSP+DV   KA   E G E+ + A D APF GLAFK+ATDPFVGRLTF RVY G L++GSYV N  K K+ERV RL++MH+ +RNEI E+ +GDI A IGLK+TTTG++L D K  + LE+M+F  PVI ++VEPK+KADQ+KM +AL KLAEEDPTFK  T+PETG+T+IAGMGELHLDI+VDRM+REF VE  VG PQV++RETF K+   +GK+++QSGG+GQYG V I F PN++ KGFEF D IVGG +PREYI  V+ GL+ AM +G LAGYP+ID+KA L+DGS+H+VDSSE AFK+AASLAL+ A      V+LEPIM +E+  PE   GD MG +++RRG +EG E R N QV+ A VPL EMFGYAT LRS +QGRG + M   HY   PKS+ +EII
  S:     5 REFPLEKTRNIGIVAHIDAGKTTTTERILYYTGKIHKIGETHDGASQMDWMEQEQERGITITSAATTAQWKENRINIIDTPGHVDFTVEVERSLRVLDGAVVVLDAQSGVEPQTENVWRQATTYGVPRIVFVNKMDKIGANFDYSVSTIKDRLQANPLPVQMPIGAEDSFEGVIDLIEMKADLYDEDELGSKWDTVD---VPDEYKEDAQARRDEMIEALADVNEDIMDKYLEGEEISNDEIRAAIRQATLNLDVFPVFAGSAFKNKGVQMMLDGVNDYLPSPLDVKPYKATDPETGEEIELKADDSAPFAGLAFKIATDPFVGRLTFFRVYRGTLEAGSYVLNATKGKRERVGRLLQMHSNHRNEIPEVFSGDIAAAIGLKNTTTGDSLTDPKTPLILESMEFPDPVIQVSVEPKSKADQDKMDVALQKLAEEDPTFKAETNPETGETLIAGMGELHLDIIVDRMKREFNVEATVGEPQVAYRETFTKQVSAQGKFVRQSGGKGQYGDVWIEFTPNEEGKGFEFEDAIVGGVVPREYIPSVEQGLKEAMQNGVLAGYPLIDVKAKLYDGSYHDVDSSEAAFKVAASLALRNAAPKGGAVILEPIMKVEIIAPEDNLGDVMGHVTARRGRVEGMEARGNAQVVNAFVPLAEMFGYATVLRSATQGRGTFTMTMDHYEPVPKSIQDEII 689
>gi|81429380|ref|YP_396381.1| elongation factor G [Lactobacillus sakei subsp. sakei 23K] >gi|90110697|sp|Q38UQ9|EFG_LACSS Elongation factor G (EF-G) >gi|78611023|emb|CAI56076.1| Elongation factor G (EF-G) [Lactobacillus sakei subsp. sakei 23K] (695 aa)
Score = 2237, Expect = 0.0e+00, Identities = 412/682 (60%), Positives = 529/682 (77%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFT+EVERSLRVLDGAI VLDAQ GVEPQTE VWRQA+ Y VPRI+FVNKMDK GANF+ S+ +++ RL   A  +Q+PIGAE++F G+IDLIE +   +D    G K +  +   +P  + ++  + RA LVE VA+ +D +M  YLEG+EIS  ++K  IR+  I  +FFPV  GSAFKNKG+++L+D VVD+LPSP+DV P      ED +EV + A DD PF GLAFK+ATDPFVGRLTF RVY+G L+SGSY+ N  K+K+ERV RL++MH+ +RNEI E+ +GDI A IGLK+TTTG++L D    + LE+M+F  PVI ++VEP++K D++K+ +AL KLAEEDPTFK  T+ ETG+T+I+GMGELHLDI+VDRMRREFKV   +G PQV++RETF K++  +GK+++QSGG+GQYG V + F PN++ KGFEF D IVGG +PREYI  V+ GL+ +MA+G LAGYP+ID+KA L+DGS+H+VDS+E AFKIAAS+ALK A K     +LEPIM +EV  PE+Y GD MG +++RRG +EG E R N Q++ A VPL EMFGYAT LRS +QGRG + M F HY+  PKS+  EII
  S:     5 REFPLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAEWKGNRVNIIDTPGHVDFTIEVERSLRVLDGAITVLDAQSGVEPQTENVWRQATTYGVPRIVFVNKMDKLGANFDYSMTTLEDRLQANAHAVQMPIGAEDEFQGVIDLIEMQADIYDEDELGAKWDTVD---VPADYLEEATKRRAELVEAVADVNDDIMDKYLEGEEISKEELKAAIRQATIDLKFFPVFAGSAFKNKGVQMLMDGVVDYLPSPLDVRPYNAKNPEDDSEVELMAGDDKPFAGLAFKIATDPFVGRLTFFRVYTGTLQSGSYILNATKDKRERVGRLLQMHSNHRNEIPEVFSGDIAAAIGLKNTTTGDSLTDVDHPLILESMEFPDPVIQVSVEPESKEDRDKLDLALQKLAEEDPTFKAETNNETGETLISGMGELHLDIMVDRMRREFKVVAKIGEPQVAYRETFTKQASAQGKFVRQSGGKGQYGDVWVEFTPNEEGKGFEFEDAIVGGVVPREYIPSVEQGLKESMANGVLAGYPLIDVKAKLYDGSYHDVDSNESAFKIAASMALKNAAKQAGAEILEPIMKVEVIAPEEYLGDIMGQVTARRGAVEGMEARGNAQIVNAMVPLSEMFGYATTLRSATQGRGTFTMVFDHYSAVPKSIQEEII 689
>gi|196253512|ref|ZP_03152136.1| translation elongation factor G [Clostridium thermocellum DSM 4150] >gi|196197053|gb|EDX91926.1| translation elongation factor G [Clostridium thermocellum DSM 4150] (697 aa)
Score = 2237, Expect = 0.0e+00, Identities = 418/687 (60%), Positives = 532/687 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDG-NEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R   L N RN GIMAHIDAGKTTT+ERILF++GR+HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A+ GVEPQ+ETVWRQA +Y+VPR+ +VNKMD  GA+F   ++ +++RL    VPIQLPIG E++F GIIDLIE K Y++     +  E++ IP+  ++  ++ R +L+E VA +D++LM  YLE +EI+ A+IK  +RKG I  +  PVLCGS++KNKG++ LLDA+VD++PSPVD+   K    DG  E+   ASDD PF  LAFK+ +DP+VG+L F RVYSG L SGSYV N  K K+ER+ RL+ MHA +R E++ + AGDI A +GLK+TTTG+TL D+   V LE+M F +PVI +A+EPKTKA QEKM++AL KLAEEDPTF+T+TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGKYI+QSGG+GQYGH  I  EP  +  G+EFV+KIVGG IP+EYI  V AG+++AM +G LAGYP++D+K TL+DGS+HEVDSSEMAFK+AAS+A KE  K   PV+LEPIM + VTVPE Y GD +GD++SRRG IEG E R   QVI A VPL EMFGYAT LRS SQGRG + M+ SH+ E PK++  +II+ +
  S:     1 MPRQFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGSATMDWMEQEQERGITITSAATTAQWKGTRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCAKGGVEPQSETVWRQADKYKVPRMAYVNKMDIIGADFFNCIKMMKERLQANPVPIQLPIGKEDNFQGIIDLIEMKAYYYMDDLGKVIEQRDIPEDMRELAEEYRTNLLENVAEYDEELMMKYLEAEEITEAEIKAALRKGTIAVKAIPVLCGSSYKNKGVQRLLDAIVDYMPSPVDIEAIKGVSVDGETEIERHASDDEPFSALAFKIMSDPYVGKLCFFRVYSGKLSSGSYVLNATKGKRERIGRLLMMHANHREEVDMVYAGDIAAAVGLKETTTGDTLCDEANPVILESMNFPEPVIHVAIEPKTKAGQEKMALALQKLAEEDPTFRTYTDQETGQTIIAGMGELHLEIIVDRLLREFKVEANVGNPQVAYKETIRKSVKSEGKYIRQSGGKGQYGHCWIEIEPKERGTGYEFVNKIVGGVIPKEYIPAVDAGIQSAMNNGVLAGYPVVDVKVTLYDGSYHEVDSSEMAFKVAASMAFKEGMKKADPVILEPIMKVVVTVPEDYMGDVIGDLNSRRGRIEGMEARAGAQVIHAYVPLAEMFGYATALRSRSQGRGVFSMEISHFEEVPKNIQEQIISGR 689
>gi|153004771|ref|YP_001379096.1| translation elongation factor G [Anaeromyxobacter sp. Fw109-5] >gi|152028344|gb|ABS26112.1| translation elongation factor G [Anaeromyxobacter sp. Fw109-5] (697 aa)
Score = 2235, Expect = 0.0e+00, Identities = 408/688 (59%), Positives = 523/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L  +RNFGIMAHIDAGKTTT+ERILF++G  HKIGE H+G +VMDWMEQE+ERGITITSAAT+  W++  LN+IDTPGHVDFT+EVERSLRVLDGA AV DA  GV+PQ+ETVWRQA +Y+VPRI F+NKMD+ GA++ R+VQ+IQQ+L  + V +Q+PIGAE+ F G++DL++ K + F D     K +E  IP+  ++   + R+ L E  A  DD+LM  YL+G+ ++  ++ R +RKG +  +FFPV+CG+AFKNKG++ +LDAVVDFLP P+DVP  K     G EV  + SD  PF  LAFK+  DPFVG LTF RVYSG L++GSYV+N  K+KKER+ RL++MHA  R EI+E+ AGDI A +GL+ TTTG+TL D+   V LE M+F +PVI +A+EPK+KADQ+KM IAL++L  EDP+F+  TD ETGQTIIAGMGELHL+ILVDRM REFKVE NVG PQV++RET  K+ E EG+YI+Q+GGRGQYGH  +R  P +  KGFEFV+  VGG IP+E+I P+Q G+E AM SG LAGYP++DIK  +FDGS+H+VDSSEMAFKIA S+  K+      P+LLEPIMA+EVT P+ Y GD +GD++SRRG I+       +QVI+A VPL EMFGYATDLRS +QGR  Y MQF HYA+ P ++   I++  K
  S:     1 MPRNSPLERYRNFGIMAHIDAGKTTTTERILFYTGVTHKIGEVHEGTTVMDWMEQERERGITITSAATTAFWRDHRLNIIDTPGHVDFTIEVERSLRVLDGACAVFDAVQGVQPQSETVWRQADKYKVPRICFINKMDRIGADYFRAVQTIQQKLSARPVSLQIPIGAEDKFRGMVDLVKMKGITFDDETMGAKYQEIEIPENLRELAAEYRSKLEEAAAEVDDELMHKYLDGRPLTNEELLRGLRKGTLEMRFFPVICGTAFKNKGVQQILDAVVDFLPGPLDVPAVKGVTLKGEEVTRATSDSEPFSALAFKIMNDPFVGNLTFFRVYSGKLEAGSYVQNATKDKKERIGRLLQMHANKREEIKEVYAGDIAAAVGLRATTTGDTLCDEANPVVLERMEFPEPVIDVAIEPKSKADQDKMGIALNRLQMEDPSFRVHTDEETGQTIIAGMGELHLEILVDRMFREFKVEANVGKPQVAYRETITKQVESEGRYIRQTGGRGQYGHCWLRLIPQEPGKGFEFVNATVGGSIPKEFISPIQKGIEEAMTSGVLAGYPVVDIKVEVFDGSYHDVDSSEMAFKIAGSMGFKDGAAKAKPILLEPIMAVEVTTPDDYMGDVIGDLNSRRGKIQAMNPGTGIQVIEALVPLAEMFGYATDLRSKTQGRATYSMQFKHYAQVPNNIAETIVSKAK 690
>gi|58336628|ref|YP_193213.1| elongation factor G [Lactobacillus acidophilus NCFM] >gi|75358067|sp|Q5FM92|EFG_LACAC Elongation factor G (EF-G) >gi|58253945|gb|AAV42182.1| translational elongation factor ef-G [Lactobacillus acidophilus NCFM] (697 aa)
Score = 2235, Expect = 0.0e+00, Identities = 407/682 (59%), Positives = 527/682 (77%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G+S MDWM++EKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA  Y VPRI+FVNKMDK GA+F++SV+S+ +RL   A  +Q+PIG+ + F G+IDLI      +D  K   K +  P+PD++K++ ++ RA L+E VA+ DD +M  YL G+EIS  ++K  IRK  +  +FFPV  GSAFKNKG++++LD V+D+LPSP+DV P      + G+EV + A D  PF  LAFK+ATDPFVGRLTF+RVY+G L+SGSYV N  KN +ERV RL++MHA +R EI E+ +GDI   IGLK+TTTG++L D    + LE++Q   PVI ++VEPK+KAD++KM +AL KL EEDPTF+  T+PETGQT+I+GMGELHLDI+V+RMRREF VE  +G PQV++RETF KE++ +GK+++QSGG+GQYG V I F PN++ KG+EF D IVGG +PRE+I  V  GL+ AM +G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AASLAL+ A      V+LEPIM ++VT PE+Y GD MG I++RRG +EG E R   ++I + VPL EMFGYAT LRS +QGRG + M F HY+ TPKS+  +II
  S:     5 REFPLAKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGDSQMDWMDEEKERGITITSAATTAQWKDYRINIIDTPGHVDFTIEVERSLRVLDGAVTVLDAQAGVEPQTENVWRQAETYGVPRIVFVNKMDKIGADFDKSVKSLHERLNANAQAVQMPIGSADTFEGVIDLINMVADIYDEDKLGSKWDTVPVPDEYKEEAEKRRAALIEAVADVDDNIMEKYLGGEEISNDELKAAIRKATLNLEFFPVYAGSAFKNKGVQMMLDGVIDYLPSPLDVKPYVAHDPKTGDEVELMADDKKPFAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKNTTTGDSLTDPDHPLILESLQVPDPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGQTLISGMGELHLDIMVERMRREFNVEAKIGEPQVAYRETFTKEAKAQGKFVRQSGGKGQYGDVWIDFTPNEEGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASLALRNAASKAGAVILEPIMKVQVTTPEEYLGDVMGSITARRGTMEGMEDRAGAKIINSFVPLSEMFGYATTLRSSTQGRGTFTMVFDHYSPTPKSIQADII 689
>gi|161506871|ref|YP_001576825.1| elongation factor G [Lactobacillus helveticus DPC 4571] >gi|172048365|sp|A8YXK3.1|EFG_LACH4 Elongation factor G (EF-G) >gi|160347860|gb|ABX26534.1| translation elongation factor G [Lactobacillus helveticus DPC 4571] (697 aa)
Score = 2234, Expect = 0.0e+00, Identities = 409/682 (59%), Positives = 526/682 (77%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G+S MDWM++EKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA  Y VPRI+FVNKMDK GA+F++SV+S+ +RL   A  +Q+PIG+ + F G+IDLI      +D  K   K +  PIPDQ+K++ ++ R  L+E VA+ DD +M  YL G+EIS  ++K  IRK  +  +FFPV  GSAFKNKG++++LD V+D+LPSP+DV P      + G+EV + A D  PF  LAFK+ATDPFVGRLTF+RVY+G L+SGSYV N  KN +ERV RL++MHA +R EI E+ +GDI   IGLK+TTTG++L D    + LE+++   PVI ++VEPK+KAD++KM +AL KL EEDPTF+  T+PETGQT+I+GMGELHLDI+V+RMRREF V+  +G PQV++RETF KE+E +GK+++QSGG+GQYG V I F PN++ KG+EF D IVGG +PRE+I  V  GL+ AM +G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AASLALK A      V+LEPIM ++VT PE+Y GD MG I++RRG +EG E R   +VI + VPL EMFGYAT LRS +QGRG + M F HY+ TPKS+  +II
  S:     5 REFPLAKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGDSQMDWMDEEKERGITITSAATTAQWKDYRINIIDTPGHVDFTIEVERSLRVLDGAVTVLDAQAGVEPQTENVWRQAETYGVPRIVFVNKMDKIGADFDKSVKSLHERLNANAHAVQMPIGSADTFEGVIDLINMVADIYDEDKLGSKWDTVPIPDQYKEEAEKRRGELIEAVADVDDGIMEKYLGGEEISNDELKAAIRKATLNLEFFPVYAGSAFKNKGVQMMLDGVIDYLPSPLDVKPYVAHDPKTGDEVELMADDKKPFAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKNTTTGDSLTDPDHPLILESLKVPDPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGQTLISGMGELHLDIMVERMRREFNVDAKIGEPQVAYRETFTKEAEAQGKFVRQSGGKGQYGDVWIDFTPNEEGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASLALKNAASKAGAVILEPIMKVQVTTPEEYLGDVMGSITARRGTMEGMEDRAGAKVINSFVPLSEMFGYATTLRSSTQGRGTFTMVFDHYSPTPKSIQADII 689
>gi|118444241|ref|YP_877195.1| elongation factor G [Clostridium novyi NT] >gi|166201594|sp|A0PXU3.1|EFG_CLONN Elongation factor G (EF-G) >gi|118134697|gb|ABK61741.1| translation elongation factor G [Clostridium novyi NT] (687 aa)
Score = 2233, Expect = 0.0e+00, Identities = 418/688 (60%), Positives = 527/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L  FRN GIMAHIDAGKTT++ERILF++G+ HKIGETH+G + MDWM QE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLD AI +LDA+ GVEPQTETVWRQA +Y+VPR+IFVNKMD  GA+F  SVQ+++ RL   AVPIQ+PIG E+D+ G +DLI+ K   FD       +E  IP+  KD+ ++ R+ ++E +   D++LM  YLEG+EIS  +I   +RK  I  +  PVLCG+A+KNKGI+ LLDAV+ +LPSP+D+P  K   EDGNEV   ASDD P   LAFK+ATDPFVG+L FVR+YSGV+ SGSYV N  KNKKER+ RLVKMHA +R E+EE+ AG++ A+IGLK+TTTG+TL D+   V LE+M+F +PVIS+A+EPKTKA QEKM IAL+KLAEEDPTFKT+TD ETGQ IIAGMGELHL+I+VDR++REFKVE NVGAPQV+++ET     + EGK+++QSGGRGQYGH  I   P++ + +EF + IVGG IPREYI  V  G++ A  SG L GYP+I+ K   +DGS+H+VDSSEMAFK+A S+A K      +PVLLEP+M +E+ VPE+Y GD MGD++SRRG IEG   R   QVI A VPL EMFGYAT LRS +QGRG Y M+F++Y E PKS+  +++   K
  S:     1 MARQYPLNKFRNIGIMAHIDAGKTTSTERILFYTGKTHKIGETHEGAATMDWMVQEQERGITITSAATTCFWKDHQINIIDTPGHVDFTVEVERSLRVLDSAITILDAKGGVEPQTETVWRQADKYQVPRMIFVNKMDILGADFYMSVQTVRDRLRANAVPIQIPIGKEDDYAGHVDLIKMKAVIFDKELGVNYDEVEIPEDLKDKAEEYRSAMIEAIVETDEELMMKYLEGEEISEEEIHTALRKATIANEIVPVLCGTAYKNKGIQHLLDAVLAYLPSPLDIPSIKGVDEDGNEVERHASDDEPLGALAFKIATDPFVGKLAFVRIYSGVMHSGSYVLNSNKNKKERIGRLVKMHANHREEVEELYAGELGAVIGLKNTTTGDTLCDENAPVILESMEFPEPVISVAIEPKTKAAQEKMGIALAKLAEEDPTFKTYTDQETGQVIIAGMGELHLEIIVDRLQREFKVECNVGAPQVAYKETIKNAVKAEGKFVRQSGGRGQYGHCWIELIPHEGE-YEFENAIVGGAIPREYIPAVDNGIQEAAQSGILGGYPVINFKVKCYDGSYHDVDSSEMAFKVAGSMAFKNGMAKATPVLLEPVMKVEIVVPEEYMGDVMGDVNSRRGRIEGMNPRGGAQVIAAFVPLSEMFGYATVLRSRTQGRGTYSMEFANYEEVPKSIAEKVVGENK 687
>gi|150015040|ref|YP_001307294.1| elongation factor G [Clostridium beijerinckii NCIMB 8052] >gi|189027846|sp|A6LPQ8.1|EFG_CLOB8 Elongation factor G (EF-G) >gi|149901505|gb|ABR32338.1| translation elongation factor G [Clostridium beijerinckii NCIMB 8052] (688 aa)
Score = 2233, Expect = 0.0e+00, Identities = 411/687 (59%), Positives = 528/687 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTT+ERILF++G  HKIGE HDGE+ MDWM QE+ERGITITSAATS  WK   LN+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA +Y VPR+I+VNKMD TGA+F R +Q+++ RL   AVPIQ+P+G+E  F G++DLI+   + F  D GK+ +  E+ IP ++ DQ ++ RA ++E +A  D++LM  YLEG+E++I ++K  +RK  I  + +P +CGS++KNKG++ ++D VVD+LPSP+DVP  K    DG E   ++SD  P   LAFK+ATDPFVG+L F R+YSGV++SGSYV N  K KKER+ RLVKMH+ +R+E+E + AG+I A+IGLK+TTTG+TL  +   + LEAM+F +PVI +A+EPKTK  QEKM +AL+KLAEEDPTFKT+TD ETGQTIIAGMGELHL+I+VDR++REFKVE NVGAPQV+++ET     + E KY KQSGG+GQYGH  I  EP + + + F + +VGG IP+EYI  + AG++ A  +G +AGY +I+ K  L  GS+HEVDSSEMAFKIA S+A K A    SPVLLEP+M +EVTVPE+Y GD +GDI+SRRG++EG E  +  QVI+A VPL EMFGYAT LRS +QGRG Y M F HY E PK++  +I  ++
  S:     1 MARKYPLDKFRNFGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGEATMDWMVQEQERGITITSAATSCFWKEHELNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADFFRCIQTVKDRLKANAVPIQIPVGSEQGFKGMVDLIKNVAFIFYDDLGKDMR--EEAIPAEYADQAEEYRAAMIEAIAETDEELMEKYLEGEELTIEELKAALRKATIANEIYPCICGSSYKNKGVQEMIDGVVDYLPSPLDVPAIKGTTLDGEEDHRNSSDSEPLSALAFKIATDPFVGKLAFTRIYSGVMQSGSYVLNSTKGKKERIGRLVKMHSNSRSEVESLEAGEIGAVIGLKNTTTGDTLCAENSPIILEAMEFPEPVIRVAIEPKTKDAQEKMGMALAKLAEEDPTFKTWTDTETGQTIIAGMGELHLEIIVDRLQREFKVECNVGAPQVAYKETIRSAVKAEAKYAKQSGGKGQYGHAVIEMEPTEGE-YVFENAVVGGAIPKEYIPAIDAGIQEASKNGIIAGYNVINFKVKLVHGSYHEVDSSEMAFKIAGSMAFKNAMSKASPVLLEPMMKVEVTVPEEYMGDVIGDINSRRGIMEGMEALNGAQVIRAFVPLSEMFGYATTLRSRTQGRGVYSMVFDHYDEVPKNIQEQIAGSR 686
>gi|42518427|ref|NP_964357.1| elongation factor G [Lactobacillus johnsonii NCC 533] >gi|62286678|sp|Q74L90|EFG_LACJO Elongation factor G (EF-G) >gi|41582712|gb|AAS08323.1| elongation factor G [Lactobacillus johnsonii NCC 533] (698 aa)
Score = 2231, Expect = 0.0e+00, Identities = 408/682 (59%), Positives = 525/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G+S MDWME+EKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA  Y VPRI+FVNKMDK GA+F++SV+S+ +RL   A  +Q+PIG+ + F G+IDLI      +D  K   K +  P+PD++K++  + R  L+E VA+ DD +M  YL G+EIS  ++K  IRK  +  +FFPV  GSAFKNKG++++LD VVD+LPSP+DV P      + G+EV + A D  PF  LAFK+ATDPFVGRLTF+RVY+G L+SGSYV N  KN +ERV RL++MHA +R EI E+ +GDI   IGLK+TTTG++L D    + LE++Q   PVI ++VEPK+KAD++KM +AL KL EEDPTF+  T+PETGQT+I+GMGELHLDI+V+RM+REF VE  +G PQV++RETF KE++ +GK+++QSGG+GQYG V I F PN++ KG+EF D IVGG +PRE+I  V  GL+ AM +G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AASLAL+ A      V+LEPIM ++VT PE+Y GD MG I++RRG +EG E R   +VI + VPL EMFGYAT LRS +QGRG + M F HY+ TPKS+  +II
  S:     5 REFPLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGDSQMDWMEEEKERGITITSAATTAQWKDYRINIIDTPGHVDFTIEVERSLRVLDGAVTVLDAQAGVEPQTENVWRQAETYGVPRIVFVNKMDKIGADFDKSVKSLHERLNANAQAVQMPIGSADTFEGVIDLINMVADVYDEDKLGSKWDTIPVPDEYKEEALKRRNELIEAVADVDDGIMDKYLGGEEISNDELKAAIRKATLNLEFFPVYAGSAFKNKGVQMMLDGVVDYLPSPLDVKPYVAHDPKTGDEVELMADDKKPFAALAFKIATDPFVGRLTFIRVYTGSLQSGSYVLNASKNSRERVGRLLQMHANSRTEISEVFSGDIAGAIGLKNTTTGDSLTDPAHPLILESLQVPDPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGQTLISGMGELHLDIMVERMKREFNVEATIGEPQVAYRETFTKEAKAQGKFVRQSGGKGQYGDVWIEFTPNEEGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASLALRNAASKAGAVILEPIMKVQVTTPEEYLGDVMGSITARRGSMEGMEDRAGAKVINSFVPLSEMFGYATTLRSSTQGRGTFTMVFDHYSPTPKSIQADII 689
>gi|184155993|ref|YP_001844333.1| elongation factor G [Lactobacillus fermentum IFO 3956] >gi|183227337|dbj|BAG27853.1| elongation factor G [Lactobacillus fermentum IFO 3956] (694 aa)
Score = 2231, Expect = 0.0e+00, Identities = 406/682 (59%), Positives = 523/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTT +ERIL+++G+IHKIGETHDG S MDWME+EKERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVER+LRVLDGA+ VLDAQ GVEPQTETVWRQA  + VPR++F NKMDK GANF+ SV++I++RL V  +PIQ+PIGAE++F G+IDL++   Y +D  K  E  +   IP   KD+ +     ++E +A+ +D +M  YLEG EIS+ +IK  IR+  +  + FPV+ GSA+K+KGI+++LDAV+D+LPSPVDV    A+ E+GN + ++A DD PF  LAFK+ATDPFVGRLTF+RVY+G LKSGSYV N  K K+ER+ RL++MH+  +NEI E+ +GDI A IGLK+TTTG++L D    +QLE+M F +PVI ++VEPK+KADQ+KM   L KLAEEDPTFK  T+PETG+T+IAGMGELHLDI+V+R+RREF  EV VG PQVS+RE F K+   +GK+++QSGG+GQYG V I F P  +  GFEF D IVGG +PREYI  V+ GL+ AM +G LAGYP++D+ A L+DGS+HEVDSSE AFK+AASLAL+ A      V+LEPIM +++  PE   GD MG +++RRG I+G E+R N Q++ + VPL EMFGYAT LRS +QGRG + M F HY+  PKS+  EII
  S:     5 REYPLEKTRNIGIMAHIDAGKTTATERILYYTGKIHKIGETHDGASQMDWMEEEKERGITITSAATTAVWKDTRINIIDTPGHVDFTVEVERALRVLDGAVTVLDAQAGVEPQTETVWRQADDFNVPRLVFANKMDKMGANFDYSVKTIKERLNVTPLPIQMPIGAEDEFAGVIDLVKMVAYIYDEDKLGENWDTVEIPADMKDEAESRHDAMIETLADVNDDIMEKYLEGAEISVDEIKAAIRQATLDQELFPVMAGSAYKDKGIQMMLDAVLDYLPSPVDVKPFVAHDEEGNAIELTAGDDKPFAALAFKIATDPFVGRLTFLRVYTGSLKSGSYVLNATKGKRERIGRLLQMHSNQQNEISEVFSGDIAAAIGLKNTTTGDSLTDPDHPLQLESMDFPEPVIQVSVEPKSKADQDKMDKGLQKLAEEDPTFKAETNPETGETLIAGMGELHLDIIVERLRREFNAEVTVGKPQVSYREAFTKQVSAQGKFVRQSGGKGQYGDVWIEFTPLEEGAGFEFEDAIVGGVVPREYIPAVEQGLKEAMENGVLAGYPLVDLHAKLYDGSYHEVDSSEAAFKVAASLALRNAAPKGGAVILEPIMKVDIVAPEDNLGDVMGHVTARRGSIDGMEERGNAQLVHSFVPLSEMFGYATTLRSATQGRGTFTMTFDHYSAVPKSIQEEII 688
>gi|147676652|ref|YP_001210867.1| translation elongation factors [Pelotomaculum thermopropionicum SI] >gi|189027868|sp|A5D5I7.1|EFG_PELTS Elongation factor G (EF-G) >gi|146272749|dbj|BAF58498.1| translation elongation factors [Pelotomaculum thermopropionicum SI] (692 aa)
Score = 2231, Expect = 0.0e+00, Identities = 408/687 (59%), Positives = 518/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGE-DGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE H+G + MDWM QE+ERGITITSAATS  W++C +N+IDTPGHVDFTVEVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI ++NKMD+ GA+F R +Q I++RLG   V IQLPIG E+ F G++DL+  +   +       +EE  IP +   +    R  L+E VA FD+ LM  YLE  E++  +IK  +R+  +  +  PVLCGS+FKNKG++ LLDA+VD+LP+P D+P  +      G   +  A DD PF  LAFK+ TDP+VG+LTF RVYSG LKSGSYV N  +N++ERV R+++MHA +R +IEE+ AGDI A +GLK TTTG+TL D+K  V LE+M+F +PVI +A+EPKTKADQEKM +AL KLAEEDPTF+  TDPETGQT+I+GMGELHL+I+VDRM REFKVE NVG PQV+++ET  K++  EGK+I+Q+GGRGQYGHV +  EP +   G+ F  KI+GG IP+EYI  V AG + AM +G LAG+P+ID+  TL DGS+HEVDSSEMAFKIA S+  K+A +   PVLLEP+M +EV V E+Y GD +GD++SRRG IE  E R+ +QVI A VPL EMFGYATDLRS +QGRGNY MQFSHYA+ P ++   IIA +
  S:     1 MARQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHEGTATMDWMAQEQERGITITSAATSCRWRDCQINIIDTPGHVDFTVEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRVGADFHRGIQMIRERLGANPVAIQLPIGVEDGFCGVVDLVRNRAIIYTDDLGTTSEETEIPPELAGEAAAFRERLIEAVAEFDESLMEKYLENGELTEEEIKEGLRRATLAVKIVPVLCGSSFKNKGVQPLLDAIVDYLPAPTDIPAIRGVNPVSGAGEVREARDDEPFSALAFKIMTDPYVGKLTFFRVYSGRLKSGSYVYNSTRNRRERVGRILRMHANHREDIEEVCAGDIVAAVGLKTTTTGDTLCDEKEPVILESMEFPEPVIQVAIEPKTKADQEKMGVALQKLAEEDPTFRVSTDPETGQTLISGMGELHLEIIVDRMMREFKVEANVGRPQVAYKETVRKKARAEGKFIRQTGGRGQYGHVVLEVEPREPGSGYLFTSKIIGGVIPKEYIPAVDAGAKEAMENGVLAGFPVIDVGVTLLDGSYHEVDSSEMAFKIAGSIGFKDAARRADPVLLEPVMKVEVVVNEEYMGDVIGDLNSRRGRIEEMEARNGMQVIHAYVPLAEMFGYATDLRSRTQGRGNYTMQFSHYAQVPDNIAEGIIARR 689
>gi|116495952|ref|YP_807686.1| elongation factor G [Lactobacillus casei ATCC 334] >gi|122262648|sp|Q034X8.1|EFG_LACC3 Elongation factor G (EF-G) >gi|116106102|gb|ABJ71244.1| translation elongation factor 2 (EF-2/EF-G) [Lactobacillus casei ATCC 334] (700 aa)
Score = 2229, Expect = 0.0e+00, Identities = 411/682 (60%), Positives = 524/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGAI VLDAQ GVEPQTE VWRQA+ Y VPR++FVNKMDK GA+F+ S+ ++  RL   A  +Q+PIGAE+ F G+IDLIE K   +D    G K +  +   +PD +K+  ++    L+E VA+ DD +M  YLEG+EIS A++K  IRK  I  +F+PVL GSAFKNKG+++LLDAV+D+LPSP+DV    A   D G+ V ++A DD PF  LAFKVATDPFVGRLT++RVYSG L++GSYV N  K+ +ERV RL++MH+ +R EI E+ +GDI A IGLK+TTTG++L D    + LE++    PVI +++EP +K DQ+K+ + L KL+EEDPTFK  T PETG+T+IAGMGELHLDI+VDR++REFKV   VG PQV++RETF KE+  +GK+++QSGG+GQYG V I F PN++ KGFEF + IVGG +PREYI  V+ GL+ AMA+G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AAS+ALK A K    V+LEPIM +EV  PE+Y GD MG I++RRG +EG E R N Q++ + VPL EMFGYAT LRS +QGRG + M F HY   PKS+  EII
  S:     5 REFPLDRTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMPQEQERGITITSAATTAFWKDHRVNIIDTPGHVDFTIEVERSLRVLDGAITVLDAQSGVEPQTENVWRQATTYGVPRLVFVNKMDKIGADFDYSMTTLHDRLQANAHAVQMPIGAEDKFEGVIDLIEMKADLYDEDELGTKWDTVD---VPDDYKEAAQKAHNDLIEAVADVDDGIMDKYLEGEEISNAELKAAIRKATINLEFYPVLAGSAFKNKGVQMLLDAVIDYLPSPLDVRPYHATDPDTGDAVELTAGDDKPFAALAFKVATDPFVGRLTYIRVYSGTLEAGSYVLNATKDNRERVGRLLQMHSNHREEIPEVFSGDIAAAIGLKNTTTGDSLTDVDHPLILESLDVPDPVIQVSIEPDSKEDQDKLDVGLQKLSEEDPTFKAETSPETGETLIAGMGELHLDIMVDRLKREFKVAAKVGEPQVAYRETFTKETSAQGKFVRQSGGKGQYGDVWIEFSPNEEGKGFEFENAIVGGVVPREYIPAVEQGLKEAMANGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASMALKNASKSAGAVILEPIMHVEVVAPEEYLGDVMGQITARRGRVEGMEARGNAQLVNSMVPLAEMFGYATTLRSATQGRGTFTMTFDHYEAVPKSIQAEII 689
>gi|191639433|ref|YP_001988599.1| Elongation factor G (EF-G) [Lactobacillus casei] >gi|190713735|emb|CAQ67741.1| Elongation factor G (EF-G) [Lactobacillus casei BL23] (700 aa)
Score = 2229, Expect = 0.0e+00, Identities = 411/682 (60%), Positives = 525/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G S MDWM QE+ERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGAI VLDAQ GVEPQTE VWRQA+ Y VPR++FVNKMDK GA+F+ S+ ++  RL   A  +Q+PIGAE+ F G+IDLIE K   +D    G K +  +   +PD +K+  ++    L+E VA+ DD +M  YLEG+EIS A++K  IRK  I  +F+PVL GSAFKNKG+++LLDAV+D+LPSP+DV    A   D G+ V ++A DD PF  LAFKVATDPFVGRLT++RVYSG L++GSYV N  K+ +ERV RL++MH+ +R EI E+ +GDI A IGLK+TTTG++L D    + LE++    PVI +++EP +K DQ+K+ + L KL+EEDPTFK  T+PETG+T+IAGMGELHLDI+VDR++REFKV   VG PQV++RETF KE+  +GK+++QSGG+GQYG V I F PN++ KGFEF + IVGG +PREYI  V+ GL+ AMA+G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AAS+ALK A K    V+LEPIM +EV  PE+Y GD MG I++RRG +EG E R N Q++ + VPL EMFGYAT LRS +QGRG + M F HY   PKS+  EII
  S:     5 REFPLDRTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMPQEQERGITITSAATTAFWKDHRVNIIDTPGHVDFTIEVERSLRVLDGAITVLDAQSGVEPQTENVWRQATTYGVPRLVFVNKMDKIGADFDYSMTTLHDRLQANAHAVQMPIGAEDKFEGVIDLIEMKADLYDEDELGTKWDTVD---VPDDYKEAAQKAHNDLIEAVADVDDGIMDKYLEGEEISNAELKAAIRKATINLEFYPVLAGSAFKNKGVQMLLDAVIDYLPSPLDVRPYHATDPDTGDAVELTAGDDKPFAALAFKVATDPFVGRLTYIRVYSGTLEAGSYVLNATKDNRERVGRLLQMHSNHREEIPEVFSGDIAAAIGLKNTTTGDSLTDVDHPLILESLDVPDPVIQVSIEPDSKEDQDKLDVGLQKLSEEDPTFKAETNPETGETLIAGMGELHLDIMVDRLKREFKVAAKVGEPQVAYRETFTKETSAQGKFVRQSGGKGQYGDVWIEFTPNEEGKGFEFENAIVGGVVPREYIPAVEQGLKEAMANGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASMALKNASKSAGAVILEPIMHVEVVAPEEYLGDVMGQITARRGRVEGMEARGNAQLVNSMVPLAEMFGYATTLRSATQGRGTFTMTFDHYEAVPKSIQAEII 689
>gi|153938085|ref|YP_001392837.1| elongation factor G [Clostridium botulinum F str. Langeland] >gi|170756221|ref|YP_001783124.1| translation elongation factor G [Clostridium botulinum B1 str. Okra] >gi|189027848|sp|B1IGF7.1|EFG_CLOBK Elongation factor G (EF-G) >gi|189027849|sp|A7GJ77.1|EFG_CLOBL Elongation factor G (EF-G) >gi|152933981|gb|ABS39479.1| translation elongation factor G [Clostridium botulinum F str. Langeland] >gi|169121433|gb|ACA45269.1| translation elongation factor G [Clostridium botulinum B1 str. Okra] (689 aa)
Score = 2228, Expect = 0.0e+00, Identities = 407/682 (59%), Positives = 523/682 (76%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           L  FRN GIMAHIDAGKTT +ERILF++G+ HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+ +LDA+ GVEPQTETVWRQA  Y+VPR++F+NKMDK GA+F  SV ++++RL   AVP+QLPIGAE+ F+GIIDL++     +        +E  IP+  K+  ++ R  L+E VA  D+ +M  YLEG+EIS+ +IK  +RKGV+  +  PVLCGSA+KNKG++LLLDA+++F+PSP+D+   K      G E+   A   AP   LAFK+ATDPF+G+L F R+YSG +KSG+YV N  K K+ER+ RLVKMHA +R ++EE++AG++ AI+GLKDTTTG+TL DD   + LE M+F +PVI +++EPKTKA QEKM IAL+KLAEEDPTF+T+T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGK+I+QSGGRGQYGH  I   P + + +EF + +VGG IP+EYI  +  G++ A  SG +AGYP+I+ K  LFDGS+H+VDSSEMAFKIA S+A K A      VLLEP M +EV VPE+Y GD +GDI+SRRG IEG   R   +VI+A VPL EMFGYAT LRS +QGRGNYVMQF HY E PKS+ +++I  +K
  S:     8 LAKFRNIGIMAHIDAGKTTATERILFYTGKTHKIGETHEGAATMDWMEQEQERGITITSAATTCFWKDHQVNIIDTPGHVDFTVEVERSLRVLDGAVTILDAKSGVEPQTETVWRQADNYKVPRMVFINKMDKLGADFLMSVGTLRERLHANAVPLQLPIGAEDSFSGIIDLVKNDAIIYKDDLGTVMDETEIPEDMKEMAEEYRTMLLEAVAEVDEDIMMKYLEGEEISVEEIKTALRKGVLANKIVPVLCGSAYKNKGVQLLLDAIIEFMPSPLDIEDVKGTEPTTGEEMTRPADAKAPLAALAFKIATDPFIGKLAFTRIYSGTMKSGTYVFNSNKGKRERIGRLVKMHANHREDVEELKAGELGAIVGLKDTTTGDTLCDDADPIILENMEFPEPVIDVSIEPKTKAGQEKMGIALAKLAEEDPTFRTYTNQETGQTIIAGMGELHLEIIVDRLIREFKVECNVGQPQVAYKETIKKHVKAEGKFIRQSGGRGQYGHCWIEMMPTEGE-YEFQNAVVGGSIPKEYIPAIDNGIQEASQSGIIAGYPVINFKVKLFDGSYHDVDSSEMAFKIAGSMAFKNAMSKADAVLLEPSMKVEVVVPEEYMGDVIGDINSRRGRIEGMTPRAGAEVIRAFVPLSEMFGYATTLRSKTQGRGNYVMQFDHYEEVPKSIQDKVIGERK 689
>gi|39997952|ref|NP_953903.1| elongation factor G [Geobacter sulfurreducens PCA] >gi|62286552|sp|Q748Y8|EFG2_GEOSL Elongation factor G 2 (EF-G 2) >gi|39984897|gb|AAR36253.1| translation elongation factor G [Geobacter sulfurreducens PCA] (692 aa)
Score = 2228, Expect = 0.0e+00, Identities = 419/688 (60%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGE H+G + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F R V  I+ RL    VPIQLPIGAE+ + G++DL+E K   +D    G K  +AE   IP    +  ++ R  L+EE+A FDD LM  YL G+E++  +IK  +RK  I  Q  PV+CGSAFKNKG++ LLD+VV +LPSP+D+P       + G E+   ASDD PF  LAFK+ TDPFVG+L F RVYSGVL SGSYV N  K KKER+ RL+KMHA  R EI+E+ AGDI A +GLK TTTG+TL  +   V LE+++F +PVI++A+EPKTKADQEK+ I+L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ +VEGK+++QSGGRGQYGHV I  EP +  KG+EFVD I GG +PREYI  V  G++ AM +G LAGYP +D K  L DGS+HEVDSSEMAFKIA S+A KEA     PVLLEPIM++EV VPE+Y GD +GD++SRRG I G E R   QV+ A VPL +MFGYATDLRS +QGR  Y M F HY + PKSV  EI+A  K
  S:     1 MARQVSLEKTRNIGIMAHIDAGKTTTTERILYYTGVTHKIGEVHEGAATMDWMEQEQERGITITSAATTCFWGDHRVNIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYRVPRIAFINKMDRVGADFFRGVGMIRDRLKANPVPIQLPIGAEDTYRGVVDLVEMKAIIWDEESLGAKYHEAE---IPADLAEMAQEYREKLIEEIATFDDALMEKYLGGEELTTDEIKAAVRKATIDIQICPVICGSAFKNKGVQNLLDSVVAYLPSPLDIPAITGIDAKSGEEITRKASDDEPFSALAFKIMTDPFVGQLCFFRVYSGVLNSGSYVYNSTKEKKERIGRLLKMHANKREEIKEVYAGDIAAAVGLKYTTTGDTLCPEDSPVVLESIEFPEPVIAIAIEPKTKADQEKLGISLQKLASEDPSFRVRTDEETGQTIISGMGELHLEIIVDRLMREFKVEANVGKPQVAYRETVTKKVKVEGKFVRQSGGRGQYGHVWIELEPQEAGKGYEFVDAIKGGVVPREYIPAVDKGIQEAMETGVLAGYPTVDFKVALVDGSYHEVDSSEMAFKIAGSMAFKEAAAKAGPVLLEPIMSVEVVVPEEYMGDVIGDLNSRRGRIMGMEGRAGAQVVSAMVPLAQMFGYATDLRSATQGRATYTMTFDHYEQVPKSVSEEIVAKVK 691
>gi|148381424|ref|YP_001255965.1| translation elongation factor G [Clostridium botulinum A str. ATCC 3502] >gi|153933458|ref|YP_001385799.1| elongation factor G [Clostridium botulinum A str. ATCC 19397] >gi|153936637|ref|YP_001389206.1| elongation factor G [Clostridium botulinum A str. Hall] >gi|168178829|ref|ZP_02613493.1| translation elongation factor G [Clostridium botulinum NCTC 2916] >gi|189027845|sp|A7FZ72.1|EFG_CLOB1 Elongation factor G (EF-G) >gi|189027847|sp|A5I7K9.1|EFG_CLOBH Elongation factor G (EF-G) >gi|148290908|emb|CAL85044.1| translation elongation factor G, Ef-G [Clostridium botulinum A str. ATCC 3502] >gi|152929502|gb|ABS35002.1| translation elongation factor G [Clostridium botulinum A str. ATCC 19397] >gi|152932551|gb|ABS38050.1| translation elongation factor G [Clostridium botulinum A str. Hall] >gi|182670126|gb|EDT82102.1| translation elongation factor G [Clostridium botulinum NCTC 2916] (689 aa)
Score = 2226, Expect = 0.0e+00, Identities = 407/682 (59%), Positives = 523/682 (76%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           L  FRN GIMAHIDAGKTT +ERILF++G+ HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+ +LDA+ GVEPQTETVWRQA  Y+VPR++F+NKMDK GA+F  SV ++++RL   AVP+QLPIGAE+ F+GIIDL++     +        +E  IP+  K+  ++ R  L+E VA  D+ +M  YLEG+EIS+ +IK  +RKGV+  +  PVLCGSA+KNKG++LLLDA+++F+PSP+D+   K      G E+   A   AP   LAFK+ATDPF+G+L F R+YSG +KSG+YV N  K K+ER+ RLVKMHA +R ++EE++AG++ AI+GLKDTTTG+TL DD   + LE M+F +PVI +++EPKTKA QEKM IAL+KLAEEDPTF+T+T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGK+I+QSGGRGQYGH  I   P + + +EF + +VGG IP+EYI  +  G++ A  SG +AGYP+I+ K  LFDGS+H+VDSSEMAFKIA S+A K A      VLLEP M +EV VPE+Y GD +GDI+SRRG IEG   R   +VI+A VPL EMFGYAT LRS +QGRGNYVMQF HY E PKS+ +++I  +K
  S:     8 LAKFRNIGIMAHIDAGKTTATERILFYTGKTHKIGETHEGAATMDWMEQEQERGITITSAATTCFWKDHQVNIIDTPGHVDFTVEVERSLRVLDGAVTILDAKSGVEPQTETVWRQADNYKVPRMVFINKMDKLGADFLMSVGTLRERLHANAVPLQLPIGAEDSFSGIIDLVKNDAVIYKDDLGTVMDETEIPEDMKEIAEEYRTMLLEAVAEVDEDIMMKYLEGEEISVEEIKTALRKGVLANKIVPVLCGSAYKNKGVQLLLDAIIEFMPSPLDIEDVKGTEPTTGEEMTRPADAKAPLAALAFKIATDPFIGKLAFTRIYSGTMKSGTYVFNSNKGKRERIGRLVKMHANHREDVEELKAGELGAIVGLKDTTTGDTLCDDADPIILENMEFPEPVIDVSIEPKTKAGQEKMGIALAKLAEEDPTFRTYTNQETGQTIIAGMGELHLEIIVDRLIREFKVECNVGQPQVAYKETIKKHVKAEGKFIRQSGGRGQYGHCWIEMMPTEGE-YEFQNAVVGGSIPKEYIPAIDNGIQEASQSGIIAGYPVINFKVKLFDGSYHDVDSSEMAFKIAGSMAFKNAMSKADAVLLEPSMKVEVVVPEEYMGDVIGDINSRRGRIEGMTPRAGAEVIRAFVPLSEMFGYATTLRSKTQGRGNYVMQFDHYEEVPKSIQDKVIGERK 689
>gi|110800420|ref|YP_697097.1| elongation factor G [Clostridium perfringens ATCC 13124] >gi|168212001|ref|ZP_02637626.1| translation elongation factor G [Clostridium perfringens B str. ATCC 3626] >gi|168215386|ref|ZP_02641011.1| translation elongation factor G [Clostridium perfringens CPE str. F4969] >gi|119368719|sp|Q0TMP3|EFG_CLOP1 Elongation factor G (EF-G) >gi|110675067|gb|ABG84054.1| translation elongation factor G [Clostridium perfringens ATCC 13124] >gi|170710072|gb|EDT22254.1| translation elongation factor G [Clostridium perfringens B str. ATCC 3626] >gi|170713242|gb|EDT25424.1| translation elongation factor G [Clostridium perfringens CPE str. F4969] (688 aa)
Score = 2225, Expect = 0.0e+00, Identities = 414/687 (60%), Positives = 521/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTT+ERILF++GR HKIGETHDG S MDWM QE+ERGITITSAAT+  WK   LN+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA +Y VPR+I+VNKMD TGA++   + ++++RL   AV IQ+PIG E+ F G++DL+  +   F     +  E   +P    D+ ++ RA ++E +A  D++LM  YLEG+E+++ ++K  +RK  I  +  PV+CGS++KNKG++ ++D VVD+LPSP+D+P  K    DG E +  ASDDAP   LAFK+ATDPFVGRL F RVYSGVL+SGSYV N  K KKER+ RLVKMHA +R E+E + A ++ A+IGLK+TTTG+TL  +   + LE M+F +PVIS+A+EPKTKA QEKM IALSKLAEEDPTFKT+TD ETGQTIIAGMGELHLDI+VDR++REFKVE NVGAPQV+++ET  K  E E K+ +QSGGRGQYGH KI   P + + +EF + IVGG IPREYI  V  G+  A  SG +AGYP+I+ K  LFDGS+H+VDSSEMAFKIA S+A K A      VLLEPIM +E+TVPE+Y GD +GD++SRRG +EG + R+  Q+I+A +PL EMFGYAT LRS +QGRG Y M+F HY + PKS+  E+   K
  S:     1 MARQYPLEKFRNFGIMAHIDAGKTTTTERILFYTGRNHKIGETHDGASTMDWMAQEQERGITITSAATTCFWKGYELNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADYYNCINTVRERLQANAVAIQIPIGQEDQFQGMVDLLTNQAIIFKDDLGKDIEVSDVPADLADKAEEYRAAMIEAIAETDEELMMKYLEGEELTLEELKVALRKATINNEIIPVICGSSYKNKGVQQMIDGVVDYLPSPLDIPAVKGTNLDGEEEVREASDDAPMSALAFKIATDPFVGRLAFTRVYSGVLESGSYVLNSTKGKKERIGRLVKMHANSREEVESLEAAELGAVIGLKNTTTGDTLCTEAAPIILEKMEFPEPVISIAIEPKTKAGQEKMGIALSKLAEEDPTFKTWTDQETGQTIIAGMGELHLDIIVDRLQREFKVECNVGAPQVAYKETIKKAVEAEAKFARQSGGRGQYGHCKIEMIPTEGE-YEFENAIVGGAIPREYIPAVDNGIREAAESGIIAGYPVINFKIRLFDGSYHDVDSSEMAFKIAGSMAFKNAMAKADAVLLEPIMKVEITVPEEYMGDVIGDVNSRRGRMEGMDSRNGAQIIRAFIPLSEMFGYATALRSRTQGRGTYAMEFDHYDDVPKSIQEEVAGKK 686
>gi|168181861|ref|ZP_02616525.1| translation elongation factor G [Clostridium botulinum Bf] >gi|182674868|gb|EDT86829.1| translation elongation factor G [Clostridium botulinum Bf] (689 aa)
Score = 2225, Expect = 0.0e+00, Identities = 408/682 (59%), Positives = 523/682 (76%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           L  FRN GIMAHIDAGKTT +ERILF++G+ HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+ +LDA+ GVEPQTETVWRQA  Y+VPR++F+NKMDK GA+F  SV ++++RL   AVP+QLPIGAE+ F+GIIDL++     +        +E  IP+  K+  ++ R  L+E VA  D+ +M  YLEG+EIS+ +IK  +RKGV+  +  PVLCGSA+KNKG++LLLDA+++F+PSP+D+   K      G E+   A   AP   LAFK+ATDPF+G+L F R+YSG +K+G+YV N  K K+ER+ RL+KMHA +R E+EE++AGD+ AIIGLKDTTTG+TL DD   + LE M+F +PVI +++EPKTKA QEKM IAL+KLAEEDPTF+T+T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGK+++QSGGRGQYGH  I   P + + +EF + IVGG IP+EYI  +  G++ A  SG +AGYP+I+ K  LFDGS+H+VDSSEMAFKIA S+A K A      VLLEP M +EV VPE+Y GD +GDI+SRRG IEG   R   +VI+A VPL EMFGYAT LRS +QGRGNYVMQF HY E PKS+ +++I  +K
  S:     8 LAKFRNIGIMAHIDAGKTTATERILFYTGKTHKIGETHEGGATMDWMEQEQERGITITSAATTCFWKDHQVNIIDTPGHVDFTVEVERSLRVLDGAVTILDAKSGVEPQTETVWRQADNYKVPRMVFINKMDKLGADFLMSVGTLRERLHANAVPLQLPIGAEDAFSGIIDLVKNDAVIYKDDLGTVMDETEIPEDMKEMAEEYRTMLLEAVAEVDEDIMMKYLEGEEISVEEIKTALRKGVLANKIVPVLCGSAYKNKGVQLLLDAIIEFMPSPLDIEDVKGTEPTTGEEMTRPADAKAPLAALAFKIATDPFIGKLAFTRIYSGTMKNGTYVFNSNKGKRERIGRLMKMHANHREEVEELKAGDLGAIIGLKDTTTGDTLCDDADPIILENMEFPEPVIDVSIEPKTKAGQEKMGIALAKLAEEDPTFRTYTNQETGQTIIAGMGELHLEIIVDRLIREFKVECNVGQPQVAYKETVRKHVKAEGKFVRQSGGRGQYGHCWIEMMPTEGE-YEFENAIVGGSIPKEYIPAIDNGIQEASQSGIIAGYPVINFKVKLFDGSYHDVDSSEMAFKIAGSMAFKNAMSKADAVLLEPSMKVEVVVPEEYMGDVIGDINSRRGRIEGMTPRAGAEVIRAFVPLSEMFGYATTLRSKTQGRGNYVMQFDHYEEVPKSIQDKVIGERK 689
>gi|168187817|ref|ZP_02622452.1| translation elongation factor G [Clostridium botulinum C str. Eklund] >gi|169294343|gb|EDS76476.1| translation elongation factor G [Clostridium botulinum C str. Eklund] (688 aa)
Score = 2224, Expect = 0.0e+00, Identities = 418/685 (61%), Positives = 525/685 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L  FRN GIMAHIDAGKTT++ERILF++G+ HKIGETH+G + MDWM QE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLD AI +LDA+ GVEPQTETVWRQA +YEVPR+IFVNKMD  GA+F  SVQ+++ RL   AVPIQ+PIG E D+ G +DLI+ K   FD       EE  IP++ KD+ ++ RA ++E +   D++LM  YLEG+EIS  +I   +RK  I  +  PVLCG+A+KNKGI+ LLDAV+ +LPSP+D+P  K   EDGNEV   ASDD P   LAFK+ATDPFVG+L FVRVYSGV+ SGSYV N  K KKER+ RLVKMHA +R E++E+ AG++ A+IGLK+TTTG+TL D+   V LE+M+F +PVIS+A+EPKTKA QEKM IAL+KLAEEDPTFKT+TD ETGQ IIAGMGELHL+I+VDR++REFKVE NVGAPQV+++ET     + EGK+++QSGGRGQYGH  I   P++ + +EF + IVGG IPREY+  V  G++ A  SG L GYP+I+ K   +DGS+H+VDSSEMAFK+A S+A K      +PVLLEP+M +E+ VPE+Y GD MGD++SRRG IEG   R   QVI A VPL EMFGYAT LRS +QGRG Y M+F++Y E PKS+  +++ 
  S:     1 MARQYPLNKFRNIGIMAHIDAGKTTSTERILFYTGKTHKIGETHEGAATMDWMVQEQERGITITSAATTCFWKDHQINIIDTPGHVDFTVEVERSLRVLDSAITILDAKGGVEPQTETVWRQADKYEVPRMIFVNKMDILGADFYMSVQTVRDRLRANAVPIQIPIGKEEDYAGHVDLIKMKAVVFDKELGVHFEEVEIPEELKDKAEEYRAAMLEAIVETDEELMMKYLEGEEISEEEIHTALRKATIANEIVPVLCGTAYKNKGIQHLLDAVLAYLPSPLDIPSIKGVDEDGNEVERHASDDEPLGALAFKIATDPFVGKLAFVRVYSGVMHSGSYVLNSNKVKKERIGRLVKMHANHREEVDELYAGELGAVIGLKNTTTGDTLCDENSPVILESMEFPEPVISVAIEPKTKAAQEKMGIALAKLAEEDPTFKTYTDQETGQVIIAGMGELHLEIIVDRLQREFKVECNVGAPQVAYKETIKNAVKAEGKFVRQSGGRGQYGHCWIELIPHEGE-YEFENAIVGGAIPREYVPAVDNGIQEASQSGILGGYPVINFKVKCYDGSYHDVDSSEMAFKVAGSMAFKNGMAKATPVLLEPVMKVEIVVPEEYMGDVMGDVNSRRGRIEGMNPRGGAQVIAAFVPLSEMFGYATVLRSRTQGRGTYSMEFANYEEVPKSIAEKVVG 684
>gi|18311390|ref|NP_563324.1| elongation factor G [Clostridium perfringens str. 13] >gi|110801645|ref|YP_699666.1| elongation factor G [Clostridium perfringens SM101] >gi|168208044|ref|ZP_02634049.1| translation elongation factor G [Clostridium perfringens E str. JGS1987] >gi|168218312|ref|ZP_02643937.1| translation elongation factor G [Clostridium perfringens NCTC 8239] >gi|169344025|ref|ZP_02865014.1| translation elongation factor G [Clostridium perfringens C str. JGS1495] >gi|21263509|sp|Q8XHS1|EFG_CLOPE Elongation factor G (EF-G) >gi|119368720|sp|Q0SQE1|EFG_CLOPS Elongation factor G (EF-G) >gi|18146074|dbj|BAB82114.1| translation elongation factor EF-G [Clostridium perfringens str. 13] >gi|110682146|gb|ABG85516.1| translation elongation factor G [Clostridium perfringens SM101] >gi|169297849|gb|EDS79945.1| translation elongation factor G [Clostridium perfringens C str. JGS1495] >gi|170660659|gb|EDT13342.1| translation elongation factor G [Clostridium perfringens E str. JGS1987] >gi|182379682|gb|EDT77161.1| translation elongation factor G [Clostridium perfringens NCTC 8239] (688 aa)
Score = 2223, Expect = 0.0e+00, Identities = 414/687 (60%), Positives = 521/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTT+ERILF++GR HKIGETHDG S MDWM QE+ERGITITSAAT+  WK   LN+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA +Y VPR+I+VNKMD TGA++   + ++++RL   AV IQ+PIG E+ F G++DL+  +   F     +  E   +P    D+ ++ RA ++E +A  D++LM  YLEG+E+++ ++K  +RK  I  +  PV+CGS++KNKG++ ++D VVD+LPSP+D+P  K    DG E +  ASDDAP   LAFK+ATDPFVGRL F RVYSGVL+SGSYV N  K KKER+ RLVKMHA +R E+E + A ++ A+IGLK+TTTG+TL  +   + LE M+F +PVIS+A+EPKTKA QEKM IALSKLAEEDPTFKT+TD ETGQTIIAGMGELHLDI+VDR++REFKVE NVGAPQV+++ET  K  E E K+ +QSGGRGQYGH KI   P + + +EF + IVGG IPREYI  V  G+  A  SG +AGYP+I+ K  LFDGS+H+VDSSEMAFKIA S+A K A      VLLEPIM +E+TVPE+Y GD +GD++SRRG +EG + R+  Q+I+A +PL EMFGYAT LRS +QGRG Y M+F HY + PKS+  E+   K
  S:     1 MARQYPLEKFRNFGIMAHIDAGKTTTTERILFYTGRNHKIGETHDGASTMDWMAQEQERGITITSAATTCFWKGYELNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADYYNCINTVRERLQANAVAIQIPIGQEDQFQGMVDLLTNQAIIFKDDLGKDIEVGEVPADLADKAEEYRAAMIEAIAETDEELMMKYLEGEELTLEELKVALRKATINNEIIPVICGSSYKNKGVQQMIDGVVDYLPSPLDIPAVKGTNLDGEEEVREASDDAPMSALAFKIATDPFVGRLAFTRVYSGVLESGSYVLNSTKGKKERIGRLVKMHANSREEVESLEAAELGAVIGLKNTTTGDTLCTEAAPIILEKMEFPEPVISIAIEPKTKAGQEKMGIALSKLAEEDPTFKTWTDQETGQTIIAGMGELHLDIIVDRLQREFKVECNVGAPQVAYKETIKKAVEAEAKFARQSGGRGQYGHCKIEMIPTEGE-YEFENAIVGGAIPREYIPAVDNGIREAAESGIIAGYPVINFKIRLFDGSYHDVDSSEMAFKIAGSMAFKNAMAKADAVLLEPIMKVEITVPEEYMGDVIGDVNSRRGRMEGMDSRNGAQIIRAFIPLSEMFGYATALRSRTQGRGTYAMEFDHYDDVPKSIQEEVAGKK 686
>gi|116628961|ref|YP_814133.1| elongation factor G [Lactobacillus gasseri ATCC 33323] >gi|122274041|sp|Q046C7.1|EFG_LACGA Elongation factor G (EF-G) >gi|116094543|gb|ABJ59695.1| translation elongation factor 2 (EF-2/EF-G) [Lactobacillus gasseri ATCC 33323] (698 aa)
Score = 2221, Expect = 0.0e+00, Identities = 407/682 (59%), Positives = 525/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGK-EEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G+S MDWM++EKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+ VLDAQ GVEPQTE VWRQA  Y VPRI+FVNKMDK GA+F++SV+S+ +RL   A  +Q+PIG+ + F G+IDLI      +D  K   K +  P+PD++K++  + R  L+E VA+ DD +M  YL G+EIS  ++K  IRK  +  +FFPV  GSAFKNKG++++LD V+D+LPSP+DV P      + G+EV + A D  PF  LAFK+ATDPFVGRLTF+RVY+G L+SGSYV N  KN +ERV RL++MHA +R EI E+ +GDI   IGLK+TTTG++L D    + LE++Q   PVI ++VEPK+KAD++KM +AL KL EEDPTF+  T+PETGQT+I+GMGELHLDI+V+RM+REF VE  +G PQV++RETF KE++ +GK+++QSGG+GQYG V I F PN++ KG+EF D IVGG +PRE+I  V  GL+ AM +G LAGYP+ID+KA L+DGS+HEVDSSE AFK+AASLAL+ A      V+LEPIM ++VT PE+Y GD MG I++RRG +EG E R   +VI + VPL EMFGYAT LRS +QGRG + M F HY+ TPKS+  EII
  S:     5 REFPLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGDSQMDWMDEEKERGITITSAATTAQWKDYRINIIDTPGHVDFTIEVERSLRVLDGAVTVLDAQAGVEPQTENVWRQAETYGVPRIVFVNKMDKIGADFDKSVKSLHERLNANAHAVQMPIGSADTFEGVIDLINMVADVYDEDKLGSKWDTIPVPDEYKEEALKRRNELIEAVADVDDGIMDKYLGGEEISNDELKAAIRKATLNLEFFPVYAGSAFKNKGVQMMLDGVIDYLPSPLDVKPYVAHDPKTGDEVELMADDKKPFAALAFKIATDPFVGRLTFIRVYTGSLQSGSYVLNASKNARERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKNTTTGDSLTDPDHPLILESLQVPDPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGQTLISGMGELHLDIMVERMKREFNVEATIGEPQVAYRETFTKEAKAQGKFVRQSGGKGQYGDVWIDFTPNEEGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEVDSSEAAFKVAASLALRNAAAKAGAVILEPIMKVQVTTPEEYLGDVMGSITARRGSMEGMEDRAGAKVINSFVPLSEMFGYATTLRSSTQGRGTFTMVFDHYSPTPKSIQAEII 689
>gi|160935070|ref|ZP_02082456.1| hypothetical protein CLOLEP_03946 [Clostridium leptum DSM 753] >gi|156866523|gb|EDO59895.1| hypothetical protein CLOLEP_03946 [Clostridium leptum DSM 753] (693 aa)
Score = 2218, Expect = 0.0e+00, Identities = 415/687 (60%), Positives = 525/687 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGETHDG + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEV+RSLRVLDG++ VL A+ GVEPQ+ETVWRQA  Y VPR+ +VNKMD  GA+F R VQ ++ RL   AVPIQLPIG+E+ F GIIDL+E K  VY+ + G + K EE  IPD  K+  ++ RA L+E VA  DD+L+  YL G+E+++ +IKR IRK  I     PV CG++++NKG++ LLDA+VD++P+P DV   K    E   EV+  +SDD PF  LAFK+ TDPFVG+L F RVYSG + +G+ V N  K+  ER+ R+++MHA +R +IE   AGDI A +GLK+T+TG+TL D+K  V LE+M F +PVI +A+EPKTKA QEKM IAL+KLAEEDPTFK +TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET    ++V+ KY +QSGG+GQYGHVKIR EPN  KG+EFV+ IVGG IP+EYI  V  G++ AM SG LAGY ++D+K TL+DGS+HEVDSSEMAFKIAAS+A KEA +   PVL+EPIM + V VPE+Y GD +GD++SRRG+I+G +     Q I A VPL EMFGYATD+RS +QGRG Y M+ S YAE PKSV  +II+++
  S:     1 MPRQVSLEKTRNVGIMAHIDAGKTTTTERILYYTGVNHKIGETHDGAATMDWMAQEQERGITITSAATTCFWKEHRINIIDTPGHVDFTVEVQRSLRVLDGSVTVLCAKGGVEPQSETVWRQADEYHVPRMAYVNKMDIMGADFYRVVQMMKDRLQCNAVPIQLPIGSEDTFKGIIDLVEMKADVYYDEMGTDMKVEE--IPDDMKELAEKYRAELIEHVAEQDDELLEKYLGGEELTVDEIKRTIRKSCIANTMVPVTCGTSYRNKGVQKLLDAIVDYMPAPTDVAAIKGINPETEEEVVRHSSDDEPFSALAFKIMTDPFVGKLCFFRVYSGTINAGTTVYNANKDNNERIGRILQMHANHRQDIECCYAGDIAAAVGLKNTSTGDTLCDEKHPVILESMVFPEPVIRVAIEPKTKAGQEKMGIALAKLAEEDPTFKAYTDEETGQTIIAGMGELHLEIIVDRLLREFKVEANVGKPQVAYKETIRGTADVDNKYARQSGGKGQYGHVKIRIEPNPGKGYEFVNAIVGGAIPKEYIPAVDQGIQGAMLSGVLAGYNVVDVKVTLYDGSYHEVDSSEMAFKIAASMAFKEAMRKAQPVLMEPIMKVAVIVPEEYMGDVIGDLNSRRGMIQGMDALPGAQRINAMVPLSEMFGYATDMRSKTQGRGQYTMEPSDYAEVPKSVGEKIISSR 688
>gi|119510867|ref|ZP_01629991.1| elongation factor EF-2 [Nodularia spumigena CCY9414] >gi|119464476|gb|EAW45389.1| elongation factor EF-2 [Nodularia spumigena CCY9414] (692 aa)
Score = 2217, Expect = 0.0e+00, Identities = 415/688 (60%), Positives = 522/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKE-SEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L   RN GI AHIDAGKTTT+ERILF+SG IHKIGE H+G +V DWM QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGANF R    +  RL   A+ IQLPIG+E +F+GI+DL+ ++ Y ++  +    EE  IP + +++V + R  L+E VA  +D LM  Y EG+E++ A+I+  +RKG I  +  PVLCGSAFKNKG++L+LDAVVD+LP+P +VP  +     G  V   A D+ P   LAFK+  DP+ GRLTFVRVYSGVLK GSYV N  KNKKER+SRLV + A  R +++E+RAGD+ A +GLK+T TG+T+ D+   V LE++   +PVIS+AVEPKTK D +K+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  KE S++EGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G++ +  SG LAGYP+IDIKATL DGS+H+VDSSEMAFKIA S+A+KEA    SPVLLEP+M +EV VPE Y GD MGD++SRRG IEG    D +  + AKVPL EMFGYATD+RS +QGRG + M+FSHY E P++V   IIA  K
  S:     1 MARTIPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEGTAVTDWMAQERERGITITAAAISTSWKDHQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHDQMCDRLRANAIAIQLPIGSETEFSGIVDLVRQRAYIYNNDEGTDIEETDIPAEMQEKVAEYRTKLIEAVAETNDVLMNKYFEGEELTEAEIRTALRKGTIANKIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPAIQGTLPTGEAVERRADDEEPLSALAFKIMADPY-GRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVILKADERMDVDEMRAGDLGAALGLKETLTGDTITDEGSPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVHVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKEVSKIEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIVGGTVPKEYISPAEQGMKESCESGILAGYPLIDIKATLIDGSYHDVDSSEMAFKIAGSMAMKEAVLKASPVLLEPMMKVEVEVPENYLGDVMGDLNSRRGQIEGMGSDDGLAKVTAKVPLAEMFGYATDIRSKTQGRGIFSMEFSHYEEVPRNVAEAIIAKSK 689
>gi|186684014|ref|YP_001867210.1| protein synthesis factor, GTP-binding [Nostoc punctiforme PCC 73102] >gi|186466466|gb|ACC82267.1| protein synthesis factor, GTP-binding [Nostoc punctiforme PCC 73102] (692 aa)
Score = 2216, Expect = 0.0e+00, Identities = 410/688 (59%), Positives = 520/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKE-SEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L   RN GI AHIDAGKTTT+ERILF+SG IHKIGE H+G +V DWMEQE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGANF +  + I+ RL   A+ IQLPIG+ENDF GI+DL+ ++ Y +   +    +E  IP++ + QV + R  L+E  A  DD LMA Y EG+E++  +I+  +RKG I     PVLCGSAFKNKG++L+LDAVVD+LP+P +VP  +    +G+ +   A D+ P   LAFK+  DP+ GRLTFVRVYSGVLK GSYV N  KNKKER+SRLV M A +R +++E+RAGD+ A +GLKDT TG+TL DD   V LE++   +PVIS+AVEPKTK D +K+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  K  ++VEGK+I+QSGG+GQYGHV I  EP +   GFEFV KI GG +P+EY+ P + G++ +  SG LAGYP+ID+KATL DGS+H+VDSSEMAFKIA S+A+KEA    SPV+LEP+M +EV VPE Y G+ +GD+++RRG IE       +  + +KVPL  MFGYATD+RS +QGRG + M+FSHY E P+SV   IIA  K
  S:     1 MARTIPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEGTAVTDWMEQERERGITITAAAISTSWKDHQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQAERYKVPRIAFINKMDRTGANFYKVHEQIRDRLRANAIAIQLPIGSENDFQGIVDLVRQRAYIYANDQGTDIQETDIPEELQAQVDEFRTKLIEAAAETDDALMAKYFEGEELTEQEIRTALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPSEVPPIQGLLPNGDTIERRADDNEPLAALAFKIMADPY-GRLTFVRVYSGVLKKGSYVLNASKNKKERISRLVLMKADDRQDVDELRAGDLGAALGLKDTLTGDTLCDDGSPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVRVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKAVNKVEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIAGGTVPKEYVGPAEQGMKESCESGVLAGYPLIDVKATLIDGSYHDVDSSEMAFKIAGSMAMKEAVLKASPVILEPMMKVEVEVPEDYMGNVIGDLNTRRGQIESQSTEKGLAKVTSKVPLASMFGYATDIRSKTQGRGTFTMEFSHYEEVPRSVAETIIAKSK 689
>gi|182417386|ref|ZP_02948718.1| translation elongation factor G [Clostridium butyricum 5521] >gi|182378765|gb|EDT76289.1| translation elongation factor G [Clostridium butyricum 5521] (688 aa)
Score = 2214, Expect = 0.0e+00, Identities = 408/683 (59%), Positives = 520/683 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR   L  FRNFGIMAHIDAGKTTT+ERILF++G  HKIGE HDGE+ MDWM QE+ERGITITSAATS  WK   LN+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA +Y VPR+I+VNKMD TGA+F R +Q+++ RL   AVPIQ+PIG E +F G++DLI+   + F  D GK+ +  E+ IP +  DQ ++ RA ++E +A  D+ LM  YLEG+E+SI ++K  +RK  I  + +P +CGS++KNKG++ ++D VVDFLPSP+D+P  K    +G E   SA D  P   LAFK+ATDPFVG+L F R+Y+GV++SG+YV N  K KKER+ RLVKMH+ +R E+E + AG+I A+IGLK+TTTG+TL  +   + LE+M+F +PVIS+A+EP +KA QEKM +AL+KLAEEDPTFKT+T+ ETGQTIIAGMGELHLDI+VDR++REFKVE  VGAPQV+++ET     + E KY KQSGG+GQYGH  I  EP + + + F + IVGG IP+EYI  + AG++ A  +G +AGY +I+ K  L  GS+HEVDSSEMAFKIA S+A K A    SPVLLEP+M +E+TVPE+Y GD +GD SSRRG IEG E  +  ++++A VPL EMFGYAT LRS +QGRG Y M F HY E PK++  EI
  S:     1 MARKYPLDKFRNFGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGEATMDWMVQEQERGITITSAATSCEWKGHELNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADFFRCIQTVKDRLKANAVPIQIPIGGEENFKGMVDLIKNVAFVFYDDLGKDIR--EEAIPAELADQAEEYRAAMIEAIAETDETLMEKYLEGEELSIEELKTALRKATIANEIYPCICGSSYKNKGVQEMIDGVVDFLPSPLDIPAVKGTTLEGEEDSRSADDKEPLAALAFKIATDPFVGKLAFTRIYAGVMQSGTYVLNSTKGKKERIGRLVKMHSNSRQEVEALEAGEIGAVIGLKNTTTGDTLCSESSPIILESMEFPEPVISVAIEPASKAAQEKMGLALAKLAEEDPTFKTWTEEETGQTIIAGMGELHLDIIVDRLKREFKVECTVGAPQVAYKETIRSAVKAEAKYAKQSGGKGQYGHAVIEMEPTEGE-YVFENAIVGGAIPKEYIPAIDAGIQEASKNGIIAGYNVINFKVKLVHGSYHEVDSSEMAFKIAGSMAFKNAMAKASPVLLEPMMKVEITVPEEYMGDVIGDCSSRRGRIEGMEDVNGAKIVRAFVPLSEMFGYATALRSRTQGRGVYSMVFDHYEEVPKNIQEEI 682
>gi|116493165|ref|YP_804900.1| elongation factor G [Pediococcus pentosaceus ATCC 25745] >gi|122265371|sp|Q03EB4.1|EFG_PEDPA Elongation factor G (EF-G) >gi|116103315|gb|ABJ68458.1| translation elongation factor 2 (EF-2/EF-G) [Pediococcus pentosaceus ATCC 25745] (697 aa)
Score = 2213, Expect = 0.0e+00, Identities = 425/682 (62%), Positives = 538/682 (78%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETH+G S MDWM QE+ERGITITSAAT+ +WKN  +N+IDTPGHVDFT+EVERSLRVLDGA+AVLDAQ GVEPQTETVWRQAS Y+VPRI+F NKMDK GA+F+ SVQSI  RL   A+PIQ+PIGAE+DF GIIDL+E K   +D    G + E  +   +PD++K++ ++ R  ++E++A+ D+ +M  YL G++IS+A+IK  IRKG +  + FPVL GSAFKNKG++++LDAVVD+LPSP+DV P +    E G++V + A DD  F  LAFKVATDPFVGRLTF+RVY G L+SGSYV N  K K+ERV RL++MH+  R EI E+ +GDI A IGLK+TTTG++L D    +QLE+M F  PVI +AVEPK+KADQ+KM IAL KLAEEDP+F+  T+PETG+T+IAGMGELHLDI+VDRM+REF VE  +GAPQVS+RE F K++  +GK+++QSGG+GQYG V + FEPN++ KGFEF D IVGG +PREYI  V+ GL  AM +G LAGYP++D+KA L+DGS+H+VDSSE AFK+AASLAL+ A K  +PV+LEPIM +E+ VPE+Y GD MG +++RRG ++G E     + I A VPL EMFGYAT LRS SQGRG + M F HY   PKS+  EII
  S:     5 REFPLERTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAAWKNHRINIIDTPGHVDFTIEVERSLRVLDGAVAVLDAQAGVEPQTETVWRQASDYDVPRIVFANKMDKLGADFDFSVQSIHDRLQANALPIQMPIGAEDDFQGIIDLVEMKADLYDVDELGTEWETVD---VPDEYKEEAEKRRNEMIEQLADIDENIMEKYLGGEDISVAEIKAAIRKGTLALELFPVLAGSAFKNKGVQMMLDAVVDYLPSPLDVKPYSATDPETGDQVELIAGDDKSFAALAFKVATDPFVGRLTFIRVYQGTLESGSYVLNATKGKRERVGRLLQMHSNQRQEIPEVFSGDIAAAIGLKNTTTGDSLTDPAHPLQLESMVFPDPVIEVAVEPKSKADQDKMDIALQKLAEEDPSFRAETNPETGETVIAGMGELHLDIIVDRMKREFNVEATIGAPQVSYREAFTKKTSAQGKFVRQSGGKGQYGDVWVEFEPNEEGKGFEFEDAIVGGVVPREYIPSVEEGLREAMNNGVLAGYPLVDVKAKLYDGSYHDVDSSEAAFKVAASLALRAAAKTAAPVILEPIMKVEIRVPEEYMGDIMGQVTARRGRVDGMEAIAGAEEIHAFVPLSEMFGYATTLRSASQGRGTFTMTFDHYEAVPKSIQEEII 689
>gi|170761821|ref|YP_001788824.1| translation elongation factor G [Clostridium botulinum A3 str. Loch Maree] >gi|189027850|sp|B1KSM8.1|EFG_CLOBM Elongation factor G (EF-G) >gi|169408810|gb|ACA57221.1| translation elongation factor G [Clostridium botulinum A3 str. Loch Maree] (689 aa)
Score = 2213, Expect = 0.0e+00, Identities = 407/682 (59%), Positives = 521/682 (76%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           L  FRN GIMAHIDAGKTT +ERILF++G+ HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+ +LDA+ GVEPQTETVWRQA  Y+VPR++F+NKMDK GA+F  SV ++++RL   AVP+QLPIGAE+ F+GIIDL++     +        +E  IP+  K+  ++ R  L+E VA  D+ +M  YLEG+EIS+ +IK  +R GVI  +  PVLCGSA+KNKG++LLLDA+V+F+PSP+D+   K      G E+   A   AP   LAFK+ATDPF+G+L F R+YSG +KSG+YV N  K K+ER+ RLVKMHA +R E++E++AG++ AI+GLKDTTTG+TL DD   + LE M+F +PVI +++EPKTKA QEKM IAL+KLAEEDPTF+T+T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGK+++QSGGRGQYGH  I   P + + +EF + IVGG IP+EYI  +  G++ A  SG +AGYP+I+ K  L DGS+H+VDSSEMAFKIA S+A K A      VLLEP M +EV VPE+Y GD +GDI+SRRG IEG   R   +VI+A VPL EMFGYAT LRS +QGRGNYVMQF HY E PKS+ +++I  +K
  S:     8 LAKFRNIGIMAHIDAGKTTATERILFYTGKTHKIGETHEGGATMDWMEQEQERGITITSAATTCFWKDHQVNIIDTPGHVDFTVEVERSLRVLDGAVTILDAKSGVEPQTETVWRQADNYKVPRMVFINKMDKLGADFLMSVGTLRERLHANAVPLQLPIGAEDSFSGIIDLVKNDAVIYKDDLGTVMDETEIPEDMKEIAEEYRTMLLEAVAEVDEDIMMKYLEGEEISVEEIKTALRHGVIANKIVPVLCGSAYKNKGVQLLLDAIVEFMPSPLDIEDVKGTEPTTGEEMTRPADAKAPLAALAFKIATDPFIGKLAFTRIYSGTMKSGTYVFNSNKGKRERIGRLVKMHANHREEVDELKAGELGAIVGLKDTTTGDTLCDDANPIILENMEFPEPVIDVSIEPKTKAGQEKMGIALAKLAEEDPTFRTYTNQETGQTIIAGMGELHLEIIVDRLIREFKVECNVGQPQVAYKETVRKHVKAEGKFVRQSGGRGQYGHCWIEMMPTEGE-YEFDNAIVGGAIPKEYIPAIDNGIQEASQSGIIAGYPVINFKVKLVDGSYHDVDSSEMAFKIAGSMAFKNAMSKADAVLLEPSMKVEVVVPEEYMGDVIGDINSRRGRIEGMTPRAGAEVIRAFVPLSEMFGYATTLRSKTQGRGNYVMQFDHYEEVPKSIQDKVIGERK 689
>gi|78221843|ref|YP_383590.1| elongation factor G [Geobacter metallireducens GS-15] >gi|119368673|sp|Q39Y09|EFG1_GEOMG Elongation factor G 1 (EF-G 1) >gi|78193098|gb|ABB30865.1| translation elongation factor 2 (EF-2/EF-G) [Geobacter metallireducens GS-15] (692 aa)
Score = 2212, Expect = 0.0e+00, Identities = 416/688 (60%), Positives = 520/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGE H+G + MDWMEQE+ERGITITSAAT+ +W +  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GA+F R V  I+ RL    VPIQLPIGAE+ F G++DL+E K   +D    G +   EE  IP   ++  ++    +VEE+++ DD LM  YL G+E+++ +++  IR   I  Q  PV+CGS+FKNKG++ LLD+VV++LPSPVD+P  K    D G E+   A+D  PF  LAFK+ TDPFVG+L F+RVYSGVL SGSYV N  K KKER+ RL+KMHA  R EI+E+ AGDI A +GLK TTTG+TL  +   V LE+++F +PVI++A+EPKTKADQEK+ I+L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ +VEGK+++QSGGRGQYGHV I  EP +  KG+EFVD I GG +PREYI  V  G++ AM +G LAG+P +D K +L DGS+HEVDSSEMAFKIA S+A KEA    SPVLLEPIM++EV VPE+Y GD +GD++SRRG I G E R   QV+ A VPL +MFGYATDLRS +QGR  Y M F HY + PKSV  EIIA  K
  S:     1 MARLVPLEKTRNIGIMAHIDAGKTTTTERILYYTGVTHKIGEVHEGAATMDWMEQEQERGITITSAATTCNWGDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAFVNKMDRVGADFFRGVSMIRDRLKANPVPIQLPIGAEDTFKGVVDLVEMKAIVWDEESLGAKFHVEE--IPADLQELAQEYHEKMVEEISSHDDALMEKYLGGEELTVDEVRAAIRNATIAIQICPVICGSSFKNKGVQNLLDSVVEYLPSPVDIPAIKGVDADSGAEIERKAADSEPFAALAFKIMTDPFVGQLCFIRVYSGVLNSGSYVYNSTKGKKERIGRLLKMHANKREEIKEVLAGDIAAAVGLKYTTTGDTLCPEDAPVILESIEFPEPVIAIAIEPKTKADQEKLGISLQKLASEDPSFRVRTDEETGQTIISGMGELHLEIIVDRLMREFKVEANVGKPQVAYRETVTKKVKVEGKFVRQSGGRGQYGHVWIEMEPQEPGKGYEFVDAIKGGVVPREYIPAVDKGIQEAMDTGVLAGFPCVDFKVSLVDGSYHEVDSSEMAFKIAGSMAFKEAAAKASPVLLEPIMSVEVVVPEEYMGDVIGDLNSRRGRIMGMEGRAGAQVVSAMVPLAQMFGYATDLRSATQGRATYTMTFDHYEQVPKSVSEEIIAKVK 691
>gi|16330914|ref|NP_441642.1| elongation factor G [Synechocystis sp. PCC 6803] >gi|2494254|sp|P74228|EFG2_SYNY3 Elongation factor G 2 (EF-G 2) >gi|1653408|dbj|BAA18322.1| elongation factor EF-G [Synechocystis sp. PCC 6803] (691 aa)
Score = 2212, Expect = 0.0e+00, Identities = 414/688 (60%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MARTV L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE H+G +V DWM QE+ERGITIT+AA S  W    +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI FVNKMD+TGANF R  Q I  RL   AVP+Q+PIG+E +F GI+DL+  K Y +        +E PIPD  KD+ ++ R  LVE VA  DD LM  YLEG+E++  ++   +R+G I     PVLCGSAFKNKG++LLLDAVVD+LPSP++VP  + +  DG      A D AP   LAFKV  DPF GRLTFVRVYSGVL+ GSYV N  K KKER+SRL+ + A +R E++++ AGD+ A++GLKDT TG+TL DD+  + LE++   QPVIS+AVEPKTK D +K+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  K  + EGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG IP+EYI P + G++ A ASG LAGYP+ID+KATL DGSFH+VDSSEMAFKIA S+A++EA     PVLLEP+M +E+ VP+ + G+ +GD+++RRG IEG E    +  + A VPL EMFGYATD+RS +QGRG + M+FSHYAE P++V   I+A  +
  S:     1 MARTVPLERIRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHEGTAVTDWMAQERERGITITAAAISTDWLGHHINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQAERYQVPRIAFVNKMDRTGANFFRVCQQIGDRLRANAVPVQIPIGSEAEFEGIVDLVRMKAYLYKNDLGTDIQEVPIPDSVKDKTEEYRLRLVESVAEADDALMEKYLEGEELTADELVAGLRRGTIAGTMVPVLCGSAFKNKGVQLLLDAVVDYLPSPLEVPAIEGHLPDGEVATRPAEDKAPLSALAFKVMADPF-GRLTFVRVYSGVLEKGSYVLNSTKEKKERISRLIILKADDRIEVDQLNAGDLGAVLGLKDTLTGDTLCDDQEPIILESLFVPQPVISVAVEPKTKQDMDKLSKALQSLSEEDPTFRVSVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKAVQAEGKFIRQSGGKGQYGHVVIEVEPTEPGTGFEFVSKIVGGVIPKEYIAPSEQGMKEACASGVLAGYPVIDLKATLVDGSFHDVDSSEMAFKIAGSMAIREAVGQADPVLLEPVMKVEIEVPDDFMGNVIGDLNARRGHIEGQETEQGIAKVAASVPLAEMFGYATDIRSKTQGRGIFSMEFSHYAEVPRNVAEAIVAKSR 688
>gi|94968251|ref|YP_590299.1| translation elongation factor 2 (EF-2/EF-G) [Acidobacteria bacterium Ellin345] >gi|119368708|sp|Q1ISC5|EFG_ACIBL Elongation factor G (EF-G) >gi|94550301|gb|ABF40225.1| translation elongation factor 2 (EF-2/EF-G) [Acidobacteria bacterium Ellin345] (697 aa)
Score = 2212, Expect = 0.0e+00, Identities = 404/685 (58%), Positives = 523/685 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR V L   RN GIMAHIDAGKTTT+ER+LF++GR H+IGE H+G + MDWM QE+ERGITITSAAT+ +W++  +N+IDTPGHVDFT EVERSLRVLDGA+AV DA  GVEPQ+ETVWRQA +Y VPRI F+NK+DK GA+FE ++ +I++RL  K V IQ PIG E+ F G+IDL + K + + D     + + + IP +   + +     +VE +A  DD+LMA Y+EG+E++ A+++  +R+  I  + FPV  G+AFKNKG++ LLDAVVD+LPSP+D+P       D G E   SA D  PF  LAFK+ TDPFVG+LTF+RVYSG LK+G  V N  K + ER+ RL+KMHA  R EI EI AGDICA++GLK  TTG+T+ D+K  + LE+++F  PVIS+AVEPKTK+DQEKM +AL+KLA+EDPTF+  TDP++GQTIIAGMGELHL+ILVDRM REF V+ NVG PQV++RET  KE++ EGKYI+Q+GG GQYGH KIR  PN+  KG+EF++ IVGG IP+E+IKP+  G++ A+  G LAGY M+D+K TL+DGS+H+VDS+EMAFKIA S+A KEA +  SPVLLEP+M++EV VPE+Y G  +GD++SRRG IEG E R   QV+KA VPL EMFGY   +RS +QGR  + M F+HY E P+SV  EI+A
  S:     1 MARQVPLERCRNIGIMAHIDAGKTTTTERVLFYTGRTHRIGEVHEGTATMDWMAQEQERGITITSAATTCTWRDERINIIDTPGHVDFTAEVERSLRVLDGAVAVFDAVHGVEPQSETVWRQADKYSVPRICFINKIDKMGADFEHAIDTIRKRLNAKPVAIQYPIGLEDKFKGVIDLFKMKALVWHDEAMGSQYDVEEIPAELLKKAQAFHNLMVETIAECDDELMAKYIEGEEMTAAELQAGLRRATIAMKVFPVTVGTAFKNKGVQTLLDAVVDYLPSPLDIPPVTGKNPDTGLEEQRSADDKQPFAALAFKIMTDPFVGQLTFIRVYSGQLKTGDSVYNSSKGRTERIGRLLKMHANKREEIGEIMAGDICAVVGLKTITTGDTISDEKHPLVLESIEFPTPVISVAVEPKTKSDQEKMGVALNKLAQEDPTFRVSTDPDSGQTIIAGMGELHLEILVDRMMREFHVQANVGKPQVAYRETIRKEAQAEGKYIRQTGGSGQYGHCKIRVGPNEPGKGYEFINDIVGGTIPKEFIKPIDQGIKEALEGGVLAGYEMVDVKVTLYDGSYHDVDSNEMAFKIAGSMAFKEAARKASPVLLEPVMSVEVVVPEEYMGVIIGDLNSRRGRIEGLEHRAGSQVVKAMVPLAEMFGYVNSMRSNTQGRATFSMHFAHYEEAPRSVAEEIVA 688
>gi|196235476|ref|ZP_03134278.1| translation elongation factor G [Thermus aquaticus Y51MC23] >gi|196220220|gb|EDY14837.1| translation elongation factor G [Thermus aquaticus Y51MC23] (691 aa)
Score = 2210, Expect = 0.0e+00, Identities = 406/679 (59%), Positives = 528/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++G+IHKIGE H+G + MD+MEQE+ERGITIT+A T+  W++  +N+IDTPGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ +Q ++    L+E  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    DG EV I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQ+K+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR+RREFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++D+K TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD++SRRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E P+ +  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGKIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWRDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLGLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLEQAREYHEKLIEAAADFDENVMLKYLEGEEPTEEELVAAIRKGTIDIKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPDGEEVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEIPEPVIDVAIEPKTKADQDKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLRREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKAEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDVKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNSRRGQILGMEPRGNAQVIRAYVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPRQIQEKLI 688
>gi|168333597|ref|ZP_02691862.1| translation elongation factor G [Epulopiscium sp. 'N.t. morphotype B'] (693 aa)
Score = 2210, Expect = 0.0e+00, Identities = 413/687 (60%), Positives = 526/687 (76%)
  Q:     2 ARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRF---EPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
            R   L   RN GIMAHIDAGKTT +ERILF++GR HKIGETH+G + MDWMEQEKERGITITSAAT+  W N  +N+IDTPGHVDFTVEVERSLRVLD A+ V  A+ GVEPQ+ETVWRQA +Y VPR+ FVNKMD  GA+F  +V  ++ RLG  AVP+QLPIGAE++F GIIDL+E K Y +  D GKE   +E  IPD  K++ ++ R   ++ +A+ DD L   YLEG+E+++ ++K  +RK VIG Q  PV CGSA+KNKG++ LLDA+V+++P+P D+   K    D +E ++  +SD+ PF  LAFK+ TDPFVG+L F RVYSG L+SGSYV N  K KKER+ R+V+MHA +R +I+++ AGDI A +GLK TTTG+TL  +   V LE+M F +PVIS+A+EPKTKA QEKM IALSKLAEEDPTFK +TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++ET  K+ ++E K+++QSGG GQYGH K+RF   +PN +K +EF   +VGG IP+EYI  V  G+ +AM SGPLAGY ++ I A  +DGS+H+VDSSEMAFKIA S+A K+A K    +LLEPIM + V VPE Y GD +G+I+SRRG IEG E R+  Q I+A VPL EMFGYATDLRS +QGRGNY M+F HY + PKS+ ++++A  K
  S:     3 GREYPLERTRNIGIMAHIDAGKTTLTERILFYTGRNHKIGETHEGGATMDWMEQEKERGITITSAATTCFWNNNRVNIIDTPGHVDFTVEVERSLRVLDSAVGVFCAKGGVEPQSETVWRQADKYNVPRMAFVNKMDIMGADFYNAVDMMRDRLGTNAVPMQLPIGAEDEFIGIIDLLENKAYIYKDDLGKE--IDEIEIPDDMKEKAEKFREEAIDAIASIDDDLAEKYLEGEELTLQELKTGLRKAVIGTQIVPVFCGSAYKNKGVQRLLDAIVEYMPAPTDIEAIKGIDPDTDEPMVRHSSDEEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVYNSVKGKKERIGRIVQMHANSRQDIDKVYAGDIAAAVGLKGTTTGDTLCTEDNPVILESMVFPEPVISVAIEPKTKAGQEKMGIALSKLAEEDPTFKAYTDQETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKETLAKDVDIESKFVRQSGGSGQYGHCKVRFSRLDPNSEKTYEFKSSVVGGSIPKEYIPAVDKGIRDAMTSGPLAGYEVLGIMADCYDGSYHDVDSSEMAFKIAGSMAFKDAMKKAGGLLLEPIMKVVVIVPEDYMGDVIGNINSRRGRIEGMEARNGAQEIRALVPLAEMFGYATDLRSRTQGRGNYSMEFDHYEQCPKSIQDKVVADGK 693
>gi|46199633|ref|YP_005300.1| elongation factor G [Thermus thermophilus HB27] >gi|62286675|sp|Q72I01|EFG_THET2 Elongation factor G (EF-G) >gi|46197259|gb|AAS81673.1| protein translation elongation factor G (EF-G) [Thermus thermophilus HB27] (691 aa)
Score = 2208, Expect = 0.0e+00, Identities = 410/679 (60%), Positives = 526/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYHVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDEHIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|55981664|ref|YP_144961.1| elongation factor G [Thermus thermophilus HB8] >gi|119190|sp|P13551|EFG_THETH Elongation factor G (EF-G) >gi|66773798|sp|Q5SHN5|EFG_THET8 Elongation factor G (EF-G) >gi|40889076|pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide >gi|40889077|pdb|1KTV|B Chain B, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide >gi|157830795|pdb|1DAR|A Chain A, Elongation Factor G In Complex With Gdp >gi|157830957|pdb|1ELO|A Chain A, Elongation Factor G Without Nucleotide >gi|165760896|pdb|2OM7|L Chain L, Structural Basis For Interaction Of The Ribosome With The Switch Regions Of Gtp-Bound Elongation Factors >gi|48240|emb|CAA34354.1| unnamed protein product [Thermus thermophilus] >gi|55773077|dbj|BAD71518.1| elongation factor G (EF-G) [Thermus thermophilus HB8] (691 aa)
Score = 2208, Expect = 0.0e+00, Identities = 410/679 (60%), Positives = 527/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|94985971|ref|YP_605335.1| elongation factor G [Deinococcus geothermalis DSM 11300] >gi|119368722|sp|Q1IX68|EFG_DEIGD Elongation factor G (EF-G) >gi|94556252|gb|ABF46166.1| translation elongation factor G [Deinococcus geothermalis DSM 11300] (696 aa)
Score = 2205, Expect = 0.0e+00, Identities = 405/678 (59%), Positives = 522/678 (76%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNC------SLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           L +FRN GI AHIDAGKTTT+ERIL+++GR H IGE HDG + MDWMEQE+ERGITIT+AAT+  WK        ++N+IDTPGHVDFT+EVERS+RVLDGA+AV D+  GVEPQ+ETVWRQA RY VPRI F NKMDKTGA+FE  V  I++RLG    PIQ P+G EN+F GIIDL+ ++ Y +      + +E  +P ++ D+V +MRA L+E  A  D+ LM  YLEG+E S+  +   +RKG I  + FPVLCGS+ KNKG++LLLDAVVD+LPSP+D+P  K   E+G  +   A  +     LAFK+  DP+VGRLTFVR+YSG L++GSYV N  K+K+ERV RL+KMHA +R E+ E++AG++ A+IGLKD  TG TL+ D    V LE++   +PVI LA+EPKTKADQEKM I L KLAEEDPTFK  TD E+GQT I+GMGELHL+ILVDR++RE+KV+ NVGAPQV++RET  K  +VEGK+++QSGGRGQ+GHVKI+ EP     GF F + +VGG +P+EYI P Q G+E AM SGP+ G+P++D+K TL+DGS+HEVDSSEMAFKIA S+ALKEA +  +P LLEPIM +EVTVPE+Y GD +GD++SRRG I+G E R N Q++KA VPL EMFGYATD+RS +QGR +Y M F HY++ P ++  +++
  S:     9 LTHFRNIGIAAHIDAGKTTTTERILYYTGRTHNIGEVHDGAATMDWMEQERERGITITAAATTAKWKRSGTNEEYTINIIDTPGHVDFTIEVERSMRVLDGAVAVFDSSQGVEPQSETVWRQADRYGVPRIAFANKMDKTGASFELVVNDIRERLGAIPAPIQYPMGQENEFKGIIDLVRQRAYTYTNDLGTEIQEHDVPAEYADKVAEMRAQLIEAAAEVDEDLMMMYLEGEEPSVEQLVAALRKGTIDKKIFPVLCGSSLKNKGVQLLLDAVVDYLPSPLDIPAIKGTTENGEVIEYPADPEGKLAALAFKIMADPYVGRLTFVRIYSGTLQAGSYVYNASKDKRERVGRLLKMHANSREEVTELKAGELGAVIGLKDAGTGNTLIGDGDTRVLLESIDVPEPVIKLAIEPKTKADQEKMGIGLQKLAEEDPTFKVETDQESGQTTISGMGELHLEILVDRLKREYKVDANVGAPQVAYRETITKPVDVEGKFVRQSGGRGQFGHVKIKAEPLEPGAGFVFENAVVGGTVPKEYIGPAQKGIEEAMQSGPMLGFPVVDMKVTLYDGSYHEVDSSEMAFKIAGSMALKEAVQKGAPALLEPIMRVEVTVPEEYMGDIIGDLNSRRGQIQGMEARGNAQIVKAFVPLSEMFGYATDMRSMTQGRASYSMFFDHYSQVPNNLAQQLM 694
>gi|159794862|pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex (691 aa)
Score = 2204, Expect = 0.0e+00, Identities = 409/679 (60%), Positives = 526/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+ID PGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|153952858|ref|YP_001393623.1| elongation factor G [Clostridium kluyveri DSM 555] >gi|189027851|sp|A5N4P4.1|EFG_CLOK5 Elongation factor G (EF-G) >gi|146345739|gb|EDK32275.1| FusA2 [Clostridium kluyveri DSM 555] (688 aa)
Score = 2203, Expect = 0.0e+00, Identities = 409/688 (59%), Positives = 524/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L  FRN GIMAHIDAGKTTT+ERILF++GR HKIGE H+G++ MDWM QE+ERGITITSAAT   WK  ++N+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA  Y VPR+++VNKMD TGA+F   V +++ RL   A+PIQ+PIG+E++F GI++L++ +   ++       +E  IP   KD+ ++ R  L+E ++  D+ +M  YLEG+E++  +I   IRKGVI  +  PVLCGS++KNKG++ ++DAVVDF+PSP+D+P  K    E G E    A D+ P   LAFK+ATDPFVG+L F R+YSG++KSG+YV N  K KKER++RLVKMH+  R E++E+RAGD+ AI+GLKDTTTG TL D++  V LE+M+F +PVI +A+EPKTKA QEKM IALSKLAEEDPTFKT TD ETGQTII+GMGELHL+I+VDR++REFKVE NVG PQV+++ET  K  + EGK+++QSGG GQYGH  I   P+ ++G+ F + IVGG IP+EYI P+  G++ A  +G +AGYP I+ K  L+DGS+H+VDSSEMAFKIAAS+A K A     PVLLEP+M +EVTVPE+Y GD +GDI+SRRG IEG + R   QVI++ VPL EMFGYAT LRS +QGRG Y M F HY E PKS+  +I   KK
  S:     1 MGREYPLEKFRNIGIMAHIDAGKTTTTERILFYTGRTHKIGEVHEGQATMDWMAQEQERGITITSAATFCKWKGYAINIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADNYGVPRLVYVNKMDSTGADFYMCVNTLRDRLHCNAIPIQIPIGSESEFKGIVNLVKNEAIIYEDDLGTVMDEVEIPGDLKDEAEKYRTELIEAISELDEDIMMKYLEGEELTEEEIISAIRKGVISNKIVPVLCGSSYKNKGVQPMIDAVVDFMPSPLDIPPIKGTDPETGEETDRPADDNQPLSALAFKIATDPFVGKLAFTRIYSGIMKSGTYVYNSTKGKKERIARLVKMHSNRREEVDELRAGDLGAIVGLKDTTTGNTLCDEQNAVVLESMEFPEPVIHVAIEPKTKAGQEKMGIALSKLAEEDPTFKTHTDQETGQTIISGMGELHLEIIVDRLQREFKVECNVGKPQVAYKETIRKTVKAEGKFVRQSGGHGQYGHCWIEMSPS-EEGYSFENAIVGGTIPKEYISPIDEGIKQASETGTVAGYPAINFKVKLYDGSYHDVDSSEMAFKIAASMAFKNAMSKADPVLLEPMMRVEVTVPEEYMGDVIGDINSRRGRIEGMDPRAGAQVIRSFVPLSEMFGYATVLRSRTQGRGVYSMTFDHYEEVPKSIQEKITGEKK 688
>gi|177666114|ref|ZP_02941910.1| translation elongation factor G [Cyanothece sp. PCC 8801] >gi|172074798|gb|EDT60215.1| translation elongation factor G [Cyanothece sp. PCC 8801] (691 aa)
Score = 2203, Expect = 0.0e+00, Identities = 407/685 (59%), Positives = 525/685 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART+ L   RN GI AHIDAGKTTT+ERILF++G  HK+GE H+G + MDWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RYEVPRI FVNKMD+TGANF+R  + I+ RL   AVPIQ+PIG+E+DF+GI+DL+  +   +     EK EE  +P+   +Q    R+ L+E VA +++ L+  YLEG+++S A+IK+ +R+  +     P+LCGSAFKNKG++LLLDAVVD+LPSP++VP  K    DG+E +  ASD+ PF  LAFK+A+DPF GRLTF+RVYSGVL+ GSYV N  KN KER++RL+ + + +R E++E+RAGD+ A IGLK+TTTG+TL DD   + LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTF+   +PET QT+IAGMGELHL+ILVDRM RE+KVE +VG PQV++RET  K  + EGKYI+QSGG+GQYGHV I  EP +   GFEFV KIVGG IP+EYI PV+ G++    SG +AGYP+ID+K TL DGS+H+VDSSEMAFKIA S+AL+ A    SPV+LEP+M +EV VPE + GD +GD+++RRG IEG    D +  + AKVPL EMFGYATD+RS +QGRG + M+FSHYAE P++V   IIA
  S:     1 MARTIPLERVRNIGIAAHIDAGKTTTTERILFYTGIAHKLGEVHEGTATMDWMAQEQERGITITAAAISTSWLDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYEVPRIAFVNKMDRTGANFDRVHEQIRDRLRANAVPIQIPIGSESDFHGIVDLVRMRAKIYQDDLGEKIEETEVPEDLLEQALDYRSKLIEAVAEYNEDLLEKYLEGEDLSEAEIKQGLRQATVNRAIVPLLCGSAFKNKGVQLLLDAVVDYLPSPLEVPPIKGLLPDGSEEVRKASDEEPFSALAFKIASDPF-GRLTFIRVYSGVLQKGSYVYNSTKNTKERLARLIVLKSNDRIEVDELRAGDLGATIGLKNTTTGDTLCDDSQPIILESLFVPEPVISVAVEPKTKQDMEKLSKALQALSDEDPTFRVSINPETNQTVIAGMGELHLEILVDRMLREYKVEASVGKPQVAYRETIRKSCDAEGKYIRQSGGKGQYGHVVIHLEPGDPGSGFEFVSKIVGGVIPKEYIAPVEQGIKECCESGVIAGYPVIDVKVTLLDGSYHDVDSSEMAFKIAGSMALRNAVTNASPVVLEPMMKVEVEVPEDFLGDVIGDLNARRGNIEGMVSEDGLAKVSAKVPLAEMFGYATDIRSKTQGRGIFSMEFSHYAEVPRNVAEAIIA 685
>gi|999552|pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution >gi|3745823|pdb|2EFG|A Chain A, Translational Elongation Factor G Complexed With Gdp >gi|15988476|pdb|1JQM|B Chain B, Fitting Of L11 Protein And Elongation Factor G (Ef-G) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G, Gdp And Fusidic Acid (691 aa)
Score = 2203, Expect = 0.0e+00, Identities = 409/679 (60%), Positives = 526/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ D  ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDNAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|15674242|ref|NP_268417.1| elongation factor G [Lactococcus lactis subsp. lactis Il1403] >gi|21263545|sp|Q9CDG1|EFG_LACLA Elongation factor G (EF-G) >gi|12725331|gb|AAK06358.1|AE006455_4 elongation factor G [Lactococcus lactis subsp. lactis Il1403] (709 aa)
Score = 2202, Expect = 0.0e+00, Identities = 406/685 (59%), Positives = 523/685 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFD----------GGKEEKAEEKPI---PDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEV-LISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L N RN GIMAH+DAGKTTT+ER+L+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  S+ ++  RLG  A PIQ+PIGAE+DF GIIDL+  K  +Y  D          G  E  AE   +    +++ +   + R  L+E +A+FD+ +M  Y  G+EI  A++K  IRK  I   F+P+L GSAFKNKG++++LDAV+D+LPSP+D+P  +    D +E     ASD+ PF  LAFK+ TDPFVGRL+F RVYSG L +GSYV N  K K+ER+ R+++MHA  R EI+ + AGDI A +GLK+TTTG++L D+K  + LE+++  +PVI L VEPKTKADQ+KM +AL KLAEEDPTF+  T+PETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQV++RETF   +   G + +QSGG+GQYG V I F PN++  GFEF + IVGG +PRE++  V+ GL   MA+G LAGYPM+DIKA L+DGS+H+VDSSE AFK+AASLA+KEA K   P +LEP+M + +TVPE+  GD MG +++RRG +   E     Q++ A VPL EMFGYAT LRS +QGRG ++M F HY++ PKSV  EIIA
  S:     1 MAREFSLANTRNIGIMAHVDAGKTTTTERVLYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAEWKGNRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDAQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFYYSLSTLGDRLGANAHPIQIPIGAEDDFIGIIDLVTMKSEIYTNDLGTDIKETVVGSDEFNAELAALDFNAEEYTELANEWREKLIEAIADFDEDIMEKYFAGEEIPEAELKAAIRKATINVDFYPMLAGSAFKNKGVQMMLDAVIDYLPSPLDIPAIQGVNPDTDEEDERPASDEEPFAALAFKIMTDPFVGRLSFFRVYSGTLDAGSYVLNTSKGKRERIGRILQMHANTRKEIQTVYAGDIAAAVGLKNTTTGDSLTDEKAKIILESIEVPEPVIQLMVEPKTKADQDKMGVALQKLAEEDPTFRVETNPETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVAYRETFRAGTSARGFFKRQSGGKGQYGDVWIEFTPNEEGAGFEFENAIVGGVVPREFVPAVEKGLVETMANGVLAGYPMVDIKAKLYDGSYHDVDSSETAFKVAASLAMKEAAKTAKPAILEPMMKVTITVPEENLGDIMGHVTARRGQVNSMEAHGKSQIVNAFVPLAEMFGYATTLRSSTQGRGTFMMVFDHYSDVPKSVQEEIIA 702
>gi|28212177|ref|NP_783121.1| elongation factor G [Clostridium tetani E88] >gi|34395596|sp|Q890N8|EFG_CLOTE Elongation factor G (EF-G) >gi|28204621|gb|AAO37058.1| protein translation elongation factor G [Clostridium tetani E88] (691 aa)
Score = 2202, Expect = 0.0e+00, Identities = 404/685 (58%), Positives = 523/685 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKA-YGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           R   L  +RN GIMAHIDAGKTTT+ERILF++G+ HKIGETHDG + MDWM QE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+ VL A+ GVEPQTETVWRQA +Y+VPR+ +VNKMD  GA+F R V  +++RL   AVPIQ+PIGAE+ F G +DLI  +   ++       + + IP+  KD  ++ R  ++E +   D++LM  YLEG+EIS+ ++   +RKGV+  +  PV+CGS++KNKG++ ++DA+V +LPSP+D+P  K  + E G EV   ASDD P   LAFK+ATDPF+G+L FVRVYSGV+K+G+YV N  K K+ER+ RLVKMHA +R E+EE+ AGD+ A++GLKDT TG+TL D+K  V LE M+F +PVIS+A+EPKTKA QEKM ++L+KLAEEDPTF+TFT+ ETGQTII GMGELHL+++VDR++REFKVE NVG PQV+++ET  K  + EGK+++QSGGRGQYGH  I   P++ + +EF + IVGG IP+EYI  +  G+E A  SG +AGYP+I+ K  L+DGS+H+VDSSEMAFKIA S+A K A     PVLLEP+M +EV VPE+Y GD MGDI+SRRG I+G E     Q I+A VPL +MFGYAT LRS +QGRGNY M+F HY E PKS+  EII  +
  S:     5 REYPLKMYRNIGIMAHIDAGKTTTTERILFYTGKTHKIGETHDGAATMDWMVQEQERGITITSAATTCIWKDHVINVIDTPGHVDFTVEVERSLRVLDGAVTVLTAKGGVEPQTETVWRQADKYKVPRMAYVNKMDIMGADFFRVVNMMRERLHANAVPIQIPIGAEDTFKGYVDLIRNEAIIYEDDLGTVMDTEEIPEDMKDIAEEYRGAMIEAIVELDEELMMKYLEGEEISVEELDLALRKGVLANKIVPVMCGSSYKNKGVQPMIDAIVKYLPSPLDIPPVKGTHPETGEEVERKASDDEPMSTLAFKIATDPFIGKLAFVRVYSGVMKNGTYVLNPVKGKRERIGRLVKMHANHREEVEELHAGDLGAVVGLKDTITGDTLCDEKEPVILEKMEFPEPVISIAIEPKTKAGQEKMGLSLAKLAEEDPTFRTFTNQETGQTIIEGMGELHLEVIVDRLQREFKVECNVGKPQVAYKETIKKAVKAEGKFVRQSGGRGQYGHCWIEMTPHEGE-YEFQNAIVGGAIPKEYIPAIDHGIEEASDSGVIAGYPVINFKVKLYDGSYHDVDSSEMAFKIAGSMAFKNAMSKADPVLLEPVMKVEVVVPEEYMGDVMGDINSRRGRIDGMEATAGAQNIRAFVPLSQMFGYATVLRSRTQGRGNYSMEFDHYEEVPKSIQEEIIGER 689
>gi|125625309|ref|YP_001033792.1| elongation factor G [Lactococcus lactis subsp. cremoris MG1363] >gi|166201609|sp|A2RP72.1|EFG_LACLM Elongation factor G (EF-G) >gi|124494117|emb|CAL99118.1| elongation factor EF-G [Lactococcus lactis subsp. cremoris MG1363] (709 aa)
Score = 2202, Expect = 0.0e+00, Identities = 406/685 (59%), Positives = 523/685 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFD----------GGKEEKAEEKPI---PDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEV-LISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L N RN GIMAH+DAGKTTT+ER+L+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLDAQ GVEPQTETVWRQA+ Y VPRI+F NKMDK GA+F  S+ ++  RLG  A PIQ+PIGAE+DF GIIDL+  K  +Y  D          G  E  AE   +    +++ +   + R  L+E +A+FD+ +M  Y  G+EI  A++K  IRK  I   F+P+L GSAFKNKG++++LDAV+D+LPSP+D+P  +    D +E     ASD+ PF  LAFK+ TDPFVGRL+F RVYSG L +GSYV N  K K+ER+ R+++MHA  R EI+ + AGDI A +GLK+TTTG++L D+K  + LE+++  +PVI L VEPKTKADQ+KM +AL KLAEEDPTF+  T+PETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQV++RETF   +   G + +QSGG+GQYG V I F PN++  GFEF + IVGG +PRE++  V+ GL   MA+G LAGYPM+DIKA L+DGS+H+VDSSE AFK+AASLA+KEA K   P +LEP+M + +TVPE+  GD MG +++RRG +   E     Q++ A VPL EMFGYAT LRS +QGRG ++M F HY++ PKSV  EIIA
  S:     1 MAREFSLANTRNIGIMAHVDAGKTTTTERVLYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAEWKGNRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDAQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFYYSLSTLGDRLGANAHPIQIPIGAEDDFIGIIDLVTMKSEIYTNDLGTDIKETVVGSDEFNAELASLDFNAEEYTELANEWREKLIEAIADFDEDIMEKYFAGEEIPEAELKAAIRKATINVDFYPMLAGSAFKNKGVQMMLDAVIDYLPSPLDIPAIQGVNPDTDEEDERPASDEEPFAALAFKIMTDPFVGRLSFFRVYSGTLDAGSYVLNTSKGKRERIGRILQMHANTRKEIQTVYAGDIAAAVGLKNTTTGDSLTDEKAKIILESIEVPEPVIQLMVEPKTKADQDKMGVALQKLAEEDPTFRVETNPETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVAYRETFRAGTSARGFFKRQSGGKGQYGDVWIEFTPNEEGAGFEFENAIVGGVVPREFVPAVEKGLVETMANGVLAGYPMVDIKAKLYDGSYHDVDSSETAFKVAASLAMKEAAKTAKPAILEPMMKVTITVPEENLGDIMGHVTARRGQVNSMEAHGKSQIVNAFVPLAEMFGYATTLRSSTQGRGTFMMVFDHYSDVPKSVQEEIIA 702
>gi|118726666|ref|ZP_01575287.1| translation elongation factor G [Clostridium cellulolyticum H10] >gi|118663925|gb|EAV70566.1| translation elongation factor G [Clostridium cellulolyticum H10] (693 aa)
Score = 2202, Expect = 0.0e+00, Identities = 405/687 (58%), Positives = 518/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R  DL + RN GIMAHIDAGKTTT+ERILF++GR+HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDG++ V  A+ GVEPQ+ETVWRQA +Y VPR+ +VNKMD  GA+F   +  ++ RL   AVPIQLPIG+E+ F G++DL+    + F     +  E++PIPD   +   + R  L+E VA  D++LM  YLEG+E ++ +IK  IRK  I  +  PV CGS++KNKG++ +LDAV+DF+PSP D+P  K    DG+ E+   A D+ PF  LAFK+ TDP+VG+L F RVYSG L SGSYV N  KNK+ER+ R+++MHA +R EI+ + +GDI A +GLKDTTTG+TL ++   V LE+M+F +PVI +A+EPKTKA QEKM +AL KLAEEDPTF+  TD ETGQTII GMGELHLDI+VDRM REFKVE NVG PQVS++ET  K  + E KY +QSGG+GQYGH  I  EP +   G+EFV+KI GG IP+EYI P+ AG++ AM +G LAGY ++DIK TL DGS+HEVDSSEMAFKIA S+A K+  +  +PVLLEPIM ++V+VPE+Y GD MG +++RRG IEG E R   Q I+A VPL EMFGYAT LRS +QGRG + MQ SH+ E PKS+  ++I+++
  S:     1 MPRQFDLEHTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGSATMDWMEQEQERGITITSAATTAQWKGNRINIIDTPGHVDFTVEVERSLRVLDGSVTVFCAKGGVEPQSETVWRQADKYGVPRMAYVNKMDIMGADFYNVIAMMKDRLQCNAVPIQLPIGSEDCFVGMVDLVTMTSHIFKDDLGQVIEDQPIPDDMIEISNKYREQLLEAVAEQDEELMMKYLEGEEFTLEEIKAGIRKATIAVKMIPVTCGSSYKNKGVQQMLDAVIDFMPSPTDIPAIKGISVDGDTEIERPADDNGPFAALAFKIMTDPYVGKLCFFRVYSGTLNSGSYVLNSTKNKRERIGRILQMHANHREEIQVVHSGDIAAAVGLKDTTTGDTLCEENNPVILESMEFPEPVIEVAIEPKTKAGQEKMGVALQKLAEEDPTFRVHTDAETGQTIIGGMGELHLDIIVDRMLREFKVEANVGNPQVSYKETIRKAVKSEMKYARQSGGKGQYGHCVIELEPREPGAGYEFVNKITGGAIPKEYIAPIDAGIQEAMNTGVLAGYNVVDIKVTLIDGSYHEVDSSEMAFKIAGSMAFKDGCRKANPVLLEPIMKVDVSVPEEYMGDVMGGLNARRGRIEGMEARGGAQNIRAVVPLSEMFGYATALRSSTQGRGTFSMQTSHFEEVPKSIQEKVISSR 689
>gi|117924152|ref|YP_864769.1| translation elongation factor 2 (EF-2/EF-G) [Magnetococcus sp. MC-1] >gi|166201611|sp|A0L5X0.1|EFG_MAGSM Elongation factor G (EF-G) >gi|117607908|gb|ABK43363.1| translation elongation factor 2 (EF-2/EF-G) [Magnetococcus sp. MC-1] (692 aa)
Score = 2202, Expect = 0.0e+00, Identities = 410/685 (59%), Positives = 514/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR + L + RN GIMAHIDAGKTT +ERIL+++GR HKIGE H+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFT+EVERSLRVLDGA+AV     GV+PQ+ETVWRQA RY VPR+ FVNKMD+ GA+F ++VQ+++ RL  +A+P Q PIGAE D  G++DLI  K Y F D     + E    P+  + +V++ R  L+E     DD LM  YLEG+EI+IA+ K C+R+ VI   F PV CGSAFKNKG++LLLDAVVD+ PSP D P  +    D  E  +   SD+ PF  LAFK+ TDPFVG LTFVRVYSGV++SG+ V N  K++KER+ RL+ MHA  R +I+E+RAGDICA++GLK+TTTGETL D    + LE M F  PVI++AVEPKTKADQE+M +AL +LA+EDP+F+   D ET QTII+GMGELHL+I+VDRM REFKV+ NVG PQV++RET  +  E E K+++QSGGRGQ+GHV +R EPN+   G+EFVD I GG +P+EYI  V+ G+  AMA+G   G+PM+D+K TLFDGS+HEVDSSEMAFKIA S+ LKE      PVLLEPIM +EV  PE Y GD MGD++SRRG I+G E   N +++KA+VPL  MFGYATDLRS SQGR  + MQF HYA+ PKS+  EI A
  S:     1 MAREIALDHVRNIGIMAHIDAGKTTVTERILYYTGRSHKIGEVHEGAATMDWMEQEQERGITITSAATTCFWKEHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCGVAGVQPQSETVWRQADRYGVPRLAFVNKMDRMGADFNKAVQTMKDRLKARAIPAQYPIGAEEDLRGMVDLITRKAYIFNDESLGAEFEVLDCPEDIEAEVEEAREALLEAALEQDDTLMEKYLEGEEITIAEFKSCMRRAVISSAFVPVFCGSAFKNKGVQLLLDAVVDYFPSPSDTPYIEGLLPDSEEAAVRKPSDEEPFAALAFKIMTDPFVGTLTFVRVYSGVMESGTSVLNASKDRKERIGRLMLMHANKREDIKEVRAGDICAVVGLKNTTTGETLCDPNKPIILEKMDFPAPVIAIAVEPKTKADQERMGVALQRLAQEDPSFRVEVDHETNQTIISGMGELHLEIIVDRMMREFKVDANVGQPQVAYRETITQMVEHESKFVRQSGGRGQFGHVWLRLEPNEPGAGYEFVDGIKGGVVPKEYIPAVKNGVGEAMANGVYVGFPMVDVKVTLFDGSYHEVDSSEMAFKIAGSMGLKEGAMKAKPVLLEPIMDVEVETPEDYMGDVMGDMNSRRGQIQGMEDSGNNRLVKAQVPLSGMFGYATDLRSMSQGRATFTMQFGHYAQVPKSIAEEIKA 688
>gi|116617322|ref|YP_817693.1| translation elongation factor 2 (EF-2/EF-G) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272477|sp|Q03ZQ2.1|EFG_LEUMM Elongation factor G (EF-G) >gi|116096169|gb|ABJ61320.1| translation elongation factor 2 (EF-2/EF-G) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (703 aa)
Score = 2201, Expect = 0.0e+00, Identities = 415/684 (60%), Positives = 525/684 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKN---------CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIAT 686
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETHDG S MD+MEQEKERGITI SAAT+  W             +N+IDTPGHVDFT+EVER+LRVLDGA+AVLD   GVEPQTETVWRQA+ Y+VPRI+FVNKMDK GA+F+ SV SI +RL V A  IQ PIGAE+DF  +IDLI ++ Y+ +    EK   + IP++ K+  ++ R  L+E VA+ DD LM  YLEG++ISI ++K  IR+  +  QF+PVL GSA+K+KG++++LDAVVD+LP P+DV P      +   E+ + A D  PF  LAFK+ TDPFVGRLTF+RVY+G LKSGSYV+N   + +ERV RL++MHA +R EIEE+ +GDI A IGLK+TTTG++L D    + LE+M+F +PVI LA+EPKTKADQ+K+S A+ KLAEEDP+F+  T+ ETGQT+IAGMGEL LDI+VDRMRREF VE  VGAPQV++RE F K  +  G + +QSGG+GQYG V I F PN++  GFEF D IVGG +PREYI  V+AGL++A+ +GPLAG+P++D+KA L+DGS+H+VDSSE AFKIAASLALKEA K    V+LEPIMA+++  PE   GD MG +S+RRG+IEG E R  V  +KAKVPL EMFGYAT LRS +QGRG + M F HY   PK++  EII T
  S:     4 REYPLERTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHDGASQMDFMEQEKERGITIQSAATTAVWHGFFDQFAKTPYRVNIIDTPGHVDFTIEVERALRVLDGAVAVLDGAAGVEPQTETVWRQATTYDVPRIVFVNKMDKLGADFQMSVDSIHERLQVNAEAIQWPIGAEDDFEAVIDLITQEAYYPEDDLGEKWAPREIPEELKELAEEKRNTLIEAVADVDDDLMEKYLEGEDISIEELKAAIRRATLALQFYPVLAGSAYKDKGVQMMLDAVVDYLPGPLDVKPYIANDPKTDEEIDLIADDSKPFAALAFKIMTDPFVGRLTFMRVYTGTLKSGSYVQNTSSDTRERVGRLLQMHATSRTEIEEVFSGDIAAAIGLKNTTTGDSLTDVSHQLILESMEFPEPVIELAIEPKTKADQDKLSNAIQKLAEEDPSFRATTNQETGQTLIAGMGELQLDIMVDRMRREFNVEATVGAPQVAYREAFTKTVQARGFFKRQSGGKGQYGDVYIEFAPNEEGAGFEFEDAIVGGVVPREYIPSVEAGLKDALNAGPLAGFPLVDLKAKLYDGSYHDVDSSEAAFKIAASLALKEAAKTAGAVILEPIMAVDIVAPEDNLGDVMGHVSARRGMIEGQESRGPVLAVKAKVPLSEMFGYATTLRSATQGRGTFQMVFDHYEAVPKNIQEEIIKT 698
>gi|67464648|pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v (691 aa)
Score = 2200, Expect = 0.0e+00, Identities = 409/679 (60%), Positives = 526/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN  I AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIVIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|67464647|pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a (691 aa)
Score = 2199, Expect = 0.0e+00, Identities = 408/679 (60%), Positives = 525/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKI E H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+ID PGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIAEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|116491307|ref|YP_810851.1| translation elongation factor 2 (EF-2/EF-G) [Oenococcus oeni PSU-1] >gi|122276511|sp|Q04ED6.1|EFG_OENOB Elongation factor G (EF-G) >gi|116092032|gb|ABJ57186.1| translation elongation factor 2 (EF-2/EF-G) [Oenococcus oeni PSU-1] (702 aa)
Score = 2198, Expect = 0.0e+00, Identities = 410/682 (60%), Positives = 520/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKN---------CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETHDG S MD+M+QEKERGITI SAAT+  W             +N+IDTPGHVDFT+EVERSLRVLDGAIAVLD   GVEPQTETVWRQA+ Y VPR++FVNKMDK GA+F+ SV S+++RL V A  IQ PIGAE+DF G+IDLI+ + ++ D     + E++PIPD  KD V++ R  L+E VA+ DD LM  YL  +EI++ D+K  IR+  +  +F+PVL GSA+K+KG++LLLDAVVD+LPSP++V P      + G+EV + A D  PF  LAFK+ TDP+VGRLTF+RVY+G LKSGSYV+N  K+ +ERV RL++MHA  R EI+E+ +GDI A IGLK T+TG++L      + LE+M+F  PVI +AVEPKTKADQEKM+ AL KL+EEDP+F   T+ ETGQT+I+GMGELHLDI+VDRMRREF V+VNVG PQV++RE F K  + +GKYI+QSGG+GQYG V I F PN + KGFEF + IVGG +PREYI  V+ GL+ AM SGPLAGYP++D+KA L+DGS+HEVDSSE AFKIAAS++L+EA K    V+LEPIM + +  P    GD MG +S+RRG+IE  E   N   + +K+PL EMFGY T LRS +QGRG + M F HY   P++V  +II
  S:     4 REFPLDRTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHDGASQMDFMDQEKERGITIQSAATTAIWHGFHEQWKDTPYRVNIIDTPGHVDFTIEVERSLRVLDGAIAVLDGAAGVEPQTETVWRQATTYAVPRLVFVNKMDKMGADFQMSVDSLKERLDVNAKAIQWPIGAEDDFAGVIDLIQREAWYPDDKLGTEWEKRPIPDDLKDLVEEKRDELIEAVADVDDSLMEKYLGEEEITVDDLKAAIRRATLALKFYPVLAGSAYKDKGVQLLLDAVVDYLPSPLEVRPYTATDPDTGDEVDLKADDKKPFAALAFKIMTDPYVGRLTFLRVYTGTLKSGSYVQNTTKDTRERVGRLLQMHAITRREIDEVFSGDIAAAIGLKATSTGDSLTSVDRPLVLESMEFPDPVIQMAVEPKTKADQEKMAEALQKLSEEDPSFHAETNSETGQTLISGMGELHLDIMVDRMRREFNVDVNVGTPQVAYREAFTKTVQAQGKYIRQSGGKGQYGDVWIEFSPNDEGKGFEFDNAIVGGAVPREYIPAVEQGLKEAMQSGPLAGYPLVDLKAKLYDGSYHEVDSSEAAFKIAASMSLREASKTAGAVILEPIMKVSIVSPIDNLGDVMGHVSARRGMIEDQETHGNTVTVTSKIPLAEMFGYTTTLRSATQGRGTFQMFFDHYEAVPRNVQEDII 696
>gi|11513537|pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a >gi|34811522|pdb|1PN6|A Chain A, Domain-Wise Fitting Of The Crystal Structure Of T.Thermophilus Ef-G Into The Low Resolution Map Of The Release Complex.Puromycin.Efg.Gdpnp Of E.Coli 70s Ribosome. (691 aa)
Score = 2198, Expect = 0.0e+00, Identities = 409/679 (60%), Positives = 526/679 (77%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEEDPTF+  T PETGQTII+GMGELHL+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+ EVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYAEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|126697637|ref|YP_001086534.1| translation elongation factor G [Clostridium difficile 630] >gi|168715548|ref|ZP_02747825.1| translation elongation factor G [Clostridium difficile QCD-63q42] >gi|196127769|ref|ZP_03119518.1| translation elongation factor G [Clostridium difficile ATCC 43255] >gi|119368718|sp|Q18CF4|EFG_CLOD6 Elongation factor G (EF-G) >gi|115249074|emb|CAJ66885.1| translation elongation factor G [Clostridium difficile 630] (688 aa)
Score = 2197, Expect = 0.0e+00, Identities = 408/683 (59%), Positives = 509/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR   L   RN GIMAHIDAGKTTT+ERILF++G+ HKIGETH+G S MDWMEQEKERGITITSAAT+ SWK+  +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GVEPQ+E VWRQA  Y VPRI FVNKMD  GA+F   V  ++ RL   AVP+QLPIG E+ F GIIDL++     +      + EE  IP+  K+   + R  LVE VA  D++LM  YLEG+E++I ++K  IRK  I C+  PV CG+A++NKG++L++DAV+D+LP+P D+P  K    DG E    +SD+ PF  LAFK+ TDPFVG+L F RVYSG L+SGSYV N  KNK+ER+ R+++MHA  R EI ++ AGDI A +GLKDTTTG+TL D    + LE+M+F +PVIS+A+EP +KA QEKM IAL KLAEEDPTF   TD ETGQTII+GMGELHL+I+VDR+ REFKVE  VGAPQV++RET  +  +VE KY KQSGGRGQYGHVKIR  P +  +G++F +K VGG +P+EY+ PV  G++ AM SG +AGYP++D+   L+DGS+HEVDSSEMAFK+A S+A K+A K  + VLLEP   +EV  PE Y GD MGD++SRRGLI+G E R   QVI A VPL EMFGY+TDLRS +QGR  Y M F HY + P SV  +I
  S:     1 MARKFPLERTRNIGIMAHIDAGKTTTTERILFYTGQTHKIGETHEGASQMDWMEQEKERGITITSAATTASWKDHRINIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVEPQSENVWRQAETYGVPRIAFVNKMDILGADFYNVVSMMKSRLNSNAVPMQLPIGKEDSFIGIIDLLKMDAVIYKDDLGVEMEETDIPEDMKELAAEWREKLVESVAETDEELMMKYLEGEELTIDELKVAIRKATIACEMNPVFCGTAYRNKGVQLVIDAVLDYLPAPTDIPAIKGILADGEEAERHSSDEEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVLNATKNKRERIGRILQMHANTREEITKVYAGDIAAAVGLKDTTTGDTLCDPANPIILESMEFPEPVISVAIEPSSKAAQEKMGIALQKLAEEDPTFTVKTDQETGQTIISGMGELHLEIIVDRLLREFKVEAKVGAPQVAYRETITQPVDVEYKYSKQSGGRGQYGHVKIRVAPQEPGEGYKFTNKTVGGSVPKEYVGPVDMGIQGAMQSGIVAGYPVVDVAVELYDGSYHEVDSSEMAFKMAGSMAFKDAMKKGNAVLLEPYFKVEVVTPEDYMGDVMGDLNSRRGLIQGMEARSGAQVINAFVPLSEMFGYSTDLRSSTQGRATYTMIFDHYEQVPASVAKKI 684
>gi|51894213|ref|YP_076904.1| protein translation elongation factor G [Symbiobacterium thermophilum IAM 14863] >gi|62286663|sp|Q67JU0|EFG_SYMTH Elongation factor G (EF-G) >gi|51857902|dbj|BAD42060.1| protein translation elongation factor G [Symbiobacterium thermophilum IAM 14863] (694 aa)
Score = 2196, Expect = 0.0e+00, Identities = 418/684 (61%), Positives = 527/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M+R V L   RN GIMAHIDAGKTTT+ERILF++GR HK+GETH+G + MD+M QE+ERGITI SAAT+ SWK+  +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A+ GVEPQ+ETVWRQA +Y VPR+ +VNKMD  GA+F R ++ +++RLG + VPIQ+PIGAE+ F G++DL+     +Y+ D GK+ +  E+PIP+  ++ V+Q R  ++E     DD LM  YL G+E+++ +IKR +RK  + C+  PV CGS++KNKG++ LLDA+VD+LPSP+D+P  +    E G      A D+ PF  LAFKV +DP+VG+L F RVYSG LKSGSYV N  K K+ER+ RLV+MHA +R E+E +  GDI A +GLKDT TG+TL  D   V LE+M+F +PVI LAVEPKTKADQ+K+S AL KLAEEDPTF+ FTDPETGQTIIAGMGELHL+I+VDR++REFKV VNVG PQVS+RET     E VEG++++QSGGRGQYGHV I  EP +   GF F +KIVGG IP+E+I PV+ G++ A+ +G LAGYPMID+K  L  GS+HEVDSSE AFKIA S+ALK A +   PVLLEP M +EVTVPE+Y GD +GD+++RRG IEG E R N QVI+A+VPL EMFGYATDLRS +QGRG Y MQF HY E P +V   II
  S:     1 MSRQVSLDRLRNIGIMAHIDAGKTTTTERILFYTGRTHKLGETHEGAATMDFMVQEQERGITIQSAATTCSWKDHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCAKGGVEPQSETVWRQADKYGVPRLAYVNKMDTIGADFFRVIRMMEERLGARPVPIQIPIGAEDTFRGVVDLVRNVAIMYYDDLGKDIR--EEPIPEDMRELVEQYRTRMIEAATEADDALMEKYLMGEELTVEEIKRGLRKLTVECKINPVCCGSSYKNKGVQPLLDAIVDYLPSPLDIPPVQGTDPETGEPAERKADDNEPFSALAFKVVSDPYVGKLCFFRVYSGQLKSGSYVLNATKGKRERIGRLVRMHANHREEVEVVETGDIAAAVGLKDTGTGDTLCTDAAPVILESMEFPEPVIQLAVEPKTKADQDKLSTALLKLAEEDPTFRMFTDPETGQTIIAGMGELHLEIIVDRLQREFKVGVNVGKPQVSYRETVRGRVENVEGRFVRQSGGRGQYGHVVINLEPAEPGSGFIFENKIVGGVIPKEFIGPVEQGIKEALQNGVLAGYPMIDVKVELVFGSYHEVDSSEAAFKIAGSMALKAAAQKAQPVLLEPYMRVEVTVPEEYMGDVIGDLNARRGRIEGMEARGNAQVIRAQVPLAEMFGYATDLRSRTQGRGVYSMQFDHYEEVPPNVAKPII 687
>gi|187776573|ref|ZP_02993046.1| hypothetical protein CLOSPO_00087 [Clostridium sporogenes ATCC 15579] >gi|187775232|gb|EDU39034.1| hypothetical protein CLOSPO_00087 [Clostridium sporogenes ATCC 15579] (673 aa)
Score = 2195, Expect = 0.0e+00, Identities = 401/673 (59%), Positives = 517/673 (76%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAHIDAGKTT +ERILF++G+ HKIGETH+G + MDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFTVEVERSLRVLDGA+ +LDA+ GVEPQTETVWRQA  Y+VPR++F+NKMDK GA+F  SV ++++RL   AVP+QLPIGAE+ F+GIIDL++     +        +E  IP+  K+  ++ R  L+E VA  D+ +M  YLEG+EIS+ +IK  +RKGV+  +  PVLCGSA+KNKG++LLLDA+++F+PSP+D+   K      G E+   A   AP   LAFK+ATDPF+G+L F R+YSG +KSG+YV N  K K+ER+ RLVKMHA +R ++EE++AG++ AI+GLKDTTTG+TL DD   + LE M+F +PVI +++EPKTKA QEKM IAL+KLAEEDPTF+T+T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K  + EGK+I+QSGGRGQYGH  I   P + + +EF + +VGG IP+EYI  +  G++ A  SG +AGYP+I+ K  LFDGS+H+VDSSEMAFKIA S+A K A      VLLEP M +EV VPE+Y GD +GDI+SRRG IEG   R   +VI+A VPL EMFGYAT LRS +QGRGNYVMQF HY E PKS+ +++I  +K
  S:     1 MAHIDAGKTTATERILFYTGKTHKIGETHEGAATMDWMEQEQERGITITSAATTCFWKDHQVNIIDTPGHVDFTVEVERSLRVLDGAVTILDAKSGVEPQTETVWRQADNYKVPRMVFINKMDKLGADFLMSVGTLRERLHANAVPLQLPIGAEDSFSGIIDLVKNDAIIYKDDLGTVMDETEIPEDMKEMAEEYRTMLLEAVAEVDEDIMMKYLEGEEISVEEIKVALRKGVLANKIVPVLCGSAYKNKGVQLLLDAIIEFMPSPLDIEDVKGTEPTTGEEMTRPADAKAPLAALAFKIATDPFIGKLAFTRIYSGTMKSGTYVFNSNKGKRERIGRLVKMHANHREDVEELKAGELGAIVGLKDTTTGDTLCDDANPIILENMEFPEPVIDVSIEPKTKAGQEKMGIALAKLAEEDPTFRTYTNQETGQTIIAGMGELHLEIIVDRLIREFKVECNVGQPQVAYKETIKKHVKAEGKFIRQSGGRGQYGHCWIEMMPTEGE-YEFQNAVVGGSIPKEYIPAIDNGIQEASQSGIIAGYPVINFKVKLFDGSYHDVDSSEMAFKIAGSMAFKNAMSKADAVLLEPSMKVEVVVPEEYMGDVIGDINSRRGRIEGMTPRAGAEVIRAFVPLSEMFGYATTLRSKTQGRGNYVMQFDHYEEVPKSIQDKVIGERK 673
>gi|189424407|ref|YP_001951584.1| translation elongation factor G [Geobacter lovleyi SZ] >gi|189420666|gb|ACD95064.1| translation elongation factor G [Geobacter lovleyi SZ] (692 aa)
Score = 2194, Expect = 0.0e+00, Identities = 408/688 (59%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEE----KAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M+R   L  +RN GIMAHIDAGKTTT+ERIL+++G  HKIGE H+G + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F R VQ I+ RL    VP+QLP+G E+ F GI+DL+  K   +D   EE    K  E+ IP    D+ K+ R  L+EE+++ DD LM  YL G+E++ A+I   IR   I  Q  PV+CGS+FKNKG++ LLDAVVD++PSP+D+P  K   E G EV   A D  PF  L FK+ TDPFVG+LTF+RVYSGVL+SGSYV N  K K+ER+ RL+KMHA  R EI+E+ AGDI A +GLK TTTG+TL ++   V LE+++F +PVIS+A+EPKTK+DQEK+ ++L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDRM REFKVE NVG PQV++RET  K+ +VEGK+++QSGGRGQYGHV +  EP  +  KG+EFVD I GG +PREYI  V  G++ A  +G LAG+P++D+K TL DGS+HEVDSSEMAFKIA S+  KE  +   P+LLEPIM++EV VPE+Y G+ +GD++SRRG I G + R   QV+ + VPL  MFGY+TDLRS +QGR  Y M F HY   PKSV +EIIA  K
  S:     1 MSRLSPLDKYRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHEGTATMDWMEQEQERGITITSAATTCEWNDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYRVPRIAFINKMDRIGADFFRGVQMIKDRLKANPVPLQLPVGKEDYFKGIVDLVRMKAIIWD---EESLGAKFHEEEIPADLLDEAKEWRDKLIEEISSHDDALMEKYLGGEELTEAEIMAAIRSCTINIQIIPVVCGSSFKNKGVQNLLDAVVDYMPSPLDIPAIKGIDESGAEVERKADDTEPFSALGFKIMTDPFVGQLTFIRVYSGVLQSGSYVYNATKGKRERIGRLLKMHANKREEIKEVYAGDIAAAVGLKYTTTGDTLCNEDQAVILESIEFPEPVISIAIEPKTKSDQEKLGLSLQKLASEDPSFRVKTDEETGQTIISGMGELHLEIIVDRMMREFKVEANVGKPQVAYRETITKKVKVEGKFVRQSGGRGQYGHVWLEVEPQPEPGKGYEFVDAIKGGVVPREYIPAVDKGIQEATDNGVLAGFPVVDVKVTLIDGSYHEVDSSEMAFKIAGSMGFKEGCQKAGPILLEPIMSVEVVVPEEYMGEVIGDLNSRRGRIMGMDSRAGAQVVSSMVPLANMFGYSTDLRSATQGRATYAMTFDHYEPVPKSVSDEIIAKVK 691
>gi|196165507|ref|ZP_03126038.1| translation elongation factor G [Clostridium difficile QCD-23m63] (688 aa)
Score = 2194, Expect = 0.0e+00, Identities = 407/683 (59%), Positives = 509/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR   L   RN GIMAHIDAGKTTT+ERILF++G+ HKIGETH+G S MDWMEQEKERGITITSAAT+ SWK+  +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GVEPQ+E VWRQA  Y VPRI F+NKMD  GA+F   V  ++ RL   AVP+QLPIG E+ F GIIDL++     +      + EE  IP+  K+   + R  LVE VA  D++LM  YLEG+E++I ++K  IRK  I C+  PV CG+A++NKG++L++DAV+D+LP+P D+P  K    DG E    +SD+ PF  LAFK+ TDPFVG+L F RVYSG L+SGSYV N  KNK+ER+ R+++MHA  R EI ++ AGDI A +GLKDTTTG+TL D    + LE+M+F +PVIS+A+EP +KA QEKM IAL KLAEEDPTF   TD ETGQTII+GMGELHL+I+VDR+ REFKVE  VGAPQV++RET  +  +VE KY KQSGGRGQYGHVKIR  P +  +G++F +K VGG +P+EY+ PV  G++ AM SG +AGYP++D+   L+DGS+HEVDSSEMAFK+A S+A K+A K  + VLLEP   +EV  PE Y GD MGD++SRRGLI+G E R   QVI A VPL EMFGY+TDLRS +QGR  Y M F HY + P SV  +I
  S:     1 MARKFPLEKTRNIGIMAHIDAGKTTTTERILFYTGQTHKIGETHEGASQMDWMEQEKERGITITSAATTASWKDHRINIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVEPQSENVWRQAETYGVPRIAFINKMDILGADFYNVVSMMKSRLNSNAVPMQLPIGKEDSFIGIIDLLKMDAVIYKDDLGVEMEETDIPEDMKELAAEWREKLVESVAETDEELMMKYLEGEELTIDELKVAIRKATIACEMNPVFCGTAYRNKGVQLVIDAVLDYLPAPTDIPAIKGILADGEEAERHSSDEEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVLNATKNKRERIGRILQMHANTREEITKVYAGDIAAAVGLKDTTTGDTLCDPANPIILESMEFPEPVISVAIEPSSKAAQEKMGIALQKLAEEDPTFTVKTDQETGQTIISGMGELHLEIIVDRLLREFKVEAKVGAPQVAYRETITQPVDVEYKYSKQSGGRGQYGHVKIRVAPQEPGEGYKFTNKTVGGSVPKEYVGPVDMGIQGAMQSGIVAGYPVVDVAVELYDGSYHEVDSSEMAFKMAGSMAFKDAMKKGNAVLLEPYFKVEVVTPEDYMGDVMGDLNSRRGLIQGMEARSGAQVINAFVPLSEMFGYSTDLRSSTQGRATYTMIFDHYEQVPASVAKKI 684
>gi|168696866|ref|ZP_02729143.1| translation elongation factor G [Clostridium difficile QCD-37x79] >gi|168726736|ref|ZP_02759013.1| translation elongation factor G [Clostridium difficile QCD-76w55] >gi|168730434|ref|ZP_02762711.1| translation elongation factor G [Clostridium difficile QCD-97b34] >gi|196160580|ref|ZP_03121141.1| translation elongation factor G [Clostridium difficile CIP 107932] (688 aa)
Score = 2193, Expect = 0.0e+00, Identities = 406/683 (59%), Positives = 509/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR   L   RN GIMAHIDAGKTTT+ERILF++G+ HKIGETH+G S MDWMEQEKERGITITSAAT+ SWK+  +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GVEPQ+E VWRQA  Y VPRI F+NKMD  GA+F   +  ++ RL   AVP+QLPIG E+ F GIIDL++     +      + EE  IP+  K+   + R  LVE VA  D++LM  YLEG+E++I ++K  IRK  I C+  PV CG+A++NKG++L++DAV+D+LP+P D+P  K    DG E    +SD+ PF  LAFK+ TDPFVG+L F RVYSG L+SGSYV N  KNK+ER+ R+++MHA  R EI ++ AGDI A +GLKDTTTG+TL D    + LE+M+F +PVIS+A+EP +KA QEKM IAL KLAEEDPTF   TD ETGQTII+GMGELHL+I+VDR+ REFKVE  VGAPQV++RET  +  +VE KY KQSGGRGQYGHVKIR  P +  +G++F +K VGG +P+EY+ PV  G++ AM SG +AGYP++D+   L+DGS+HEVDSSEMAFK+A S+A K+A K  + VLLEP   +EV  PE Y GD MGD++SRRGLI+G E R   QVI A VPL EMFGY+TDLRS +QGR  Y M F HY + P SV  +I
  S:     1 MARKFPLEKTRNIGIMAHIDAGKTTTTERILFYTGQTHKIGETHEGASQMDWMEQEKERGITITSAATTASWKDHRINIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVEPQSENVWRQAETYGVPRIAFINKMDILGADFYNVISMMKSRLNSNAVPMQLPIGKEDSFIGIIDLLKMDAVIYKDDLGVEMEETDIPEDMKELAAEWREKLVESVAETDEELMMKYLEGEELTIDELKVAIRKATIACEMNPVFCGTAYRNKGVQLVIDAVLDYLPAPTDIPAIKGILADGEEAERHSSDEEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVLNATKNKRERIGRILQMHANTREEITKVYAGDIAAAVGLKDTTTGDTLCDPANPIILESMEFPEPVISVAIEPSSKAAQEKMGIALQKLAEEDPTFTVKTDQETGQTIISGMGELHLEIIVDRLLREFKVEAKVGAPQVAYRETITQPVDVEYKYSKQSGGRGQYGHVKIRVAPQEPGEGYKFTNKTVGGSVPKEYVGPVDMGIQGAMQSGIVAGYPVVDVAVELYDGSYHEVDSSEMAFKMAGSMAFKDAMKKGNAVLLEPYFKVEVVTPEDYMGDVMGDLNSRRGLIQGMEARSGAQVINAFVPLSEMFGYSTDLRSSTQGRATYTMIFDHYEQVPASVAKKI 684
>gi|134298090|ref|YP_001111586.1| elongation factor G [Desulfotomaculum reducens MI-1] >gi|172044217|sp|A4J108.1|EFG_DESRM Elongation factor G (EF-G) >gi|134050790|gb|ABO48761.1| translation elongation factor 2 (EF-2/EF-G) [Desulfotomaculum reducens MI-1] (692 aa)
Score = 2193, Expect = 0.0e+00, Identities = 419/688 (60%), Positives = 524/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK--DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE HDG + MDWM QE+ERGITITSAAT+  W    +N+IDTPGHVDFTVEVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPR+ ++NKMD+ GA+F   +  I+ RLG   V IQLPIG+E+ F GI+DL+ +K  VY  D G    +E   IP    DQV++ R  L+E VA  D++LM  YLEG+E++  +IK  IRK  +  +  PV+CGS+FKNKG++ LLDA+VD+LP+P DVP  +    D G E    +SD+ PF  LAFK+ TDP+VG+L++ RVYSG LKSGSYV N  K KKERV R+++MHA +R EI E+ AGDI A +GLKDTTTG+TL D+K  + LE+M+F  PVI +A+EPKTKADQ+KM +ALSKL+EEDPTFK  TD ETGQTIIAGMGELHL+I+VDR+ REFKV+ NVG PQV+++ET  K  + EGK+++QSGG+GQYGHV I  EP +    G+EFV+KIVGG +PREYI PV  G++ AM +G LAGY M+DIKATL+DGS+HEVDSSEMAFKIA S+A K   +  +PVLLEPI  +EVTVPE+Y GD +GD++SRRG IE   QR N +++ A VPL EMFGYATDLRS +QGRG Y MQ  HY E PK++   IIA +K
  S:     1 MARQFPLERTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHDGAATMDWMVQEQERGITITSAATTAQWNGHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRLAYINKMDRVGADFFNGMDMIKNRLGANPVAIQLPIGSEDRFKGIVDLVTKKAIVYIDDLGT--NSETTDIPADMVDQVEEYREKLLEAVAESDEELMMKYLEGEELTEEEIKVAIRKATLAVKITPVICGSSFKNKGVQSLLDAIVDYLPAPTDVPPIQGVNPDTGTEDQRISSDNEPFAALAFKIMTDPYVGKLSYFRVYSGTLKSGSYVLNSTKGKKERVGRILQMHANHREEIPEVYAGDIAAAVGLKDTTTGDTLCDEKSLIILESMEFPDPVIHVAIEPKTKADQDKMGVALSKLSEEDPTFKVRTDEETGQTIIAGMGELHLEIIVDRLLREFKVQANVGRPQVAYKETIRKAVKAEGKFVRQSGGKGQYGHVWIELEPLEAGGPGYEFVNKIVGGVVPREYIAPVDNGIKEAMENGILAGYQMVDIKATLYDGSYHEVDSSEMAFKIAGSMAFKNGAQKANPVLLEPIFKVEVTVPEEYMGDVIGDLNSRRGRIEEMGQRGNARIVSAFVPLAEMFGYATDLRSKTQGRGTYSMQHDHYEEVPKNIAEGIIAKRK 691
>gi|170017950|ref|YP_001728869.1| translation elongation factor G [Leuconostoc citreum KM20] >gi|189027862|sp|B1MW21.1|EFG_LEUCK Elongation factor G (EF-G) >gi|169804807|gb|ACA83425.1| Translation elongation factor G [Leuconostoc citreum KM20] (703 aa)
Score = 2192, Expect = 0.0e+00, Identities = 408/682 (59%), Positives = 522/682 (76%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKN---------CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDV-PQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GIMAHIDAGKTTT+ERIL+++G+IHKIGETHDG S MD+MEQEKERGITI SAAT+  W             +N+IDTPGHVDFT+EVER+LRVLDGA+AVLD   GVEPQTETVWRQA+ Y+VPRI+FVNKMDK GA+F  SV+S+ +RL V A  IQ PIGAE++F  +IDLI ++ Y+      EK E + IP + K+  ++ R  L+E VA+ DD LM  YLEG++IS+ ++K  IR+  +  QF+PVL GSA+K+KG++++LDAVVD+LP P+DV P      + G E+ + A D   F  LAFK+ TDPFVGRLTF+RVY+G L+SGSYV+N   + +ERV RL++MHA +R EI+E+ +GDI A IGLK+TTTG++L      + LE+M+F +PVI LA+EPKTKADQ+K+S A+ KLAEEDP+F+  T+PETG T+IAGMGEL LDI+VDRMRREF VE  VGAPQV++RE F +  +  G + +QSGG+GQYG V I F PN++  GFEF D IVGG +PREYI  V+AGL++A+ +GPLAG+P++D+KA L+DGS+H+VDSSE AFKIAASLALKEA K    V+LEPIMA+++  PE   GD MG +S+RRG+IEG E R  V  +KAKVPL EMFGYAT LRS +QGRG + M F HY   PK++  EII
  S:     4 REYPLERTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETHDGASQMDFMEQEKERGITIQSAATTAVWHGFFDQFAKTPYRVNIIDTPGHVDFTIEVERALRVLDGAVAVLDGAAGVEPQTETVWRQATTYDVPRIVFVNKMDKLGADFAMSVESMHERLQVNAEAIQWPIGAEDEFEAVIDLITQEAYYPVDDLGEKWEPREIPAELKELAEEKRNTLIEAVADVDDDLMEKYLEGEDISVEELKAAIRRATLALQFYPVLAGSAYKDKGVQMMLDAVVDYLPGPLDVKPYVANDPKTGEEIDLIADDSKSFAALAFKIMTDPFVGRLTFMRVYTGTLQSGSYVQNTSSDTRERVGRLLQMHATSRTEIDEVFSGDIAAAIGLKNTTTGDSLTAVDHQLILESMEFPEPVIELAIEPKTKADQDKLSNAIQKLAEEDPSFRATTNPETGDTLIAGMGELQLDIMVDRMRREFNVEATVGAPQVAYREAFTQTVQARGYFKRQSGGKGQYGDVYIEFSPNEEGAGFEFEDAIVGGVVPREYIPSVEAGLKDALNAGPLAGFPLVDLKAKLYDGSYHDVDSSEAAFKIAASLALKEAAKTAGAVILEPIMAVDIVAPEDNLGDVMGHVSARRGMIEGQESRGPVLAVKAKVPLSEMFGYATTLRSATQGRGTFQMVFDHYEAVPKNIQEEII 696
>gi|29374846|ref|NP_813999.1| elongation factor G [Enterococcus faecalis V583] >gi|34395590|sp|Q839G9|EFG_ENTFA Elongation factor G (EF-G) >gi|29342304|gb|AAO80070.1| translation elongation factor G [Enterococcus faecalis V583] (693 aa)
Score = 2191, Expect = 0.0e+00, Identities = 417/684 (60%), Positives = 529/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAH+DAGKTTT+ERIL+++G+IHKIGETH+G S MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFT+EV+RSLRVLDGA+ VLD+Q GVEPQTETVWRQA+ Y+VPRI+F NKMDK GA+F  SV+S+  RL   A PIQ+PIGAE DF GIIDLI+ K   +        +E  IP+ + ++ ++ R  LVE VA  D+ LM  YLEG+EI+  ++   IR+  I  +FFPVL GSAFKNKG++L+LDAV+D+LPSP+D+   K      +E     +DD APF  LAFKV TDPFVGRLTF RVYSGVL+SGSYV N  K KKER+ R+++MHA  R EI+++ +GDI A +GLKDTTTG+TL      V LE+++F  PVI +AVEPK+KADQ+KM +AL KLAEEDP+F+  T+ ETG+T+I+GMGELHLD+LVDRM+REFKVE NVGAPQVS+RETF   ++ EGK+++QSGG+GQYGHV + F PN++ KGFEF + IVGG +PREYI  V+ GLE++M +G LAGYP++DIKA L+DGS+H+VDS+E AF++AAS+ALK A K  +PV+LEP+M + +TVPE Y GD MG ++SRRG +EG E   N Q++ A VPL EMFGYAT LRS +QGRG ++M F HY + PKSV  EII
  S:     1 MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVWRQATEYKVPRIVFCNKMDKIGADFFYSVESLHDRLQANAHPIQIPIGAEEDFTGIIDLIKMKAEIYTNDLGTDIQETDIPEDYLEKAQEWREKLVEAVAETDEDLMMKYLEGEEITEEELVAGIRQATINVEFFPVLAGSAFKNKGVQLMLDAVLDYLPSPLDIDAIKGIDTKTDEETTRPADDEAPFASLAFKVMTDPFVGRLTFFRVYSGVLESGSYVLNASKGKKERIGRILQMHANTRQEIDKVYSGDIAAAVGLKDTTTGDTLCALDAPVILESIEFPDPVIQVAVEPKSKADQDKMGVALQKLAEEDPSFRVETNVETGETVISGMGELHLDVLVDRMKREFKVEANVGAPQVSYRETFRAATKAEGKFVRQSGGKGQYGHVWVEFTPNEEGKGFEFENAIVGGVVPREYIPAVEKGLEDSMNNGVLAGYPLVDIKAKLYDGSYHDVDSNETAFRVAASMALKAAAKNANPVILEPMMKVTITVPEDYLGDIMGHVTSRRGRVEGMEAHGNSQIVNAMVPLAEMFGYATTLRSATQGRGTFMMVFDHYEDVPKSVQEEII 686
>gi|145956382|ref|ZP_01805378.1| hypothetical protein CdifQ_04000078 [Clostridium difficile QCD-32g58] (683 aa)
Score = 2191, Expect = 0.0e+00, Identities = 405/679 (59%), Positives = 507/679 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSV 679
           MAR   L   RN GIMAHIDAGKTTT+ERILF++G+ HKIGETH+G S MDWMEQEKERGITITSAAT+ SWK+  +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GVEPQ+E VWRQA  Y VPRI F+NKMD  GA+F   +  ++ RL   AVP+QLPIG E+ F GIIDL++     +      + EE  IP+  K+   + R  LVE VA  D++LM  YLEG+E++I ++K  IRK  I C+  PV CG+A++NKG++L++DAV+D+LP+P D+P  K    DG E    +SD+ PF  LAFK+ TDPFVG+L F RVYSG L+SGSYV N  KNK+ER+ R+++MHA  R EI ++ AGDI A +GLKDTTTG+TL D    + LE+M+F +PVIS+A+EP +KA QEKM IAL KLAEEDPTF   TD ETGQTII+GMGELHL+I+VDR+ REFKVE  VGAPQV++RET  +  +VE KY KQSGGRGQYGHVKIR  P +  +G++F +K VGG +P+EY+ PV  G++ AM SG +AGYP++D+   L+DGS+HEVDSSEMAFK+A S+A K+A K  + VLLEP   +EV  PE Y GD MGD++SRRGLI+G E R   QVI A VPL EMFGY+TDLRS +QGR  Y M F HY + P SV
  S:     1 MARKFPLEKTRNIGIMAHIDAGKTTTTERILFYTGQTHKIGETHEGASQMDWMEQEKERGITITSAATTASWKDHRINIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVEPQSENVWRQAETYGVPRIAFINKMDILGADFYNVISMMKSRLNSNAVPMQLPIGKEDSFIGIIDLLKMDAVIYKDDLGVEMEETDIPEDMKELAAEWREKLVESVAETDEELMMKYLEGEELTIDELKVAIRKATIACEMNPVFCGTAYRNKGVQLVIDAVLDYLPAPTDIPAIKGILADGEEAERHSSDEEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVLNATKNKRERIGRILQMHANTREEITKVYAGDIAAAVGLKDTTTGDTLCDPANPIILESMEFPEPVISVAIEPSSKAAQEKMGIALQKLAEEDPTFTVKTDQETGQTIISGMGELHLEIIVDRLLREFKVEAKVGAPQVAYRETITQPVDVEYKYSKQSGGRGQYGHVKIRVAPQEPGEGYKFTNKTVGGSVPKEYVGPVDMGIQGAMQSGIVAGYPVVDVAVELYDGSYHEVDSSEMAFKMAGSMAFKDAMKKGNAVLLEPYFKVEVVTPEDYMGDVMGDLNSRRGLIQGMEARSGAQVINAFVPLSEMFGYSTDLRSSTQGRATYTMIFDHYEQVPASV 680
>gi|17231830|ref|NP_488378.1| elongation factor G [Nostoc sp. PCC 7120] >gi|27923769|sp|Q8YP62|EFG_ANASP Elongation factor G (EF-G) >gi|17133474|dbj|BAB76037.1| translation elongation factor EF-G [Nostoc sp. PCC 7120] (692 aa)
Score = 2188, Expect = 0.0e+00, Identities = 411/688 (59%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKE-SEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG IHKIGE H+G +V DWM+QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGANF R  + ++ RL   A+ IQLPIG+ENDF GI+DL+ ++ Y ++  +    EE  IP   +DQV++    LVE VA  DD LM+ Y +G+ ++  +I+  +RKG I     PVLCGSAFKNKG++L+LDAVVD+LP+P +VP  +    +G+ +   A D+ P   LAFK+  DP+ GRLTFVRVYSGVLK GSYV N  KNKKER+SRLV M A +R ++EE+RAGD+ A +GLKDT TG+T+ D+   V LE++   +PVIS+AVEPKTK D +K+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  K  + VEGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G++ +  SG LAGYP+ID+KATL  GS+H+VDSSEMAFKIA S+ALKEA    SPVLLEP+M +EV VPE Y G+ +GD+ SRRG IE       +  + +KVPL  MFGYATD+RS +QGRG + M+FSHY E P+SV   IIA  K
  S:     1 MARINPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEGTAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHEQMRDRLRANAIAIQLPIGSENDFKGIVDLVRKRAYMYNNDQGTDIEETDIPADLQDQVEEYYTKLVEAVAETDDDLMSKYFDGEPLTEEEIRSALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPLAALAFKIMADPY-GRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVLMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKPVTNVEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIVGGVVPKEYIGPAEQGMKESCESGILAGYPLIDVKATLVHGSYHDVDSSEMAFKIAGSMALKEAVLKASPVLLEPMMKVEVEVPEDYIGNVIGDLISRRGQIESQSTEQGLAKVASKVPLATMFGYATDIRSKTQGRGIFTMEFSHYEEVPRSVAETIIAKSK 689
>gi|89893214|ref|YP_516701.1| elongation factor G [Desulfitobacterium hafniense Y51] >gi|119368723|sp|Q250N5|EFG_DESHY Elongation factor G (EF-G) >gi|89332662|dbj|BAE82257.1| hypothetical protein [Desulfitobacterium hafniense Y51] (692 aa)
Score = 2187, Expect = 0.0e+00, Identities = 409/687 (59%), Positives = 516/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKA-YGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE HDG + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI ++NKMD+ GA+F R V  I  RLG   VPIQ+PIGAE+ F GIIDL+  K   +       ++   IP    DQ  + R  L+E VA+ D++LM  YLEG+E++  +I+  IRKG IG +F PV+CGS+FKNKG++ LLDAVV+++P+P DVP  K  + E G      +SD  PF  LAFK+  DP+VG+L F RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EI E+ AGDI A +GLKDTTTG+TL DDK  + LE+MQF  PVI++A+EPKTK DQEKM  AL++LAEEDPTFK  TD ++GQTII GMGELHL+I+VDR++REFKVE NVG PQV+++ET  +  + EGK+++QSGGRGQYGH  I  EP  +  GFEFV+KIVGG IPREYI P+  G+E AM +G  AGYP++DI+AT++DGS+H+VDSSEMAFKIA S+A K       P ++EP+M +EVTVPE+Y G+ +GD++SRRG IEG E     Q+++  VPL EMFGYATDLRS +QGRG YVM F HY E PK++   I+A +
  S:     1 MARQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHDGAATMDWMVQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRMGADFFRGVSMIADRLGANPVPIQIPIGAEDQFKGIIDLVTMKAMVYTDDLGTTSDTADIPGDLVDQANEYREKLLEAVADTDEELMMKYLEGEELTEEEIRNGIRKGTIGLKFIPVVCGSSFKNKGVQPLLDAVVEYMPAPTDVPNIKGVHPETGEADERHSSDKDPFSALAFKIMADPYVGKLAFFRVYSGVLSSGSYVYNSTKGKRERIGRILQMHANHREEIPEVYAGDIAAAVGLKDTTTGDTLCDDKAPIILESMQFPDPVINVAIEPKTKQDQEKMGTALARLAEEDPTFKMHTDQDSGQTIIEGMGELHLEIIVDRLQREFKVECNVGRPQVAYKETIRRAVKAEGKFVRQSGGRGQYGHCWIEIEPLEQGSGFEFVNKIVGGVIPREYIAPIGQGIEEAMQNGIQAGYPVMDIRATVYDGSYHDVDSSEMAFKIAGSMAFKAGAAKADPAIIEPVMKVEVTVPEEYMGEVIGDMNSRRGRIEGMEATGTAQIVRGFVPLSEMFGYATDLRSKTQGRGVYVMMFDHYEEVPKNIAEGIVAKR 689
>gi|152990021|ref|YP_001355743.1| elongation factor G [Nitratiruptor sp. SB155-2] >gi|166220154|sp|A6Q1M7.1|EFG_NITSB Elongation factor G (EF-G) >gi|151421882|dbj|BAF69386.1| translation elongation factor G [Nitratiruptor sp. SB155-2] (692 aa)
Score = 2187, Expect = 0.0e+00, Identities = 408/684 (59%), Positives = 526/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +   RN GI AHIDAGKTTT+ERIL+++G  HKIGE H+G + MDWM+QEKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGA+AV  A  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GA+F      I++RL    VPIQ+PIGAE++F G++DL+E K   +D    G K E  +   IP++ +++ ++ R  LVE VA  D++L+  YL G+E++  +IK+ I+KG +     P+LCGSAFKNKG++ LLDAVVD+LP+P +V   K    + G EV + ++D+ PF  LAFK+ TDPFVG+L+F+RVY G + SGSYV N  K KKERV RL+KMHA  R EI+E+ AG+I A++GLK T TG+TL D+   V LE M+F +PVIS+AVEPKTKADQEKM+ AL+KLAEEDP+F+  TD ETGQTII+GMGELHL+I+VDRM+REFKV+  VG PQV++RET     + E KY KQSGGRGQYGHV I+ EP +  KG+EFV+ I GG IP+EYI  V  G++ AM +G LAGYP++DIKATL+DGS+H+VDSSEMAFKIA S+A KEA K  +P+LLEPIM +EV VPE+Y GD +GDI+ RRG ++  E R   +++ A VPL EMFGY+TDLRSF+QGRG Y M+F HY E PK+V +EII
  S:     1 MARKTPIEKVRNIGIAAHIDAGKTTTTERILYYTGISHKIGEVHEGAATMDWMDQEKERGITITSAATTCFWKDHQINIIDTPGHVDFTIEVERSMRVLDGAVAVFCAVGGVQPQSETVWRQANKYHVPRIVFVNKMDRIGADFYNVENQIRERLKANPVPIQIPIGAEDNFRGVVDLVEMKGIVWDDETMGAKYEVID---IPEELREKAEEYREKLVEAVAETDEELLDKYLGGEELTTEEIKKGIKKGTLDMTITPMLCGSAFKNKGVQTLLDAVVDYLPAPTEVSWIKGIDPKTGEEVSVESTDNGPFAALAFKIMTDPFVGQLSFIRVYRGQIASGSYVLNSTKEKKERVGRLLKMHANKREEIKELPAGEIGAVVGLKYTLTGDTLCDESHPVILEKMEFPEPVISVAVEPKTKADQEKMATALAKLAEEDPSFRVHTDEETGQTIISGMGELHLEIIVDRMKREFKVDAEVGQPQVAYRETIKAPVDQEYKYAKQSGGRGQYGHVFIKLEPQEPGKGYEFVNNITGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDIKATLYDGSYHDVDSSEMAFKIAGSMAFKEAAKKANPILLEPIMKVEVEVPEEYMGDVIGDINRRRGQVQSMEDRAGNKIVTAMVPLAEMFGYSTDLRSFTQGRGTYSMEFDHYEEVPKNVADEII 687
>gi|75907511|ref|YP_321807.1| elongation factor G [Anabaena variabilis ATCC 29413] >gi|119368712|sp|Q3MDM4|EFG_ANAVT Elongation factor G (EF-G) >gi|75701236|gb|ABA20912.1| translation elongation factor 2 (EF-2/EF-G) [Anabaena variabilis ATCC 29413] (692 aa)
Score = 2186, Expect = 0.0e+00, Identities = 410/688 (59%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKE-SEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART  L   RN GI AHIDAGKTTT+ERILF+SG IHKIGE H+G +V DWM+QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGANF R  + ++ RL   A+ IQLPIG+ENDF GI+DL+ ++ Y ++  +    +E  IP   ++QV++    LVE VA  DD LM  Y +G+ ++  +I+  +R+G I     PVLCGSAFKNKG++L+LDAVVD+LP+P +VP  +    +G+ V   A D+ P   LAFK+  DP+ GRLTFVRVYSGVLK GSYV N  KNKKER+SRLV M A +R ++EE+RAGD+ A +GLKDT TG+T+ D+   V LE++   +PVIS+AVEPKTK D +K+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  K  + VEGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G++ +  SG LAGYP+ID+KATL  GS+H+VDSSEMAFKIA S+ALKEA    SPVLLEP+M +EV VPE Y G+ +GD+ SRRG IE       +  + +KVPL  MFGYATD+RS +QGRG + M+FSHY E P+SV   IIA  K
  S:     1 MARTNPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEGTAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHEQMRDRLRANAIAIQLPIGSENDFKGIVDLVRKRAYIYNNDQGTDIQETDIPADLQNQVEEYYTKLVEAVAETDDALMTKYFDGEALTEEEIRSALRQGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLANGDTVERRADDNEPLAALAFKIMADPY-GRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVLMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGSPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKSVTNVEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIVGGVVPKEYIGPAEQGMKESCESGILAGYPLIDVKATLVHGSYHDVDSSEMAFKIAGSMALKEAVLKASPVLLEPMMKVEVEVPEDYIGNVIGDLISRRGQIESQSTEQGLAKVASKVPLATMFGYATDIRSKTQGRGIFTMEFSHYEEVPRSVAETIIAKSK 689
>gi|169331638|ref|ZP_02860831.1| hypothetical protein ANASTE_00022 [Anaerofustis stercorihominis DSM 17244] >gi|169259700|gb|EDS73666.1| hypothetical protein ANASTE_00022 [Anaerofustis stercorihominis DSM 17244] (688 aa)
Score = 2186, Expect = 0.0e+00, Identities = 410/683 (60%), Positives = 515/683 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           M R   L   RN GIMAHIDAGKTTT+ERILF++G+IHKIGETH+G + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEV+RSLRVLDG++AV  A+ GVEPQ+ETVWRQA +Y VPRI F+NKMD  GA+F   V  I +RLG   VPIQLPIGAE DF GIIDL++ K + +   +    EE  IP    D+ ++ R  L+EE++   +++M  YLEG+EIS  +I   +R GVIG  F PVLCG+AFKNKG+++L+DAVV+ +PSP+DVP    +  + G E+    SDD PF  LAFK+  DPFVG+L F RVYSG LKSGSYV N  K +KERV R+++MHA +R +I+EIR GDI AI+GLKDTTTG+TL  +   V LE+++F  PVIS+A+EPKTKA QEKM  AL KLAEEDPTF+  TD ETGQTII GMGELHL+I+VDR+ REFKVE NVG PQV+F+E   K +  + KY KQSGGRGQYGHV I  EPN++ KG+EFV +IVGG IP+EYI+PV  G++ AM SG +AGY ++D+K  L DGS+H+VDSSEMAFK+A S+A K+A     PVL+EPI  IEV VPE+Y GD MGD++SRRG IEG E  + VQ ++  VPL EMF Y TDLRS +QGRG + + FSHY   P+S+++++
  S:     1 MGREFSLDKVRNIGIMAHIDAGKTTTTERILFYTGKIHKIGETHEGGAQMDWMEQEQERGITITSAATTCHWKGHEINIIDTPGHVDFTVEVQRSLRVLDGSVAVFCAKGGVEPQSETVWRQADKYNVPRIAFINKMDIMGADFYNVVNMISERLGANPVPIQLPIGAEEDFVGIIDLVKMKAFIYHDDEGVDIEETEIPADMVDKAEEYREKLLEEISVNSEEIMEKYLEGEEISEKEIIAALRAGVIGLDFIPVLCGTAFKNKGVQMLIDAVVNLMPSPLDVPAMVGHNPKTGEEMERHPSDDEPFSALAFKIMADPFVGKLAFTRVYSGTLKSGSYVYNSTKGRKERVGRILRMHANDRKQIDEIRTGDIVAIVGLKDTTTGDTLCAENSQVLLESIEFPDPVISVAIEPKTKAGQEKMITALVKLAEEDPTFRFKTDDETGQTIIEGMGELHLEIIVDRLLREFKVEANVGKPQVAFKEAITKPARSDYKYAKQSGGRGQYGHVVIEIEPNEEGKGYEFVSEIVGGAIPKEYIEPVSKGIQGAMESGIVAGYEVLDVKVRLVDGSYHDVDSSEMAFKLAGSMAFKDAMAKAGPVLVEPIFKIEVVVPEEYLGDVMGDLTSRRGKIEGMELNNGVQTLRGFVPLSEMFQYTTDLRSKTQGRGTHTLTFSHYEPAPQSMLDKL 685
>gi|109647472|ref|ZP_01371375.1| translation elongation factor G [Desulfitobacterium hafniense DCB-2] >gi|109640562|gb|EAT50117.1| translation elongation factor G [Desulfitobacterium hafniense DCB-2] (692 aa)
Score = 2183, Expect = 0.0e+00, Identities = 409/687 (59%), Positives = 516/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKA-YGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE HDG + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI ++NKMD+ GA+F R V  I  RLG   VPIQ+PIGAE+ F GIIDL+  K   +       ++   IP    DQ  + R  L+E VA+ D++LM  YLEG+E++  +I+  IRKG IG +F PV+CGS+FKNKG++ LLDAVV+++P+P DVP  K  + E G      +SD  PF  LAFK+  DP+VG+L F RVYSGVL SGSYV N  K K+ER+ R+++MHA +R EI E+ AGDI A +GLKDTTTG+TL DDK  + LE+MQF  PVI++A+EPKTK DQEKM  AL++LAEEDPTFK  TD ++GQTII GMGELHL+I+VDR++REFKVE NVG PQV+++ET  +  + EGK+++QSGGRGQYGH  I  EP  +  GFEFV+KIVGG IPREYI P+  G+E AM +G  AGYP++DI+AT++DGS+H+VDSSEMAFKIA S+A K       P ++EP+M +EVTVPE+Y G+ +GD++SRRG IEG E     Q+++  VPL EMFGYATDLRS +QGRG YVM F HY E PK++   I+A +
  S:     1 MARQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHDGAATMDWMVQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRMGADFFRGVSMIADRLGANPVPIQIPIGAEDQFKGIIDLVTMKAMIYTDDLGTTSDVADIPGDLVDQANEYREKLLEAVADTDEELMMKYLEGEELTEEEIRNGIRKGTIGLKFIPVVCGSSFKNKGVQPLLDAVVEYMPAPTDVPNIKGVHPETGEADERHSSDKDPFSALAFKIMADPYVGKLAFFRVYSGVLGSGSYVYNSTKGKRERIGRILQMHANHREEIPEVYAGDIAAAVGLKDTTTGDTLCDDKAPIILESMQFPDPVINVAIEPKTKQDQEKMGTALARLAEEDPTFKMHTDQDSGQTIIEGMGELHLEIIVDRLQREFKVECNVGRPQVAYKETIRRAVKSEGKFVRQSGGRGQYGHCWIEIEPLEQGSGFEFVNKIVGGVIPREYIAPIGQGIEEAMQNGIQAGYPVMDIRATVYDGSYHDVDSSEMAFKIAGSMAFKAGAAKADPAIIEPVMKVEVTVPEEYMGEVIGDMNSRRGRIEGMEATGTAQIVRGFVPLSEMFGYATDLRSKTQGRGVYVMMFDHYEEVPKNIAEGIVAKR 689
>gi|75766386|pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue (691 aa)
Score = 2182, Expect = 0.0e+00, Identities = 406/679 (59%), Positives = 522/679 (76%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLV-DDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           DL   RN GI AHIDAGKTTT+ERIL+++GRIHKIGE H+G + MD+MEQE+ERGITIT+A T+  WK+  +N+ID PGHVDFT+EVERS+RVLDGAI V D+  GVEPQ+ETVWRQA +Y+VPRI F NKMDKTGA+    ++++Q+RLG + V +QLPIG E+ F+GIID++  K Y +         E PIP+++ DQ ++    LVE  A+FD+ +M  YLEG+E +  ++   IRKG I  +  PV  GSA KNKG++LLLDAVVD+LPSP+D+P  K    +G  V I    + P   LAFK+  DP+VGRLTF+RVYSG L SGSYV N  K +KERV+RL++MHA +R E+EE++AGD+ A++GLK+T TG+TLV +D   V LE+++  +PVI +A+EPKTKADQEK+S AL++LAEE PTF   T PETG TII+GMGEL L+I+VDR++REFKV+ NVG PQV++RET  K  +VEGK+I+Q+GGRGQYGHVKI+ EP  +  GFEFV+ IVGG IP+EYI  VQ G+E AM SGPL G+P++DIK TL+DGS+HEVDSSEMAFKIA S+A+KEA +   PV+LEPIM +EVT PE+Y GD +GD+++RRG I G E R N QVI+A VPL EMFGYATDLRS +QGRG++VM F HY E PK V  ++I
  S:     8 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEESPTFSVSTHPETGSTIISGMGELSLEIIVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI 688
>gi|148655340|ref|YP_001275545.1| translation elongation factor G [Roseiflexus sp. RS-1] >gi|166220170|sp|A5USJ2.1|EFG_ROSS1 Elongation factor G (EF-G) >gi|148567450|gb|ABQ89595.1| translation elongation factor 2 (EF-2/EF-G) [Roseiflexus sp. RS-1] (701 aa)
Score = 2182, Expect = 0.0e+00, Identities = 405/688 (58%), Positives = 538/688 (78%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK----NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY------GEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R V L   RN GI+AHIDAGKTTT+ERILF++GR +K+GE H+G +VMDWMEQE+ERGITIT+AAT+  W        +N+IDTPGHVDFT EVERSLRVLDG + V DA  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GANFER+V+ I++RLG K VPIQ PIG+E+ F GI+DLI  K  +Y  D GK E  E   IP +  D+V+++R  ++E +A  DD+LM  YLEG+E+S+ +++R +RK  I  Q  PVLCG+A +NKG++ LLDA+V +LPSPVD+P  +        G+DG E++    S+DAPF GL FK+ +DPFVG+L + RVYSG L++GSYV N  +N++ER+ RL++MHA +R EI+E+ AGDI A++G K + TG+T+ D    + LE+++F +PVI LA+EPKTKADQ+KM++ALSKLAEEDPTF+ FTD ETGQTIIAGMGELHL+++VDRMRRE+KVE N G PQV++RE+    ++V+ K+++Q+GG+GQYGHVK++ EP  + KGFEF++ IVGG IPREYI  V+AG++ AMASG +AGYP++D+K TL+DGS+HEVDSSEMAFKIAAS+ LKEA +   P+LLEP+M +E+  PE + G  +GDI+SRRG +EG E R N QVI+A VPL  MFGY TDLRS +QGR    M+F++Y   P+++  EI+  ++
  S:     1 MPREVPLERIRNIGIIAHIDAGKTTTTERILFYTGRTYKLGEVHEGTAVMDWMEQERERGITITAAATTAEWTVEGVPYRINIIDTPGHVDFTAEVERSLRVLDGGVVVFDAVAGVEPQSETVWRQADKYHVPRICFVNKMDRIGANFERTVEMIRERLGAKPVPIQFPIGSEDRFRGIVDLITNKAVLYVDDQGKRE--ELDAIPTEIADEVERLRNEMIEAIAETDDELMLLYLEGEELSVEELRRALRKATIKGQLVPVLCGAALRNKGVQRLLDAIVHYLPSPVDIPPVRGTRPGQVAGDDGVEMITRPTSEDAPFTGLVFKIVSDPFVGKLAYFRVYSGKLETGSYVLNSTRNQRERIGRLLQMHANHREEIKEVYAGDIAAMVGPKQSYTGDTICDPNDPIVLESIRFPEPVIQLAIEPKTKADQDKMAVALSKLAEEDPTFRVFTDQETGQTIIAGMGELHLEVIVDRMRREYKVEANQGKPQVAYRESITVPADVDSKFVRQTGGKGQYGHVKLQVEPLERGKGFEFINAIVGGVIPREYIPAVEAGVKEAMASGVIAGYPVVDLKVTLYDGSYHEVDSSEMAFKIAASMGLKEAVRKGRPILLEPVMKVEIVTPEDFLGTVLGDINSRRGHVEGMEARGNAQVIRAYVPLASMFGYTTDLRSATQGRATSSMEFAYYQPLPEALAKEIVEKRR 700
>gi|32265857|ref|NP_859889.1| elongation factor G [Helicobacter hepaticus ATCC 51449] >gi|46576268|sp|Q7VJ85|EFG_HELHP Elongation factor G (EF-G) >gi|32261906|gb|AAP76955.1| translation elongation factor EF-G [Helicobacter hepaticus ATCC 51449] (692 aa)
Score = 2180, Expect = 0.0e+00, Identities = 408/688 (59%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L+  RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSA T+  W++  +NLIDTPGHVDFT+EVERS+RVLDGAIAV  +  GV+PQ+ETVWRQA++Y VPR++FVNKMD+ GANF      I+QRL    VPI +PIGAE +F G+IDL++ K + + D     K + + IP +  ++  + R  L+E  A  D+ LM  YL G+E+SI DIK+ I+ G +     P+LCGS+FKNKG++ LLDAVVD+LP+P +V + K    ++ +E+ + +SDD  F GLAFK+ TDPFVG+LTFVR Y G L+SGSYV N  K KKERV RL+KMH+  R +I+EI AG+ICA +GLKDT TG+TL D+K+ V LE M F +PVI +AVEPKTKADQEKMSIALSKLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  VG PQV+FRET     E E KY KQSGGRGQYGHV IR EP +   G+EFV+ I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A K+A +  + VLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P +V  EI+  +K
  S:     1 MARKTPLVRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSATTTCFWRDYQINLIDTPGHVDFTIEVERSMRVLDGAIAVFCSVGGVQPQSETVWRQANKYGVPRMVFVNKMDRIGANFYSVESQIKQRLKANPVPINIPIGAEENFKGVIDLVQMKAIVWNDESMGAKYDVEEIPSELVEKANEYREKLLEAAAEQDEALMEKYLGGEELSIEDIKKGIKIGCLNMSLIPMLCGSSFKNKGVQTLLDAVVDYLPAPTEVAEIKGIDPKNESELSVESSDDGAFAGLAFKIMTDPFVGQLTFVRAYRGKLESGSYVLNSTKGKKERVGRLLKMHSNKREDIKEIYAGEICAFVGLKDTVTGDTLCDEKVPVILERMDFPEPVIQIAVEPKTKADQEKMSIALSKLAEEDPSFRVSTHEETGQTLIGGMGELHLEIIVDRLKREFKVEAEVGEPQVAFRETIRTAVEQECKYAKQSGGRGQYGHVHIRLEPKEAGTGYEFVNNISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKITLYDGSYHDVDSSEMAFKIAGSMAFKDACRKANAVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRMGLKIVNAFVPLAEMFGYSTDLRSATQGRGTYTMEFDHYGEVPSNVAKEIMEKRK 691
>gi|88807943|ref|ZP_01123454.1| elongation factor EF-2 [Synechococcus sp. WH 7805] >gi|88787982|gb|EAR19138.1| elongation factor EF-2 [Synechococcus sp. WH 7805] (691 aa)
Score = 2180, Expect = 0.0e+00, Identities = 407/688 (59%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   A PIQLPIGAE D +GIIDL+E K + +     +  E   +PD  KDQV + R +L+E VA  D+ L+  +LE  E+S+ ++K  IRKGV+     PVLCGSAFKNKG++L+LDAVVD+LP+P+DVP  +    +G E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K+ KER+SRLV + A +R E++E+RAGD+ A++GLK TTTG+TL   +  + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S  EGK+ +Q+GG+GQYGHV I  EP + + GFEFV+KIVGG +P+EYIKP + G++    SG +AGYP+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+A K C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D    + AKVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+  +
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWNDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHAQIKDRLKANAAPIQLPIGAEGDLSGIIDLVENKAHIYKDDLGQNIEITDVPDDMKDQVAEWRNYLMEAVAETDEALIEKFLETGELSVEELKAGIRKGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPIQGVLPNGEEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGVLQKGSYVMNSTKDSKERISRLVVLKADDREEVDELRAGDLGAVLGLKATTTGDTLCSAEDPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVNTDQETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASSRGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFEFVNKIVGGVVPKEYIKPSEMGMKETCESGVIAGYPLIDVKVTMVDGSYHDVDSSEMAFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEVPEDFLGSIIGDLSSRRGQVEGQAIDDGTSKVSAKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQ 688
>gi|159029229|emb|CAO87589.1| fusA [Microcystis aeruginosa PCC 7806] (691 aa)
Score = 2179, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L   RN GI AHIDAGKTTT+ERILF++G  HK+GE HDG ++ DWMEQE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG +AV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGANF +  + ++ RL   AVPIQ+PIGAE++ +GI+DL++ + Y +     +  EE  IP+    + ++ R  LVE VA  D++L+  YLEG+E++ A+IKR +R+G I     PVLCGSAFKNKG++LLLDAVVD+LPSP +V   K    DG+E +  A DDAPF  LAFK+  DPF GRLTF+RVYSGVL  GSY  N  K  KER++RL+ + +  R E++E+RAGD+ A IGLK+T TG+TL D+K  V LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTF+   DPET QT+IAGMGELHL+ILVDRM RE+KVE  VGAPQV++RET  K    EGK+I+QSGG+GQYGHV I  EP +   GF FV KIVGG IP+EYI P + G++ A  SG +AGYP+ID+KATL DGSFH+VDSSEMAFKIA S+A+KEA    +PVLLEP+M +EV VPE + G+ +GD++SRRG IEG E    +  + AKVPL EMFGYATD+RS +QGRG + M+FSHY E P++V   II   K
  S:     1 MARTIPLERVRNIGIAAHIDAGKTTTTERILFYTGVAHKLGEVHDGTAITDWMEQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVVAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFFKVYEQLRDRLRANAVPIQMPIGAESELSGIVDLVKMRAYIYKDDLGKDIEETDIPEDLLKKAEEFRVQLVEAVAEADEELLEKYLEGEELTEAEIKRGLREGTIAGTIVPVLCGSAFKNKGVQLLLDAVVDYLPSPSEVAAVKGILPDGSEAIREAKDDAPFSALAFKIMADPF-GRLTFLRVYSGVLAKGSYAYNSTKGTKERIARLIVLKSNERIEVDELRAGDLGAAIGLKNTITGDTLCDEKNPVILESLFIPEPVISVAVEPKTKQDIEKLSKALQALSDEDPTFRVKVDPETNQTVIAGMGELHLEILVDRMLREYKVEATVGAPQVAYRETVRKPVRAEGKFIRQSGGKGQYGHVVIELEPGEPGSGFVFVSKIVGGAIPKEYINPSEQGMKEACESGIVAGYPVIDLKATLVDGSFHDVDSSEMAFKIAGSMAIKEAVMKAAPVLLEPMMKVEVEVPEDFIGNVIGDLNSRRGQIEGQETETGIAKVSAKVPLAEMFGYATDIRSKTQGRGIFTMEFSHYEEVPRNVAEAIITKSK 688
>gi|148263138|ref|YP_001229844.1| elongation factor G [Geobacter uraniireducens Rf4] >gi|146396638|gb|ABQ25271.1| translation elongation factor 2 (EF-2/EF-G) [Geobacter uraniireducens Rf4] (692 aa)
Score = 2178, Expect = 0.0e+00, Identities = 409/688 (59%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN---EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W++  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F R V  I+ RL    +PIQLP+G E+ F GIIDL+E K   +D    G   +  E P  D   +  ++ R  ++EE+++ DD LM  Y+ G+E++  +IK  IRK  I  Q  PV+CGSAFKNKG++ LLDAV+D++P+P D+P  K  G D N   E+  +ASDD PF  LAFK+ TDPFVG+L F RVYSGVL SGSYV N  K K+ER+ R++KMHA  R EI+E+ AGDI A +GLK TTTG+TL +++  V LE+++F +PVIS+A+EPKTKADQEK+ ++L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ + EGK+++QSGGRGQYGHV +  EP +  KG+EFVD I GG +PREYI  V  G++ AM +G LAG+P++D K  L DGS+HEVDSSEMAFKIA S+  KE      PVLLEPIMA+EV VPE Y GD +GD++SRRG I G E R   QV+ + VPL +MFGY+TDLRS +QGR  Y M F HY + PKSV  EI+A  K
  S:     1 MARLVSLAKTRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCHWRDNRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYSVPRIAFINKMDRVGADFFRGVSMIKDRLKANPLPIQLPVGKEDTFKGIIDLVEMKAVIWDEESLGATFQVTEIPAADL--ELAQEYREKMIEELSSHDDVLMEKYIGGEELTNEEIKAAIRKSTISIQICPVICGSAFKNKGVQNLLDAVIDYMPAPTDIPAIK--GIDANTEAEIERNASDDEPFSALAFKIMTDPFVGQLCFFRVYSGVLNSGSYVYNATKGKRERIGRILKMHANKREEIKEVYAGDIAAAVGLKYTTTGDTLCEEEKPVILESIEFPEPVISIAIEPKTKADQEKLGLSLQKLATEDPSFRVKTDEETGQTIISGMGELHLEIIVDRLMREFKVEANVGKPQVAYRETITKKVKAEGKFVRQSGGRGQYGHVWLELEPQEPGKGYEFVDAIKGGVVPREYISSVDKGIQEAMDTGVLAGFPVVDFKVALVDGSYHEVDSSEMAFKIAGSMGFKEGCAKAGPVLLEPIMAVEVVVPEDYMGDVIGDLNSRRGRIMGMESRAGAQVVNSMVPLAQMFGYSTDLRSATQGRATYSMTFDHYEQVPKSVAEEIVAKVK 691
>gi|148238716|ref|YP_001224103.1| elongation factor G [Synechococcus sp. WH 7803] >gi|166220181|sp|A5GIP1.1|EFG_SYNPW Elongation factor G (EF-G) >gi|147847255|emb|CAK22806.1| Elongation factor G [Synechococcus sp. WH 7803] (691 aa)
Score = 2178, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   A PIQLPIGAE D +GIIDL+E K + +     +  E   +PD  KDQV + R +L+E VA  D+ L+  +LE  E+S+ ++K  IRKGV+     PVLCGSAFKNKG++L+LDAVVD+LP+P+DVP  +    +G E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A +R E++E+RAGD+ A++GLK TTTG+TL   +  + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S  EGK+ +Q+GG+GQYGHV I  EP + + GFEF++KIVGG +P+EYIKP + G++    SG +AGYP+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+A K C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D    + AKVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+  +
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWNDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAAPIQLPIGAEGDLSGIIDLVENKAHIYKDDLGQNIEVTDVPDDMKDQVAEWRTYLMEAVAETDEALIEKFLETGELSVEELKAGIRKGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPIQGVLPNGEEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGVLAKGSYVLNSTKDSKERISRLVVLKADDREEVDELRAGDLGAVLGLKATTTGDTLCSAEDPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVALAEEDPTFRVNTDQETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASSRGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFEFINKIVGGVVPKEYIKPSEMGMKETCESGVIAGYPLIDVKVTMIDGSYHDVDSSEMAFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEVPEDFLGSIIGDLSSRRGQVEGQAIDDGTSKVSAKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQ 688
>gi|188588068|ref|YP_001919669.1| translation elongation factor G [Clostridium botulinum E3 str. Alaska E43] >gi|188498349|gb|ACD51485.1| translation elongation factor G [Clostridium botulinum E3 str. Alaska E43] (688 aa)
Score = 2178, Expect = 0.0e+00, Identities = 406/687 (59%), Positives = 525/687 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTT+ERILF++G  HKIGETHDG S MDWM QE+ERGITITSAAT+ +WK   LN+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA +Y VPR+I+VNKMD TGA+F R + +++ RL   AVPIQ+PIG+E +F G+IDLI      F  D GK+ +  E+ IP ++ ++ ++ RA ++E +A  D++LM  YL+G+EI+  ++K  +RK  I  + +P +CGS++KNKG++ ++D VVD+LPSP+D+P  K    +G E   +A+D  P   LAFK+ATDPFVG+L + R+YSG+++SGSYV N  K KKER+ RLVKMH+ +R E+E + AG++ A+IGLK+T+TG+TL  +K  + LE+M+F +PVIS+A+EPKTKA QEKM +AL+KLAEEDPTFKT+T+ ETGQTIIAGMGELHLDI+VDR++REFKVE NVGAPQV+++ET  K  + E KY KQSGG+GQYGH  I  EP + + + F + IVGG IPREYI  V  G++ A  +G +AGY +I+ K  L  GS+HEVDSSEMAFKIA S+A K A     PVLLEP+M +E+TVPE+Y GD +GD++SRRG +EG E  +  QVI+A VPL EMFGYAT LRS +QGRG Y M F HY E PKS+  ++   K
  S:     1 MARKYPLDKFRNFGIMAHIDAGKTTTTERILFYTGINHKIGETHDGASTMDWMVQEQERGITITSAATTCAWKEHELNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADFFRCISTVRDRLKGNAVPIQIPIGSEENFQGMIDLIRNVAILFYDDLGKDMR--EEAIPAEYAEKAEEYRAAMIEAIAEADEELMMKYLDGEEITEEELKAGLRKATIANEIYPCICGSSYKNKGVQQMIDGVVDYLPSPLDIPAVKGTNLEGEEAERNAADGEPLSALAFKIATDPFVGKLAYTRIYSGIMESGSYVLNSTKGKKERIGRLVKMHSNSRQEVESLEAGELGAVIGLKNTSTGDTLCSEKDPIILESMEFPEPVISVAIEPKTKAAQEKMGMALAKLAEEDPTFKTWTNEETGQTIIAGMGELHLDIIVDRLKREFKVECNVGAPQVAYKETIRKAVKAEAKYAKQSGGKGQYGHAVIEMEPTEGE-YVFENAIVGGAIPREYIPAVDNGIQEASLNGIIAGYNVINFKVRLVHGSYHEVDSSEMAFKIAGSMAFKNAMSKADPVLLEPMMKVEITVPEEYMGDVIGDVNSRRGRMEGMEAVNGAQVIRAFVPLSEMFGYATSLRSRTQGRGVYSMVFDHYEEVPKSIQEQVAGNK 686
>gi|188527981|ref|YP_001910668.1| elongation factor G [Helicobacter pylori Shi470] >gi|188144221|gb|ACD48638.1| elongation factor G [Helicobacter pylori Shi470] (692 aa)
Score = 2177, Expect = 0.0e+00, Identities = 408/688 (59%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+QRL    VPI +PIGAE+ F G+IDL++ K   ++    G +   EE  IP    ++ KQ R  LVE VA  D+ LM  YL G+E+SI +IK+ I+ G +     P+LCGS+FKNKG++ LLDAV+D+LP+P +V   K    +   EV + +SDD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K+KKERV RL+KMH+  R +I+E+ AG+ICA +GLKDT TG+TL D+K  V LE M+F +PVI +AVEPKTKADQEKM +AL KLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  +G PQV+FRET       E KY KQSGGRGQYGHV I+ EP +   G+EFV++I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A KEA +  +PVLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P ++  EI+  +K
  S:     1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYSVENQIKQRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNNETMGAKYDVEE--IPSDLLEKAKQYREKLVEAVAEQDEALMEKYLGGEELSIEEIKKGIKTGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKTEEEVFVKSSDDGEFAGLAFKIMTDPFVGQLTFVRVYRGNLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTLCDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREFKVEAEIGQPQVAFRETIRSSVSKEHKYAKQSGGRGQYGHVFIKLEPKEPGSGYEFVNEISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691
>gi|167629464|ref|YP_001679963.1| elongation factor G [Heliobacterium modesticaldum Ice1] >gi|167592204|gb|ABZ83952.1| translation elongation factor g [Heliobacterium modesticaldum Ice1] (691 aa)
Score = 2176, Expect = 0.0e+00, Identities = 413/688 (60%), Positives = 517/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L   RN GIMAHIDAGKTTT+ERILF++GR+HKIGE HDG + MDWM QE+ERGITITSAAT+  W+   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI ++NKMD+ GA+F R V  I++RLG   VPIQ+PIGAE+ F GI+DLI  K  +Y  D GK     E  IP+   D   + R  L+E VA  D++LM  YLEG+E++  +I+  IRK  +  +  PVLCGS+FKNKG++ LLDAVV+FLP+PVD+P  K    D G E +   SD+ PF  LAFK+  DP+VG+L F RVYSG L SGSYV N  K KKER+ R+++MHA +R EI E+  GDI A +GLKDTTTG+TL D+K  + LE+MQF +PVI +A+EPKTKADQ+KM+IAL +L+EEDPTF+  TD ETGQTII+GMGELHL+I+VDRM REFKVE NVG PQV+++ET   +++ EGK+++QSGGRGQYGH  I  EP     G+EFV+KIVGG IPREYI  +  G+  A  +G LAGYP +D + TL  GS+H+VDSSEMAFKIA S+A KE     +PV+LEP+M +EVTVPE+Y GD +GDI+SRRG IEG E R + QV++  VPL EMFGYATDLRS +QGRG YVM +SH  E P+++   IIA +K
  S:     1 MPRQFPLNKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHDGAATMDWMVQEQERGITITSAATTCQWRGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRIGADFFRGVSMIRERLGANPVPIQIPIGAEDQFKGIVDLITMKAIIYVDDLGKTSDVTE--IPEDLADIAAEYREKLLEAVAESDEELMMKYLEGEELTEEEIRNGIRKSTLAVKMIPVLCGSSFKNKGVQPLLDAVVEFLPAPVDIPAVKGVNPDSGEEDVREVSDEEPFSTLAFKIMADPYVGKLAFFRVYSGKLSSGSYVYNSTKGKKERIGRILQMHANHREEIAEVYTGDIAAAVGLKDTTTGDTLCDEKHPIILESMQFPEPVIHVAIEPKTKADQDKMAIALQRLSEEDPTFRMSTDHETGQTIISGMGELHLEIIVDRMMREFKVEANVGRPQVAYKETIRSKAKAEGKFVRQSGGRGQYGHAVIEIEPLEPGAGYEFVNKIVGGVIPREYIPAIDNGIREAAETGVLAGYPTVDFRVTLVFGSYHDVDSSEMAFKIAGSMAFKEGAAKANPVILEPVMKVEVTVPEEYMGDVIGDINSRRGRIEGMESRGSTQVVRGYVPLSEMFGYATDLRSRTQGRGQYVMMYSHNEEVPRNIAEGIIAKRK 690
>gi|15612183|ref|NP_223835.1| elongation factor G [Helicobacter pylori J99] >gi|6919881|sp|Q9ZK24|EFG_HELPJ Elongation factor G (EF-G) >gi|4155707|gb|AAD06689.1| ELONGATION FACTOR G (EF-G) [Helicobacter pylori J99] (692 aa)
Score = 2174, Expect = 0.0e+00, Identities = 408/688 (59%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+QRL    VPI +PIGAE+ F G+IDL++ K   ++    G +   EE  IP    ++ KQ R  LVE VA  D+ LM  YL G+E+ I +IK+ I+ G +   F P+LCGS+FKNKG++ LLDAV+D+LP+P +V   K    +   EV + +SDD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K+KKERV RL+KMH+  R +I+E+ AG+ICA +GLKDT TG+TL D+K  V LE M+F +PVI +AVEPKTKADQEKM +AL KLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  +G PQV+FRET       E KY KQSGGRGQYGHV I+ EP +   G+EFV++I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A KEA +  +PVLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P ++  EI+  +K
  S:     1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQIKQRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNNETMGAKYDVEE--IPSDLLEKAKQYREKLVEAVAEQDEALMEKYLGGEELDIEEIKKGIKTGCLNMSFVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKTEEEVFVKSSDDGEFAGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTLCDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREFKVEAEIGQPQVAFRETIRSSVSKEHKYAKQSGGRGQYGHVFIKLEPKEPGSGYEFVNEISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691
>gi|22299292|ref|NP_682539.1| elongation factor G [Thermosynechococcus elongatus BP-1] >gi|34222488|sp|Q8DI43|EFG_SYNEL Elongation factor G (EF-G) >gi|22295475|dbj|BAC09301.1| translation elongation factor EF-G [Thermosynechococcus elongatus BP-1] (691 aa)
Score = 2174, Expect = 0.0e+00, Identities = 415/688 (60%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART  L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE H+G +V DWMEQE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY VPRI+FVNKMD+TGANF +    I+ RL   AVPIQLPIGAE+ F GI+DL+    K+Y  D GKE   E+  IP +  +  ++ R  L+E VA  DD LM  Y EG+E++  +I+  +RKG I     P+LCGSAFKNKG++LLLDAVVD+LP+P+D+P  K    DG EV  +A DD P   LAFK+ +DP+ GRLTFVRVYSGVLK GSYV N  K KKER+SRL+ + A  R E++E+RAGD+ A +GLK+T TG+TL D+   V LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM+RE+KVE N+G PQV++RET  K    EGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G++ A  SG LAGYP+ID+K TL DGS+HEVDSSEMAFKIA S+A+KEA    +PVLLEP+M +EV VPE++ G  MGD+ +RRG IEG    + +  + AKVPL+ MFGYATD+RS +QGRG + M+FSHY E P++V   IIA  K
  S:     1 MARTTPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHEGTTVTDWMEQERERGITITAAAISTSWRDHQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYSVPRIVFVNKMDRTGANFYKVHDQIRDRLRANAVPIQLPIGAEDQFKGIVDLVRMRAKIYKDDLGKE--IEDTEIPAEMTELAQEYRTKLIEAVAETDDALMEKYFEGEELTEEEIRAALRKGTIAGTIVPMLCGSAFKNKGVQLLLDAVVDYLPAPIDIPAIKGRLPDGTEVERAADDDQPLAALAFKIMSDPY-GRLTFVRVYSGVLKKGSYVLNATKGKKERISRLIVLKADERIEVDELRAGDLGAALGLKETFTGDTLCDESSPVILESLYIPEPVISVAVEPKTKQDMEKLSKALQALSEEDPTFRVSVDPETNQTVIAGMGELHLEILVDRMQREYKVEANIGQPQVAYRETIRKPVRAEGKFIRQSGGKGQYGHVVIEVEPAEPGTGFEFVSKIVGGVVPKEYIPPAEQGMKEACESGILAGYPVIDLKVTLVDGSYHEVDSSEMAFKIAGSIAIKEAVMKANPVLLEPMMKVEVEVPEEFLGTVMGDLIARRGQIEGQTVENGIAKVTAKVPLERMFGYATDIRSNTQGRGIFSMEFSHYEEVPRNVAEAIIAKNK 688
>gi|154484489|ref|ZP_02026937.1| hypothetical protein EUBVEN_02203 [Eubacterium ventriosum ATCC 27560] >gi|149734337|gb|EDM50254.1| hypothetical protein EUBVEN_02203 [Eubacterium ventriosum ATCC 27560] (689 aa)
Score = 2173, Expect = 0.0e+00, Identities = 401/672 (59%), Positives = 509/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK------------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFE---PNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTT +ERIL+++G  +KIGETHDG S MDWMEQE+ERGITITSAAT+  W                +N+IDTPGHVDFTVEVERSLRVLDGA+ V DA+ GVEPQ+E VWRQA  Y VPR+ F+NKMDK GA+F  SVQ+I  RLG  A+P+Q+PIG E+DF G+IDL E + Y++   K E  E   IPD  KD   +   +LVE++   DD LM  YLEG+E SI D+K  +RKG I C+  PV CGSA+KNKG++ +LD V++++P+P D+P      EDGNEV+  +SDD PF  LAFK+ TDPFVG+L F RVYSG + SGSYV N  KNKKERV R+V+MHA  R EI+++ +GDI A +G K TTTG+T+ D++  V LE+M+F +PVI LA+EPKTK DQ KM  AL+KLAEEDPTF+  TD ETGQTIIAGMGELHLD++VDR+ REFKVE NVGAPQV+++ETF K  +V+ KY KQSGGRGQYGH K++FE   PN ++ F+F   +VGG IP+EYI  V  G+E A  SG +AG+P++ + AT++DGS+HEVDSSEMAF IA S+A K+A     PVLLEPIM +EVT+PE+Y GD +G ++S+RG IEG +     +++KA VPL EMFGY+T+LRS +QGRGNY M F  Y   PKSV ++I + +
  S:     1 MAHIDAGKTTLTERILYYTGVNYKIGETHDGASTMDWMEQEQERGITITSAATTCHWTLEDHHKPKAGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFDAKAGVEPQSENVWRQADTYNVPRMAFINKMDKMGADFFYSVQTIIDRLGKNAIPVQIPIGKEDDFIGLIDLFEMEAYYYKDDKGEDIEITAIPDDLKDLANEWHENLVEKICELDDDLMMQYLEGEEPSIDDMKAALRKGTIACEAVPVFCGSAYKNKGVQKMLDGVIEYMPAPTDIPDITGTDEDGNEVVRHSSDDEPFAALAFKIMTDPFVGKLAFFRVYSGTMNSGSYVLNATKNKKERVGRIVQMHANKRTEIDKVYSGDIAAAVGFKITTTGDTICDEQHPVILESMEFPEPVIELAIEPKTKNDQGKMGEALAKLAEEDPTFRAHTDTETGQTIIAGMGELHLDVIVDRLLREFKVEANVGAPQVAYKETFTKAVDVDSKYAKQSGGRGQYGHCKVKFEPMDPNGEEQFKFESTVVGGNIPKEYIPAVGEGIEEAAQSGIIAGFPVLGVHATVYDGSYHEVDSSEMAFHIAGSMAFKDAMAKADPVLLEPIMKVEVTMPEEYMGDVIGSLNSKRGQIEGMDDIGGGKIVKAFVPLSEMFGYSTELRSATQGRGNYSMFFEKYQAAPKSVQDKIASAR 687
>gi|126658888|ref|ZP_01730031.1| elongation factor G [Cyanothece sp. CCY0110] >gi|126619838|gb|EAZ90564.1| elongation factor G [Cyanothece sp. CCY0110] (688 aa)
Score = 2171, Expect = 0.0e+00, Identities = 403/675 (59%), Positives = 520/675 (77%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
            RN GI AHIDAGKTTT+ERILF++G  +K+GE H+G + MDWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA+RY+VPRI FVNKMD+TGANF +  Q I+ RL   AVPIQ+PIG E++F GI+DL+    K+Y  D GK    E+  IPD++ +Q K+ RA L+E +A  D+ L+  YLEG+EI+ A+IK+ +RKG +     P+LCGSAFKNKG++LLLDAVVD+LPSP+DVP      +DG+E    A D+ PF  LAFK+A+DP+ GRLTF+RVYSGVL+ G+YV N  + +KER+SRL+ + + +R E++E+RAGD+ A IGL++T TG+TL D+K  + LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTFK   DPET QT+IAGMGELHL+ILVDRM RE+KVE  VG PQV++RE+  K SE EGKYI+QSGG+GQYGHV I  EP +   GFEF+ KIVGG IP+E+I P + G++ A  SG +AGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A++ A K  SPVLLEP+M +EV VPE + GD +GD+++RRG IEG    D +  I A VPL EMFGYATD+RS +QGRG + M+FSHYAE P++V   I+
  S:     1 MRNIGIAAHIDAGKTTTTERILFYTGIAYKLGEVHEGTATMDWMAQEQERGITITAAAISTSWLDQRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQANRYQVPRIAFVNKMDRTGANFFKVYQQIRDRLKANAVPIQIPIGTESEFRGIVDLVRMRAKIYQDDLGK--NIEDTEIPDEYLEQAKEYRAKLIEAIAEIDETLLEKYLEGEEITEAEIKQGLRKGTLDKTIIPMLCGSAFKNKGVQLLLDAVVDYLPSPLDVPPITGLLKDGSEDTRKADDEEPFSALAFKIASDPY-GRLTFMRVYSGVLEKGNYVYNATQEQKERISRLIVLKSNDRIEVDELRAGDLGAAIGLRNTITGDTLCDEKHPILLESLYIPEPVISVAVEPKTKQDMEKLSKALQALSDEDPTFKVSVDPETNQTVIAGMGELHLEILVDRMLREYKVEATVGQPQVAYRESIRKASEAEGKYIRQSGGKGQYGHVVIELEPAEAGSGFEFISKIVGGTIPKEFISPAEQGMKEACNSGIIAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAIRNAVKKASPVLLEPMMKVEVEVPEDFLGDVIGDLNARRGNIEGMNTDDGLAKISADVPLAEMFGYATDIRSKTQGRGIFSMEFSHYAEVPRNVAEAIV 675
>gi|118579116|ref|YP_900366.1| elongation factor G [Pelobacter propionicus DSM 2379] >gi|118501826|gb|ABK98308.1| translation elongation factor 2 (EF-2/EF-G) [Pelobacter propionicus DSM 2379] (692 aa)
Score = 2170, Expect = 0.0e+00, Identities = 403/688 (58%), Positives = 519/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-----EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L  +RN GIMAHIDAGKTTT+ERIL+++G  HKIGE H+G + MDWMEQE+ERGITITSAAT+ SW++  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F R VQ I+ RL    +PIQ+PIG E +F G++DL+  K   +    EE+A      E+ IP     + ++ R  ++EE+++ DD LM  YL G+E++  +I   IR   IG +FFPV+CG+AFKNKG++ LLDAVVD++PSP+D+P  K    D G EV   ASDD PF  L FK+ TDPFVG+LTF RVYSGV+ SGSYV N  K KKER+ R++KMHA  R EI+E+ AGDI A +GLK TTTG+TL  +   V LE+++F +PVIS+A+EPKTKADQEK+ ++L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ +VEGK+++QSGGRGQYGHV +  EP +  KG+EFVD I GG +PREYI  V  G++ A  +G LAG+P++DIK TL DGS+HEVDSSEMAFKIA S+  KE  +  SP++LEPI+++EV VP++Y GD +GD++S+RG I G + R   Q++ A VP+  MFGY+TDLRS +QGR  Y M F HY   PKSV  EI+A  K
  S:     1 MPRLATLDKYRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHEGAATMDWMEQEQERGITITSAATTCSWRDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAFINKMDRVGADFFRGVQMIRDRLKANPLPIQIPIGKEENFKGVVDLVRMKAVIW----EEEALGANYHEEEIPADLLVEAQEYRDKMIEEISSHDDTLMEKYLSGEELTEQEIMDAIRTCTIGIKFFPVICGTAFKNKGVQNLLDAVVDYMPSPLDIPAIKGLDADTGEEVERPASDDVPFSALGFKIMTDPFVGQLTFFRVYSGVINSGSYVYNSTKGKKERIGRILKMHANKREEIKEVFAGDIAAAVGLKYTTTGDTLCTEDDAVILESIEFPEPVISIAIEPKTKADQEKLGLSLQKLASEDPSFRVKTDEETGQTIISGMGELHLEIIVDRLLREFKVEANVGKPQVAYRETITKKVKVEGKFVRQSGGRGQYGHVWLEVEPQEAGKGYEFVDAIKGGVVPREYIPAVDKGIKEATENGVLAGFPVVDIKVTLIDGSYHEVDSSEMAFKIAGSMGFKEGCQKASPIILEPIVSVEVVVPDEYMGDVIGDLNSKRGRIMGMDTRAGAQIVNAMVPMASMFGYSTDLRSATQGRATYSMTFDHYEPVPKSVAEEIVAKAK 691
>gi|169824189|ref|YP_001691800.1| translation elongation factor G [Finegoldia magna ATCC 29328] >gi|167830994|dbj|BAG07910.1| translation elongation factor G [Finegoldia magna ATCC 29328] (695 aa)
Score = 2170, Expect = 0.0e+00, Identities = 409/687 (59%), Positives = 519/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFE----PNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR V L + RN GIMAHIDAGKTT +ERIL++SG+IHKIG+THDG + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDG++A+ DA+ GVEPQ+ETVWRQA +Y VPRI F+NKMD TGA++  SV +I++RL   AVPI++PIGAE+ F G++DLI  K  +Y  + G E   EE  IP    +  ++ RA L+E +A  D++LM  YLEG+E++  +IKR IR   I     PVLCGSA+KNKG++ LLDA+VD++P+P+DVP  K      +E     +SD+ PF  LAFK+ATDP+VG+L F RVYSG ++SGSYV N  K K+ER+ R++ MHA  R EI++  AGDI AIIGLKDTTTG+TL D   +V LE M+F  PVIS+A+EPKTKA QEKM IAL+KLAEEDPTF+T+TD ETG TII+GMGELHL+I+VDR+ REFKVE N+G PQV++RE+  + +E +GKY+KQSGGRGQYG   +R E    P +  G EFV+ IVGG IP+EYI  VQAG E A  +G L GYPM+D+K TL DGS+H+VDSSEMA+KIA S+  + A     P+LLEP M +E+T P++Y GD MGD+SSRRG I+G   ++ V V+ A +PL EMFGYATDLRS +QGR  Y MQF HY + P S+  E+I  K
  S:     1 MARQVSLKDTRNIGIMAHIDAGKTTVTERILYYSGKIHKIGDTHDGAAQMDWMVQEQERGITITSAATTCFWKGNRINIIDTPGHVDFTVEVERSLRVLDGSVALFDAKSGVEPQSETVWRQADKYGVPRICFINKMDATGADYFMSVDTIRERLRANAVPIEIPIGAEDKFVGVVDLITMKANIYKNELGTEFTVEE--IPSDLVEVAEKYRAELLENIAEHDEELMEKYLEGEELTEEEIKRAIRTATIANAMNPVLCGSAYKNKGVQPLLDAIVDYMPAPIDVPDIKGVDPQTDEPTTRKSSDEEPFAALAFKIATDPYVGKLAFTRVYSGTVESGSYVYNSTKGKRERIGRILMMHANKREEIDKAYAGDIVAIIGLKDTTTGDTLCDMDSEVILENMEFPDPVISVAIEPKTKASQEKMGIALAKLAEEDPTFRTYTDEETGDTIISGMGELHLEIIVDRLLREFKVEANIGNPQVAYRESITQAAEAQGKYVKQSGGRGQYGDCTLRVEPLDNPEESNGIEFVNAIVGGAIPKEYIPSVQAGAEEAAQTGILGGYPMLDMKITLLDGSYHDVDSSEMAYKIAGSMGFRAAVAKAKPILLEPAMKVEITTPDEYLGDVMGDVSSRRGKIDGMNPKNGVHVLDAFIPLAEMFGYATDLRSKTQGRATYSMQFDHYEQVPNSISEEVIGKK 692
>gi|172039002|ref|YP_001805503.1| elongation factor EF-G [Cyanothece sp. ATCC 51142] >gi|171700456|gb|ACB53437.1| elongation factor EF-G [Cyanothece sp. ATCC 51142] (697 aa)
Score = 2168, Expect = 0.0e+00, Identities = 404/684 (59%), Positives = 521/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR + L   RN GI AHIDAGKTTT+ERILF++G  +K+GE H+G + MDWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA+RY VPRI FVNKMD+TGANF +  Q I+ RL   AVPIQ+PIG E++F GI+DL+    K+Y  D GK    E+  IPD++ +Q ++ RA L+E +A  D+ L+  YLEG++++  DI++ +RKG +     P+LCGSAFKNKG++LLLDAVVD+LPSP+DVP      +DG E    A D  PF  LAFK+A+DP+ GRLTF+RVYSGVL+ G+YV N  + +KER+SRL+ + + +R E++E+RAGD+ A IGL++T TG+TL D+K  + LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTFK   DPET QT+IAGMGELHL+ILVDRM RE+KVE  VG PQV++RET  K S+ EGKYI+QSGG+GQYGHV I  EP +   GFEFV KIVGG IP+E+I P + G++ A  SG +AGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A++ A K  SPVLLEP+M +EV VPE + GD +GD+++RRG IEG    D +  I A VPL EMFGYATD+RS +QGRG + M+FSHYAE P++V   I+
  S:     1 MARNIPLERVRNIGIAAHIDAGKTTTTERILFYTGIAYKLGEVHEGTATMDWMAQEQERGITITAAAISTSWLDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQANRYHVPRIAFVNKMDRTGANFFKVYQQIRDRLKANAVPIQIPIGTESEFRGIVDLVRMRAKIYQDDLGK--NIEDTEIPDEYLEQAQEYRAKLIEAIAEIDETLLEKYLEGEQLTEEDIRQGLRKGTLNKTIIPMLCGSAFKNKGVQLLLDAVVDYLPSPLDVPPITGLLKDGTEDSRKADDQEPFSALAFKIASDPY-GRLTFMRVYSGVLEKGNYVYNATQEQKERISRLIVLKSNDRIEVDELRAGDLGAAIGLRNTITGDTLCDEKHPILLESLYIPEPVISVAVEPKTKQDMEKLSKALQALSDEDPTFKVSVDPETNQTVIAGMGELHLEILVDRMLREYKVEATVGQPQVAYRETIRKPSDAEGKYIRQSGGKGQYGHVVIELEPGEAGSGFEFVSKIVGGTIPKEFISPAEQGMKEACDSGIIAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAIRNAVKKASPVLLEPMMKVEVEVPEDFLGDVIGDLNARRGQIEGMNTDDGLAKISADVPLAEMFGYATDIRSKTQGRGIFSMEFSHYAEVPRNVAEAIV 684
>gi|95931445|ref|ZP_01314151.1| translation elongation factor G [Desulfuromonas acetoxidans DSM 684] >gi|95132513|gb|EAT14206.1| translation elongation factor G [Desulfuromonas acetoxidans DSM 684] (691 aa)
Score = 2168, Expect = 0.0e+00, Identities = 397/688 (57%), Positives = 510/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L N RN GIMAHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFT+EVERSLRVLDG++AV  +  GVEPQ+ETVWRQA +Y VPR+ FVNKMD+ GA+F+R V  ++ RLG   VP+QLPIG E+ F G++DL+E K + +D    G   ++ E   IP +    V+  R  ++EE+  +D+ LM  YL G E+++A+IK  IR   I     PVLCGSAFKNKG++ LLDAVVD++P P DVP  +     GNE+   A DD PF  LAFK+ TDPFVG+L+F RVYSG+ ++GS V N  K KKER+ R++KMHA  R EI+++ +GDI A +GLK TTTG+TL D + +  LEAM+F  PVI +AVEPKTK+DQEKM +AL KL  EDP+    TD ETGQTI++GMGELHL++++DR++REFKVE N+GAPQV++RE+  K  EV+GK+++QSGGRGQYG   +R EP +   GFEFVD I GG IPREYI  V  G E A  +G +AG+P++D+K T++DGS+H+VDSSEMAFKIA S+  KE      P LLEP+MA+EV VPE+Y GD +GD++SRRG ++G + R + QVI A VPL  MFGYAT+LRS +QGR  Y M F HY + PK++  EIIA  K
  S:     1 MARKVSLANTRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWKENRINIIDTPGHVDFTIEVERSLRVLDGSVAVFCSVGGVEPQSETVWRQADKYGVPRLAFVNKMDRIGADFQRGVDMMKDRLGANPVPLQLPIGKEDYFKGVVDLVEMKAFIWDDESLGANFDEVE---IPAEMSGDVEAAREAMLEELCTYDEGLMEKYLGGDELTVAEIKSAIRTATIDLHINPVLCGSAFKNKGVQHLLDAVVDYMPCPTDVPAIEGLDPKGNEITRPADDDGPFAALAFKIMTDPFVGQLSFFRVYSGIAEAGSSVLNSTKGKKERLGRILKMHANKREEIKQVYSGDIAAAVGLKYTTTGDTLCDSEGECLLEAMEFPDPVIHIAVEPKTKSDQEKMGVALGKLLAEDPSLGVRTDEETGQTILSGMGELHLEVIIDRLKREFKVEANIGAPQVAYRESITKSVEVQGKFVRQSGGRGQYGDCWLRIEPQEPGAGFEFVDAIKGGVIPREYIPAVGKGAEEASQNGVIAGFPIVDVKVTVYDGSYHDVDSSEMAFKIAGSMGFKEGAAKAGPALLEPMMAVEVVVPEEYMGDVIGDLNSRRGKVQGMDSRGSAQVISAHVPLASMFGYATELRSMTQGRATYTMVFDHYDQVPKAISEEIIAKVK 690
>gi|56750664|ref|YP_171365.1| elongation factor G [Synechococcus elongatus PCC 6301] >gi|81299694|ref|YP_399902.1| elongation factor G [Synechococcus elongatus PCC 7942] >gi|119183|sp|P18667|EFG_SYNP6 Elongation factor G (EF-G) >gi|119368776|sp|Q31PV4|EFG_SYNP7 Elongation factor G (EF-G) >gi|1405432|emb|CAA35495.1| fus [Synechococcus elongatus PCC 6301] >gi|56685623|dbj|BAD78845.1| elongation factor EF-G [Synechococcus elongatus PCC 6301] >gi|81168575|gb|ABB56915.1| translation elongation factor 2 (EF-2/EF-G) [Synechococcus elongatus PCC 7942] (694 aa)
Score = 2168, Expect = 0.0e+00, Identities = 407/688 (59%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVI---GCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR+V L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWMEQE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG +AV  +  GV+PQ+ETVWRQA RY VPRI+FVNKMD+TGA+F +    I+ R+   AVPIQ+PIGAE+DF GI+DL+E K + +            IP + ++   + R+ +VE VA  D+ L+  Y E  ++SI DIK  +RKGV+     +  P+LCGSAFKNKG++LLLDAVV+ LPSP D+P  +    DG   L  +SD+APF  LAFK+  DP+ GRLTFVRVYSG+L+ GSYV N  K KKERVSRL+ + A +R E++E+RAGD+ A++GLKDT TG+TL DD+  + LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+   D ET QT+IAGMGELHL+ILVDRM RE+KVE N+GAPQV++RET  K  + EGK+++QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EY+ P + G++    SG LAGYP+IDIKATL DGS+H+VDSSEMAFKIA S+A+KEA +   PVLLEP+M +EV VPE + G  MG++ SRRG IEG    +    + AKVPL EMFGYATDLRS +QGRG + M+FS Y E P++V   IIA  K
  S:     1 MARSVPLEKVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGNAVTDWMEQERERGITITAAAISTSWKDYRVNIIDTPGHVDFTIEVERSMRVLDGVVAVFCSVGGVQPQSETVWRQADRYSVPRIVFVNKMDRTGADFFKVYGQIRDRVRANAVPIQIPIGAESDFQGIVDLVEMKAHIYTNDLGTDILVTDIPAELQETAAEWRSKMVEAVAETDEALLDKYFEDGDLSIEDIKAGLRKGVLIQGNDRLVPMLCGSAFKNKGVQLLLDAVVELLPSPQDIPPIQGTLPDGEVALRPSSDEAPFSALAFKIMADPY-GRLTFVRVYSGILQKGSYVYNATKGKKERVSRLIILKADDRIEVDELRAGDLGAVLGLKDTFTGDTLCDDQNPIILESLFIPEPVISVAVEPKTKNDMEKLSKALQALSEEDPTFRVSVDSETNQTVIAGMGELHLEILVDRMLREYKVEANIGAPQVAYRETVRKAVKAEGKFVRQSGGKGQYGHVVIELEPAEPGTGFEFVSKIVGGTVPKEYVGPAEQGMKETCESGVLAGYPLIDIKATLVDGSYHDVDSSEMAFKIAGSMAIKEAVRKADPVLLEPVMKVEVEVPEDFLGSVMGNLISRRGQIEGQATTNGTATVSAKVPLAEMFGYATDLRSMTQGRGIFTMEFSQYEEVPRNVAETIIAKNK 691
>gi|156743951|ref|YP_001434080.1| translation elongation factor G [Roseiflexus castenholzii DSM 13941] >gi|189027966|sp|A7NR66.1|EFG_ROSCS Elongation factor G (EF-G) >gi|156235279|gb|ABU60062.1| translation elongation factor G [Roseiflexus castenholzii DSM 13941] (701 aa)
Score = 2167, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 534/688 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK----NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY------GEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R V L   RN GI+AHIDAGKTTT+ERILF++GR +K+GE H+G +VMDWMEQE+ERGITIT+AAT+  W        +N+IDTPGHVDFT EVERSLRVLDG + V DA  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GANF R+V  I++RLG K VP+Q PIGAE+ F GI+DLI  K  +Y  D GK E+ E   IP    D+V+++R  ++E +A  DD+L   YLEG+E+S+ +++R +RK  I  +  PVLCG+A +NKG++ LLDAVV +LPSPVD+P  +        G+DG E++    S+DAPF GL FK+ +DPFVG+L + RVYSG L++GSYV N  +N++ER+ RL++MHA +R EI+E+ AGDI A++G K + TG+T+ D    + LE+++F +PVI LA+EPKTKADQ+K+++AL KLAEEDPTF+ FTDPETGQTIIAGMGELHL+++VDRMRRE+KVE N G PQV++RE+    ++V+ K+++QSGG+GQYGHVK++ EP  + KGFEFV+ IVGG IPREYI  V+AG++ AMASG +AGYP++DIK TL+DGS+HEVDSSEMAFKIAAS+ LKEA +   P+LLEP+M +E+  PE + G  +GDI+SRRG +EG E R N QVI+A VPL  MFGY TDLRS +QGR    M+F++Y   P ++  EII  ++
  S:     1 MPREVPLERIRNIGIIAHIDAGKTTTTERILFYTGRTYKLGEVHEGTAVMDWMEQERERGITITAAATTAEWTVEGTPYRINIIDTPGHVDFTAEVERSLRVLDGGVVVFDAVAGVEPQSETVWRQADKYHVPRICFVNKMDRIGANFMRTVDMIRERLGAKPVPVQFPIGAEDRFRGIVDLITNKAVIYVDDQGKREELEA--IPADVADEVERLRNEMIEAIAETDDELTLLYLEGEELSVEELRRALRKATIQGKLVPVLCGAALRNKGVQRLLDAVVYYLPSPVDIPPVRGTRPGQIAGDDGVEMITRPTSEDAPFTGLVFKIVSDPFVGKLAYFRVYSGKLETGSYVLNSTRNQRERIGRLLQMHANHREEIKEVYAGDIAAMVGPKQSYTGDTICDPNDPIVLESIRFPEPVIQLAIEPKTKADQDKLAVALGKLAEEDPTFRVFTDPETGQTIIAGMGELHLEVIVDRMRREYKVEANQGKPQVAYRESITVPADVDSKFVRQSGGKGQYGHVKLQVEPLERGKGFEFVNGIVGGVIPREYIPAVEAGVKEAMASGVIAGYPVVDIKVTLYDGSYHEVDSSEMAFKIAASMGLKEAVRKGRPILLEPVMKVEIVTPEDFLGAVLGDINSRRGHVEGMEARGNAQVIRAYVPLASMFGYTTDLRSATQGRATSSMEFAYYQPLPDALAKEIIEKRR 700
>gi|108563559|ref|YP_627875.1| elongation factor G [Helicobacter pylori HPAG1] >gi|119368733|sp|Q1CS71|EFG_HELPH Elongation factor G (EF-G) >gi|107837332|gb|ABF85201.1| translation elongation factor EF-G [Helicobacter pylori HPAG1] (692 aa)
Score = 2167, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 514/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VPI +PIGAE+ F G+IDL++ K   ++    G +   EE  IP    ++ KQ R  LVE VA  D+ LM  YL G+E+S+ +IK+ I+ G +     P+LCGS+FKNKG++ LLDAV+D+LP+P +V   K    +   EV + +SDD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K+KKERV RL+KMH+  R +I+E+ AG+ICA +GLKDT TG+TL D+K  V LE M+F +PVI +AVEPKTKADQEKM +AL KLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  +G PQV+FRET       E KY KQSGGRGQYGHV I+ EP +   G+EFV++I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A KEA +  +PVLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P ++  EI+  +K
  S:     1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQIKLRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNNETMGSKYDVEE--IPSDLLEKAKQYREKLVEAVAEQDEALMEKYLGGEELSVEEIKKGIKTGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKTEEEVFVKSSDDGEFAGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTLCDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREFKVEAEIGQPQVAFRETIRSSVSKEHKYAKQSGGRGQYGHVFIKLEPKEPGSGYEFVNEISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691
>gi|109948058|ref|YP_665286.1| elongation factor G [Helicobacter acinonychis str. Sheeba] >gi|122973218|sp|Q17VN9.1|EFG_HELAH Elongation factor G (EF-G) >gi|109715279|emb|CAK00287.1| elongation factor EF-G [Helicobacter acinonychis str. Sheeba] (692 aa)
Score = 2166, Expect = 0.0e+00, Identities = 405/688 (58%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+QRL    VPI +PIGAE+ F G+IDL++ K   ++    G +   EE  IP    ++ K+ R  LVE +A  D+ LM  YL G+E+S+ +IK+ I+ G +     P+LCGS+FKNKG++ LLDAV+D+LP+P +V   K    +   EV + +SDD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K+KKERV RL+KMH+  R +I+E+ AG+ICA +GLKDT TG+TL D+K  V LE M+F +PVI +AVEPKTKADQEKM +AL KLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  +G PQV+FRET       E KY KQSGGRGQYGHV I+ EP +   G+EFV++I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A KEA +  +PVLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P ++  EI+  +K
  S:     1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQIKQRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNNETMGAKYDVEE--IPSDLLERAKEYREKLVEAIAEQDEALMEKYLGGEELSVEEIKKGIKIGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKTEEEVFVKSSDDGEFAGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTLCDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREFKVEAEIGQPQVAFRETIRSSVSKEHKYAKQSGGRGQYGHVFIKLEPKEPGSGYEFVNEISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691
>gi|20808663|ref|NP_623834.1| translation elongation and release factors (GTPase) [Thermoanaerobacter tengcongensis MB4] >gi|27923767|sp|Q8R7V1|EFG_THETN Elongation factor G (EF-G) >gi|20517298|gb|AAM25438.1| Translation elongation and release factors (GTPases) [Thermoanaerobacter tengcongensis MB4] (690 aa)
Score = 2165, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L   RN GIMAHIDAGKTTT+ERILF++G+ HK+GE H+G + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLR+LDGA+AV  A+ GVEPQ+ETVWRQA +Y VPRI +VNKMD  GA+F   +  I++RLG   V IQ+PIG E+ F GI+DLI+ +   +        +E  IP+  K   ++ R  L+E +A  D+ +M  YLEG+EI+  +I   +RKG I  +  PV+CGS++KNKG++ LLDA+V++LPSP+D+P  K    DG E L    DD  PF  LAFK+  DP+VG+L F RVYSG LK+GSYV N  K KKER+ R+++MHA +R EI+ +  GDI A +GLKDTTTG+TL D+   + LE+M F +PVIS+A+EPKTKA QEKMSIALSKLAEEDPTFKT+TD ETGQTIIAGMGELHL+I+VDR+RREF VE NVG PQV+++ET  K   VEGK+I+QSGGRGQYGHV +  EP  + +G+ F ++IVGG IP+E+I  V AG++ AM +G L GYP+ID+K  L DGS+HEVDSS+MAFKIA S+A +E  K   PVLLEPIM +EV VPE+Y GD +GD+++RRG +EG E R   +VI+A VPL EMFGYATDLRS +QGRG Y MQF HY E PK++  +I++ KK
  S:     1 MPRDFSLDKVRNIGIMAHIDAGKTTTTERILFYTGKTHKLGEVHEGTATMDWMVQEQERGITITSAATTCYWKGHKINIIDTPGHVDFTVEVERSLRILDGAVAVFSAKEGVEPQSETVWRQADKYHVPRIAYVNKMDVIGADFFNVIDMIRERLGANPVAIQIPIGKEDTFRGIVDLIKMEAIIYKDDLGTVMDETEIPEDLKPLAEEYREKLLEAIAEVDETIMEKYLEGEEITEEEIHAALRKGTINGELVPVVCGSSYKNKGVQPLLDAIVNYLPSPLDLPPVKGMSIDGGEELERKPDDNEPFSALAFKIMADPYVGKLAFFRVYSGTLKAGSYVLNSTKGKKERIGRILRMHANHREEIDAVYTGDIAAAVGLKDTTTGDTLCDENHPILLESMDFPEPVISVAIEPKTKAAQEKMSIALSKLAEEDPTFKTYTDQETGQTIIAGMGELHLEIIVDRLRREFNVECNVGKPQVAYKETITKPVRVEGKFIRQSGGRGQYGHVWLEMEPAPRGEGYIFENRIVGGVIPKEFIPAVDAGIQEAMQNGVLGGYPVIDVKVALVDGSYHEVDSSDMAFKIAGSIAFREGMKKADPVLLEPIMKVEVVVPEEYMGDVIGDLNARRGKVEGMETRSGARVIRAFVPLAEMFGYATDLRSKTQGRGTYTMQFHHYEEVPKNIAEQILSAKK 690
>gi|19704888|ref|NP_602383.1| protein translation elongation factor G (EF-G) [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|27923766|sp|Q8R602|EFG_FUSNN Elongation factor G (EF-G) >gi|19712779|gb|AAL93682.1| Protein Translation Elongation Factor G (EF-G) [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (693 aa)
Score = 2164, Expect = 0.0e+00, Identities = 405/683 (59%), Positives = 512/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR + L   RN GIMAHIDAGKTTT+ERILF++G   K+ E H+G++ MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A  GV+PQ+ETVWRQA +Y+VPR+ F NKMD+ GANF+  V  I+++LG   VPIQ+PIGAE+ F G++DLIE K  V+  D  + +  + K I  + K++ ++ R +++E +   DD LM  +  G+EI+  +I + +RK  I     PV+CG+AFKNKGI+ LLDA+V+++P+P DV   +       +VLI    SDDAPF  LAFKV TDPFVGRLTF RVYSG ++ G+ V N  K KKER+ R+++MHA NR EIE +  GDI A +GLKDT TG+TL  +   + LE M+F +PVIS+AVEPKTK DQEKM IALSKLAEEDPTFK  TD ETGQTII+GMGELHL+I+VDRM+REFKVE NVG PQV++RET  +  + E KY KQSGGRGQYGHVKI  EPN  K FEFV+KI GG IPREYI  V+ G + A+ SG +AGYP++D+K TL+DGS+HEVDSSEMAFKIA S+ALK+A     PV+LEP+  +EVT PE+Y GD +GD++SRRG++ G   R+  ++I AKVPL EMFGYATDLRS SQGR  Y  +FS Y + P S+  +I
  S:     1 MARKISLDMTRNVGIMAHIDAGKTTTTERILFYTGVERKLKEVHEGQATMDWMEQEQERGITITSAATTCFWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFSAVDGVQPQSETVWRQADKYKVPRLAFFNKMDRIGANFDMCVSDIKEKLGSNPVPIQIPIGAEDQFEGVVDLIEMKEIVWPVDSDQGQHFDVKDIRAELKEKAEETRQYMLESIVETDDALMEKFFGGEEITKEEIIKGLRKATIDNTIVPVVCGTAFKNKGIQALLDAIVNYMPAPTDVAMVEGRDPKNPDVLIDREMSDDAPFAALAFKVMTDPFVGRLTFFRVYSGFVEKGATVLNSTKGKKERMGRILQMHANNREEIEHVYCGDIAAAVGLKDTATGDTLCAENAPIVLEQMEFPEPVISVAVEPKTKNDQEKMGIALSKLAEEDPTFKVRTDEETGQTIISGMGELHLEIIVDRMKREFKVESNVGKPQVAYRETITQSCDQEVKYAKQSGGRGQYGHVKIILEPNPGKEFEFVNKITGGVIPREYIPAVEKGCKEALESGVIAGYPLVDVKVTLYDGSYHEVDSSEMAFKIAGSMALKQAATKAKPVILEPVFKVEVTTPEEYMGDIIGDLNSRRGMVSGMIDRNGAKIITAKVPLSEMFGYATDLRSKSQGRATYSWEFSEYLQVPASIQKQI 687
>gi|167036798|ref|YP_001664376.1| translation elongation factor G [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039517|ref|YP_001662502.1| translation elongation factor G [Thermoanaerobacter sp. X514] >gi|166853757|gb|ABY92166.1| translation elongation factor G [Thermoanaerobacter sp. X514] >gi|166855632|gb|ABY94040.1| translation elongation factor G [Thermoanaerobacter pseudethanolicus ATCC 33223] (689 aa)
Score = 2164, Expect = 0.0e+00, Identities = 403/687 (58%), Positives = 518/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R   L   RN GIMAHIDAGKTTT+ERILF++G++HK+GE H+G + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLR+LDGA+AV  A+ GVEPQ+ETVWRQA +Y VPRI +VNKMD  GA+F   ++ I++RLG   V IQ+PIG E+ F GI+DLI+ +   ++       +E  IPD  KD  ++ R  L+E V+  D+ ++  YLEG+EI+  +I + +RKG I  +  PV+CGS++KNKGI+ +LDA+V +LPSP+D+P  K      G E+   A D  PF  LAFK+  DP+VG+L F RVYSG L +GSYV N  K KKER+SR+++MHA +R E+E +  GDI A +GLKDTTTG+TL D+   + LE+M F +PVIS+A+EPKTKA QEKM+ AL KLAEEDPTFKT+TD ETGQTIIAGMGELHL+I+VDR+RREF V+ NVG PQV+++ET  K  ++EGK+I+QSGGRGQYGHV +  EP  + +G+ F ++IVGG IP+EYI  V AG++ AM +G L GYP+ID+K  L DGS+HEVDSS+MAFKIA S+A KE  K  +PVLLEPIM +EV VPE+Y GD +GDI++RRG +EG E R   QVI+A VPL EMFGYATDLRS +QGRG Y MQF HY E PK++ ++I+  K
  S:     1 MPRDYSLDKVRNIGIMAHIDAGKTTTTERILFYTGKVHKLGEVHEGTATMDWMVQEQERGITITSAATTCYWKGHKINIIDTPGHVDFTVEVERSLRILDGAVAVFSAKEGVEPQSETVWRQADKYHVPRIAYVNKMDIIGADFFNVIKMIKERLGANPVAIQIPIGKEDTFRGIVDLIKMEAIIYEDDLGTVMDETEIPDDLKDLAEEYREKLLEAVSEQDETILEKYLEGEEITEEEIHKALRKGTINGELVPVVCGSSYKNKGIQPMLDAIVRYLPSPLDLPPVKGMALATGEEIERKADDSEPFSALAFKIMADPYVGKLAFFRVYSGTLNAGSYVLNSTKGKKERISRILQMHANHRQEMEAVYTGDIAAAVGLKDTTTGDTLCDENHPILLESMDFPEPVISVAIEPKTKAAQEKMTTALLKLAEEDPTFKTYTDQETGQTIIAGMGELHLEIIVDRLRREFNVDCNVGKPQVAYKETITKPVKIEGKFIRQSGGRGQYGHVWLEMEPAPRGEGYTFENRIVGGVIPKEYIPAVDAGVQEAMQNGVLGGYPVIDVKVALVDGSYHEVDSSDMAFKIAGSIAFKEGMKKANPVLLEPIMKVEVVVPEEYMGDIIGDINARRGRVEGMEARAGAQVIRAFVPLAEMFGYATDLRSKTQGRGTYTMQFHHYEEVPKNIADQILEKK 689
>gi|15645809|ref|NP_207986.1| elongation factor G [Helicobacter pylori 26695] >gi|2494251|sp|P56002|EFG_HELPY Elongation factor G (EF-G) >gi|2314354|gb|AAD08239.1| translation elongation factor EF-G (fusA) [Helicobacter pylori 26695] (692 aa)
Score = 2164, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 514/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VPI +PIGAE+ F G+IDL++ K   ++    G +   EE  IP    ++ K+ R  LVE VA  D+ LM  YL G+E+SI +IK+ I+ G +     P+LCGS+FKNKG++ LLDAV+D+LP+P +V   K    +   EV + +SDD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K+KKERV RL+KMH+  R +I+E+ AG+ICA +GLKDT TG+TL D+K  V LE M+F +PVI +AVEPKTKADQEKM +AL KLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  +G PQV+FRET       E KY KQSGGRGQYGHV I+ EP +   G+EFV++I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A KEA +  +PVLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P ++  EI+  +K
  S:     1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQIKLRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNNETMGAKYDVEE--IPSDLLEKAKEYREKLVEAVAEQDEALMEKYLGGEELSIEEIKKGIKAGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKTEEEVFVKSSDDGEFAGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTLCDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREFKVEAEIGQPQVAFRETIRSSVSKEHKYAKQSGGRGQYGHVFIKLEPKEPGSGYEFVNEISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691
>gi|91070537|gb|ABE11443.1| elongation factor G [uncultured Prochlorococcus marinus clone HOT0M-5C8] (691 aa)
Score = 2163, Expect = 0.0e+00, Identities = 405/688 (58%), Positives = 513/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +  Q I+ RL   A PIQLPIGAE D  GIIDL+  K Y +        EE PIP+  KD+  + R+ L+E VA  D+QL+  +L+  E++   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDV   +    +G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL +    + LE +   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+  TD ET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  PE + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II+  +
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNQQIKDRLKANAFPIQLPIGAEGDLTGIIDLVSNKAYLYKNDLGTDIEEAPIPEDMKDEAMEWRSKLMESVAENDEQLIEIFLDKGELTEDQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVKPIQGVLPNGKEDIRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCNTDAPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALQALSEEDPTFRVSTDQETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVVIEMEPAEVGKGFEFVNKIVGGTVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPEDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAIISKNQ 688
>gi|160878395|ref|YP_001557363.1| translation elongation factor G [Clostridium phytofermentans ISDg] >gi|189027852|sp|A9KRZ3.1|EFG_CLOPH Elongation factor G (EF-G) >gi|160427061|gb|ABX40624.1| translation elongation factor G [Clostridium phytofermentans ISDg] (705 aa)
Score = 2163, Expect = 0.0e+00, Identities = 404/686 (58%), Positives = 516/686 (75%)
  Q:     2 ARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK------------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
            R   L   RN GIMAHIDAGKTT SERIL+++G  +KIG+TH+G + MDWMEQE+ERGITITSAAT+  W                +NLIDTPGHVDFTVEVERSLRVLD A+ V  A+ GVEPQ+ETVWRQA +Y VPR+ FVNKMD +GANF   V  I+ RLG  AVPIQLPIG E+ F G+IDL E K Y++   K E+ E K IPD  KDQ ++ RA ++E +   DD L+  +LEG E S  ++K+ +R   I  Q  PVLCGSA++NKG++ LLDAV++F+P+P D+   K + E+GNE+   +SD+ PF  LAFK+  DPFVG+L F RVYSG L +GSYV N  KNKKERV R+++MHA  R +++++ +GDI A +G K T+TG+T+ D+K  V LEAM+F +PVI +A+EPKTKA Q+KM  AL+KLAEEDPTF+  T+ ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++E F KE +++ KY KQSGGRGQYGH K++F P   N +K FEFV  +VGG IP+EYI  VQAG+E+AM  G L GYP++ ++A  +DGS+HEVDS+EMAFKIA S+A K+A     P+LLEPIM +EVTVP+ Y GD +GDISSRRG IEGTE  +  ++I+  VPL EMFGY+T LRS +QGRG Y M FS Y   PK+V  ++++ K
  S:     3 GREYPLERTRNIGIMAHIDAGKTTLSERILYYTGVNYKIGDTHEGTATMDWMEQEQERGITITSAATTCHWTLELEHKKAPGALEHRINLIDTPGHVDFTVEVERSLRVLDSAVGVFCAKGGVEPQSETVWRQADKYNVPRMAFVNKMDISGANFFNVVDMIKSRLGKNAVPIQLPIGKEDTFKGVIDLFEMKAYYYLDDKGEQIEIKEIPDDMKDQAEEYRAAMIESICETDDDLIEAFLEGNEPSNEELKKALRNATISVQIIPVLCGSAYRNKGVQKLLDAVIEFMPAPTDIEDIKGFDEEGNEIHRISSDEEPFAALAFKIMADPFVGKLAFFRVYSGTLNAGSYVLNATKNKKERVGRILQMHANKREDLDKVYSGDIAAAVGFKFTSTGDTICDEKHPVVLEAMEFPEPVIDVAIEPKTKAGQDKMGEALAKLAEEDPTFRVRTNEETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKEGFTKEVDIDSKYAKQSGGRGQYGHCKVKFSPMDVNGEKVFEFVSTVVGGAIPKEYIPAVQAGIEDAMKCGVLGGYPVLGVRANCYDGSYHEVDSNEMAFKIAGSMAFKDAMHKAGPILLEPIMRVEVTVPDDYMGDVIGDISSRRGRIEGTEDNNGSKIIRGFVPLSEMFGYSTTLRSKTQGRGAYSMFFSTYEPVPKNVQEKVLSNK 703
>gi|188584833|ref|YP_001916378.1| translation elongation factor 2 (EF-2/EF-G) [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349520|gb|ACB83790.1| translation elongation factor 2 (EF-2/EF-G) [Natranaerobius thermophilus JW/NM-WN-LF] (691 aa)
Score = 2163, Expect = 0.0e+00, Identities = 398/684 (58%), Positives = 518/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-----GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R   L   RN GIMAHIDAGKTTT+ERILF++GR+HK+GETHDG S MD+M+QE+ERGITITSAAT+  W++  +N+IDTPGHVDFTVEVERSLRVLDGAI V  A+ GVEPQ+ETVW QA RY VPRI ++NKMD  GA+F   V  + +RL    VPIQLPIG E+DF GI+DLI+     +      + EE  IP+  ++  ++ R  ++E  A +D++LM  YLEG+EI+  +I+  +R+G +  +  PVLCGS++KNKG+++LL+AV+D+LP+P DVP  +        E+  E  +S SDD PF  LAFK+ TDP+VG+L F RVYSG +++GSYV N  K KKERV R+++MHA +R E   +  GDI A +GLK+T+TGETL   +  + LE+MQF +PVIS+A+EPKT+ADQEKM+ +L KL+EEDPTF+T TD ETGQTII GMGELHL+++VDR+ REFKVE NVG PQV+++ET    ++ EGK+I+QSGGRGQYGHV I  EP  +  G+EF DKIVGG IP+EYI  V  G++ AM +G LAGYPM+D+K TL+DGS+HEVDS+E AFKIA S+A K+  K  SPV+LEPIM +E+ VPE+Y GD MGD++SRRG IEG E+R   ++I++ VPL EMFGYAT LRS +QGRG Y M+FSHY E P S+  E++
  S:     1 MTRKFPLEQTRNIGIMAHIDAGKTTTTERILFYTGRVHKLGETHDGASTMDFMDQEQERGITITSAATTCQWRDTRVNIIDTPGHVDFTVEVERSLRVLDGAIGVFCAKGGVEPQSETVWHQADRYHVPRIAYINKMDIMGADFYNVVDMMNERLQANPVPIQLPIGKEDDFQGIVDLIKNTAVIYKDDLGTEWEEVEIPEDMQELAEEYRDKMLEMAAEYDEELMMKYLEGEEITSEEIRLALREGCLKTELTPVLCGSSYKNKGVQMLLNAVIDYLPAPTDVPPIEGVVPGKEDEEEKEQRVS-SDDEPFSALAFKIVTDPYVGKLCFFRVYSGKIEAGSYVYNPVKGKKERVGRILQMHANHREERNVVYTGDIAAAVGLKNTSTGETLCSPEKPIVLESMQFPEPVISVAIEPKTRADQEKMATSLQKLSEEDPTFQTHTDDETGQTIIKGMGELHLEVIVDRLLREFKVEANVGKPQVAYKETIKAPTKSEGKFIRQSGGRGQYGHVLIEMEPLERGAGYEFEDKIVGGVIPKEYIPAVDNGIQEAMQNGVLAGYPMVDVKITLYDGSYHEVDSNESAFKIAGSMAFKDGSKKASPVILEPIMKVEIVVPEEYMGDVMGDVNSRRGRIEGMEERSGSRLIRSYVPLAEMFGYATQLRSTTQGRGTYTMEFSHYDEVPDSIAKELM 689
>gi|166367018|ref|YP_001659291.1| elongation factor G [Microcystis aeruginosa NIES-843] >gi|166089391|dbj|BAG04099.1| elongation factor EF-G [Microcystis aeruginosa NIES-843] (682 aa)
Score = 2163, Expect = 0.0e+00, Identities = 401/679 (59%), Positives = 513/679 (75%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
            RN GI AHIDAGKTTT+ERILF++G  HK+GE HDG ++ DWMEQE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG +AV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGANF +  + ++ RL   AVPIQ+PIGAE++ +GI+DL++ + Y +     +  EE  IP+   ++ ++ R  LVE VA  D++L+  YLEG+E++ A+IKR +R+G I     PVLCGSAFKNKG++LLLDAVVD+LPSP +V   K    DG+E +  A DDAPF  LAFK+  DPF GRLTF+RVYSGVL  GSY  N  K  KER++RL+ + +  R E++E+RAGD+ A IGLK+T TG+TL DDK  + LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTF+   DPET QT+IAGMGELHL+ILVDRM RE+KVE  VGAPQV++RET  K    EGK+I+QSGG+GQYGHV I  EP +   GF FV KIVGG IP+EYI P + G++ A  SG +AGYP+ID+KATL DGSFH+VDSSEMAFKIA S+A+KEA    +PVLLEP+M +EV VPE + G+ +GD++SRRG IEG E    +  + AKVPL EMFGYATD+RS +QGRG + M+FSHY E P++V   II   K
  S:     1 MRNIGIAAHIDAGKTTTTERILFYTGVAHKLGEVHDGTAITDWMEQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVVAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFFKVYEQLRDRLRTNAVPIQMPIGAESELSGIVDLVKMRAYIYKDDLGKDIEETDIPEDLLEKAEEFRVQLVEAVAEADEELLEKYLEGEELTEAEIKRGLREGTIAGTIVPVLCGSAFKNKGVQLLLDAVVDYLPSPSEVAAVKGILPDGSEAIREAKDDAPFSALAFKIMADPF-GRLTFLRVYSGVLAKGSYAYNSTKGTKERIARLIILKSNERIEVDELRAGDLGAAIGLKNTITGDTLCDDKNPIILESLFIPEPVISVAVEPKTKQDIEKLSKALQALSDEDPTFRVKVDPETNQTVIAGMGELHLEILVDRMLREYKVEATVGAPQVAYRETVRKPVRAEGKFIRQSGGKGQYGHVVIELEPGEPGSGFVFVSKIVGGAIPKEYISPSEQGMKEACESGIVAGYPVIDLKATLVDGSFHDVDSSEMAFKIAGSMAIKEAVMKATPVLLEPMMKVEVEVPEDFIGNVIGDLNSRRGQIEGQETETGIAKVSAKVPLAEMFGYATDIRSKTQGRGIFTMEFSHYEEVPRNVAETIITKSK 679
>gi|196190718|gb|EDX85682.1| translation elongation factor G [Synechococcus sp. PCC 7335] (691 aa)
Score = 2162, Expect = 0.0e+00, Identities = 402/688 (58%), Positives = 512/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L + RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWMEQEKERGITIT+AA S +W+   +N+IDTPGHVDFT+EVERS+RVLDG +AV  +  GV+PQ+ETVWRQA RY+VPRI FVNKMD+TGA+F +  + ++ RL  KA+PIQ+PIGAE+ F G++DL++ K + ++       +   IP++ + Q ++ R  LVE +A  +D LM  YLEG+E S   + + IR+  I     P+LCGSAFKNKG++LLLD VVD+LPSP +VP  +    +G   +  ASD+ P   LAFK+  DP+ GRLTF+RVYSGVLK GSYV N  K+KKER+SRL+ + A  R E+EE+RAGD+ A +GLKDT TG+T+ D    + LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTFK   D ET QT+IAGMGELHLDILV+RM REFKVE N+GAPQV++RET  K S  E K+I+QSGG+GQYGHV I  EP +   GFEF+ KIVGG IPRE+I P + G++ A  SG LAGYP+ID+K TL DGS+H+VDSSEMAFKIA S+A+KEA    SPVLLEP+M +EV  PE + GD MGD++SRRG IEG      V  + ++VPL EMFGYATD+RS +QGRG++ M+FS Y E P++V   IIA  K
  S:     1 MARTISLKDVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGNAVTDWMEQEKERGITITAAAISTTWREHQINIIDTPGHVDFTIEVERSMRVLDGVVAVFCSVGGVQPQSETVWRQADRYKVPRIAFVNKMDRTGADFFKVYEQVKDRLKAKAIPIQIPIGAEDQFRGVVDLVQMKAHIYENDLGTDIQVTDIPEEMRSQAEEYRTLLVEAIAETNDDLMERYLEGEEFSADVLMKGIRQATIKDNLVPMLCGSAFKNKGVQLLLDGVVDYLPSPPEVPAIEGILPNGETGVRPASDETPAAALAFKIMADPY-GRLTFIRVYSGVLKKGSYVYNATKDKKERISRLIILKADERTEVEEMRAGDLGAALGLKDTFTGDTICDPDAPIVLESLYIPEPVISVAVEPKTKQDMEKLSKALQSLSEEDPTFKVSIDSETNQTVIAGMGELHLDILVNRMLREFKVEANIGAPQVAYRETVLKPSTAESKFIRQSGGKGQYGHVVIELEPGEQGSGFEFISKIVGGTIPREFIGPAEQGMKEACGSGILAGYPLIDVKVTLVDGSYHDVDSSEMAFKIAGSMAVKEAVMKASPVLLEPMMKVEVEAPEDFLGDVMGDLNSRRGQIEGMGSESGVTKVTSRVPLAEMFGYATDIRSKTQGRGSFSMEFSQYEEVPRNVAEAIIARNK 688
>gi|126697038|ref|YP_001091924.1| elongation factor G [Prochlorococcus marinus str. MIT 9301] >gi|166220158|sp|A3PEZ8.1|EFG_PROM0 Elongation factor G (EF-G) >gi|126544081|gb|ABO18323.1| Elongation factor G [Prochlorococcus marinus str. MIT 9301] (691 aa)
Score = 2161, Expect = 0.0e+00, Identities = 403/685 (58%), Positives = 514/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM+QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +  + I+ RL   A+PIQLPIGAE D  GIIDL+  K Y +        EE PIP + +++  + R  L+E VA  D++L+  +LE  E+S   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDV   +     G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL +    + LE +   +PVIS+AVEPKTK D EK+S AL+ L+EEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  P+ + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II+
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMDQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNKQIKDRLKANALPIQLPIGAEGDLTGIIDLVANKAYLYKNDLGTDIEEAPIPSEMEEEAAEWRNKLMESVAENDEELIEIFLETGELSTEQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVKPIQGVLPSGKEDVRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCNTDDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALTALSEEDPTFRVSTDPETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVIIEMEPAEVGKGFEFVNKIVGGAVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPDDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAIIS 685
>gi|113955109|ref|YP_729614.1| elongation factor G [Synechococcus sp. CC9311] >gi|119368777|sp|Q0ID58|EFG_SYNS3 Elongation factor G (EF-G) >gi|113882460|gb|ABI47418.1| translation elongation factor G [Synechococcus sp. CC9311] (691 aa)
Score = 2161, Expect = 0.0e+00, Identities = 401/688 (58%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW N  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   AVPIQLPIGAE + +GIIDL+E K + +     +  E   +P   KD+  + R  L+E +A  D+ L+  +LE  E+S +D+KR IR GV+     PVLCGSAFKNKG++L+LDAVVD+LP+P+DVP  +    +G E +  + D+APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K+ KER+SRLV + A +R E++ +RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP + + GFEF++KIVGG +P+EYIKP + G++    SG +AGYP+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+A K C+PVLLEP+M +EV +PE + G  +GD+SSRRG +EG    D    + +KVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+  +
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWNNHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVFGQIKDRLKANAVPIQLPIGAEGELSGIIDLVENKAHIYKDDLGQDIEVTDVPADMKDEADKWRNVLMETIAENDEDLIEKFLESGELSNSDLKRGIRTGVLKHNLVPVLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPIQGLLPNGKEAVRPSDDNAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVLNSTKDTKERISRLVVLKADDREEVDALRAGDLGAVLGLKNTTTGDTLCATDDPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVRTDQETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRGSSKGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFEFINKIVGGIVPKEYIKPAEQGMKETCESGVIAGYPLIDVKCTMVDGSYHDVDSSEMAFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEIPEDFLGSVIGDLSSRRGQVEGQSVDDGTSKVSSKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQ 688
>gi|53803545|ref|YP_114791.1| elongation factor G [Methylococcus capsulatus str. Bath] >gi|62286520|sp|Q605A9|EFG2_METCA Elongation factor G 2 (EF-G 2) >gi|53757306|gb|AAU91597.1| translation elongation factor G [Methylococcus capsulatus str. Bath] (698 aa)
Score = 2160, Expect = 0.0e+00, Identities = 402/684 (58%), Positives = 514/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEE-KAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  +  +RN GIMAHIDAGKTTT+ERILF++G  HKIGE HDG ++MDWMEQE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGA A+  A  GVEPQ+ETVWRQA +Y VPR+ FVNKMD+ GA+F R V  I+ RLG   VP+QLPIGAE++F G++DL+  K  ++D   +  +     +P +        R  +VE  A   + LM  YLEG E+++ +IKR +R   +  +  PVLCGSAFKNKG++ +LDAVVD+LPSPVD P     GE G E    + D+A F  LAFK+ATDP+VG LTF+RVYSGVL SG  V N  K+++ER+ RLV+MHA NR E++E+RAGDI A IGLKD TTG+TL D K  + LE M+F +PVIS+AVEPKTKADQEKM IAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM+REF V+ NVGAPQV++RET  K  E EGKY++Q+GGRGQYGHV +R EP +   G+EFV+ IVGG +P+EYI  V  G++  + +G LAG+P++D++ TLFDGS+H+VDSSEMAFKIA S+A KE  +  SPVLLEPIM +EV  PE+Y GD +GDI+ RRG+++G ++    +VI+ +VPL EMFGYATDLRS +QGR  Y M F  Y E P  V + +I
  S:     1 MARTTPIERYRNIGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGAAIMDWMEQEQERGITITSAATTCFWRGMDGSFPEYRINIIDTPGHVDFTIEVERSLRVLDGACAIFCAVGGVEPQSETVWRQADKYGVPRLAFVNKMDRAGADFLRVVDQIRSRLGGSPVPVQLPIGAEDEFKGVVDLLRMKAIWWDDSTQGMRFSLGDVPAEMVAACVAWREKMVEAAAEASEDLMEKYLEGGELTVEEIKRGLRVRTLANEIVPVLCGSAFKNKGVQAMLDAVVDYLPSPVDTPPVVGIGEGGLESSRKSCDNASFSALAFKIATDPYVGVLTFIRVYSGVLSSGDTVYNPVKDRRERIGRLVQMHANNREEVKEVRAGDIAAAIGLKDVTTGDTLCDPKDVITLERMEFPEPVISVAVEPKTKADQEKMGIALNKLAQEDPSFRVRTDEESGQTIISGMGELHLEIIVDRMKREFGVDANVGAPQVAYRETIRKAVEQEGKYVRQTGGRGQYGHVWLRIEPLDPGGGYEFVNGIVGGVVPKEYIPAVDKGIQEQLQNGVLAGFPVVDVRVTLFDGSYHDVDSSEMAFKIAGSMAFKEGARKASPVLLEPIMKVEVVTPEEYMGDVVGDINRRRGIVQGMDEVPAGKVIRCEVPLSEMFGYATDLRSATQGRATYSMHFEKYVEAPTHVADAVI 693
>gi|116075712|ref|ZP_01472971.1| elongation factor EF-2 [Synechococcus sp. RS9916] >gi|116067027|gb|EAU72782.1| elongation factor EF-2 [Synechococcus sp. RS9916] (691 aa)
Score = 2159, Expect = 0.0e+00, Identities = 405/685 (59%), Positives = 515/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   AVPIQLPIGAE + +GIIDL+E K + +     +  E   +P   +DQV++ R  L+E VA  D+ L+  +LE  E+S  ++K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDVP  +    DG E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K +KER+SRLV + A +R E++ +RAGD+ A++GLK TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP + + GFEFV+KIVGG +P+E+IKP + G++    SG +AG+PMIDIK T+ DGS+H+VDSSEMAFKIA S+A K+A K C+PVLLEP+M +EV VPE++ G  +GD+SSRRG +EG    D    + AKVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWNDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAVPIQLPIGAEGELSGIIDLVENKAHIYKDDLGQNIEVTEVPADMQDQVEEWRNVLMEAVAETDEALIEKFLESGELSTEELKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVPPIQGVLPDGKEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVLNSTKGEKERISRLVVLKADDREEVDALRAGDLGAVLGLKATTTGDTLCSADDPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVALAEEDPTFRVNTDAETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASSKGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFEFVNKIVGGVVPKEFIKPSEMGMKETCESGVIAGFPMIDIKVTMVDGSYHDVDSSEMAFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEVPEEFLGSIIGDLSSRRGQVEGQAIDDGTSKVSAKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIIS 685
>gi|33862065|ref|NP_893626.1| elongation factor G [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|46576260|sp|Q7UZY6|EFG_PROMP Elongation factor G (EF-G) >gi|33634283|emb|CAE19968.1| Elongation factor G [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (691 aa)
Score = 2159, Expect = 0.0e+00, Identities = 403/688 (58%), Positives = 515/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +  Q I+ RL   A PIQLPIGAE D +GIIDL+  K Y +        EE PIPD+ KD+  + R+ L+E VA  D++L+  +L+  E++   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+P+DV   +    +G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL +    + LE +   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+  TD ET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  P+ + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II+  +
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNQQIKDRLKANAFPIQLPIGAEGDLSGIIDLVSNKAYLYKNDLGTDIEEAPIPDEMKDEALEWRSKLMESVAENDEELIEIFLDKGELTEDQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPIDVKPIQGVLPNGKEDVRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCNTDDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALQALSEEDPTFRVSTDQETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVVIEMEPAEVGKGFEFVNKIVGGTVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPDDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAIISKNQ 688
>gi|123969244|ref|YP_001010102.1| elongation factor G [Prochlorococcus marinus str. AS9601] >gi|166220162|sp|A2BT84.1|EFG_PROMS Elongation factor G (EF-G) >gi|123199354|gb|ABM70995.1| Elongation factor G [Prochlorococcus marinus str. AS9601] (691 aa)
Score = 2158, Expect = 0.0e+00, Identities = 403/685 (58%), Positives = 514/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +  + I+ RL   A+PIQLPIGAE D  GIIDL+  K Y +        EE PIP + +++  + R  L+E VA  D++L+  +LE  E+S   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDV   +     G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL + +  + LE +   +PVIS+AVEPKTK D EK+S AL+ L+EEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  P+ + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II+
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNKQIKDRLKANALPIQLPIGAEGDLTGIIDLVANKAYLYKNDLGTDIEEAPIPSEMEEEAAEWRFKLMESVAENDEELIEIFLETGELSEEQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVKPIQGVLPSGKEDIRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCNTEDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALTALSEEDPTFRVSTDPETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVIIEMEPAEVGKGFEFVNKIVGGAVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPDDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAIIS 685
>gi|78779985|ref|YP_398097.1| elongation factor G [Prochlorococcus marinus str. MIT 9312] >gi|119368751|sp|Q318N4|EFG_PROM9 Elongation factor G (EF-G) >gi|78713484|gb|ABB50661.1| translation elongation factor 2 (EF-2/EF-G) [Prochlorococcus marinus str. MIT 9312] (691 aa)
Score = 2158, Expect = 0.0e+00, Identities = 403/684 (58%), Positives = 511/684 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   A+PIQLPIGAE D  GIIDL+  K Y +        +E PIP +  D+  + R  L+E VA  D++L+  +LE  E+S   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDV   +     G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL + +  + LE +   +PVIS+AVEPKTK D EK+S AL+ L+EEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  P+ + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNNQIKDRLKANALPIQLPIGAEGDLTGIIDLVANKAYLYKNDLGTDIQEAPIPSEMDDEAAEWRYKLMESVAENDEELIETFLETGELSEEQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVKPIQGVLPSGKEDVRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCNTEDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALTALSEEDPTFRVSTDPETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVIIEMEPAEVGKGFEFVNKIVGGAVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPDDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAII 684
>gi|86608400|ref|YP_477162.1| elongation factor G [Synechococcus sp. JA-2-3B'a(2-13)] >gi|119368775|sp|Q2JMX8|EFG_SYNJB Elongation factor G (EF-G) >gi|86556942|gb|ABD01899.1| translation elongation factor G [Synechococcus sp. JA-2-3B'a(2-13)] (707 aa)
Score = 2157, Expect = 0.0e+00, Identities = 422/688 (61%), Positives = 523/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKN---------------CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKE-SEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MARTV L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA +  W                  ++N+IDTPGHVDFT+EVERS+RVLDG IAV D+  GV+PQ+ETVWRQA+RY VPRI FVNKMD+ GANF +    I++RL   AVPIQLPIGAE+ F GI+DL+  + ++Y  + GK+ +    PIP++ KD V + RA LVE VA  D+ LM  Y   +++S AD+   +RKG I  Q  P+LCGSAFKNKG+++LLDAVVD+LPSPVD+P  K    DG+EV   ASDD PF  LAFK+ +D + G LTF+RVYSGVL  G+YV N  KNKKER+SRLV + A  R +++E+RAGD+ A++GLKDTTTG+TL D+   V LE++   +PVIS+AVEPKTKAD +K+S AL  LA+EDPTF+   DPET QTII+GMGELHL+ILVDRM REF VE NVG PQV++RET  K  S VEGK+++QSGGRGQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G+  A  SG LAGYP+IDI+ATL DGS+HEVDSSEMAFKIA S+ALKEA +  SP LLEP+M +EV VPE + GD +GDI++RRG +EG      +  + AKVPL EMFGYATD+RS +QGRG + M+FSHY E P+S+   IIA  K
  S:     1 MARTVPLERVRNIGIAAHIDAGKTTTTERILFYSGLVHKIGEVHDGTAVTDWMAQERERGITITAAAITTRWTKRDPANPSQPLSGAPEYTINIIDTPGHVDFTIEVERSMRVLDGVIAVFDSVGGVQPQSETVWRQANRYNVPRIAFVNKMDRMGANFLKVYNQIRERLKANAVPIQLPIGAEDGFCGIVDLVRMQARIYMDEIGKDIRP--APIPEEMKDLVAEYRAKLVEAVAETDEALMEKYFAEEDLSEADLMAGLRKGTISGQIVPMLCGSAFKNKGVQMLLDAVVDYLPSPVDIPAIKGVLPDGSEVSRRASDDEPFSALAFKLMSDKY-GDLTFIRVYSGVLTKGTYVLNSTKNKKERISRLVVLKADERLDVDELRAGDLGAVVGLKDTTTGDTLCDENAPVILESLFIPEPVISVAVEPKTKADIDKLSKALQALAKEDPTFRVSVDPETNQTIISGMGELHLEILVDRMLREFNVEANVGNPQVAYRETIRKPVSRVEGKFVRQSGGRGQYGHVVIDLEPAEPGTGFEFVSKIVGGVVPKEYIGPAEQGIREACESGVLAGYPLIDIRATLVDGSYHEVDSSEMAFKIAGSMALKEAARRASPTLLEPMMKVEVEVPEAFVGDVIGDINARRGQMEGMNTEGGITKVNAKVPLAEMFGYATDIRSKTQGRGTFTMEFSHYEEVPRSIAEAIIAKNK 704
>gi|158334958|ref|YP_001516130.1| elongation factor G [Acaryochloris marina MBIC11017] >gi|158305199|gb|ABW26816.1| translation elongation factor G [Acaryochloris marina MBIC11017] (691 aa)
Score = 2157, Expect = 0.0e+00, Identities = 396/688 (57%), Positives = 511/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR+V L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE HDG +V DWM+QE+ERGITIT+AA S +W++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI+FVNKMD+TGANF R    I+ RL   AV +QLPIG+E+ F GI+DL+  K + +   +    +E  IP+  ++Q ++ R  LVE VA  DD LM  YLEG+ +S  +IK  +R+G I     P+LCGSAFKNKG++LLLDAV+D++P+P+DVP  +    DG E    A D+ P   LAFKV +DP+ GRLTF+RVYSGVL  GSY+ N  KNKKERVSRL+ M A +R E++E+RAGD+ A +GLKDT TGETL +    + LE++   +PVIS+AVEPKTK D +K+S AL  L++EDPTF+   DPET QT+IAGMGELHL+IL+DRM REFKVE N+GAPQV++RET  K    EGK+++QSGG+GQYGHV +  EP ++  GFEF+ KIVGG +P+E+I P + G++ A  SG LAGYP+ID++ATL DGS+H+VDSSEMAFKIA S+A+KE     SP LLEP+M +EV VPE + G  MGD+ SRRG IEG E    +  +  KVPL  MFGYATD+RS +QGRG + M+F +Y + P++V   II   K
  S:     1 MARSVPLKKVRNIGIAAHIDAGKTTTTERILFYSGVVHKVGEVHDGNTVTDWMDQERERGITITAAAISTTWQDHQVNIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYQVPRIVFVNKMDRTGANFFRVYDQIRDRLKANAVAVQLPIGSEDKFQGIVDLVNMKAFIYTNDQGTDIQETEIPESIQEQAQEYRTLLVEAVAEADDALMEKYLEGESLSETEIKSALRRGTIAGTIVPMLCGSAFKNKGVQLLLDAVIDYMPAPIDVPAIQGTLLDGTEAERPADDEEPLAALAFKVMSDPY-GRLTFIRVYSGVLTKGSYILNPTKNKKERVSRLIIMKADDRIEVDELRAGDLGAALGLKDTFTGETLCNPAQPIVLESLFIPEPVISVAVEPKTKQDMDKLSKALQSLSQEDPTFRVSVDPETNQTVIAGMGELHLEILIDRMLREFKVEANIGAPQVAYRETIRKAVTAEGKFVRQSGGKGQYGHVVVEIEPAEEGTGFEFISKIVGGSVPKEFIGPAEQGMKEACESGILAGYPLIDVRATLVDGSYHDVDSSEMAFKIAGSMAIKEGVMQASPALLEPMMKVEVEVPEDFLGPVMGDLISRRGQIEGQEVAQGLAKVTTKVPLATMFGYATDIRSMTQGRGIFTMEFGNYEDVPRNVAEPIIEKNK 688
>gi|157414110|ref|YP_001484976.1| elongation factor G [Prochlorococcus marinus str. MIT 9215] >gi|166919591|sp|A8G709.1|EFG_PROM2 Elongation factor G (EF-G) >gi|157388685|gb|ABV51390.1| Elongation factor G [Prochlorococcus marinus str. MIT 9215] (691 aa)
Score = 2157, Expect = 0.0e+00, Identities = 403/685 (58%), Positives = 513/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +  + I+ RL   A+PIQLPIGAE D  GIIDL+  K Y +        EE PIP + +++  + R  L+E VA  D++L+  +LE  E+S   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDV   +     G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL +    + LE +   +PVIS+AVEPKTK D EK+S AL+ L+EEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  P+ + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II+
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNKQIKDRLKANALPIQLPIGAEGDLTGIIDLVANKAYLYKNDLGTDIEEAPIPSEMEEEAAEWRYKLMESVAENDEELIEIFLETGELSEEQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVKPIQGVLPSGKEDVRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCNTDDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALTALSEEDPTFRVSTDPETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVIIEMEPAEVGKGFEFVNKIVGGAVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPDDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAIIS 685
>gi|34762376|ref|ZP_00143378.1| Protein Translation Elongation Factor G (EF-G) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887958|gb|EAA25024.1| Protein Translation Elongation Factor G (EF-G) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (693 aa)
Score = 2156, Expect = 0.0e+00, Identities = 403/683 (59%), Positives = 513/683 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR V L   RN GIMAHIDAGKTTT+ERILF++G   KIGE H+G++ MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A  GV+PQ+ETVWRQA +Y+VPR+ F NKMD+ GANF+  V  I+++LG   VPIQ+PIGAE+ F GI+DLIE  E V+  D  + +  + K I  + +++ ++ R +++E +   DD LM  +  G+EI+  +I + +RK  I     PV+CG+AFKNK I+ LLDA+V+++P+P DV   +       ++LI    SD+APF  LAFKV TDPFVGRLTF RVYSG+++ G+ V N  K KKER+ R+++MHA  R EI+++  GDI A +GLKDTTTG+TL  +   + LE M+F +PVIS+AVEPKTK DQEKM IALSKLAEEDPTF+  TD ETGQTII+GMGELHL+I+VDRM+REFKVE NVG PQV++RET  +  + E KY KQSGGRGQYGHVKI  EPN  K FEFV+KI GG IPREYI  V+ G   A+ SG +AGYP++D+K TL+DGS+HEVDSSEMAFKIA S+ALK+A     PV+LEP+  +EVT PE+Y GD +GD++SRRG++ G   R+  ++I AKVPL EMFGYATDLRS SQGR  Y  +FS Y + P S+  +I
  S:     1 MARKVSLDMTRNVGIMAHIDAGKTTTTERILFYTGVERKIGEVHEGQATMDWMEQEQERGITITSAATTCFWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFSAVDGVQPQSETVWRQADKYKVPRLAFFNKMDRIGANFDMCVSDIKEKLGSNPVPIQIPIGAEDQFEGIVDLIEMKELVWPIDSDQGQHYDTKDIRAELQEKAEEARQYMLESIVETDDALMEKFFGGEEITKEEIIKGLRKATIDNTIVPVVCGTAFKNKCIQPLLDAIVNYMPAPTDVAMVEGRDPKNPDILIDREMSDEAPFASLAFKVMTDPFVGRLTFFRVYSGIVEKGATVLNSTKGKKERMGRILQMHANKREEIDQVYCGDIAAAVGLKDTTTGDTLCAEDAPIVLEQMEFPEPVISVAVEPKTKNDQEKMGIALSKLAEEDPTFRVRTDEETGQTIISGMGELHLEIIVDRMKREFKVESNVGKPQVAYRETITQSCDQEVKYAKQSGGRGQYGHVKIILEPNPGKEFEFVNKITGGVIPREYIPAVEKGCREALESGVIAGYPLVDVKVTLYDGSYHEVDSSEMAFKIAGSMALKQAATKSKPVILEPVFKVEVTTPEEYMGDIIGDLNSRRGMVSGMIDRNGAKIITAKVPLSEMFGYATDLRSKSQGRATYSWEFSEYLQVPASIQKQI 687
>gi|34556895|ref|NP_906710.1| elongation factor G [Wolinella succinogenes DSM 1740] >gi|46576244|sp|Q7MA53|EFG_WOLSU Elongation factor G (EF-G) >gi|34482610|emb|CAE09610.1| ELONGATION FACTOR G (FRAGMENT) [Wolinella succinogenes] (693 aa)
Score = 2155, Expect = 0.0e+00, Identities = 407/688 (59%), Positives = 514/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN----EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR + L   RN GI AHIDAGKTTT+ERILF++G  HK+GE HDG + MDWMEQEKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPR++FVNKMD+ GANF      I  RL  + VP+ +P+GAE+ F G+IDL++ K   + D     K + + IP    ++  + R  ++E  A  D+ LM  YL G+E++  +IKR ++ G       P+LCGS+FKNKG++ LLDAV+D+LP+P +V  A  +G D      E+ + +SD+  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K KKERV RL+KMHA  R +I+EI AG+ICA +GLK+T TG+TL  +K  V LE M+F +PVIS+AVEPKTKADQEKM IAL+KLAEEDP+F+  +D ETGQTII+GMGELHL+I+VDRM+REFKVE  VG PQV+FRET  K    E KY KQSGGRGQYGHV I+ EP +  KG+EFV+ I GG IP+EYI  V  G++ AM SG LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A K+A +  SPVLLEPIM +EV VPE Y GD +GD++ RRG I     R  ++VI A VPL EMFGY+TDLRS +QGRG Y M+FSHY E P ++  EII  +K
  S:     1 MARKIPLNRIRNIGIAAHIDAGKTTTTERILFYTGVSHKVGEVHDGAATMDWMEQEKERGITITSAATTCFWKDYQVNIIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRMVFVNKMDRIGANFYNVESQISDRLKARPVPVVIPVGAEDTFKGVIDLLQMKALIWNDETMGAKYDIEEIPADLVEKANEYREKMIEAAAEQDEALMEKYLNGEELTTEEIKRGLKIGCHAMAIIPMLCGSSFKNKGVQTLLDAVIDYLPAPTEV--ADIHGVDAKDETKEISVQSSDEGEFAGLAFKIMTDPFVGQLTFVRVYRGSLESGSYVYNSTKGKKERVGRLLKMHANKREDIKEIYAGEICAFVGLKETLTGDTLCSEKEPVILERMEFPEPVISIAVEPKTKADQEKMGIALNKLAEEDPSFRVNSDEETGQTIISGMGELHLEIIVDRMKREFKVEAEVGQPQVAFRETVRKAVNKECKYAKQSGGRGQYGHVFIKLEPQEAGKGYEFVNDISGGVIPKEYIPAVDKGIKEAMQSGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKDAAREASPVLLEPIMKVEVEVPEDYMGDVIGDLNRRRGQINSMGDRSGIKVINAFVPLAEMFGYSTDLRSATQGRGTYTMEFSHYGEVPGNISKEIIEKRK 692
>gi|110602375|ref|ZP_01390480.1| translation elongation factor G:Small GTP-binding protein domain [Geobacter sp. FRC-32] >gi|110546911|gb|EAT60232.1| translation elongation factor G:Small GTP-binding protein domain [Geobacter sp. FRC-32] (692 aa)
Score = 2155, Expect = 0.0e+00, Identities = 404/688 (58%), Positives = 512/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA----EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+ +W++  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F R V  I+ RL    VPIQLP+G E+ F GIIDL+  K   +D   EE      +E  IP    +  ++ R  ++EE+++ DD LM  Y+ G+E+S  +I   IRK  I  Q  PV+CGSAFKNKG++ LLDAV+D++P+P D+P  K    +  E +   A+D  PF  L FK+ TDPFVG+L F RVYSGVL SGSYV N  K K+ER+ R++KMHA  R EI+E+ AGDI A +GLK TTTG+TL  +   V LE+++F +PVIS+A+EPKTKADQEK+ ++L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ +VEGK+++QSGGRGQYGHV +  EP +  KG+EFVD I GG +PREYI  V  G++ AM +G +AG+P++D K +L DGS+HEVDSSEMAFKIA S+  KE     SPVLLEPIM++EV VPE Y GD +GD++SRRG I G E R   QV+ + VPL +MFGY+TDLRS +QGR  Y M F HY + PKSV  EI+A  K
  S:     1 MARLVSLEMTRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCNWRDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYGVPRIAFINKMDRIGADFFRGVSMIKDRLKANPVPIQLPVGKEDTFKGIIDLVTMKAIIWD---EESLGATFQETEIPAADLELAQEYREKMIEELSSHDDVLMEKYIGGEELSNEEIMAAIRKSTIAIQIIPVICGSAFKNKGVQNLLDAVIDYMPAPTDIPAIKGIDANTEEPIERKAADSEPFSALGFKIMTDPFVGQLCFFRVYSGVLNSGSYVYNATKGKRERIGRILKMHANKREEIKEVYAGDIAAAVGLKYTTTGDTLCVEDNPVILESIEFPEPVISIAIEPKTKADQEKLGLSLQKLASEDPSFRVKTDEETGQTIISGMGELHLEIIVDRLMREFKVEANVGKPQVAYRETITKKIKVEGKFVRQSGGRGQYGHVWLELEPQEPGKGYEFVDAIKGGVVPREYISSVDKGIQEAMDTGVMAGFPVVDFKVSLVDGSYHEVDSSEMAFKIAGSMGFKEGCSKASPVLLEPIMSVEVVVPEDYMGDVIGDLNSRRGRIMGMESRAGAQVVNSMVPLAQMFGYSTDLRSATQGRATYSMTFDHYEQVPKSVAEEIVAKVK 691
>gi|148243268|ref|YP_001228425.1| elongation factor G [Synechococcus sp. RCC307] >gi|166220182|sp|A5GW13.1|EFG_SYNR3 Elongation factor G (EF-G) >gi|147851578|emb|CAK29072.1| Elongation factor G [Synechococcus sp. RCC307] (691 aa)
Score = 2153, Expect = 0.0e+00, Identities = 399/688 (57%), Positives = 513/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S +W +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I  RL  KA PIQLPIGAE D +GIIDL+  K Y +        EE  IP    D+  + RA L+E VA  D++L+  +LE  E++ A++K+ IR GV+     P+LCGSAFKNKG++L+LDAVVD+LP+P+DVP  +    DG+E +  + D+APF  LAFKV  DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A +R E++++RAGD+ A++GLK+TTTG+TL D    + LE +   +PVIS+AVEPKTK D EK+S AL+ L+EEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP +   GFEF++KIVGG +P+E+IKP + G++    SG +AG+P+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D +  + AKVPL EMFGYAT LRS +QGRG + M+FS Y E P++V   II+  +
  S:     1 MPRDFPLDRVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTAWNDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVYGQIVDRLKAKAAPIQLPIGAEGDLSGIIDLVANKAYIYKNDLGTDIEEAEIPADMADEAAEWRAKLMESVAENDEELIEKFLETGELTEAELKKGIRDGVLKHGLVPMLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPIQGVLADGSEAVRPSDDNAPFSALAFKVMADPY-GKLTFVRMYSGVLSKGSYVMNSTKDVKERISRLVVLKADDREEVDQLRAGDLGAVLGLKNTTTGDTLCDPDNSIVLETLFIPEPVISVAVEPKTKGDMEKLSKALTSLSEEDPTFRVSTDEETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKFARQTGGKGQYGHVVIEMEPGEPGTGFEFINKIVGGAVPKEFIKPAEMGMKETCESGVIAGFPLIDVKCTMVDGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEVPEDFLGSIIGDLSSRRGQVEGQSIDDGISKVSAKVPLAEMFGYATQLRSMTQGRGIFSMEFSRYEEVPRNVAEAIISKNQ 688
>gi|167769919|ref|ZP_02441972.1| hypothetical protein ANACOL_01260 [Anaerotruncus colihominis DSM 17241] >gi|167667910|gb|EDS12040.1| hypothetical protein ANACOL_01260 [Anaerotruncus colihominis DSM 17241] (686 aa)
Score = 2152, Expect = 0.0e+00, Identities = 404/677 (59%), Positives = 515/677 (76%)
  Q:    11 RNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           RN GIMAHIDAGKTTT+ERIL+++G  HKIGETH+G + MDWM QE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSL+VLDG++ V  A+ GVEPQ+ETVWRQA++Y VPR+ +VNKMD  GA+F   +  +++RL   AVPIQLPIGAE  F GIIDLIE K  VY+ D GK+ + EE  IP+   ++ +Q R  L+E +A+ D+ LM  YL G+EIS  +IK  IRK  I     PV CG+++KNKG++ LLDA+VDF+P+P DVP  K    +  E       D  PF  LAFK+ATDP+VG+L F RVYSG++ +G+ V N  K   ER+ R+++MHA +R ++E    GDI A +GLK+TTTG+TL D K  + LE+M+F +PVI LA+EPKTKA QEKM+I LSKLAEEDPTF+T+TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  K ++V+ KY +QSGG+GQYGHVKI+ EPN+  KG+EFV+ IVGG IP+EYI P+  G++ AM +G LAGYP++D+K TL+DGS+HEVDSSEMAFKIAAS+A K A     PV+LEPIM + V  PE Y GD +GD++SRRG I+G E     Q IKA VPL EMFGY+ DLRS +QGRG+YVM+ SHY E PKS+   I++T+
  S:     3 RNIGIMAHIDAGKTTTTERILYYTGINHKIGETHEGTATMDWMAQEQERGITITSAATTAYWKGHRINIIDTPGHVDFTVEVERSLKVLDGSVTVFCAKGGVEPQSETVWRQANKYNVPRMGYVNKMDIMGADFYHVIDMMRKRLKCNAVPIQLPIGAETFFKGIIDLIEMKADVYYDDLGKDMRVEE--IPEDMLEKAQQYREELLESLADQDEALMEKYLAGEEISTDEIKAAIRKATIANTIVPVCCGTSYKNKGVQKLLDAIVDFMPAPTDVPNIKGVNPETEEEEERKPGDKEPFAALAFKIATDPYVGKLCFFRVYSGMVDAGTSVYNSNKQNSERMGRILQMHANHRKDLETCYCGDIAAAVGLKNTTTGDTLCDPKHPIILESMEFPEPVIDLAIEPKTKAGQEKMAIGLSKLAEEDPTFRTYTDAETGQTIIAGMGELHLEIIVDRLLREFKVEANVGKPQVAYKETIRKMADVDHKYARQSGGKGQYGHVKIKIEPNESGKGYEFVNAIVGGAIPKEYIGPIDQGIQGAMQAGVLAGYPVVDVKVTLYDGSYHEVDSSEMAFKIAASMAFKMAMAKADPVILEPIMRVTVNTPEDYMGDVIGDLNSRRGQIQGMEAVFGAQEIKAFVPLSEMFGYSNDLRSKTQGRGSYVMEPSHYIEVPKSIAEGIMSTR 681
>gi|193214797|ref|YP_001995996.1| translation elongation factor G [Chloroherpeton thalassium ATCC 35110] >gi|193088274|gb|ACF13549.1| translation elongation factor G [Chloroherpeton thalassium ATCC 35110] (705 aa)
Score = 2152, Expect = 0.0e+00, Identities = 401/684 (58%), Positives = 516/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK---------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R + L   RN GIMAHIDAGKTTT+ERIL+++GR+H++GE HDG + MDWMEQEKERGITITSAAT+  W+            +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A  GVEPQ+ETVWRQA++Y+VPRI +VNKMD+ GA+F   V+ I++RL    VPIQ+PIG    F G IDLI  K   +D       +E  IP   ++Q K  R +++E V++ DD L+  YL G+EI+  +++R +R   +  +  PVLCGS+FKNKG++ +LDAVV++LPSP+DV     +   D +E +    DD APF GLAFK+ +DP+VG+LTF RVYSGVLKSGSYV N    KKER+ RL++MHA +R +++E+ AGDI A +GLKDT TG+TL D+   + LE M F +PVI +A+EPKTKAD +K+ ++L+KLAEEDPTFK   + +T QT+IAGMGELHL+I+VDR++REFKV+ NVG PQVS++ET  K+ E EGK+++QSGG+GQ+G V I  EP+ KDKGFEFV++I GG IP+EYI  V  G++ AM +G +AGYPMID+K TLFDG +HEVDSSEMAFKIA S+  KE  +    VLLEPIMA+EV  PE+Y GD MGD+S RRG IEG  QR   QVIKAKVPL  MFGY+T+LRS +QGR NY M+F  Y+E P S+ NEI+
  S:     1 MPRQIPLEKVRNIGIMAHIDAGKTTTTERILYYTGRVHRLGEVHDGAATMDWMEQEKERGITITSAATTCFWQPRYGLLKDVRHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVFCAVGGVEPQSETVWRQANKYKVPRIGYVNKMDRVGADFFNVVEMIKERLKANPVPIQIPIGQGEMFAGFIDLIRMKGIIYDKEDGTTYQEVEIPHDLENQAKTWRVNMLEAVSDIDDSLLEKYLNGEEITEEEVRRTLRVATLKTEIIPVLCGSSFKNKGVQFMLDAVVEYLPSPIDVGAVTGHSPRDEDEKIARQPDDSAPFAGLAFKITSDPYVGKLTFFRVYSGVLKSGSYVLNSITGKKERIGRLLQMHANHREDLDEVFAGDIAAAVGLKDTKTGDTLCDESKSIVLEKMVFPEPVIQIAIEPKTKADSDKLGMSLAKLAEEDPTFKVSMNEDTNQTLIAGMGELHLEIIVDRLKREFKVDANVGKPQVSYKETIRKKVEAEGKFVRQSGGKGQFGLVNIIVEPSEKDKGFEFVNEIKGGSIPKEYIPAVSQGIQEAMRNGIVAGYPMIDVKVTLFDGKYHEVDSSEMAFKIAGSIGFKEGARKAGAVLLEPIMAVEVITPEEYMGDVMGDLSGRRGHIEGMHQRAGAQVIKAKVPLSAMFGYSTELRSMTQGRANYSMEFHDYSEVPASIANEIV 696
>gi|154249820|ref|YP_001410645.1| translation elongation factor G [Fervidobacterium nodosum Rt17-B1] >gi|189027858|sp|A7HM55.1|EFG_FERNB Elongation factor G (EF-G) >gi|154153756|gb|ABS60988.1| translation elongation factor G [Fervidobacterium nodosum Rt17-B1] (691 aa)
Score = 2151, Expect = 0.0e+00, Identities = 399/683 (58%), Positives = 514/683 (75%)
  Q:     2 ARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKV--YFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           A  VDL   RN GIMAHIDAGKTTT+ERIL+ +GR H+IG   DG + MDWM QEKERGITITSAAT+  WK   +N+IDTPGHVDFT+EVERSLRVLDGA+AV DA  GVEPQ+ETVWRQA +Y VPRI F+NKMDKTGA+FE +VQ++ +RLG   +P+QLP+GAE+DF G+IDLIE K   +    G E   EE  IP Q+KD+  + R  ++E++A  DD++M  YLEG+E SI  I   +R+  I     PV CGSA  N GI+ LLD +V +LPSP+D+P  K + + GNE+ +  +++APFV  AFK+ TDP+VG+LTF+RVYSG L+ GSYV N  K  KERVSRL+ +HA  R ++E +RAGDI  +IG+K T TG+T+ ++   V LE M+F +PVIS+A+EP+TK D+ K+S AL  L +EDP+ + + D ETG+TI++GMGELHL+I+VDR++REF V V VG PQV++RET  K+ ++EGKYI+QSGGRGQYGHV ++FEP   DK FEFVDK VGG IP++YI  ++ G+  AM  G LAGYP++ IKATL DGS+HEVDSSEMAFKIAAS+A KEA +  +PVLLEPIM +EVT PE Y G+ + D++SRR  I+  E R +++V+KA VPL EMFGYAT LRS SQGR NY M  SHY + P+ V  +I+
  S:     6 ALYVDLNKLRNIGIMAHIDAGKTTTTERILYFTGRKHQIGSVDDGTATMDWMVQEKERGITITSAATTCLWKEHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFDATAGVEPQSETVWRQADKYNVPRIAFMNKMDKTGADFEMAVQTMVERLGAHPIPVQLPMGAESDFAGVIDLIEMKAIRWLNPEGTEMVVEE--IPTQWKDKADEAREDMIEKIAEVDDEIMEMYLEGEEPSIEQIHAALRRITIAGLGTPVFCGSAKMNLGIQPLLDGIVRYLPSPLDLPPVKGFDKAGNEIQVQPTENAPFVAYAFKIQTDPYVGKLTFLRVYSGKLEKGSYVINTTKGVKERVSRLIFLHADKREDVEYVRAGDIVGVIGMKSTITGDTVCEENTYVILEKMEFPEPVISIAIEPETKDDETKLSKALQSLLDEDPSLRAYVDQETGETILSGMGELHLEIIVDRLKREFNVNVRVGKPQVAYRETITKDVKIEGKYIRQSGGRGQYGHVVVQFEPLGLDKTFEFVDKTVGGVIPKQYIPAIEEGIREAMQVGVLAGYPVVGIKATLLDGSYHEVDSSEMAFKIAASMAFKEAMEKGNPVLLEPIMKVEVTTPEDYMGNIIADLNSRRAHIDALENRGHLRVVKALVPLSEMFGYATTLRSLSQGRANYTMVLSHYEKVPEKVAEKIL 689
>gi|86605982|ref|YP_474745.1| elongation factor G [Synechococcus sp. JA-3-3Ab] >gi|119368774|sp|Q2JUX5|EFG_SYNJA Elongation factor G (EF-G) >gi|86554524|gb|ABC99482.1| translation elongation factor G [Synechococcus sp. JA-3-3Ab] (710 aa)
Score = 2150, Expect = 0.0e+00, Identities = 422/688 (61%), Positives = 525/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW-----KNCS----------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKE-SEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MARTV L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE H+G +V DWM QE+ERGITIT+AA +  W     KN S          +N+IDTPGHVDFT+EVERS+RVLDG IAV D+  GV+PQ+ETVWRQA+RY VPRI FVNKMD+ GANF +    I++RL   AVPIQLPIGAE++F GI+DL+  +  +Y  + GK+ +    PIP++ KD V + RA LVE VA  D+ LM  Y   +++S AD+   +RKG I  Q  P+LCGSAFKNKG+++LLDAVVD+LPSP+D+P  K    DG+EV   ASDD PF  LAFK+ +D + G LTF+RVYSGVL  G+YV N  KNKKER+SRLV + A  R +++E+RAGD+ A++GLKDTTTG+TL D+   V LE++   +PVIS+AVEPKTKAD +K+S AL  LA+EDPTF+   DPET QTII+GMGELHL+ILVDRM REF VE NVG PQV++RET  K  S VEGK+I+Q+GGRGQYGHV I  EP +   GFEFV KIVGG IP+EYI P + G+  A  SG LAGYP+IDI+ TL DGS+HEVDSSEMAFKIA S+ALKEA +  +PVLLEP+M +EV VPE + GD +GDI++RRG +EG      +  + AKVPL EMFGYATD+RS +QGRG + M+FSHY E P+S+   IIA  K
  S:     1 MARTVPLERVRNIGIAAHIDAGKTTTTERILFYSGLVHKLGEVHEGTTVTDWMAQERERGITITAAAITTRWTKRDPKNPSQPLAGAPEYTINIIDTPGHVDFTIEVERSMRVLDGVIAVFDSVGGVQPQSETVWRQANRYNVPRIAFVNKMDRMGANFLKVYNQIRERLKANAVPIQLPIGAEDEFRGIVDLVRLQANIYMDEIGKDIRP--APIPEEMKDLVAEYRAKLVEAVAETDEALMEKYFAEEDLSEADLMAGLRKGTISGQIVPMLCGSAFKNKGVQMLLDAVVDYLPSPIDIPAIKGVLPDGSEVSRKASDDEPFSALAFKLMSDKY-GDLTFIRVYSGVLTKGTYVLNSTKNKKERISRLVVLKADERLDVDELRAGDLGAVLGLKDTTTGDTLCDENAPVILESLYIPEPVISVAVEPKTKADIDKLSKALQALAKEDPTFRVSVDPETNQTIISGMGELHLEILVDRMLREFNVEANVGNPQVAYRETIRKPVSRVEGKFIRQTGGRGQYGHVVIDLEPAEPGTGFEFVSKIVGGVIPKEYIPPAEQGIREACESGVLAGYPLIDIRVTLVDGSYHEVDSSEMAFKIAGSMALKEAARRANPVLLEPMMKVEVEVPEAFVGDVIGDINARRGQMEGMSTEGGISKVNAKVPLAEMFGYATDIRSKTQGRGIFTMEFSHYEEVPRSIAEAIIAKSK 704
>gi|150392163|ref|YP_001322212.1| translation elongation factor G [Alkaliphilus metalliredigens QYMF] >gi|166919584|sp|A6TWI5.1|EFG_ALKMQ Elongation factor G (EF-G) >gi|149952025|gb|ABR50553.1| translation elongation factor G [Alkaliphilus metalliredigens QYMF] (689 aa)
Score = 2150, Expect = 0.0e+00, Identities = 408/687 (59%), Positives = 503/687 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDA-PFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDK-GFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R   L   RN GIMAHIDAGKTTT+ERILF+SG   K+GETH+G S MDWM+QEKERGITITSAAT+  W N  +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A+ GVEPQ+ETVWRQ  +Y+VPR+ FVNKMD+ GA+F   +Q +  RL    V +QLPIG+E +F GIIDL+  E  +Y  D G+E K  E  IP++ K+   + R  LVE V+   ++LM  YLEG+ ++  ++ + IR+G I  Q  PV CGSA+KNKG++LLLD VV ++PSP+D+P       D  E +   +DD+ PF  LAFK+  DP+VG+L F RVYSG L +GSYV N  K KKER+ R+++MHA  R EI  + AGDI A +GLKDTTTG+TL D    V LE+M F +PVIS+A+EPKTKA QEKM +AL KLAEEDPTFKT+TD ET QTIIAGMGELHL+I+VDRM REFKVE  VG PQV+++ET  K  EVE KY KQSGGRGQYGHVKIR  P +   G+EF +  VGG IPREY+  V  G++ AM +G LAGY ++D K  L+DGS+H+VDSSEMAFKIA S+A KE  +  SP LLEP M +EV  PE Y GD +GD++SRRG IEG E R   QVIKA VPL EMFGY+TDLRS +QGR  Y M F+HYA+ P S+  +I+  K
  S:     1 MPREFPLERTRNIGIMAHIDAGKTTTTERILFYSGTTRKLGETHEGASQMDWMDQEKERGITITSAATTCQWLNHRVNIIDTPGHVDFTVEVERSLRVLDGAVAVFCAKGGVEPQSETVWRQGDKYKVPRMAFVNKMDRQGADFFNVMQMMIDRLAANPVAVQLPIGSEEEFTGIIDLVKMEATIYLDDVGQETKIVE--IPEELKELAVEYREKLVEAVSETSEELMMKYLEGEALTEEELVKGIRQGTINVQITPVYCGSAYKNKGVQLLLDGVVAYMPSPLDIPAISGIDADTQEEIERHADDSEPFSALAFKIMADPYVGKLAFFRVYSGTLDAGSYVLNSTKGKKERIGRILQMHANTRAEIPTVYAGDIAAAVGLKDTTTGDTLCDPTDAVILESMVFPEPVISVAIEPKTKAGQEKMGVALQKLAEEDPTFKTYTDEETSQTIIAGMGELHLEIIVDRMMREFKVEATVGKPQVAYKETITKAVEVEAKYAKQSGGRGQYGHVKIRMIPQEPGIGYEFTNSTVGGSIPREYVPAVDQGIQGAMVNGILAGYEVVDFKVELYDGSYHDVDSSEMAFKIAGSMAFKEGMRKASPALLEPYMKVEVVTPEDYMGDVIGDLNSRRGQIEGMESRSGAQVIKAFVPLSEMFGYSTDLRSKTQGRATYSMHFNHYAQVPASISEKIMTGK 689
>gi|145620222|ref|ZP_01776258.1| translation elongation factor G [Geobacter bemidjiensis Bem] >gi|144943448|gb|EDJ78537.1| translation elongation factor G [Geobacter bemidjiensis Bem] >gi|197086680|gb|ACH37951.1| translation elongation factor G [Geobacter bemidjiensis Bem] (692 aa)
Score = 2150, Expect = 0.0e+00, Identities = 400/688 (58%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE---VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+ +W++  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F R +  I+ RL    VP+Q+PIG+E ++ G++DLIE K + F D       +   IP    +Q ++ R  L+EEV++ DD LM  YL G+EIS A++K  IR+  +  +  PV+CGSAFKNKG++ LLDAV+D++P+P D+P  +  G D N    +   ASD  PF  L FK+ TDPFVG+L F RVYSGV++SGSYV N  K K+ER+ R++KMHA  R EI+E+ AGDI A +GLK TTTG+TL  +   V LE+++F +PVIS+A+EPKTKADQEK+ ++L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ + EGK+++QSGGRGQ+GHV +  EP +  KG+EFVD I GG +PREYI  V  G++ A+ +G +AG+P++DIK TL DGS+HEVDSSEMAFKIA S+  KE  +  SP++LEPIM++EV VPE+Y GD +GD++SRRG I G E R   QV+ + VPL +MFGY+TDLRS +QGR  Y M F HY   PKSV  EI+A  K
  S:     1 MARQVSLEMTRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCNWRDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYRVPRIAFINKMDRVGADFFRGIAMIKDRLKANPVPLQIPIGSEENYKGLVDLIEMKGIVFNDESMGATFDTIEIPADLLEQAQEYREALIEEVSSHDDVLMEKYLGGEEISNAELKAAIRQATLDIKICPVICGSAFKNKGVQHLLDAVLDYMPAPTDIPAIQ--GVDANTDAPIERHASDSEPFAALGFKIMTDPFVGQLCFFRVYSGVIQSGSYVYNATKGKRERIGRILKMHANKREEIKEVYAGDIAAAVGLKYTTTGDTLCAEDHAVILESIEFPEPVISIAIEPKTKADQEKLGLSLGKLASEDPSFRVKTDEETGQTIISGMGELHLEIIVDRLFREFKVEANVGKPQVAYRETITKKVKAEGKFVRQSGGRGQFGHVWLEVEPQEAGKGYEFVDAIKGGVVPREYIPAVDKGIKEALDNGVMAGFPVVDIKVTLVDGSYHEVDSSEMAFKIAGSMGFKEGCQKASPIILEPIMSVEVVVPEEYMGDVIGDLNSRRGRIMGMEGRAGAQVVASMVPLAQMFGYSTDLRSATQGRATYSMTFDHYEPVPKSVAEEIVAKVK 691
>gi|87301865|ref|ZP_01084699.1| elongation factor EF-2 [Synechococcus sp. WH 5701] >gi|87283433|gb|EAQ75388.1| elongation factor EF-2 [Synechococcus sp. WH 5701] (691 aa)
Score = 2149, Expect = 0.0e+00, Identities = 400/688 (58%), Positives = 510/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE HDG +V DWMEQE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG +AV  A  GV+PQ+ETVWRQA RY VPRI+FVNKMD+TGANF +    I+ RL   AVP+QLPIGAE +  GIIDL+ EK   +         E  IP+  K++  + R  L+E VA  D++L+  YLE  E++   + + IR GV+     P+LCGSAFKNKG++L+LDAVVD+LP+P+DVP       DG E      D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K+KKER+SRL+ + A +R E++E+RAGD+ A++GLKDTTTG+TL  +   + LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    ++ EGK+ +Q+GG+GQYGHV I  EP +   GFEFV+KIVGG +P+EYI P + G++    SG +AG+PMIDIK T+ DGS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV +PE + G  +GD+SSRRG +EG    +    +++KVPL EMFGYAT LRS +QGRG + M+FSHY E P++V   IIA  +
  S:     1 MARAYPLDRVRNIGIAAHIDAGKTTTTERILFYSGVVHKMGEVHDGAAVTDWMEQERERGITITAAAISTSWKDHRINIIDTPGHVDFTIEVERSMRVLDGVVAVFCAVGGVQPQSETVWRQADRYNVPRIVFVNKMDRTGANFLKVYDQIKDRLKANAVPLQLPIGAEGELKGIIDLVREKAILYTNDLGTDILEGEIPENMKEEAAEWRGKLMESVAETDEELLEAYLENGELTQEQLIKGIRTGVVKHGLVPMLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPITGLLPDGTESNRPCDDSAPFSALAFKVMADPY-GKLTFVRMYSGVLQKGSYVLNSTKDKKERISRLILLKADDREEVDELRAGDLGAVLGLKDTTTGDTLCVESDPIILESLFIPEPVISVAVEPKTKGDMEKLSKALQSLSEEDPTFRVSTDPETSQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRARAKGEGKFARQTGGKGQYGHVVIEMEPGEPGSGFEFVNKIVGGIVPKEYIGPAENGMKETCQSGVIAGFPMIDIKVTMVDGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEIPEDFLGSVIGDLSSRRGQVEGQSIDNGQSKVQSKVPLAEMFGYATQLRSMTQGRGIFSMEFSHYEEVPRNVAEAIIAKNQ 688
>gi|187933091|ref|YP_001884470.1| translation elongation factor G [Clostridium botulinum B str. Eklund 17B] >gi|187721244|gb|ACD22465.1| translation elongation factor G [Clostridium botulinum B str. Eklund 17B] (688 aa)
Score = 2149, Expect = 0.0e+00, Identities = 407/687 (59%), Positives = 523/687 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L  FRNFGIMAHIDAGKTTT+ERILF++G  HKIGETHDG S MDWM QE+ERGITITSAAT+ +WK   LN+IDTPGHVDFTVEVERSLRVLDGA+ VLDA+ GVEPQTETVWRQA +Y VPR+I+VNKMD TGA+F R + +++ RL   AVPIQ+PIG+E +F G+IDLI      F  D GK+ +  E+ IP ++ ++ ++ RA ++E +A  D++LM  YLEG+EI+  ++K  +RK  I  + +P +CGS++KNKG++ ++D VVD+LPSP+D+P  K    +G E   +A+D  P   LAFK+ATDPFVG+L + R+YSG+++SGSYV N  K KKER+ RLVKMH+ +R E+E + AG++ A+IGLK+T TG+TL  +K  + LE+M+F +PVIS+A+EPKTKA QEKM +AL+KLAEEDPTFKT+T+ ETGQTIIAGMGELHLDI+VDR++REFKVE NVGAPQV+++ET  K  + E KY KQSGG+GQYGH  I  EP + + + F + IVGG IPREYI  V  G++ A  +G +AGY +I+ K  L  GS+HEVDSSEMAFKIA S+A K A     PVLLEP+  +E+TVPE+Y GD +GD++SRRG +EG E+    QVI+A VPL EMFGYAT LRS +QGRG Y M F HY E PKS+  E+   K
  S:     1 MARKYPLDKFRNFGIMAHIDAGKTTTTERILFYTGINHKIGETHDGASTMDWMVQEQERGITITSAATTCAWKEHELNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADFFRCISTVRDRLKGNAVPIQIPIGSEENFQGMIDLIRNVAILFYDDLGKDMR--EEAIPAEYAEKAEEYRAAMIEAIAEADEELMMKYLEGEEITEEELKAGLRKATIANEIYPCICGSSYKNKGVQQMIDGVVDYLPSPLDIPAVKGTNLEGEEAERNAADGEPLSALAFKIATDPFVGKLAYTRIYSGIMESGSYVLNSTKGKKERIGRLVKMHSNSRQEVESLEAGELGAVIGLKNTGTGDTLCSEKDPIILESMEFPEPVISVAIEPKTKAAQEKMGMALAKLAEEDPTFKTWTNEETGQTIIAGMGELHLDIIVDRLKREFKVECNVGAPQVAYKETIRKAVKAEAKYAKQSGGKGQYGHAVIEMEPTEGE-YVFENAIVGGAIPREYIPAVDNGIQEASLNGIIAGYNVINFKVRLVHGSYHEVDSSEMAFKIAGSMAFKNAMAKADPVLLEPVEKVEITVPEEYMGDVIGDVNSRRGRMEGMEEVSGAQVIRAFVPLSEMFGYATSLRSRTQGRGVYSMVFDHYEEVPKSIQEEVAGNK 686
>gi|194477017|ref|YP_002049196.1| elongation factor EF-2 [Paulinella chromatophora] >gi|171192024|gb|ACB42986.1| elongation factor EF-2 [Paulinella chromatophora] (691 aa)
Score = 2149, Expect = 0.0e+00, Identities = 395/685 (57%), Positives = 507/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE HDG +V DWM QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG +AV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   + PIQLPIGAE + +GIIDL+  K + +     +  EE  IP    ++  + R +L+E VA  D++L+  +LE  E+S   +   IR GV+     P+LCGSAFKNKG++LLLDAVVD+LPSP D+   +    DG+E    + DDAPF  LAFKV  DPF G+LTF+R+YSG+L  GSYV N  K+KKER+SRL+ + A +R E++E+RAGD+ A++GLKDTTTG+TL D    + LE +   +PVIS+AVEPKTK D EK+S AL+ LAEEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    ++ EGK+ +Q+GG+GQYGHV I  EP +   GFEF++KIVGG +P+EYI P  AG++    SG +AGYP+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+  K C+PV+LEP+M +EV +PE Y G  +GD+SSRRG +EG         ++ KVPL EMFGYAT LRS +QGRG + M+FSHY E P++V   II+
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKMGEVHDGAAVTDWMAQERERGITITAAAISTSWKDHRINIIDTPGHVDFTIEVERSMRVLDGVVAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVCNQIKSRLKANSAPIQLPIGAEGELSGIIDLVRNKAFIYKDDLGKDIEETEIPASLAEEASRWRTNLMESVAETDEELIEAFLETGELSETQLINGIRLGVLKHGLVPILCGSAFKNKGVQLLLDAVVDYLPSPTDILPVQGLLPDGSEAERPSRDDAPFSALAFKVMADPF-GKLTFIRMYSGILNKGSYVLNATKDKKERISRLIILKADDREEVDELRAGDLGAVLGLKDTTTGDTLCDSDKPIILETLFIPEPVISVAVEPKTKGDMEKLSKALTSLAEEDPTFRVSTDPETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSAKGEGKFARQTGGKGQYGHVVINMEPGEPGSGFEFINKIVGGTVPKEYIGPAAAGMKETCESGVIAGYPLIDVKVTMIDGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVILEPMMKVEVEIPEDYLGSVIGDLSSRRGQVEGQSIDGGQSKVQTKVPLAEMFGYATQLRSMTQGRGIFSMEFSHYEEVPRNVAEAIIS 685
>gi|6119886|gb|AAF04270.1|AF181877_1 elongation factor G [Helicobacter pylori] (682 aa)
Score = 2148, Expect = 0.0e+00, Identities = 401/678 (59%), Positives = 510/678 (75%)
  Q:    11 RNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDG---GKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           RN GI AHIDAGKTTTSERILF++G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VPI +PIGAE+ F G+IDL++ K   ++    G +   EE  IP    ++ KQ R  LVE VA  D+ LM  YL G+E++I +IK+ I+ G +     P+LCGS+FKNKG++ LLDAV+D+LP+P +V   +    +   EV + +SDD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSYV N  K+KKERV RL+KMH+  R +I+E+ AG+ICA +GLKDT TG+TL D+K  V LE M+F +PVI +AVEPKTKADQEKM +AL KLAEEDP+F+  T  ETGQT+I GMGELHL+I+VDR++REFKVE  +G PQV+FRET       E KY KQSGGRGQYGHV I+ EP +   G+EFV++I GG IP+EYI  V  G++ AM +G LAGYP++D K TL+DGS+H+VDSSEMAFKIA S+A KEA +  +PVLLEP+M +EV VPE+Y GD +GD++ RRG I   + R  ++++ A VPL EMFGY+TDLRS +QGRG Y M+F HY E P ++  EI+  +K
  S:     1 RNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQIKLRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNNETMGAKYDVEE--IPSDLLEKAKQYREKLVEAVAEQDEALMEKYLGGEELNIEEIKKGIKTGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIRGIDPKTEEEVFVKSSDDGEFAGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTLCDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREFKVEAEIGQPQVAFRETIRSSVSKEHKYAKQSGGRGQYGHVFIKLEPKEPGSGYEFVNEISGGVIPKEYIPAVDKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIGDLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNISKEIVEKRK 681
>gi|116072131|ref|ZP_01469399.1| elongation factor EF-2 [Synechococcus sp. BL107] >gi|116065754|gb|EAU71512.1| elongation factor EF-2 [Synechococcus sp. BL107] (691 aa)
Score = 2148, Expect = 0.0e+00, Identities = 401/685 (58%), Positives = 517/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    IQ RL   AVPIQLPIGAE + +GIIDL+E K + +     +  E   +PD  KDQV++ RA L+E+VA  D+ L+  +L+  E+S  ++K  IR GV+     PVLCGSAFKNKG++L+LDAVVD+LP+P+DVP  +    DG E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K  KER+SRLV + A +R E+++++AGD+ A++GLK+TTTG+TL   +  + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP + + GF FV+KIVGG +P+E+IKP + G++    SG +AG+P+ID+K ++ DGS+H+VDSSEMAFKIA S+A K+A + C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D    + +KVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWKDHRVNIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIQDRLKANAVPIQLPIGAEGELSGIIDLVENKAHIYKDDLGQDIEVTDVPDDMKDQVEEWRAFLMEKVAETDEALIEKFLDTGELSNDELKTGIRTGVVKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPIQGILPDGTEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVMNSTKGIKERISRLVVLKADDREEVDQLQAGDLGAVLGLKNTTTGDTLCSAEEPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVRTDQETGQTVIAGMGELHLEILVDRMMREFKVEANIGAPQVSYRETIRGSSKGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFVFVNKIVGGVVPKEFIKPSEQGMKETCESGVIAGFPLIDVKVSMVDGSYHDVDSSEMAFKIAGSMAFKDAVRKCNPVLLEPMMKVEVEVPEDFLGSVIGDLSSRRGQVEGQAIDDGTSKVSSKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIIS 685
>gi|78211873|ref|YP_380652.1| elongation factor G [Synechococcus sp. CC9605] >gi|119368779|sp|Q3AMT5|EFG_SYNSC Elongation factor G (EF-G) >gi|78196332|gb|ABB34097.1| translation elongation factor G [Synechococcus sp. CC9605] (691 aa)
Score = 2147, Expect = 0.0e+00, Identities = 401/688 (58%), Positives = 511/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   AVPIQLPIGAE + +GIIDL+  K Y +        EE  +P    D+V + R  L+E VA  D+ L+  +LE  E+S+ D+K+ IR+GV+     P+LCGSAFKNKG++L+LDAV+D+LP+PVDVP  +    DG+E +  + D APF  LAFKV  DP+ G+LTFVR+YSG+L+ GSYV N  K +KER+SRLV + A +R E++ +RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    +  EGK+ +Q+GG+GQYGHV I  EP +   GFEFV+KIVGG +P+EYIKP + G++    SG +AGYP+ID+K TL  GS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  PE + G  +GD+SSRRG +EG    D    I AKVPL EMFGYAT+LRS +QGRG + M+F +YAE P++V   II+  +
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAVPIQLPIGAEGELSGIIDLVANKAYIYKNDLGTDIEEADVPADMADEVAEWRNTLMETVAETDEALIEKFLESGELSVDDLKKGIREGVLKHGLVPMLCGSAFKNKGVQLVLDAVIDYLPAPVDVPPIQGVLPDGSEAVRPSDDSAPFSALAFKVMADPY-GKLTFVRMYSGILEKGSYVLNSTKGEKERISRLVVLKADDREEVDALRAGDLGAVLGLKNTTTGDTLCTQDDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALVALAEEDPTFRVNTDSETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRGSAGGEGKFSRQTGGKGQYGHVVIEMEPGEPGSGFEFVNKIVGGVVPKEYIKPAEQGMKETCESGVIAGYPLIDVKCTLVHGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEAPEDFLGSIIGDLSSRRGQVEGQSVEDGTSKISAKVPLAEMFGYATELRSMTQGRGIFSMEFDNYAEVPRNVAEAIISKNQ 688
>gi|78185588|ref|YP_378022.1| elongation factor G [Synechococcus sp. CC9902] >gi|119368778|sp|Q3AW54|EFG_SYNS9 Elongation factor G (EF-G) >gi|78169882|gb|ABB26979.1| translation elongation factor 2 (EF-2/EF-G) [Synechococcus sp. CC9902] (691 aa)
Score = 2147, Expect = 0.0e+00, Identities = 401/688 (58%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    IQ RL   AVPIQLPIGAE + +GIIDL+E K + +     +  E   +P+  KDQV++ RA L+E+VA  D+ L+  +L+  E+S  ++K+ IR GV+     PVLCGSAFKNKG++L+LDAVVD+LP+P+DVP  +    DG E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K  KER+SRLV + A +R E+++++AGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP + + GF FV+KIVGG +P+E+IKP + G++    SG +AG+P+ID+K ++ DGS+H+VDSSEMAFKIA S+A K+A + C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D    + AKVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+  +
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWKDHRVNIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIQDRLKANAVPIQLPIGAEGELSGIIDLVENKAHIYKDDLGQDIEITDVPEAMKDQVEEWRAFLMEKVAETDEALIEKFLDTGELSNDELKQGIRTGVVKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPIDVPPIQGILPDGTEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVMNSTKGIKERISRLVVLKADDREEVDQLQAGDLGAVLGLKNTTTGDTLCSADEPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVRTDQETGQTVIAGMGELHLEILVDRMMREFKVEANIGAPQVSYRETIRGSSKGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFVFVNKIVGGIVPKEFIKPSEQGMKETCESGVIAGFPLIDVKVSMVDGSYHDVDSSEMAFKIAGSMAFKDAVRKCNPVLLEPMMKVEVEVPEDFLGSVIGDLSSRRGQVEGQAIDDGTSKVSAKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQ 688
>gi|149195197|ref|ZP_01872287.1| elongation factor G [Caminibacter mediatlanticus TB-2] >gi|149134630|gb|EDM23116.1| elongation factor G [Caminibacter mediatlanticus TB-2] (693 aa)
Score = 2146, Expect = 0.0e+00, Identities = 400/688 (58%), Positives = 513/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD--GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R   +   RN GI AHIDAGKTTT+ERIL+++G  HKIGE H+G + MDWMEQEKERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERS+RVLDGAIAV  A  GV+PQ+ETVWRQA++Y VPRI FVNKMD+ GANF    + I++RL    VPIQ+PIGAE++F G++DL+  K   ++       K E + IP + +++ ++ R  L+E +A  D++LM  Y  G+E+S  +IK+ I+K  +  +  P+LCG+AFKNKG++ LLDAV+D+LP+P +V   K    + G E+ ++  DD PF GLAFK+ TDPFVG+LTF R YSG++KSGSYV N  KNKKERV RL++MHA  R E+ E  +G+I AI+GLK T TG+TL D+   + LE M+F  PVIS+AVEPKTKADQEKM++AL KLAEEDP+F+  TD ETGQTII+GMGELHL+I+VDR++REFKVE N G PQV++RETF  + E E KY KQSGGRGQYGHV IR  P +  KG+EFVD I GG IPREYI  V  G++ A  +G LAG+P++D K  LFDGS+HEVDSSEMAFK+A S+A KE  K  +PV+LEPIM +E+ VPE+Y GD +GDI+ RRG +   E +  V+ I A VPL EMFGY+TDLRS +QGRG Y M F HY E P ++  EII  ++
  S:     1 MPRKTPIEKVRNIGIAAHIDAGKTTTTERILYYTGVSHKIGEVHEGAATMDWMEQEKERGITITSAATTCFWKDHQINIIDTPGHVDFTIEVERSMRVLDGAIAVFCAVGGVQPQSETVWRQANKYHVPRIAFVNKMDRIGANFYEVEKQIRERLKANPVPIQIPIGAEDNFKGVVDLVRMKALVWEDEAALGSKYEIEDIPAELQEKAEEYREKLIEAIAETDEELMEKYFAGEELSEEEIKKAIKKATLNLEIVPMLCGTAFKNKGVQPLLDAVIDYLPAPTEVTWIKGIDPKTGEEISVNPGDDEPFSGLAFKIMTDPFVGKLTFTRFYSGIIKSGSYVLNSTKNKKERVGRLLRMHANKREEVSEFYSGEIGAIVGLKHTLTGDTLCDESRPIILERMEFPDPVISVAVEPKTKADQEKMALALQKLAEEDPSFRVTTDEETGQTIISGMGELHLEIIVDRLKREFKVECNTGKPQVAYRETFKNQVEQEYKYAKQSGGRGQYGHVFIRLIPQEPGKGYEFVDLIKGGVIPREYIPAVDKGIQEAAQAGVLAGFPVVDFKVELFDGSYHEVDSSEMAFKLAGSMAFKEGVKKANPVILEPIMKVEIEVPEEYMGDVIGDINRRRGQVNSMEDQHGVKKITAFVPLAEMFGYSTDLRSMTQGRGTYSMVFDHYEEVPNNIAEEIIKERQ 692
>gi|121612720|ref|YP_001000189.1| elongation factor G [Campylobacter jejuni subsp. jejuni 81-176] >gi|166201591|sp|A1VYJ8.1|EFG_CAMJJ Elongation factor G (EF-G) >gi|87250102|gb|EAQ73060.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni 81-176] (691 aa)
Score = 2146, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 510/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+R+  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E+S+ +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +VP  K   EDG EV + ++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V +EII  +
  S:     1 MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSETSDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVPNIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEIIKKR 689
>gi|15805336|ref|NP_294030.1| elongation factor G [Deinococcus radiodurans R1] >gi|21263549|sp|Q9RXK5|EFG_DEIRA Elongation factor G (EF-G) >gi|6457979|gb|AAF09887.1|AE001891_6 elongation factor G [Deinococcus radiodurans R1] (698 aa)
Score = 2146, Expect = 0.0e+00, Identities = 402/678 (59%), Positives = 516/678 (76%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSV------SWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL-ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKID-VQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           L +FRN GI AHIDAGKTTT+ERILF +GRI  +GETH+G S MDWMEQE+ERGITIT+AAT+       + ++ ++N+IDTPGHVDFT+EVERS+RVLDGA+AV D+  GVEPQ+ETVWRQA RY VPR+ F NKMDKTGA+F+  V  I++RLG    PIQ P+GAENDF G+ID++  + + F      + +   +P ++ D+V +MR  L+E  A  D+ LM  +LEG+E +  ++   IRKG I  Q FPVLCGSA KNKG++LLLDAVVD+LPSP++VP  K   EDG  V    A  +     LAFK+  DP+VGRLTFVR+YSG L SGSYV N  K+K+ERV RL+KMHA +R E+ E++AG++ A+IGLKD  TG TL+ D  D V LE++   +PVI LA+EPKTKADQEKM + L KLAEEDPTFK  TD E+GQT IAGMGELHL+ILVDR++RE+KVE NVGAPQV++RET  K+ EV+ K+ +QSGGRGQYGHVK+R EP     GF F + +VGG +P+EYI P Q G+E AM SGP+ G+P++DIK  ++DGS+HEVDSSEMAFKIA S+ LKEA +  SP +LEP+M +EVT PE+Y GD +GD++SRRG I+G E R N Q++KA VPL EMFGYATD+RS +QGR +Y M F HY + P ++  +++
  S:    10 LTHFRNIGIAAHIDAGKTTTTERILFFTGRIRNLGETHEGASQMDWMEQERERGITITAAATTAHWTHTETGEDYTVNIIDTPGHVDFTIEVERSMRVLDGAVAVFDSSQGVEPQSETVWRQADRYGVPRVAFANKMDKTGASFDLVVNDIRERLGAIPAPIQYPMGAENDFKGVIDIVRMQAHTFTNDLGTEIQVGDVPAEYMDKVNEMRQQLIEAAAEVDEDLMMKFLEGEEPTQQELIAAIRKGTIDKQIFPVLCGSALKNKGVQLLLDAVVDYLPSPLEVPSIKGTHEDGETVTEFPADPEGKLAALAFKIMADPYVGRLTFVRIYSGTLTSGSYVYNASKDKRERVGRLLKMHANSREEVTELKAGELGAVIGLKDAGTGNTLIGDGDDRVLLESIDIPEPVIKLAIEPKTKADQEKMGVGLQKLAEEDPTFKVETDQESGQTTIAGMGELHLEILVDRLKREYKVEANVGAPQVAYRETITKQVEVDSKFARQSGGRGQYGHVKLRVEPLEPGAGFIFENAVVGGTVPKEYIGPAQKGVEEAMQSGPMLGFPVVDIKVVIYDGSYHEVDSSEMAFKIAGSMGLKEAVQKGSPAILEPVMRVEVTTPEEYMGDVIGDLNSRRGQIQGMEARGNAQIVKAFVPLSEMFGYATDMRSKTQGRASYSMFFDHYTQVPTNLAQQLM 696
>gi|118475753|ref|YP_892463.1| elongation factor G [Campylobacter fetus subsp. fetus 82-40] >gi|166201588|sp|A0RQI0.1|EFG_CAMFF Elongation factor G (EF-G) >gi|118414979|gb|ABK83399.1| translation elongation factor G [Campylobacter fetus subsp. fetus 82-40] (691 aa)
Score = 2145, Expect = 0.0e+00, Identities = 404/687 (58%), Positives = 509/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+R   L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  A  GV+PQ+ETVWRQA++Y VPR++FVNKMD+ GANF    + I+ RL    VPIQ+PIGAE++F G+IDLIE K   + D  K      K IP +  ++ ++ RA ++E VA  DD LM  +  G+E+S+ +IKR I+ G +     P+LCG+AFKNKG++ LL+AVVD+LP+P +V   +   EDG+EV++ ++D+  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K KKER+ RL++MH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     GFEFV+ I GG +PREYI  V+ G + A+ SG LAGYP+ D+K TLFDGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE+Y GD +GD++ RRG I   ++R   +++ A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V  EII  +
  S:     1 MSRKTPLNMVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCAVGGVQPQSETVWRQANKYRVPRMVFVNKMDRVGANFFNVEEQIKNRLKANPVPIQIPIGAEDEFKGVIDLIEMKALVWEDDTKPTDYVTKDIPAELLEKAQEYRAKMIEAVAETDDALMEKFFGGEELSVEEIKRGIKAGCLAMTMIPMLCGTAFKNKGVQPLLNAVVDYLPAPDEVAAIRGELEDGSEVVVDSTDNGEFAGLAFKIMTDPFVGQLTFVRVYRGQLESGSYAYNTVKGKKERIGRLLRMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLAGEKEHVILEKMDFPDPVISVAVEPKTKADQEKMGIALQKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIKKSVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGFEFVNDIKGGVVPREYIPAVEKGCQEALQSGVLAGYPVEDVKVTLFDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEEYMGDVIGDLNKRRGQINSMDERAGNKIVTAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYEEVPKNVSEEIIKKR 689
>gi|82701897|ref|YP_411463.1| elongation factor G [Nitrosospira multiformis ATCC 25196] >gi|119368748|sp|Q2YB00|EFG_NITMU Elongation factor G (EF-G) >gi|82409962|gb|ABB74071.1| translation elongation factor 2 (EF-2/EF-G) [Nitrosospira multiformis ATCC 25196] (696 aa)
Score = 2145, Expect = 0.0e+00, Identities = 400/687 (58%), Positives = 516/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN G+MAHIDAGKTTT+ERILF++G  HK+GE HDG + MDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERSLRVLDGA  V  A  GV+PQTETVWRQA++Y+VPR+ FVNKMD+ GANF R  + IQ RL    VPIQLPIGAE+ F G++DLI+ K +++ D  +  + EE+ IP    +  K  R  +VE  A  +++LM  YLE  ++S ADIK+ +R   +  +  P+LCGSAFKNKG++ +LDAV+D+LPSP D+       E G      ASD+ PF GLAFK+ATDP+VG+L F RVYSGV+ SG  V N  K +KER+ RL++MHA  R EI+E+RAGDI A +GLK+  TG+TL D    + LE M F +PVI +AVEPKTK DQEKM IAL++LA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM+REF VE NVGAPQV++RE   K  +VEGK+IKQSGGRGQYGHV I+ E N+  KGFEF+D I GG +PREYI  VQ GLE  + +G LAG+P++D+K TLFDGS+H+VDS+E AFK+AAS+A K+  +  +PVLLEP+M++EV  P  + G+ +GD+SSRRG+I+G +    ++V++A+VPL EMFGYAT LRS +QGR  Y M+F HYAE PK+V   II+ K
  S:     1 MARKTPIERYRNIGVMAHIDAGKTTTTERILFYTGVSHKLGEVHDGAATMDWMEQEQERGITITSAATTCFWKGMDHNYPDHRINIIDTPGHVDFTIEVERSLRVLDGACTVFCAVGGVQPQTETVWRQANKYKVPRLAFVNKMDRAGANFMRVYEQIQSRLKAHPVPIQLPIGAEDKFEGVVDLIKMKAIHWDDASQGMRFEERDIPANMVEDAKSWREKMVESAAEANEELMNKYLEEGDLSPADIKQGLRIRTLANEIVPMLCGSAFKNKGVQAMLDAVLDYLPSPADIEAIDGEKESGEHAERHASDEEPFAGLAFKIATDPYVGQLIFFRVYSGVVTSGDTVYNPIKGRKERIGRLLQMHANQREEIKEVRAGDIAAAVGLKEAVTGDTLCDPADVITLERMVFPEPVIHVAVEPKTKLDQEKMGIALNRLAQEDPSFRVRTDEESGQTIISGMGELHLEIIVDRMKREFGVEANVGAPQVAYREAIRKSVDVEGKFIKQSGGRGQYGHVWIKMEQNEAGKGFEFIDAIKGGTVPREYIPAVQKGLEETLPNGVLAGFPVVDVKVTLFDGSYHDVDSNENAFKMAASIAFKDGMRKANPVLLEPMMSVEVETPADFMGNVVGDLSSRRGMIQGMDDLPGLKVVRAEVPLAEMFGYATSLRSATQGRATYTMEFKHYAEAPKNVAEAIISKK 696
>gi|77918312|ref|YP_356127.1| elongation factor G [Pelobacter carbinolicus DSM 2380] >gi|90110684|sp|Q3A6Q0|EFG2_PELCD Elongation factor G 2 (EF-G 2) >gi|77544395|gb|ABA87957.1| translation elongation factor 2 (EF-2/EF-G) [Pelobacter carbinolicus DSM 2380] (692 aa)
Score = 2145, Expect = 0.0e+00, Identities = 400/688 (58%), Positives = 511/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ER+L+++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W++  +N+IDTPGHVDFTVEVERSLRVLDG++AV  +  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F+R V  I++RLG  A+P+QLPIG E++F+G++DL+E K   +D    G + E  +   IP   +++V   R  LVEEV   D+ LM  YL G+EI++ ++K  IRK  I  +  PVLCGSAFKNKG++ LLDAV+D++PSPVDVP       D  E +   A DD PF  LAFKV TDPFVG+LTF RVYSGV +SG+ V N  ++KKER  RL+KMHA  R EI+++ +GDI A +GLK TTTG+TL D      LE+M+F +PVI +A+EPKTK D +KM  AL KL +EDPT +  TD ETGQTI++GMGELHL+I++DR++REFKV+ NVGAPQV++RET  K  EV+GK+++QSGGRGQYG   ++ EP +   G+EFVD I GG IPREYI  V  G E A  +G +AG+P++D+K T +DGS+H+VDSSEMAFKIA S+  K      SPVLLEP+MA+EV VPE+Y GD MGD+SSRRG + G + R   QVI + VPL  MFGYAT+LRS +QGR  Y M F HY + PK++  EI+A  K
  S:     1 MARQVSLEKTRNIGIMAHIDAGKTTTTERVLYYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWRDHRVNIIDTPGHVDFTVEVERSLRVLDGSVAVFCSVGGVEPQSETVWRQADKYRVPRIAFINKMDRIGADFDRGVNMIRERLGANAIPLQLPIGKEDNFSGVVDLVEMKAIVWDDESLGARFEVVD---IPADLQERVDSGRELLVEEVCTHDEALMDKYLGGEEITLEELKNGIRKACIDIKIIPVLCGSAFKNKGVQNLLDAVIDYMPSPVDVPAITGVVPDTEEEITRPAGDDGPFAALAFKVMTDPFVGQLTFFRVYSGVAESGATVLNATRDKKERFGRLLKMHANKREEIKQVYSGDIAAAVGLKLTTTGDTLCDPANPCLLESMEFPEPVIHIAIEPKTKGDMDKMGQALGKLVQEDPTLRVRTDEETGQTILSGMGELHLEIIIDRLQREFKVDANVGAPQVAYRETITKAVEVQGKFVRQSGGRGQYGDCWLKLEPQEPGAGYEFVDAIKGGVIPREYIPAVGKGAEEAAENGVVAGFPIVDVKVTCYDGSYHDVDSSEMAFKIAGSMGFKAGAAKASPVLLEPVMAVEVVVPEEYMGDVMGDLSSRRGRVLGMDARGGAQVINSNVPLASMFGYATELRSMTQGRATYTMVFDHYEQVPKAISEEIVARVK 691
>gi|154149329|ref|YP_001407177.1| elongation factor G [Campylobacter hominis ATCC BAA-381] >gi|166201589|sp|A7I3T6.1|EFG_CAMHC Elongation factor G (EF-G) >gi|153805338|gb|ABS52345.1| translation elongation factor G [Campylobacter hominis ATCC BAA-381] (691 aa)
Score = 2144, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 508/687 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKG--FEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   L   RN GI AHIDAGKTTTSERILF +G  HKIGETH+G + MDWM+QEKERGITITSAAT+  W++  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI FVNKMD+ GANF    + I+ RL    VP+Q+PIGAE++F G++DLI+ K   ++  +      K IP   +D+ K+    LVE VA  D++LM  + +G E+SI +IK+ I+   +     P+LCG+AFKNKG++ LLDAVVD+LP+P +VP  K   E+G EV + ++DD  F  L FK+ATDPFVG+LTFVRVY GVL SGSYV N  K KKERV R+++MH+  R EI+E+ AG+I A++GLKDT TG+TL  +K  V LE M+F  PVIS+AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP +  G  +EFV+ I GG +P+EYI  V  G + AM SG LAGYP++DIK TLFDGS+HEVDSSEMAFK+AAS+  KE  +  + V+LEP+M +EV  PE+Y GD +GD++ RRG +     R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E P++V  EII  +
  S:     1 MARKTPLHMVRNIGIAAHIDAGKTTTSERILFFTGISHKIGETHEGTATMDWMDQEKERGITITSAATTCFWRDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYHVPRIAFVNKMDRVGANFYNVEKQIKDRLKANPVPLQIPIGAEDNFKGVVDLIQMKALVWESDEPTNYVVKDIPADLQDKAKEYHDKLVEAVAETDEKLMEKFFDGVELSIDEIKKGIKTATLSLNIVPMLCGTAFKNKGVQPLLDAVVDYLPAPDEVPNIKGQYENGKEVSVESTDDGEFAALGFKIATDPFVGQLTFVRVYRGVLASGSYVYNAGKGKKERVGRILRMHSNKREEIKELYAGEIGAVVGLKDTLTGDTLASEKDPVILERMEFPDPVISVAVEPKTKADQEKMGIALQKLAQEDPSFRVATDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGKPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPMEPGGENYEFVNDIKGGAVPKEYIPAVDKGCQEAMQSGVLAGYPVVDIKVTLFDGSYHEVDSSEMAFKLAASMGFKEGARKANAVILEPMMKVEVETPEEYMGDVIGDLNKRRGQVNNMSDRGGNKIIDAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPRNVSEEIIKKR 689
>gi|167748167|ref|ZP_02420294.1| hypothetical protein ANACAC_02911 [Anaerostipes caccae DSM 14662] >gi|167652159|gb|EDR96288.1| hypothetical protein ANACAC_02911 [Anaerostipes caccae DSM 14662] (689 aa)
Score = 2143, Expect = 0.0e+00, Identities = 402/672 (59%), Positives = 507/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW---KNCS---------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTT +ERIL+++G  +KIG+TH+G + MDWMEQE+ERGITITSAAT+  W   +NC          +N+IDTPGHVDFTVEVERSLRVLDGAI V DA+ GVEPQ+E VWRQA  Y+VPR+ F+NKMD  GA+F  SV+ I+ RLG  AV IQLPIG E+DF GIIDL E K Y ++  K E      IPD  KD  +     LVE++   DD LM +YLEG+E S+  +K  +RKG   C   P+ CG+A++NKG++ LLDAV++F+P+P D+   K   EDGNE+   +SDD PF  LAFK+ TDPFVG+L F RVYSG + SGSYV N  K KKERV R+++MHA  R E++++ AGDI A +G K T TG+T+ D+K  V LE+M+F +PVI +A+EPKTKA Q KMS AL+KLAEEDPTFK  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVGAPQV+++E+F KE +V+ KY KQSGGRGQYGH K+ FEP   N ++ F+F   +VGG IP+EYI  V AG+E A   G L G+P++ +KAT++DGS+H+VDSSEMAFKIA S+A KEA +    ++LEPIM +EVT PE Y GD +GDI+SRRG IEG +     ++I+A VPL EMFGY+TDLRS +QGRGNY M F+ Y   PKSV  +IIA K
  S:     1 MAHIDAGKTTLTERILYYTGVNYKIGDTHEGTATMDWMEQEQERGITITSAATTCHWTLQENCKPKDGALEHRINIIDTPGHVDFTVEVERSLRVLDGAIGVFDAKGGVEPQSENVWRQADTYDVPRMAFINKMDILGADFYGSVEQIKDRLGANAVMIQLPIGKEDDFQGIIDLFEMKAYIYNDDKGEDISITDIPDDMKDDAEMYHTQLVEQICELDDDLMMEYLEGEEPSVEALKAALRKGTCECTAVPICCGTAYRNKGVQKLLDAVLEFMPAPTDIAAIKGVDEDGNEIERHSSDDEPFAALAFKIMTDPFVGKLAFFRVYSGTMNSGSYVLNATKQKKERVGRILQMHANKREELDKVYAGDIAAAVGFKITATGDTICDEKSPVILESMEFPEPVIDVAIEPKTKAGQGKMSEALAKLAEEDPTFKAHTDEETGQTIISGMGELHLEIIVDRLLREFKVEANVGAPQVAYKESFTKEVDVDSKYAKQSGGRGQYGHCKVHFEPMDANGEELFKFESTVVGGNIPKEYIPAVGAGIEEAAQCGILGGFPVLGVKATVYDGSYHDVDSSEMAFKIAGSMAFKEAMQKAGAIILEPIMRVEVTTPEDYMGDVIGDINSRRGRIEGMDDVGGGKIIRAFVPLAEMFGYSTDLRSRTQGRGNYSMFFNSYEPVPKSVQEKIIADK 687
>gi|189485082|ref|YP_001956023.1| elongation factor G [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287041|dbj|BAG13562.1| elongation factor G [uncultured Termite group 1 bacterium phylotype Rs-D17] (693 aa)
Score = 2143, Expect = 0.0e+00, Identities = 394/684 (57%), Positives = 513/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEE---KAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RNFGI AHIDAGKTTT+ERIL+++GR HKIGE H+G + MDWMEQEKERGITITSAAT   W++   N+IDTPGHVDFT EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA +Y VPRI+F NKMDK GA+F   V  I+++LG K +P+Q+PIGAE+ F GI+DL+  K + + G  EE   K +   +P + +++    R+ ++E +A++ D +M +++EGKE +   IK+ IR   +  +  PVLCG+AFKNKG++ +LDAV D+LPSP+D    K      +E      DD APF  LAFK+  DP++G+LT++RVYSG L+SGSYV N  K+ KER+SR+V+MH+ NR E++ +  GDI A +GLK+T TG+TL D++  + LE+M F  PVI +A+EPK+KAD+EK+ IAL++L+EEDPTF+  T+ ET QTIIAGMGELHL+ILVDRM+REF V+ NVG PQV++RET  K  E E KYI+Q+GGRGQYGHV +  EP +  KG+EFV+KIVGG IPREYI  +  G++ AM SG LAGYP+ D+K  + DGSFHEVDSSEMAFKIA S+A K+A +  SPV+LEPIM  EV VPE+Y GD +GD++SRRG I   E ++ VQ IKA VPL EMFGY+T LRS +QGRGNY M+ SHY E P  + ++I+
  S:     1 MAREYPLNKVRNFGIAAHIDAGKTTTTERILYYTGRTHKIGEVHEGAATMDWMEQEKERGITITSAATYCRWQDMQFNIIDTPGHVDFTAEVERSLRVLDGAVVVFDSGNGVEPQSETVWRQADKYGVPRIVFSNKMDKVGADFFMVVNDIEEKLGAKPIPVQIPIGAESSFQGIVDLVTMKAHIWSG--EELGAKFDITDVPKELEEKAHAARSEMIELIADYSDDIMNNFMEGKESTAVQIKQAIRNATLQIKLIPVLCGTAFKNKGVQPMLDAVCDYLPSPLDRKAFKGINPVTSETDSREVDDKAPFSALAFKIQADPYIGKLTYLRVYSGTLESGSYVYNPIKDAKERISRIVRMHSNNREEVKSVNTGDIAAAVGLKNTGTGDTLCDEEKPILLESMDFPVPVIDVAIEPKSKADEEKLGIALNRLSEEDPTFRVRTNEETNQTIIAGMGELHLEILVDRMKREFNVQANVGRPQVAYRETIRKVQEAESKYIRQTGGRGQYGHVVLTVEPQDPGKGYEFVNKIVGGVIPREYIPAIDKGIKEAMTSGTLAGYPVADVKVVVIDGSFHEVDSSEMAFKIAGSMAFKDACRKASPVILEPIMKTEVIVPEEYMGDVIGDLNSRRGKIVSMESKNKVQHIKANVPLAEMFGYSTTLRSLTQGRGNYSMEPSHYEEVPSQIADKIL 687
>gi|86151758|ref|ZP_01069972.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841387|gb|EAQ58635.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni 260.94] (691 aa)
Score = 2143, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 510/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+R+  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E+S+ +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +V   K   EDG EV + ++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TLV +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V +EII  +
  S:     1 MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSETSDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVANIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLVSEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEIIKKR 689
>gi|148925869|ref|ZP_01809556.1| elongation factor G [Campylobacter jejuni subsp. jejuni CG8486] >gi|145844855|gb|EDK21959.1| elongation factor G [Campylobacter jejuni subsp. jejuni CG8486] (693 aa)
Score = 2143, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 510/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+R+  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E+S+ +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +V   K   EDG EV + ++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TLV +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V +EII  +
  S:     3 MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSETSDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVANIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLVSEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEIIKKR 691
>gi|186902680|ref|ZP_02975622.1| translation elongation factor G [Cyanothece sp. PCC 7424] >gi|186690298|gb|EDU14932.1| translation elongation factor G [Cyanothece sp. PCC 7424] (691 aa)
Score = 2143, Expect = 0.0e+00, Identities = 406/688 (59%), Positives = 520/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR++ L   RN GI AHIDAGKTTT+ERILF++G  HK+GE H+G + MDWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG +AV  +  GV+PQ+ETVWRQA+RY+VPRI FVNKMD+TGANF +  + I+ RL   AVPIQ+PIG+ENDF+GI+DL+  K   +     ++ E+  IP    D+ ++ R  L+E VA  +++L+  YLEG+E++  +I+R +RKG I     P++CGSAFKNKG++LLLDAVVD+LPSP+DVP  K    +G E    A D+APF  LAFK+A DP+ GRLTF+RVYSGVL  GSYV N  K  KER+SRL+ + +  R E++E+RAGD+ A IGLK+T TG+TL DD   + LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTF+  TDPET QT+IAGMGELHL+ILVDRM RE+KVE  VGAPQV++RET  K    EGKYIKQSGG+GQYGHV I  EP++   GFEFV KIVGG IP+EY+ PV+ G++    +G +AGYP+ID+K TL DGS+HEVDSSEMAFKIA S+ +KEA    +PV+LEP+M +EV VPE + GD MGD++SRRG IEG    D +  + AKVPL  MFGYATD+RS +QGRG + M+FSHY E P++V  EIIA  K
  S:     1 MARSIPLERVRNIGIAAHIDAGKTTTTERILFYTGIAHKLGEVHEGTATMDWMAQEQERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVVAVFCSVGGVQPQSETVWRQANRYQVPRIAFVNKMDRTGANFYKVYEQIRDRLRANAVPIQIPIGSENDFHGIVDLVRMKAKIYKDDLGQEIEDAEIPADLADKAQEYRTILIEAVAETEEELLEKYLEGEELTEEEIRRGLRKGTISGAIMPLMCGSAFKNKGVQLLLDAVVDYLPSPLDVPAIKGILPNGEEASRKADDNAPFSALAFKIAADPY-GRLTFMRVYSGVLTKGSYVYNSTKEIKERISRLIVLKSNERIEVDELRAGDLGAAIGLKNTITGDTLCDDAKPIILESLFIPEPVISVAVEPKTKQDMEKLSKALQALSDEDPTFRVTTDPETNQTVIAGMGELHLEILVDRMLREYKVEATVGAPQVAYRETIRKSVRAEGKYIKQSGGKGQYGHVVIEVEPSEPGSGFEFVSKIVGGSIPKEYVAPVEQGIKETCETGVVAGYPVIDLKVTLVDGSYHEVDSSEMAFKIAGSMGIKEAVSKAAPVILEPMMKVEVEVPEDFLGDVMGDLNSRRGAIEGMNSEDGLAKVAAKVPLAAMFGYATDIRSKTQGRGIFSMEFSHYDEVPRNVAEEIIAKSK 688
>gi|150020842|ref|YP_001306196.1| translation elongation factor G [Thermosipho melanesiensis BI429] >gi|189027976|sp|A6LLL0.1|EFG_THEM4 Elongation factor G (EF-G) >gi|149793363|gb|ABR30811.1| translation elongation factor G [Thermosipho melanesiensis BI429] (691 aa)
Score = 2142, Expect = 0.0e+00, Identities = 395/681 (58%), Positives = 517/681 (75%)
  Q:     5 VDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFD-GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           VDL   RN GIMAHIDAGKTTT+ERILF++GR H IG   DG + MDWM QEKERGITI SAAT+  WK+  +N+IDTPGHVDFT+EVER+LRVLDGAIAV DA  GVEPQ+ETVWRQA +Y VPRI F+NKMDK GA+F+ +V+S++++L    +P+Q+P+GAE+ F G+IDLIE K + + D  G E   EE  IP+++  + ++MR  L+E++A  DD++M  YLEG+EIS   IK+ +R+  +  +  PV CGSA  N+G++ LLD V+++LPSP+D+P  K +  DG E+ +   ++ PF  LAFK+  DP+VG+LTF RVYSG L+ GSYV N  K KKER+SRL+ MHA  R ++E +RAGDI A IGLKDT TG+TL D+K  V LE M+F +PVIS+A+EP+TK DQ+K+S AL+ L++EDP+F+ + D ETG+TII+GMGELHL+I+VDR++REF   V VG PQV++RET    +E EGKYI+QSGGRGQYGHV +RFEP +  K FEF D+IVGG IP+EYI  V+ G+  A  SG L+GYPM+ IKA L DGS+HEVDSSEMAFKIAAS+A KEA K   PVLLEP+M++E+T PE+Y G+ + D++SRR  +E  + R ++++IKA VPL EMFGYATDLRS SQGR  Y M  + YA+ P  +   II+
  S:     9 VDLKKLRNIGIMAHIDAGKTTTTERILFYTGRKHNIGSVDDGTATMDWMVQEKERGITIVSAATTCMWKDHRINIIDTPGHVDFTIEVERALRVLDGAIAVFDAAAGVEPQSETVWRQADKYNVPRIAFMNKMDKIGADFDMAVKSMEKKLKANPIPVQMPMGAEDSFEGVIDLIEMKAIRWLDVEGTEMVYEE--IPEKYLAKAEEMREDLLEKLAELDDEIMEMYLEGEEISNELIKKALREATLENKATPVFCGSAKMNRGVQPLLDGVLEYLPSPLDMPPVKGWNSDGEEIEVLPDENEPFTALAFKIQADPYVGKLTFFRVYSGRLEKGSYVYNSTKGKKERISRLIFMHADKREDVEYVRAGDIVAAIGLKDTKTGDTLCDEKRPVILEKMEFPEPVISIAIEPETKKDQDKLSKALTLLSDEDPSFRAYVDNETGETIISGMGELHLEIIVDRLKREFNTNVRVGQPQVAYRETIQVPAEAEGKYIRQSGGRGQYGHVVMRFEPIDLSKTFEFEDRIVGGVIPKEYIPAVEEGVREAAQSGYLSGYPMVGIKAILLDGSYHEVDSSEMAFKIAASMAFKEAVKKAQPVLLEPVMSVEITTPEEYMGNIIADLNSRRAHVESLDSRGHLRIIKALVPLSEMFGYATDLRSQSQGRATYTMVLAKYAKVPDKIAERIIS 690
>gi|33866669|ref|NP_898228.1| elongation factor G [Synechococcus sp. WH 8102] >gi|46576257|sp|Q7U4D2|EFG_SYNPX Elongation factor G (EF-G) >gi|33633447|emb|CAE08652.1| elongation factor EF-G [Synechococcus sp. WH 8102] (690 aa)
Score = 2141, Expect = 0.0e+00, Identities = 401/688 (58%), Positives = 510/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   AVPIQLPIGAE D +GIIDL+  K Y +        EE  IP +  D+  + RA L+E +A  D+ L+  +LE  E+S  ++K+ IR+GV+     P+LCGSAFKNKG++L+LDAV+D+LP+PVDVP  +    DG E +  + D APF  LAFKV  DP+ G+LTFVR+YSG+L+ GSYV N  K +KER+SRLV + A +R E++ +RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    +  EGK+ +Q+GG+GQYGHV I  EP +   GFEFV+KIVGG +P+EYIKP + G+     SG +AGYP+ID++ TL  GS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D    I AKVPL EMFGYAT+LRS +QGRG + M+F +YAE P++V   II+  +
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAVPIQLPIGAEGDLSGIIDLVGNKAYIYKNDLGTDIEEAEIPAEMADEAAEWRATLMETIAETDEALIEKFLETGELSTEELKKGIREGVLKHGLVPMLCGSAFKNKGVQLVLDAVIDYLPAPVDVPPIQGVLPDGKEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGILEKGSYVLNSTKGEKERISRLVVLKADDREEVDALRAGDLGAVLGLKNTTTGDTLCTQDDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVNTDSETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRGSAGGEGKFSRQTGGKGQYGHVVIEMEPGEPGSGFEFVNKIVGGIVPKEYIKPAEQGMRETCESGVIAGYPLIDVRCTLVHGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEVPEDFLGSIIGDLSSRRGQVEGQGVEDGTSKISAKVPLAEMFGYATELRSMTQGRGIFSMEFDNYAEVPRNVAEAIISKNQ 688
>gi|118591187|ref|ZP_01548586.1| elongation factor EF-2 [Stappia aggregata IAM 12614] >gi|118436263|gb|EAV42905.1| elongation factor EF-2 [Stappia aggregata IAM 12614] (691 aa)
Score = 2141, Expect = 0.0e+00, Identities = 406/685 (59%), Positives = 508/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEE-KPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGN-EVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  + ++RNFGIMAHIDAGKTTT+ERILF++G+ HKIGE HDG + MDWMEQE+ERGITITSAAT+  WK   LN+IDTPGHVDFT+EVERSLRVLDGA+A+LDA  GVEPQTETVWRQA +Y VPR+IFVNKMDK GA+F+R V+ I++RLG   + +QLP+GAENDF G IDL+E K   +       A +   IP    D+ ++ R  L+E V   D+ +M  YLEG+E SI  IK+ +RKG I  +F PV CGSAFKNKG++ LLDAVVD+LPSPV+VP  K        E++  +SD+ P   LAFK+A DPFVG LTF R+YSGVL  G  + N  K+K+ERV R+++MH+ +R +I+   AGDI AI GLKDTTTG+TL D    V LE M+F +PVI +AVEPKTK DQEKM +AL++LA EDP+F+  TD E+GQTIIAGMGELHLDI+VDRM+REFKVE N+GAPQV++RET  K SEV+  + KQSGG GQ+  +K+  EP + ++G+ F  KIVGG IP+EYI  V  G+E+ M+SGPLAG+PM+DIKATL DG++H+VDSS +AF+IA     +E      P LLEPIM +EV  PE Y GD +GD++SRRG I GTE R  V VI A VPL  MFGY  +LRS SQGR  Y M F HY + P++V  E+ A
  S:     1 MARTHKIEDYRNFGIMAHIDAGKTTTTERILFYTGKSHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWKEKRLNIIDTPGHVDFTIEVERSLRVLDGAVALLDANAGVEPQTETVWRQADKYHVPRMIFVNKMDKLGADFDRCVKMIKERLGATPLVMQLPVGAENDFAGCIDLLEMKALIWQSENLGAAWDVVDIPADLADRAQEARDALIETVVEVDEAVMEAYLEGEEPSIETIKKLVRKGTISTEFVPVFCGSAFKNKGVQPLLDAVVDYLPSPVEVPDIKGIDPKTEAEIIRKSSDEEPLGLLAFKIANDPFVGSLTFCRIYSGVLNKGVSLLNTVKDKRERVGRMMQMHSNSREDIDVAYAGDIVAIAGLKDTTTGDTLCDPLKPVILERMEFPEPVIEIAVEPKTKGDQEKMGLALNRLAAEDPSFRVKTDEESGQTIIAGMGELHLDIIVDRMKREFKVEANIGAPQVAYRETITKVSEVDYTHKKQSGGSGQFARIKLIIEPAEPNEGYVFESKIVGGSIPKEYIPGVTKGIESVMSSGPLAGFPMLDIKATLIDGAYHDVDSSVLAFEIAGRAGFREGIAKAGPKLLEPIMKVEVVTPEDYMGDVIGDLNSRRGQIAGTENRGVVTVITAMVPLANMFGYVNNLRSMSQGRAQYSMVFDHYEQVPQAVAEEVQA 688
>gi|153952626|ref|YP_001398475.1| elongation factor G [Campylobacter jejuni subsp. doylei 269.97] >gi|166201590|sp|A7H4P5.1|EFG_CAMJD Elongation factor G (EF-G) >gi|152940072|gb|ABS44813.1| translation elongation factor G [Campylobacter jejuni subsp. doylei 269.97] (691 aa)
Score = 2140, Expect = 0.0e+00, Identities = 401/687 (58%), Positives = 510/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+R+  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E+S+ +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +V   K   EDG EV + ++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F+HY E PK+V +EII  +
  S:     1 MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSETSDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVANIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKAVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFNHYDEVPKNVADEIIKKR 689
>gi|119188|sp|P13550|EFG_SPIPL Elongation factor G (EF-G) >gi|581727|emb|CAA33672.1| unnamed protein product [Arthrospira platensis] (697 aa)
Score = 2140, Expect = 0.0e+00, Identities = 404/688 (58%), Positives = 519/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLE----GKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEG--TEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE H+G +V DWM QE+ERGITIT+AA S SW +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI F+NKMD+TGA+F +    I+ RL   AVPIQ+P+G E+DF+G++DL+  K Y +  D G + +  ++ IP++ +D V + R  L+E VA  D+ LM  YLE    G+ ++  +I+  +R+G I     PV+CGS+FKN+G++ LLDAVVD+LP+P +VP  K    DG E +  A DDAP   LAFKV  DP+ GRLTFVRVYSGVL+ GSY+ N  KNKKER+SRL+ + +  R E+EE+RAGD+ A +GLKDT TG+T+ D+   + LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+   D ET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQV++RET  K    EGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G++ A  SG +AGYP+ID+KATL DGS+HEVDSSEMAFKIA S+A+K      SPVLLEP+M +EV VPE + G+ +GD++SRRG IEG  T+Q  ++  + AKVPL  MFGYATD+RS +QGRG + M+FSHY E P+SV   IIA  K
  S:     1 MARTIPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKMGEVHEGTAVTDWMAQERERGITITAAAISTSWLDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQAERYQVPRIAFINKMDRTGADFFKVYGQIRDRLRANAVPIQVPVGRESDFHGLVDLVAMKTYLYTNDLGTDIQVSDE-IPEEVQDLVAEYREKLLEAVAETDEALMEKYLEQLEGGEALTEEEIRHSLRQGTIKGLIVPVICGSSFKNRGVQRLLDAVVDYLPAPTEVPPIKGVLPDGEEGVRYADDDAPLSALAFKVMADPY-GRLTFVRVYSGVLQKGSYIYNATKNKKERISRLIVLKSDERIEVEELRAGDLGAALGLKDTLTGDTICDEANSIILESLYIPEPVISVAVEPKTKQDMEKLSKALQSLSEEDPTFRVSIDSETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVAYRETIRKSIRTEGKFIRQSGGKGQYGHVVIELEPGEPGSGFEFVSKIVGGSVPKEYINPAEQGMKEACESGVIAGYPLIDVKATLVDGSYHEVDSSEMAFKIAGSMAIKNGVTKASPVLLEPMMKVEVEVPEDFIGNVIGDLNSRRGQIEGQETDQSQSIAKVVAKVPLATMFGYATDIRSKTQGRGVFSMEFSHYEEVPRSVAETIIAKSK 695
>gi|114330571|ref|YP_746793.1| elongation factor G [Nitrosomonas eutropha C91] >gi|122314435|sp|Q0AIJ8.1|EFG_NITEC Elongation factor G (EF-G) >gi|114307585|gb|ABI58828.1| translation elongation factor 2 (EF-2/EF-G) [Nitrosomonas eutropha C91] (696 aa)
Score = 2139, Expect = 0.0e+00, Identities = 400/687 (58%), Positives = 521/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M++   L  +RN GIMAHIDAGKTTTSERILF++G  HK+GE HDG + MDWMEQE+ERGITITSAAT+  WK  +       +N+IDTPGHVDFT+EVERSLRVLDGA  V  +  GV+PQTETVWRQA++Y VPR+ FVNKMD++GANF R  + +  RL    VPIQLPIGAE+ F GIIDL++ K VY+ D  +  K EE+ IP   +      R  ++E  A   ++LM  YLE  ++++ DIK+ +R   I  +  P+LCG+AFKNKG++ +LDAV+D+LPSP+DVP  K   E+G E     S+D+PF  LAFK+ATDP+VG+L F RVYSG +KSG  V N  K K+ER+ RL++MHA  R EI+E+  GDI A +GLK+ TTG+TL D    + LE M F +PVI +AVEPKTK DQEKM IAL++LA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM+REF VE NVGAPQV++RE   K+ E+EGK++KQSGGRGQYGHV +R EPN+  KGFEFVD+I GG +PREYI  V+ GL +++++G LAGYP++D+K  LFDGS+H+VDS+E AFK+AAS+A K+  K  SPVLLEP+MA+EV  P ++ G+ +GD+SSRRG+I+G E     +VI+++VPL EMFGY+T LRS +QGR  Y M+F HY+E PK+V   II+ K
  S:     1 MSKRNPLERYRNIGIMAHIDAGKTTTSERILFYTGVSHKLGEVHDGAATMDWMEQEQERGITITSAATTCFWKGMAGNYPEHRINVIDTPGHVDFTIEVERSLRVLDGACTVFCSVGGVQPQTETVWRQANKYGVPRLAFVNKMDRSGANFMRVREQMISRLKANPVPIQLPIGAEDKFAGIIDLVKMKAVYWDDASQGTKFEEREIPASQQADAATWREKMIESAAEASEELMNKYLEAGDLAVEDIKQGLRARTINNEIVPMLCGTAFKNKGVQAMLDAVLDYLPSPLDVPAIKGVDENGLEDERGPSEDSPFAALAFKIATDPYVGQLIFFRVYSGTVKSGDTVFNPVKGKRERIGRLLQMHANQREEIKEVGTGDIAAAVGLKEVTTGDTLCDPNHVITLERMDFPEPVIHVAVEPKTKIDQEKMGIALNRLAQEDPSFRVRTDEESGQTIISGMGELHLEIIVDRMKREFGVEANVGAPQVAYREAIRKQVEIEGKFVKQSGGRGQYGHVWLRMEPNEAGKGFEFVDEIKGGAVPREYIPAVEKGLRDSLSNGVLAGYPVVDVKIALFDGSYHDVDSNENAFKMAASIAFKDGMKKASPVLLEPMMAVEVETPSEFMGNVVGDLSSRRGIIQGMEDIPGFKVIRSEVPLAEMFGYSTILRSATQGRATYSMEFKHYSEAPKNVAEAIISKK 696
>gi|15791857|ref|NP_281680.1| elongation factor G [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237545|ref|YP_178559.1| elongation factor G [Campylobacter jejuni RM1221] >gi|57504744|ref|ZP_00370798.1| translation elongation factor G [Campylobacter coli RM2228] >gi|86149091|ref|ZP_01067323.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86153594|ref|ZP_01071797.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88597042|ref|ZP_01100278.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni 84-25] >gi|157414775|ref|YP_001482031.1| elongation factor G [Campylobacter jejuni subsp. jejuni 81116] >gi|172047078|sp|A8FKR7.1|EFG_CAMJ8 Elongation factor G (EF-G) >gi|21263548|sp|Q9PI16|EFG_CAMJE Elongation factor G (EF-G) >gi|62286462|sp|Q5HVX6|EFG_CAMJR Elongation factor G (EF-G) >gi|57019400|gb|EAL56098.1| translation elongation factor G [Campylobacter coli RM2228] >gi|57166349|gb|AAW35128.1| translation elongation factor G [Campylobacter jejuni RM1221] >gi|85840449|gb|EAQ57706.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85842555|gb|EAQ59767.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88190731|gb|EAQ94704.1| translation elongation factor G [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359854|emb|CAL34641.1| elongation factor G [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|157385739|gb|ABV52054.1| elongation factor EF-G [Campylobacter jejuni subsp. jejuni 81116] (691 aa)
Score = 2139, Expect = 0.0e+00, Identities = 401/684 (58%), Positives = 508/684 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M+R+  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E+S+ +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +V   K   EDG EV + ++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V +EII
  S:     1 MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSETSDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVANIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEII 686
>gi|57242429|ref|ZP_00370367.1| translation elongation factor G [Campylobacter upsaliensis RM3195] >gi|57016714|gb|EAL53497.1| translation elongation factor G [Campylobacter upsaliensis RM3195] (691 aa)
Score = 2139, Expect = 0.0e+00, Identities = 401/687 (58%), Positives = 511/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+RT  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA++V  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF    + I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+++S+ +IK  I+ G +     P+LCG+AFKNKGI+ LLDAVV +LP+P +V   K   EDG+EV ++++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   +VI A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V  EI+  +
  S:     1 MSRTTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDYQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEEQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDESKPTDYVEKEIPAELKEKAEEYRVKMIEAVSETSDELMEKYLGGEDLSLEEIKAGIKAGCLSLSIIPMLCGTAFKNKGIQPLLDAVVAYLPAPDEVVNIKGEYEDGSEVSVTSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGSLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKAVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKVITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVSEEIVKKR 689
>gi|189027839|sp|A8Z6I6.1|EFG_CAMC1 Elongation factor G (EF-G) >gi|158604949|gb|ABW74766.1| translation elongation factor G [Campylobacter concisus 13826] (692 aa)
Score = 2139, Expect = 0.0e+00, Identities = 399/682 (58%), Positives = 507/682 (74%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           R   L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK   +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF R  + I++RL    VPIQ+PIGAE++F G++DL+  K Y + D  K     E+ IP + KD+ ++ RA L+E V+  DD LM  +  G+E++  +IK+ I+ G +     P+LCG+AFKNKGI+ LLDAVVD+LP+P ++       EDG EV + ++DD  F  LAFK+ TDPFVG+LTF+RVY G L+SGSY  N  ++ KER+ RL+KMH+  R EI E+ AG+I A++GLK+T TG+TL  +K  V LE M F +PVIS+AVEPKTKADQEKM+IAL KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKV+  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     GFEFV+ I GG +P+EYI  V+ G + A+ SG LAGYP+ D+K TLFDGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE+Y GD +GD++ RRG +   + R+ V++I A  PL +MFGY+TDLRS +QGR  Y M+F HY E PK+V  EII
  S:     4 RKTPLHKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTAFWKGYQVNLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYHVPRIVFVNKMDRIGANFFRVEEQIRERLKANPVPIQIPIGAEDNFKGVVDLVRMKAYVWNDEKKPTDYVEEEIPAEVKDKAEEYRAKLIEAVSETDDSLMEKFFAGEELTEEEIKKGIKAGCLRMTITPMLCGTAFKNKGIQPLLDAVVDYLPAPDEIAAINGVYEDGTEVTVESTDDGEFAALAFKIMTDPFVGQLTFIRVYRGSLESGSYAYNTVQDCKERIGRLLKMHSNKREEITELFAGEIGAVVGLKNTLTGDTLASEKDKVILERMDFPEPVISVAVEPKTKADQEKMAIALQKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVDAEVGQPQVAYRETIRKAVEQEYKYAKQSGGRGQYGHVFLRIEPLPAASGFEFVNDIKGGVVPKEYIPAVEKGCKEALQSGVLAGYPVEDVKVTLFDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEEYMGDVIGDLNKRRGQVNSMDDRNGVKIIAAYCPLAQMFGYSTDLRSMTQGRATYSMEFDHYEEVPKNVSEEII 687
>gi|146329424|ref|YP_001210154.1| translation elongation factor G [Dichelobacter nodosus VCS1703A] >gi|166201598|sp|A5EX85.1|EFG_DICNV Elongation factor G (EF-G) >gi|146232894|gb|ABQ13872.1| translation elongation factor G [Dichelobacter nodosus VCS1703A] (699 aa)
Score = 2138, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 522/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEE----KAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEV-LISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDK-GFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GIMAHIDAGKTTT+ERILF++G  HK+GE H+G + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERSLRVLDGA  VL +  GV+PQTETVWRQA++Y+VPRI +VNKMD+TGANF R V+ +  RL   AVP+QLP+GAE+ F G++DLI+ K   +D   EE    K E   IP++ + Q ++ R  LVE  A   ++LM  YLE   +S  +I   +R+  I  +  PVLCGS+FKNKG++ +LD V++ LPSPVDVP  +    + NE     ++DDAPF  LAFK+ATDPFVG LTFVR YSGVL++G+ V N  K+KKER+ R+V+MH+ +R EI+E+ AGDI A IGLK+  TGETL D    + LE M+F +PVI++AVEPKTKADQEKM +AL+KLA+EDP+F+  TD ETGQTII+GMGELHL+I+VDRM+REFKVE NVGAPQV++RET  +  E EGK+++QSGGRGQ+GHV +R EP +   G+EFV++IVGG +P+EYI  V  G++  M +G LAGYP++DIK TL+DGS+HEVDSSEMAFK+AA+   K   +   PVLLEP+M +EV+ PE+Y GD +GD++SRRGLI+G +     +VI A+VPL  MFGYAT LRS +QGR NY M+F  Y E P +VV E+I +K
  S:     1 MARETSINKYRNLGIMAHIDAGKTTTTERILFYTGVSHKLGEVHEGAATMDWMEQEQERGITITSAATTCFWQGMAGQFDKHRINIIDTPGHVDFTIEVERSLRVLDGACLVLCSVGGVQPQTETVWRQANKYKVPRIAYVNKMDRTGANFLRVVKQMHDRLKANAVPLQLPVGAEDTFKGVVDLIKMKEIIWD---EETNGLKFEYGDIPEEMRAQAEEYREKLVEAAAESSEELMDKYLESGTLSEEEIIAGLRQRTIANEIIPVLCGSSFKNKGVQAMLDKVIELLPSPVDVPAIQGVNPNTNETEKRESTDDAPFSALAFKIATDPFVGTLTFVRCYSGVLEAGTTVLNSVKDKKERIGRIVQMHSNSRVEIKEVHAGDIAACIGLKEVVTGETLCDVNAPIILERMEFPEPVIAVAVEPKTKADQEKMGLALAKLAQEDPSFRVHTDEETGQTIISGMGELHLEIIVDRMKREFKVEANVGAPQVAYRETIRESVEQEGKFVRQSGGRGQFGHVWLRIEPQEPGFGYEFVNQIVGGVVPKEYIPAVDKGVQEQMQNGVLAGYPVVDIKVTLYDGSYHEVDSSEMAFKLAAAEGFKLGARKAKPVLLEPMMKVEVSTPEEYMGDVIGDLNSRRGLIQGMDDELTGKVIHAQVPLANMFGYATSLRSLTQGRANYSMEFDCYNEAPNNVVEEVIKSK 697
>gi|29653587|ref|NP_819279.1| translation elongation factor G [Coxiella burnetii RSA 493] >gi|161830353|ref|YP_001596182.1| translation elongation factor G [Coxiella burnetii RSA 331] >gi|189027854|sp|A9NAM1.1|EFG_COXBR Elongation factor G (EF-G) >gi|34395591|sp|Q83ES7|EFG_COXBU Elongation factor G (EF-G) >gi|29540849|gb|AAO89793.1| translation elongation factor G [Coxiella burnetii RSA 493] >gi|161762220|gb|ABX77862.1| translation elongation factor G [Coxiella burnetii RSA 331] (699 aa)
Score = 2137, Expect = 0.0e+00, Identities = 394/683 (57%), Positives = 510/683 (74%)
  Q:     2 ARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           AR + L   RN GIMAHIDAGKTTT+ER+L+++G  HK+GE H+G +VMDWMEQE+ERGITITSAAT+  W           +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA+RY VPR+ FVNKMD+ GANF R V  ++ RL    +PIQLPIGAE DF G+IDLI EK +Y+ +  +    E   IP+  K +V++ R  ++E  A   ++LM  YLE  ++S   I++ +R+  +  +  P+LCGSAFKNKG++ LLDAV+D+LPSP DVP  +   +DG+E   SASDD PF  LAFK+A+DPFVG LTF RVYSG+LKSG  V N  K KKER+ RL++MH+ +R EI+E+RAGDI A +GLK  TTG+T+ + +  + LE M F +PVIS+A+EPKTKADQEKM +AL KLA+EDP+F+  TD E+ QTII GMGELHL+I+VDRMRREF VE NVG P+V++RET  +  E +GKYI+Q+GGRGQYG V +R EP +   GFEF + IVGG +PREYI  V+ G+   M +G  AGYP++D+K T+F+GS+H+VDSSEMAFKIA S+A KE      PVLLEPIM +EV  PE+Y GD +GD++ RRG+I+G ++    +++  +VPL EMFGYATDLRS SQGR  Y M+F  YAE P ++   II
  S:     4 AREIPLNRTRNIGIMAHIDAGKTTTTERVLYYTGVSHKMGEVHEGSAVMDWMEQEQERGITITSAATTCYWLGMDQQYPKHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQANRYHVPRLGFVNKMDRAGANFLRVVNQVKDRLNANPIPIQLPIGAEEDFKGVIDLIREKAIYWNEADRGRTYELADIPEDMKAEVQKWREKMIEAAAESSEELMDKYLEAGDLSPEQIRQGLRQRTLANEIVPILCGSAFKNKGVQALLDAVIDYLPSPTDVPAIRGEEDDGSEGSRSASDDEPFAALAFKIASDPFVGTLTFFRVYSGILKSGDSVYNPIKGKKERIGRLLQMHSNSREEIKEVRAGDIAAAVGLKTVTTGDTICNQQNIITLEKMDFPEPVISVAIEPKTKADQEKMGVALGKLAQEDPSFRVHTDEESAQTIIEGMGELHLEIIVDRMRREFNVEANVGKPRVAYRETIRRSVEQQGKYIRQTGGRGQYGDVWLRIEPREPGAGFEFENAIVGGVVPREYIPAVEKGVREQMENGIRAGYPVVDVKVTIFEGSYHDVDSSEMAFKIAGSMAFKEGASKADPVLLEPIMKVEVVTPEEYMGDVVGDLNRRRGMIQGMDESPAGKIVDVEVPLAEMFGYATDLRSLSQGRATYTMEFLKYAEAPSNIAEAII 695
>gi|87125021|ref|ZP_01080868.1| Translation elongation factor G [Synechococcus sp. RS9917] >gi|86167341|gb|EAQ68601.1| Translation elongation factor G [Synechococcus sp. RS9917] (691 aa)
Score = 2137, Expect = 0.0e+00, Identities = 402/688 (58%), Positives = 511/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SWK+  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   AVPIQLPIGAE D +GIIDL+  K Y +     +  E   +P    D+V + R  L+E VA  D+ L+  +LE  E+S  ++K  IR GV+     P+LCGSAFKNKG++L+LDAVVD+LP+PVDVP  +    DG E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K +KER+SRLV + A +R E++E+RAGD+ A++GLK TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ETGQT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    +  EGK+ +Q+GG+GQYGHV I  EP + + GFEFV+KIVGG +P+E+IKP + G++    SG +AG+PMID++ T+ DGS+H+VDSSEMAFKIA S+A K+A K C+PVLLEP+M +EV +PE + G  +GD+SSRRG +EG    D    + AKVPL EMFGYAT+LRS +QGRG + M+FSHY + P++V   II+  +
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWKDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAVPIQLPIGAEGDLSGIIDLVANKAYIYKDDLGKDIEITDVPADMADEVAEWRNTLMEAVAETDEALIEKFLETGELSDEELKSGIRIGVLKHGLVPMLCGSAFKNKGVQLVLDAVVDYLPAPVDVPPIQGVLPDGKEAVRPSDDKAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVLNSTKGEKERISRLVVLKADDREEVDELRAGDLGAVLGLKATTTGDTLCAADDPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVALAEEDPTFRVNTDAETGQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASARGEGKFSRQTGGKGQYGHVVIEMEPGEPESGFEFVNKIVGGVVPKEFIKPSEMGMKETCESGVIAGFPMIDVRVTMVDGSYHDVDSSEMAFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEIPEDFLGSIIGDLSSRRGQVEGQAIDDGTSKVSAKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQ 688
>gi|120402292|ref|YP_952121.1| elongation factor G [Mycobacterium vanbaalenii PYR-1] >gi|189027864|sp|A1T4L5.1|EFG_MYCVP Elongation factor G (EF-G) >gi|119955110|gb|ABM12115.1| translation elongation factor 2 (EF-2/EF-G) [Mycobacterium vanbaalenii PYR-1] (700 aa)
Score = 2136, Expect = 0.0e+00, Identities = 409/685 (59%), Positives = 511/685 (74%)
  Q:     1 MARTV--DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE--EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MA+ V  DL   RN GIMAHIDAGKTTT+ERILF++G  +KIGE HDG + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +Y+VPRI FVNKMDK GA+F  SVQ+++ RLG   VPIQLPIG+E DF G++DL+E K   + G  +  EK +   IP   +++ ++ R  ++E VA  DD+LM  YL G+E++I +IK  +RK  I    +PVLCGSAFKNKG++ +LDAV+D+LP+P+DVP A+ +     + +IS   S D PF GLAFKVAT PF G+LT+VRVYSG + SGS V N  K KKER+ +L +MH+   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+  A+ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV++RET  ++ E VE  + KQ+GG GQ+  V I  EP        +EF +K+ GGRIPREYI  V AG ++AM  G LAGYP++++K TL DG+FHEVDSSEMAFK+A S  LK+A +   PV+LEPIMA+EVT PE Y GD +GD++SRRG I+  E+R   +V+KA+VPL EMFGY  DLRS +QGR NY M F  YAE P +V  EIIA
  S:     1 MAQDVLTDLTKVRNIGIMAHIDAGKTTTTERILFYTGISYKIGEVHDGAATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFSVQTMKDRLGANVVPIQLPIGSEGDFEGVVDLVEMKAKVWRGETKLGEKYDTVEIPADLQEKAEEYRTAMIEAVAETDDELMEKYLGGEELTIEEIKSGLRKLTITSAGYPVLCGSAFKNKGVQPMLDAVIDYLPNPLDVPAAEGHVPGKEDEIISRKPSADEPFSGLAFKVATHPFFGKLTYVRVYSGKVDSGSQVVNSTKGKKERLGKLFQMHSNKENPVESASAGHIYAVIGLKDTTTGDTLCDPNQQIVLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIRRKVEKVEYTHKKQTGGSGQFAKVLIDLEPFTGEDGATYEFENKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNVKVTLLDGAFHEVDSSEMAFKVAGSQVLKKAAQSAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVVKAQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIA 695
>gi|154706464|ref|YP_001425185.1| translation elongation factor G [Coxiella burnetii Dugway 5J108-111] >gi|189027853|sp|A9KD34.1|EFG_COXBN Elongation factor G (EF-G) >gi|154355750|gb|ABS77212.1| translation elongation factor G [Coxiella burnetii Dugway 5J108-111] (699 aa)
Score = 2135, Expect = 0.0e+00, Identities = 394/683 (57%), Positives = 510/683 (74%)
  Q:     2 ARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           AR + L   RN GIMAHIDAGKTTT+ER+L+++G  HK+GE H+G +VMDWMEQE+ERGITITSAAT+  W           +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA+RY VPR+ FVNKMD+ GANF R V  ++ RL    +PIQLPIGAE DF G+IDLI EK +Y+ +  +    E   IP+  K +V++ R  ++E  A   ++LM  YLE  ++S   I++ +R+  +  +  P+LCGSAFKNKG++ LLDAV+D+LPSP DVP  +   +DG+E   SASDD PF  LAFK+A+DPFVG LTF RVYSG+LKSG  V N  K KKER+ RL++MH+ +R EI+E+RAGDI A +GLK  TTG+T+ + +  + LE M F +PVIS+A+EPKTKADQEKM +AL KLA+EDP+F+  TD E+ QTII GMGELHL+I+VDRMRREF VE NVG P+V++RET  +  E +GKYI+Q+GGRGQYG V +R EP +   GFEF + IVGG +PREYI  V+ G+   M +G  AGYP++D+K T+F+GS+H+VDSSEMAFKIA S+A KE      PVLLEPIM +EV  PE+Y GD +GD++ RRG+I+G ++    +++  +VPL EMFGYATDLRS SQGR  Y M+F  YAE P ++   II
  S:     4 AREIPLDRTRNIGIMAHIDAGKTTTTERVLYYTGVSHKMGEVHEGSAVMDWMEQEQERGITITSAATTCYWLGMDQQYPKHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQANRYHVPRLGFVNKMDRAGANFLRVVNQVKDRLNANPIPIQLPIGAEEDFKGVIDLIREKAIYWNEADRGRTYELADIPEDMKVEVQKWREKMIEAAAESSEELMDKYLEAGDLSPEQIRQGLRQRTLANEIVPILCGSAFKNKGVQALLDAVIDYLPSPTDVPAIRGEEDDGSEGSRSASDDEPFAALAFKIASDPFVGTLTFFRVYSGILKSGDSVYNPIKGKKERIGRLLQMHSNSREEIKEVRAGDIAAAVGLKTVTTGDTICNQQNIITLEKMDFPEPVISVAIEPKTKADQEKMGVALGKLAQEDPSFRVHTDEESAQTIIEGMGELHLEIIVDRMRREFNVEANVGKPRVAYRETIRRSVEQQGKYIRQTGGRGQYGDVWLRIEPREPGAGFEFENAIVGGVVPREYIPAVEKGVREQMENGIRAGYPVVDVKVTIFEGSYHDVDSSEMAFKIAGSMAFKEGASKADPVLLEPIMKVEVVTPEEYMGDVVGDLNRRRGMIQGMDESPAGKIVDVEVPLAEMFGYATDLRSLSQGRATYTMEFLKYAEAPSNIAEAII 695
>gi|107101498|ref|ZP_01365416.1| hypothetical protein PaerPA_01002541 [Pseudomonas aeruginosa PACS2] >gi|194551489|ref|YP_002086516.1| elongation factor G [Pseudomonas aeruginosa 2192] >gi|126193882|gb|EAZ57945.1| elongation factor G [Pseudomonas aeruginosa 2192] (702 aa)
Score = 2135, Expect = 0.0e+00, Identities = 405/685 (59%), Positives = 514/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  +  +RN GI+AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +         N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+ +VNKMD+ GA+F R V  I+QRLG   VPIQL IGAE +F+G IDL++ K +Y+ D  +     E+ IP + +   ++ RAH+VE  A  +D+LM  YLEG+E+SI +IK  +R+  +  Q  P + GS+FKNKG+ L+LDAV+D+LP+P ++P  +    D  E      A DD PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R+EI+E+RAGDI A+IG+KD TTG+TL      + LE M F  PVIS+AVEPKTKADQEKM IALSKLA+EDP+F+  TD ET QTII+GMGELHLDI+VDRMRREF VE N+G PQV++RET     E+EGK+++QSGGRGQ+GH  IRF P  +  +G EF +++VGG IPRE+I  +Q G+E+ M +G LAGYP+I +KAT++DGS+H+VDSSEMAFKIAAS+A K   +    VLLEP+M +EV  PE Y GD MGD++ RRGLI+G E     +VI+A+VPL EMFGYATD+RS SQGR +Y M+F  YAE P SV   I+A
  S:     1 MARTTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMVQEQERGITITSAATTAFWQGSTKQFPHRYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGVEPQSETVWRQANKYHVPRLAYVNKMDRQGADFLRVVAQIKQRLGHVPVPIQLAIGAEENFSGQIDLVKMKAIYWNDADQGTSYREEEIPAELRALAEEWRAHMVEAAAEANDELMNKYLEGEELSIEEIKAGLRQRTLANQIVPAVLGSSFKNKGVPLVLDAVIDYLPAPSEIPAIRGTDPDDEEKHDERHADDDEPFSALAFKIATDPFVGTLTFARVYSGVLTSGDAVLNSVKGKKERVGRMVQMHANQRDEIKEVRAGDIAALIGMKDVTTGDTLCAIDKPIILERMDFPDPVISVAVEPKTKADQEKMGIALSKLAQEDPSFRVKTDEETAQTIISGMGELHLDIIVDRMRREFGVEANIGKPQVAYRETIRNTCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLEFHNEVVGGVIPREFIPAIQKGIEDQMQNGVLAGYPLIGLKATVYDGSYHDVDSSEMAFKIAASMATKHLSQKGGAVLLEPVMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDTPAGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFVRYAEVPASVAEAIVA 698
>gi|169830433|ref|YP_001716415.1| translation elongation factor G [Candidatus Desulforudis audaxviator MP104C] >gi|169637277|gb|ACA58783.1| translation elongation factor G [Candidatus Desulforudis audaxviator MP104C] (689 aa)
Score = 2134, Expect = 0.0e+00, Identities = 393/684 (57%), Positives = 518/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGE-DGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR+H+IGE  DG + MDWM QE+ERGITITSAAT+  W++  +N+IDTPGHVDFTVEVERSLRVLDGAIAV DA  GVEPQ+ETVWRQA +Y VPRI+++NKMD+ GA+F +S+QSI+ +LG   V +Q+P+GAE+ F G+IDL+  K + +      K +E PIP      V + R  L+E VA  D++LM  YL G+E+++ DIK  IRK  +  + FPVLCGS+++NKG++ LLDAVVD+LP+P DVP      +  G E    A DD PF  LAFKV  DP+VG+LTF RVYSG + SGS+V N  K KKER+ RL++MHA +R EIE   AGDI   +GLK T+TG+TL D++  + LEAM+F +PVIS+A+EPKTK DQ+KM +AL +LAEEDPTFK  ++ ETGQT+I+GMGELHL+I+VDR+ REFKV+ N+G PQV+++ET    ++ EG++I+Q+GGRGQYGHV I  EP ++ KGF F ++IVGG +P+E+I  V+ G+  A+ SG L GYP+ D+K +L DGS+H VDSSE+AFKIAAS+A+K+A    SPVLLEPIM +EV +PE Y GD + D++SRRG I   E +   Q+++A VPL EMFGYAT+LRS +QGRGN+ MQF HYAE P+++ +++I
  S:     1 MARVFPLERTRNIGIMAHIDAGKTTTTERILFYTGRVHRIGEVDDGAATMDWMVQEQERGITITSAATTCYWRDYRINIIDTPGHVDFTVEVERSLRVLDGAIAVFDAVAGVEPQSETVWRQADKYRVPRIVYLNKMDRVGADFFKSMQSIKTKLGSDPVAVQIPLGAEDRFVGMIDLVTRKAFIYTDDLGTKIKEIPIPADLTGVVAEYREKLLEMVAETDEELMIKYLNGEELTVEDIKIGIRKATLAVKKFPVLCGSSYRNKGVQPLLDAVVDYLPAPTDVPAVCGIDQRTGREDRRVARDDEPFSALAFKVMVDPYVGKLTFFRVYSGTVNSGSHVYNSTKQKKERIGRLLQMHANHREEIEAAHAGDIIGAVGLKFTSTGDTLSDEEHPIILEAMEFPEPVISIAIEPKTKGDQDKMGVALQRLAEEDPTFKIQSNEETGQTLISGMGELHLEIIVDRLLREFKVQANIGRPQVAYKETIKGIAQAEGRFIRQTGGRGQYGHVVIVVEPLDRGKGFAFSNQIVGGVVPKEFIPAVETGVREALTSGVLFGYPVADVKVSLVDGSYHPVDSSEVAFKIAASMAVKKAVANASPVLLEPIMRVEVVLPEDYVGDVISDLNSRRGHITQMEHQGKTQIVRADVPLAEMFGYATELRSRTQGRGNHTMQFDHYAEVPQNIADKMI 686
>gi|167005146|ref|ZP_02270904.1| elongation factor G [Campylobacter jejuni subsp. jejuni 81-176] (702 aa)
Score = 2134, Expect = 0.0e+00, Identities = 400/681 (58%), Positives = 506/681 (74%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK+  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VP+Q+PIGAE++F G+IDL+  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E+S+ +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +VP  K   EDG EV + ++DD  F GLAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V +EII  +
  S:    18 LKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQIPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSETSDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVPNIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEIIKKR 700
>gi|33241114|ref|NP_876056.1| elongation factor G [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|46576264|sp|Q7VA04|EFG_PROMA Elongation factor G (EF-G) >gi|33238644|gb|AAQ00709.1| Translation elongation factor EF-G [Prochlorococcus marinus subsp. marinus str. CCMP1375] (691 aa)
Score = 2134, Expect = 0.0e+00, Identities = 396/685 (57%), Positives = 508/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM QE+ERGITIT+AA S SW+   +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   A PIQLPIGAE D +GIIDL+  K + +        EE  IP    ++  + R+ L+E VA  D++L+  +LE  E++I  +K+ IR+GV+     P+LCGSAFKNKG++L+LDAV+D+LP+P+DVP  +     G + +  + D+APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K+ KER+SRLV + A +R E++++RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TD ET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGKY +Q+GG+GQYGHV I  EP +   GFEF++KIVGG +P+EYI P   G++    SG LAGYP+ID+K T+ DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D +  +++KVPL EMFGYAT LRS +QGRG + M+FS Y E P++V   II+
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMAQERERGITITAAAISTSWQEHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVYDQIKDRLKANAAPIQLPIGAEGDLSGIIDLVSNKAHIYKNDLGTDIEETEIPSDMAEKAAEWRSKLMETVAETDEELIESFLENGELTIDQLKKGIREGVLKHGLVPMLCGSAFKNKGVQLVLDAVIDYLPAPIDVPPIQGVLPSGKDDVRPSEDNAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVLNSTKDAKERISRLVVLKADDREEVDQLRAGDLGAVLGLKNTTTGDTLCSTDDPIVLETLFVPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVSTDQETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSKGEGKYARQTGGKGQYGHVVIEMEPGEPGSGFEFINKIVGGVVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTMVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEVPEDFLGSIIGDLSSRRGQVEGQSIDDGISKVQSKVPLAEMFGYATQLRSMTQGRGIFSMEFSKYEEVPRNVAEAIIS 685
>gi|57240981|ref|ZP_00368929.1| translation elongation factor G [Campylobacter lari RM2100] >gi|57018600|gb|EAL55374.1| translation elongation factor G [Campylobacter lari RM2100] (691 aa)
Score = 2134, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 508/687 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M+RT  L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WKN  +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF    + I+ RL    VP+Q+PIGAE++F G+IDLI  K   + D  K     EK IP + K++ ++ R  ++E V+   D+LM  YL G+E++  +IK  I+ G +     P+LCG+AFKNKG++ LLDAVV +LP+P +V   K   EDG EV + ++DD  F  LAFK+ TDPFVG+LTFVRVY G L+SGSY  N  K+KKER+ RL+KMH+  R EI+ + AG+I A++GLKDT TG+TL  +K  V LE M F  PVIS+AVEPKTKADQEKMSIAL+KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKVE  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     G+EFV+ I GG IP+EYI  V  G++ A+ +G LAGYP+ D+K T++DGS+HEVDSSEMAFK+AAS+  KE  +    V+LEP+M +EV  PE+Y GD +GD++ RRG +   ++R   ++I A  PL EMFGY+TDLRS +QGR  Y M+F HY E PK+V  EII  +
  S:     1 MSRTTPLKRVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKNHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFFNVEEQIKNRLKGNPVPLQIPIGAEDNFKGVIDLITMKALVWEDESKPTDYVEKEIPAELKEKAEEYRVKMIEAVSETSDELMEKYLGGEELTQDEIKAGIKAGCLSLSMVPMLCGTAFKNKGVQPLLDAVVAYLPAPDEVANIKGEYEDGTEVSVKSTDDGEFAALAFKIMTDPFVGQLTFVRVYRGSLESGSYAYNSTKDKKERIGRLLKMHSNKREEIKTLYAGEIGAVVGLKDTLTGDTLASEKDKVILERMDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLEIIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEPGSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSSEMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEEYMGDVIGDLNKRRGQVNSMDERGGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVSEEIIKKR 689
>gi|30249993|ref|NP_842063.1| elongation factor G [Nitrosomonas europaea ATCC 19718] >gi|46576284|sp|Q82T70|EFG_NITEU Elongation factor G (EF-G) >gi|30139100|emb|CAD85964.1| Translation elongation and release factors (GTPases) [Nitrosomonas europaea ATCC 19718] (696 aa)
Score = 2133, Expect = 0.0e+00, Identities = 400/687 (58%), Positives = 519/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MA+   L  +RN GIMAHIDAGKTTTSERILF++G  HK+GE HDG + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERSLRVLDGA  V  A  GV+PQTETVWRQA++Y VPR+ FVNKMD++GANF R  + +  RL    VPIQLPIGAE+ F G+IDL++ K +Y+ D  +  K EE+ IP   +      R  +VE  A   ++LM  YLE  ++SI DIK+ +R   I  +  P+LCG+AFKNKG++ +LDAV+D+LPSP+D+P  K   E+G E     S+D PF  LAFK+ATDP+VG+L F RVYSG +KSG  V N  K KKER+ RL++MHA  R EI+E+  GDI A +GLK+ TTG+TL D    + LE M F +PVI +AVEPKTK DQEKM IAL++LA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM+REF VE NVGAPQV++RE   K+ E+EGK++KQSGGRGQYGHV +R EPN+  KGFEF+D+I GG +PREYI  V+ GL++++A+G LAGYP++D+K  LFDGS+H+VDS+E AFK+AAS+A K+  +  +PVLLEP+MA+EV  P  + G+ +GD+SSRRG+I+G +     +VI+A+VPL EMFGY+T LRS +QGR  Y M+F HY+E PK+V   II  K
  S:     1 MAKKTPLERYRNIGIMAHIDAGKTTTSERILFYTGVSHKLGEVHDGAATMDWMEQEQERGITITSAATTCFWRGMAGNYPEHRINVIDTPGHVDFTIEVERSLRVLDGACTVFCAVGGVQPQTETVWRQANKYGVPRLAFVNKMDRSGANFMRVREQMISRLKTNPVPIQLPIGAEDGFAGVIDLVKMKAIYWDDASQGTKFEEREIPASMQADAAIWREKMVESAAEASEELMNKYLETGDLSIEDIKQGLRVRTINNEIVPMLCGTAFKNKGVQAMLDAVLDYLPSPLDIPAIKGTNENGVEDEREPSEDKPFSALAFKIATDPYVGQLIFFRVYSGTIKSGDTVFNPVKGKKERIGRLLQMHANQREEIKEVGTGDIAAAVGLKEVTTGDTLCDLDHIITLERMDFPEPVIHVAVEPKTKIDQEKMGIALNRLAQEDPSFRVRTDEESGQTIISGMGELHLEIIVDRMKREFGVEANVGAPQVAYREAIRKQVEIEGKFVKQSGGRGQYGHVWLRMEPNEAGKGFEFLDEIKGGVVPREYIPAVEKGLQDSLANGVLAGYPVVDVKVALFDGSYHDVDSNENAFKMAASIAFKDGMRKANPVLLEPMMAVEVETPSDFMGNVVGDLSSRRGIIQGMDDIPGFKVIRAEVPLAEMFGYSTILRSATQGRATYSMEFKHYSEAPKNVAEAIINKK 696
>gi|119485455|ref|ZP_01619783.1| elongation factor EF-2 [Lyngbya sp. PCC 8106] >gi|119457211|gb|EAW38337.1| elongation factor EF-2 [Lyngbya sp. PCC 8106] (697 aa)
Score = 2133, Expect = 0.0e+00, Identities = 405/688 (58%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADY---LEGKEISI-ADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEG--TEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE HDG +V DWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI FVNKMD+TG+NF +  + ++ RL   AVPIQ+PIG+E+DF G++DL+  K Y +  D G + + E   IPD+ KD V++ R  ++E +A  D+ +M  Y   LEG E+    +I+  IRK  I     P+LCGSAFKN+G++ LLD VVD+LP+P +VP  K     G E    A+D+AP   LAFK+  DP+ GRLTFVRVYSGVL+ GSYV N  K+KKER+SRL+ + A +R E++E+RAGD+ A +GLKDT TG+TL DD   + LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+   D ET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  K  + EGK+I+QSGG+GQYGHV I  EP +   GFEF+ KIVGG +P+EYI P   G++ A  SG +AGYP+ID+KATL DGS+H+VDSSEMAFKIA S+A+K+  +  SPVLLEP+M +EV VP+ + G  +GD++SRRG IE   T+Q   +  + AKVPL EMFGYATD+RS +QGRG + M+FSHY E P+SV   IIA  K
  S:     1 MARTIPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKMGEVHDGTAVTDWMAQERERGITITAAAISTSWRDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQAERYKVPRIAFVNKMDRTGSNFFKVYEQVRDRLRANAVPIQVPIGSESDFRGLVDLVAMKTYIYTNDLGTDIQ-ESDEIPDEVKDLVEEYREKMLESLAECDEAMMEKYLGALEGGELPTEEEIRAAIRKATIAGTIVPILCGSAFKNRGVQRLLDCVVDYLPAPTEVPAIKGTLPSGEEEERPANDEAPLSALAFKIMADPY-GRLTFVRVYSGVLQKGSYVYNSSKDKKERISRLIVLKADDRIEVDELRAGDLGAALGLKDTLTGDTLCDDSSPIILESLFIPEPVISVAVEPKTKQDMEKLSKALQSLSEEDPTFRVSIDSETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKAVKTEGKFIRQSGGKGQYGHVVIELEPGESGSGFEFISKIVGGSVPKEYINPAAEGMKEACESGVIAGYPLIDVKATLVDGSYHDVDSSEMAFKIAGSMAIKQGVQKASPVLLEPMMKVEVEVPDDFIGTVIGDLNSRRGQIEAQETDQSQGLAKVTAKVPLAEMFGYATDIRSNTQGRGIFSMEFSHYDEVPRSVAETIIAKSK 695
>gi|194546093|ref|YP_002081121.1| elongation factor G [Pseudomonas aeruginosa C3719] >gi|126167039|gb|EAZ52550.1| elongation factor G [Pseudomonas aeruginosa C3719] (702 aa)
Score = 2133, Expect = 0.0e+00, Identities = 405/685 (59%), Positives = 514/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  +  +RN GI+AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +         N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+ +VNKMD+ GA+F R V  I+QRLG   VPIQL IGAE +F+G IDL++ K +Y+ D  +     E+ IP + +   ++ RAH+VE  A  +D+LM  YLEG+E+SI +IK  +R+  +  Q  P + GS+FKNKG+ L+LDAV+D+LP+P ++P  +    D  E      A DD PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R+EI+E+RAGDI A+IG+KD TTG+TL      + LE M F  PVIS+AVEPKTKADQEKM IALSKLA+EDP+F+  TD ET QTII+GMGELHLDI+VDRMRREF VE N+G PQV++RET     E+EGK+++QSGGRGQ+GH  IRF P  +  +G EF +++VGG IPRE+I  +Q G+E+ M +G LAGYP+I +KAT++DGS+H+VDSSEMAFKIAAS+A K   +    VLLEP+M +EV  PE Y GD MGD++ RRGLI+G E     +VI+A+VPL EMFGYATD+RS SQGR +Y M+F  YAE P SV   I+A
  S:     1 MARTTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMVQEQERGITITSAATTAFWQGSTKQFPHRYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGVEPQSETVWRQANKYHVPRLAYVNKMDRQGADFLRVVAQIKQRLGHVPVPIQLAIGAEENFSGQIDLVKMKAIYWNDDDQGTSYREEEIPAELRALAEEWRAHMVEAAAEANDELMNKYLEGEELSIEEIKAGLRQRTLANQIVPAVLGSSFKNKGVPLVLDAVIDYLPAPSEIPAIRGTDPDDEEKHDERHADDDEPFSALAFKIATDPFVGTLTFARVYSGVLTSGDAVLNSVKGKKERVGRMVQMHANQRDEIKEVRAGDIAALIGMKDVTTGDTLCAIDKPIILERMDFPDPVISVAVEPKTKADQEKMGIALSKLAQEDPSFRVKTDEETAQTIISGMGELHLDIIVDRMRREFGVEANIGKPQVAYRETIRNTCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLEFHNEVVGGVIPREFIPAIQKGIEDQMQNGVLAGYPLIGLKATVYDGSYHDVDSSEMAFKIAASMATKHLSQKGGAVLLEPVMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDTPAGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFVRYAEVPASVAEAIVA 698
>gi|15597267|ref|NP_250761.1| elongation factor G [Pseudomonas aeruginosa PAO1] >gi|21263569|sp|Q9I244|EFG2_PSEAE Elongation factor G 2 (EF-G 2) >gi|9948081|gb|AAG05459.1|AE004634_2 elongation factor G [Pseudomonas aeruginosa PAO1] (702 aa)
Score = 2132, Expect = 0.0e+00, Identities = 404/685 (58%), Positives = 515/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  +  +RN GI+AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +         N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+ +VNKMD+ GA+F R V  I+QRLG   VPIQL IG+E +F+G IDL++ K +Y+ D  +     E+ IP + +   ++ RAH+VE  A  +D+LM  YLEG+E+SI +IK  +R+  +  Q  P + GS+FKNKG+ L+LDAV+D+LP+P ++P  +    D  E      A DD PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R+EI+E+RAGDI A+IG+KD TTG+TL      + LE M F  PVIS+AVEPKTKADQEKM IALSKLA+EDP+F+  TD ET QTII+GMGELHLDI+VDRMRREF VE N+G PQV++RET     E+EGK+++QSGGRGQ+GH  IRF P  +  +G EF +++VGG IPRE+I  +Q G+E+ M +G LAGYP+I +KAT++DGS+H+VDSSEMAFKIAAS+A K+  +    VLLEP+M +EV  PE Y GD MGD++ RRGLI+G E     +VI+A+VPL EMFGYATD+RS SQGR +Y M+F  YAE P SV   I+A
  S:     1 MARTTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMVQEQERGITITSAATTAFWQGSTKQFPHRYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGVEPQSETVWRQANKYHVPRLAYVNKMDRQGADFLRVVAQIKQRLGHVPVPIQLAIGSEENFSGQIDLVKMKAIYWNDADQGTSYREEEIPAELRALAEEWRAHMVEAAAEANDELMNKYLEGEELSIEEIKAGLRQRTLANQIVPAVLGSSFKNKGVPLVLDAVIDYLPAPSEIPAIRGTDPDDEEKHDERHADDDEPFSALAFKIATDPFVGTLTFARVYSGVLTSGDAVLNSVKGKKERVGRMVQMHANQRDEIKEVRAGDIAALIGMKDVTTGDTLCAIDKPIILERMDFPDPVISVAVEPKTKADQEKMGIALSKLAQEDPSFRVKTDEETAQTIISGMGELHLDIIVDRMRREFGVEANIGKPQVAYRETIRNTCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLEFHNEVVGGVIPREFIPAIQKGIEDQMQNGVLAGYPLIGLKATVYDGSYHDVDSSEMAFKIAASMATKQLSQKGGAVLLEPVMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDTPAGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFVRYAEVPASVAEGIVA 698
>gi|126666816|ref|ZP_01737793.1| translation elongation factor EF-G, GTPase [Marinobacter sp. ELB17] >gi|126628861|gb|EAZ99481.1| translation elongation factor EF-G, GTPase [Marinobacter sp. ELB17] (701 aa)
Score = 2131, Expect = 0.0e+00, Identities = 397/684 (58%), Positives = 515/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKA-YGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-----NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +  +RN GI+AH+DAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++YEVPR++FVNKMD+ GANF R V  I++RLG K +P+QLPIGAE DF G+IDLI  K +Y+         E++ +P +  D+V Q R  ++E  A  +D+L   YL+  E+++ DIK+ +R   +  +     CGSAFKNKG++ +LDAVV+FLP+P +V   +    E+G E    A D APF  LAFK+ATDPFVG LTF RVYSG L+SG+ V N  K K+ERV R+V+MHA++R EI+E+ AGDI A IGLK+ TTG+TL D+   + LE M+F  PVIS+AVEPKTKADQEKM +AL KLA+EDP+F+  TD E+GQTII+GMGELHLDI+VDRMRREF VE N+G PQV++RE   K  +VEGK+++QSGGRGQYGHVK+R +P        + F FV++IVGG +P+EYI  VQ G+   M +G LAGYP++ IKATL+DGSFH+VDS+EMAFKIA S+A+K+     SP LLEP+M +EV  PE Y GD +GD++ RRGLI+G E   + ++++ +VPL EMFGYATDLRS +QGR +Y M+FS YAE P ++   II
  S:     1 MARKTPIKRYRNIGIVAHVDAGKTTTTERVLFYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWQGMDKQYPEHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVEPQSETVWRQANKYEVPRMVFVNKMDRAGANFLRVVGQIEKRLGAKCIPVQLPIGAEEDFAGVIDLIRNKAIYWNPDDSGVTYEQRDVPAEMADEVAQYREKMMEAAAEANDELTMRYLDEGELNVEDIKKGLRMRTLANEIVVATCGSAFKNKGVQAVLDAVVEFLPAPNEVKAIRGEVDENGAEETRKADDAAPFAALAFKIATDPFVGTLTFFRVYSGTLQSGNAVYNSVKGKRERVGRMVQMHAKDRQEIKEVLAGDIAAAIGLKNVTTGDTLCDENHKIILERMEFPDPVISVAVEPKTKADQEKMGVALGKLAQEDPSFQVRTDEESGQTIISGMGELHLDIIVDRMRREFSVEANIGKPQVAYRECIRKSVDVEGKFVRQSGGRGQYGHVKVRIDPLPLDKEDAENFIFVNEIVGGTVPKEYIPAVQQGIIEQMKNGCLAGYPLLGIKATLYDGSFHDVDSNEMAFKIAGSMAMKKGALEASPALLEPLMKVEVVTPEDYMGDVVGDLNRRRGLIQGMEDGVSGKIVRCEVPLSEMFGYATDLRSATQGRASYAMEFSRYAEAPNNIAEAII 698
>gi|54296362|ref|YP_122731.1| elongation factor G [Legionella pneumophila str. Paris] >gi|62286656|sp|Q5X862|EFG_LEGPA Elongation factor G (EF-G) >gi|53750147|emb|CAH11539.1| translation elongation factor G [Legionella pneumophila str. Paris] (694 aa)
Score = 2131, Expect = 0.0e+00, Identities = 395/675 (58%), Positives = 505/675 (74%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW-------KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA---EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           +RN GI AH+DAGKTTT+ER+L+++G  HKIGE HDG + MDWM QE+ERGITITSAAT+  W       ++  +N+IDTPGHVDF +EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA++Y VPRI+FVNKMD+ GANF R V  I+QRLG   V +QLPIGAE +F G+IDLI+ K   +D  +E K    +   IP   K   ++ RAH++E  A + ++LM  YLEG+E + A+IK+ +R   I  +  PV CGSAFKNKG++ +LD V+++LPSP D+P  +   E G+E+    S D PF  LAFK+ATDPFVG LT+ R YSG+LKSG  V N  K KKER+ RL++MHA +R EI+E+RAGDI A +GLK  TTG+TL D    V LE M F  PVI++AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII GMGELHL+I+VDRM+REF VE NVG PQV++RET  +  E EGK+++QSGGRGQYGHV ++ EP +  KG+EF++ IVGG IP+EYI  V  G++  M +G +AGYP++D+K TLFDGSFHEVDSSEMAFKIA S   K+      PVLLEPIM++EV  PE Y GD MGD++ RRGL++G E     ++++A+VPL EMFGY+TDLRS +QGR  Y M+F  YAE P ++   II
  S:     8 YRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGAATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVLDGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGSTPVVLQLPIGAEEEFKGVIDLIKMKAIHWD--EENKGMTFKYVDIPADLKATCEEYRAHIIEAAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVIEYLPSPTDIPDIQGVDEHGDEIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILKSGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKVVILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKIEPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFHEVDSSEMAFKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQGMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAII 691
>gi|170078666|ref|YP_001735304.1| translation elongation factor G [Synechococcus sp. PCC 7002] >gi|169886335|gb|ACB00049.1| translation elongation factor G [Synechococcus sp. PCC 7002] (693 aa)
Score = 2130, Expect = 0.0e+00, Identities = 394/688 (57%), Positives = 517/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M R++ L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWMEQE+ERGITIT+AA S SW+N  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY VPRI FVNKMD+TGANF +  + I+ RL   A+ IQ+PIG E++F GIIDL++ + + +     +  E   IP   +D+  + R  ++E +A  D+ L+  YLEG+  + A+I   +R+G I     P+LCGSAFKNKG++LLLDAVVD+LPSP+DVP  +    DG      A D+APF  LAFK+A+DP+ GRL+F+RVYSGV++ GSYV N  K++KER+SRL+ + +  R E++E+RAGD+ A+IG++DT TG+TL +    + LE++   +PVIS+AVEPKTK D EK+S AL  L++EDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE +VG PQV++RET  ++++ EGK+I+QSGG+GQYGHV I+ EP ++  GF F  KIVGG IPREYI  V+ G++ A  SG +AGYPMID+KATL DGSFH+VDSSEMAFKIA S+A++ A    SPV+LEP+M +EV VPE++ GD MGD+++RRG I+G    + +  + AKVPL EMFGYATD+RS +QGRG + M+FS+Y E P+ V   IIA  K
  S:     1 MPRSIALEQVRNIGIAAHIDAGKTTTTERILFYSGIVHKIGEVHDGNAVTDWMEQERERGITITAAAISTSWRNHKVNIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYRVPRIAFVNKMDRTGANFFKVYEQIRDRLKANAIAIQIPIGTESEFQGIIDLVKMRAHIYKDDIGQDIEITEIPAALQDKAAEYRTIMIEAIAESDESLLEKYLEGEAFTEAEIMAALRQGTIAGTIVPLLCGSAFKNKGVQLLLDAVVDYLPSPLDVPPIQGELPDGTLGDRPADDEAPFAALAFKIASDPY-GRLSFIRVYSGVIEKGSYVYNSTKDQKERISRLIVLKSNERIEVDELRAGDLGAVIGMRDTMTGDTLCEANDPIILESLYIPEPVISVAVEPKTKQDMEKLSKALQALSDEDPTFRVSVDPETNQTVIAGMGELHLEILVDRMLREFKVEADVGQPQVAYRETIRQKADAEGKFIRQSGGKGQYGHVVIQIEPGDEGSGFAFESKIVGGAIPREYIPSVEQGMKEACESGIIAGYPMIDLKATLLDGSFHDVDSSEMAFKIAGSIAIRNAVDQASPVVLEPVMQVEVEVPEEFLGDIMGDLNARRGNIQGMNSEEGLAKVSAKVPLAEMFGYATDIRSKTQGRGIFSMEFSNYDEVPRHVAEAIIAKNK 688
>gi|154174200|ref|YP_001408636.1| elongation factor G [Campylobacter curvus 525.92] >gi|189027840|sp|A7GZJ4.1|EFG_CAMC5 Elongation factor G (EF-G) >gi|112803977|gb|EAU01321.1| translation elongation factor G [Campylobacter curvus 525.92] (692 aa)
Score = 2130, Expect = 0.0e+00, Identities = 397/685 (57%), Positives = 505/685 (73%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF-DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           R   L   RN GI AHIDAGKTTTSERILF +G  HKIGE HDG + MDWMEQEKERGITITSAAT+  WK   +NLIDTPGHVDFT+EVERS+RVLDGA+AV  +  GV+PQ+ETVWRQA++Y VPRI+FVNKMD+ GANF      I+ RL    VPIQ+PIGAE+DF G+IDL+  K Y + D  K     EK IP +  ++ ++ RA L+E V+  DD LM  +  G+E+S  +IK+ I+ G +     P+LCG+AFKNKGI+ LL+AVVD+LP+P ++   K   EDG EV + ++DD  F  LAFK+ TDPFVG+LTF+RVY G L+SGSY  N  ++ KER+ RL+KMH+  R EI  + AG+I A++GLK+T TG+TL  +K  V LE M F +PVIS+AVEPKTKADQEKM+IAL KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDRM REFKV+  VG PQV++RET  K  E E KY KQSGGRGQYGHV +R EP     GFEFV+ I GG +P+EYI  V+ G   A+ +G LAGYP+ D+K TL+DGS+HEVDSSEMAFK+AAS+  KE  +  +PV+LEP+M +EV  PE+Y GD +GD++ RRG +   ++R+  ++I A  PL +MFGY+TDLRS +QGR  Y M+F HY E PK+V  EII  +
  S:     4 RKTPLHMVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHDGAATMDWMEQEKERGITITSAATTCFWKQHQINLIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQANKYHVPRIVFVNKMDRIGANFYNVESQIRNRLKANPVPIQIPIGAEDDFKGVIDLVRMKAYVWEDDKKPTDYVEKEIPAELLEKAQEYRAKLIEAVSETDDSLMEKFFSGEELSEEEIKKGIKAGCLRMSIIPMLCGTAFKNKGIQPLLNAVVDYLPAPDEIEAIKGVYEDGTEVTVESTDDGEFAALAFKIMTDPFVGQLTFIRVYRGSLESGSYAYNTVQDSKERIGRLLKMHSNKREEISVLHAGEIGAVVGLKNTLTGDTLASEKDKVILEKMDFPEPVISVAVEPKTKADQEKMAIALQKLAQEDPSFRVNTDEESGQTIISGMGELHLEIIVDRMLREFKVDAEVGQPQVAYRETIRKPVEQEYKYAKQSGGRGQYGHVFLRIEPLEPASGFEFVNDIKGGVVPKEYIPAVEKGCREALQNGVLAGYPVEDVKVTLYDGSYHEVDSSEMAFKLAASMGFKEGARKANPVILEPMMKVEVETPEEYMGDVIGDLNKRRGQVSSMDERNGSKIITAFCPLAQMFGYSTDLRSGTQGRATYSMEFDHYEEVPKNVSEEIIKKR 690
>gi|88812760|ref|ZP_01128006.1| Translation elongation factor G [Nitrococcus mobilis Nb-231] >gi|88789998|gb|EAR21119.1| Translation elongation factor G [Nitrococcus mobilis Nb-231] (697 aa)
Score = 2129, Expect = 0.0e+00, Identities = 396/684 (57%), Positives = 514/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKN-------CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA--EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +  +RN GIMAHIDAGKTTT+ER+LF++G  HKIGE H+G +VMDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERSLRVLDGA+ V  A  GVEPQ+ETVWRQA+RY+VPRI FVNKMD+ GA+F R V+ I+QRLG +A+P+QLPIG+E DF G++DLI  K  ++D   +     ++ P P    +  +     L+   A  +++LM  YL+ + ++  +I   +R   +  +  PVLCGSAFKNKG++ LLDAV+++LPSP D+       EDG+     A+DD PF  LAFK+ATDP+VG LTF RVYSGV+++G  V N  K+K+ER  R+V+MH++ R E++E+RAGDI A IGLKD  TG+TL D    + LE M+F +PVIS+AVEPKTK DQEKM I L KLA+EDP+F+  TD E+GQTII+GMGELHL+I+VDR++REFK+E NVG PQV++RE+  + SE EGK+I+Q+GGRGQYGHV +R EP  + KG+EFV  IVGG IP+EYI  V  G+   M +G LAGYP+ID K TLFDGS+H+VDSSEMAFKIA S+A KEA    +PVLLEPIM +E+  PE++ G  MGDIS RRG ++G E   + ++I+A+VPLKEMFGYATDLRS +QGR +Y M+F  YAE P ++ +EII
  S:     1 MARKTPIERYRNIGIMAHIDAGKTTTTERVLFYTGISHKIGEVHEGAAVMDWMEQEQERGITITSAATTCFWKGMDQQYPETRINIIDTPGHVDFTIEVERSLRVLDGAVGVFCAVGGVEPQSETVWRQANRYQVPRIAFVNKMDRAGADFLRVVKQIRQRLGSQAIPVQLPIGSEEDFAGVVDLIRMKAIYWDEATQGATYKQDDP-PADMLEACQHYHEALIVAAAEANEELMERYLDEESLTSEEINEGLRIRTLNNEIVPVLCGSAFKNKGVQALLDAVIEYLPSPRDIASIGGELEDGSPAERHAADDEPFAALAFKIATDPYVGTLTFFRVYSGVVRTGDTVWNPVKDKRERFGRIVQMHSKERKELDEVRAGDIAAAIGLKDVATGDTLCDPSRKITLERMEFPEPVISVAVEPKTKGDQEKMGIGLQKLAQEDPSFRVRTDEESGQTIISGMGELHLEIIVDRLKREFKIEANVGKPQVAYRESIRRHSEAEGKFIRQTGGRGQYGHVWLRLEPQERGKGYEFVSAIVGGTIPKEYIPSVDKGIREQMDNGVLAGYPVIDFKVTLFDGSYHDVDSSEMAFKIAGSMAFKEAFMKANPVLLEPIMKVEIVTPEEFMGAVMGDISRRRGTVQGMEDSLSGKIIRAEVPLKEMFGYATDLRSATQGRASYAMEFRGYAEAPANIASEII 693
>gi|88799215|ref|ZP_01114794.1| translation elongation factor G [Reinekea sp. MED297] >gi|88777974|gb|EAR09170.1| translation elongation factor G [Reinekea sp. MED297] (698 aa)
Score = 2129, Expect = 0.0e+00, Identities = 403/684 (58%), Positives = 516/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF---DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD---KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   L  +RN GI+AH+DAGKTTT+ERILF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+  S       +N+IDTPGHVDFT+EVERSLRVLDGA+ VL A  GV+PQTETVWRQA RY+VPR++FVNKMD+ GA+F R V+ ++QRLG   VP+QLPIGAE++F G+IDLI+ K   +   D G      +  IP   +D  ++ R +LVE  A  +D+LM  Y+E +E+S  +IK  +R+  +  +     CGSAFKNKG++ +LD+V++++PSP +V   +   EDG    +   DDAPF GLAFK+ATDPFVG LTFVRVY G+LKSG  V N    KKERV R+V+MH+ NR EI+E+ AGDI A+IG+K+ TTG+T  D    + LE M F +PVIS+AVEP++KADQEKM IALSKLA+EDP+FK  TD ETGQTII G GELHLDI+VDRM+REFKVE NVGAPQV++RE     + V+ K+ +QSGGRGQYGHV ++FEP +D   +G EFV++IVGG IP+EYI  VQ G+E  M +G LAGYP++ +KATL+DGSFH+VDS+EMAFK+AAS+A+K+      P LLEP+M +EV  PE Y GD MGD++ RRG + G +   + +VI A+VPL EMFGYATDLRS SQGR +Y M+FS Y E P ++V  II
  S:     1 MARKTPLARYRNIGIVAHVDAGKTTTTERILFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWQGMSQQFDQHRINIIDTPGHVDFTIEVERSLRVLDGAVVVLCASSGVQPQTETVWRQADRYQVPRMVFVNKMDRAGADFLRVVEQMKQRLGANPVPLQLPIGAEDEFKGVIDLIKMKSILWSEDDMGMTFTYGD--IPADLQDLAEEYRTYLVETAAEANDELMEKYMESEELSEEEIKSGLRERTLSGEIVLTHCGSAFKNKGVQAVLDSVIEYMPSPTEVHAIEGELEDGTHQAVEVDDDAPFAGLAFKIATDPFVGTLTFVRVYGGILKSGDSVYNSVSGKKERVGRMVQMHSNNREEIKELLAGDIGALIGIKNVTTGDTFCDPNHVITLERMDFPEPVISVAVEPRSKADQEKMGIALSKLAQEDPSFKVHTDEETGQTIIGGQGELHLDIIVDRMKREFKVECNVGAPQVAYRERIRAVANVDSKFARQSGGRGQYGHVIVKFEPAEDENAEGLEFVNEIVGGAIPKEYIPAVQKGIEEQMQNGVLAGYPLLGLKATLYDGSFHDVDSNEMAFKVAASMAVKKLADQGKPALLEPVMNVEVVTPEDYMGDVMGDLNRRRGTVAGMDDSPSGKVINAEVPLSEMFGYATDLRSMSQGRASYTMEFSAYKEAPMNIVESII 695
>gi|114778827|ref|ZP_01453634.1| translation elongation factor G [Mariprofundus ferrooxydans PV-1] >gi|114550958|gb|EAU53522.1| translation elongation factor G [Mariprofundus ferrooxydans PV-1] (692 aa)
Score = 2128, Expect = 0.0e+00, Identities = 399/688 (57%), Positives = 508/688 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDA-PFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GIMAHIDAGKTTT+ER+LF++G  HKIGE HDG + MDWM QE+ERGITITSAAT+ SW++  +N+IDTPGHVDFT+EVERSLRVLDGA+ V  A  GV+PQ+ETVWRQA +Y VPRI FVNKMD+TGA+F   V+ I++RLG  AV + +PIG E +F G++DL+  K + + D       +   IP   ++  ++ R  L++ V   D+ LM  YLEG+ I  A +K CIRK V+     PVL G+AFKNKG++ LLDAVVD++P+P+DVP  K    D +E  +  S D+ PF  LAFKV TDPFVG LTF RVYSG +++GSYV N  KNKKER+ R+++MHA  R+EI+E+RAGDI A +GLK TTTG+TL   +  + LE M+F +PVIS+A+EPKTKADQEKM IAL +LA EDP+F+  TD ETGQTII+GMGELHL+ILVDRM+REF VE NVG PQV++RET   +++ EGK+++QSGGRGQYGH  +  EP +   GFEFVDKI GG IPREYI  V  G E AM +G LAGYPM+D++ T+ DGS+H+VDS+EMAFK+A S+  +       PV+LEP+M +EV  PE Y GD +GD++ RRG I G E R+N +VI A+VPL EMFGY+T++RS SQGR  Y MQF HY E P ++  EIIA  K
  S:     1 MARKTPLERVRNIGIMAHIDAGKTTTTERVLFYTGVSHKIGEVHDGAATMDWMAQEQERGITITSAATTCSWQDHQINIIDTPGHVDFTIEVERSLRVLDGAVGVFCAVGGVQPQSETVWRQADKYHVPRIAFVNKMDRTGADFFSVVEDIRERLGHNAVALNIPIGNEENFQGVVDLVSMKAIVWKDEAMGAMYDVMDIPADLQEVAEERRELLLDAVLVHDEDLMMAYLEGEAIDEAALKTCIRKAVLDISVIPVLAGTAFKNKGVQTLLDAVVDYMPAPIDVPAIKGVHPDTDEPDVRLSSDSEPFAALAFKVMTDPFVGTLTFFRVYSGEIEAGSYVINSTKNKKERLGRILQMHANERSEIKEVRAGDIAAAVGLKFTTTGDTLCVAEKPIILERMEFPEPVISVAIEPKTKADQEKMGIALGRLAAEDPSFRVRTDEETGQTIISGMGELHLEILVDRMKREFSVEANVGKPQVAYRETIRGKTKAEGKFVRQSGGRGQYGHCWLEIEPMEVGGGFEFVDKITGGSIPREYIPAVGKGAEEAMQNGVLAGYPMVDVRVTVVDGSYHDVDSNEMAFKVAGSMGFRAGCAQAKPVILEPMMEVEVVTPEDYMGDIVGDLNRRRGRILGMEDRNNAKVIDAEVPLSEMFGYSTNVRSMSQGRATYTMQFKHYEEVPNNIAQEIIAAVK 691
>gi|196254763|ref|ZP_03153302.1| translation elongation factor G [Cyanothece sp. PCC 7822] >gi|196203960|gb|EDX98776.1| translation elongation factor G [Cyanothece sp. PCC 7822] (691 aa)
Score = 2128, Expect = 0.0e+00, Identities = 402/688 (58%), Positives = 524/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLI--EEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR++ L   RN GI AHIDAGKTTT+ERILF++G  HK+GE H+G + MDWM QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG +A+  +  GV+PQ+ETVWRQA+RY VPRI FVNKMD+TGANF +    I+ RL   AVPIQ+PIG+E+DF+GI+DL+  + K+Y  D GKE   E+  IP    DQ ++ R  L+E VA   ++L+  YLEG+E++  +I++ IR+G I     P+LCGSAFKNKG++LLLDAVVD+LPSP+DVP  K    +G E   +A D+APF  LAFK+A DP+ GRLTF+RVYSGVL  GSYV N  KN KER+SRL+ + + +R E++E+RAGD+ A IGLK+T TG+TL D+   + LE++   +PVIS+AVEPKTK D EK+  AL  L+EEDPTF+  TDPET QT+IAGMGELHL+ILVDRM RE+KVE +VG PQV++RET  K ++ EGKYI+QSGG+GQYGHV +  +P +   GFEFV KIVGG IP+EY+  V+ G++    +G +AGYP+ID+K TL DGS+HEVDSSEMAFKIA S+ +KEA    SPV+LEP+M +EV VPE + GD +GD++ RRG IEG +  + +  + +KVPL EMFGYATD+RS +QGRG + M+FSHY E P++V  EII+  K
  S:     1 MARSIPLERVRNIGIAAHIDAGKTTTTERILFYTGIAHKLGEVHEGTATMDWMAQEQERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVVALFCSVGGVQPQSETVWRQANRYNVPRIAFVNKMDRTGANFFKVYDQIKDRLRANAVPIQIPIGSESDFHGIVDLVRMKAKIYKDDLGKE--IEDAEIPADLVDQAQEFRTILIEAVAETSEELLEKYLEGEELTEEEIRQGIRRGTITGAIMPLLCGSAFKNKGVQLLLDAVVDYLPSPLDVPAIKGVLPNGEEASRTADDNAPFSALAFKIAADPY-GRLTFLRVYSGVLSKGSYVYNSTKNIKERISRLIVLKSNDRIEVDELRAGDLGAAIGLKNTITGDTLCDEANPIILESLFIPEPVISVAVEPKTKQDMEKLGKALQALSEEDPTFRVNTDPETNQTVIAGMGELHLEILVDRMLREYKVEASVGKPQVAYRETIRKTTKAEGKYIRQSGGKGQYGHVVLEVQPAEPGSGFEFVSKIVGGSIPKEYVPAVEQGIKETCETGIIAGYPVIDLKVTLLDGSYHEVDSSEMAFKIAGSMGIKEAVSKASPVILEPMMKVEVEVPEDFLGDVIGDLNRRRGQIEGMKSEEGLGKVSSKVPLGEMFGYATDIRSNTQGRGIFSMEFSHYEEVPRNVAEEIISKSK 688
>gi|54293318|ref|YP_125733.1| elongation factor G [Legionella pneumophila str. Lens] >gi|62286655|sp|Q5WZL5|EFG_LEGPL Elongation factor G (EF-G) >gi|53753150|emb|CAH14597.1| translation elongation factor G [Legionella pneumophila str. Lens] (694 aa)
Score = 2127, Expect = 0.0e+00, Identities = 395/675 (58%), Positives = 505/675 (74%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW-------KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA---EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           +RN GI AH+DAGKTTT+ER+L+++G  HKIGE HDG + MDWM QE+ERGITITSAAT+  W       ++  +N+IDTPGHVDF +EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA++Y VPRI+FVNKMD+ GANF R V  I+QRLG   V +QLPIGAE +F G+IDLI+ K   +D  +E K    +   IP   K   ++ RAH++E  A + ++LM  YLEG+E + A+IK+ +R   I  +  PV CGSAFKNKG++ +LD V+++LPSP D+P  +   E G+E+    S D PF  LAFK+ATDPFVG LT+ R YSG+LKSG  V N  K KKER+ RL++MHA +R EI+E+RAGDI A +GLK  TTG+TL D    V LE M F  PVI++AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII GMGELHL+I+VDRM+REF VE NVG PQV++RET  +  E EGK+++QSGGRGQYGHV ++ EP +  KG+EF++ IVGG IP+EYI  V  G++  M +G +AGYP++D+K TLFDGSFHEVDSSEMAFKIA S   K+      PVLLEPIM++EV  PE Y GD MGD++ RRGL++G E     ++++A+VPL EMFGY+TDLRS +QGR  Y M+F  YAE P ++   II
  S:     8 YRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGAATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVLDGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGSTPVVLQLPIGAEEEFKGVIDLIKMKAIQWD--EENKGMTFKYVDIPADLKATCEEYRAHIIEAAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVIEYLPSPTDIPDIQGVDEHGDEIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILKSGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKVVILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAIEQEGKFVRQSGGRGQYGHVWLKIEPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFHEVDSSEMAFKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQGMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAII 691
>gi|78189810|ref|YP_380148.1| elongation factor G [Chlorobium chlorochromatii CaD3] >gi|90110689|sp|Q3APH0|EFG_CHLCH Elongation factor G (EF-G) >gi|78172009|gb|ABB29105.1| translation elongation factor 2 (EF-2/EF-G) [Chlorobium chlorochromatii CaD3] (704 aa)
Score = 2127, Expect = 0.0e+00, Identities = 395/683 (57%), Positives = 508/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK---------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++GR+H++GE HDG + MDWMEQEKERGITITSAAT+  W          N  +N+IDTPGHVDFTVEVERSLRVLDGA+A+  A  GVEPQ+ETVWRQA++Y VPRI ++NKMD+TGANF  +V+SI++RLG   VP+Q+PIG    F G +DLI  K   +D       +E  IP   +++ K  R +++E V+  DD L+  YL G++I+  ++++ +R+  +     P+LCGS+FKNKG++ +LDAV+++L SPVDVP  + +     E +    +D+ PF  LAFK+ATDPFVG+LTF RVYSGVLK+GSYV N    KKERV R+++MH+  R +IE +  GDI A +GLKD  TG+TL D+   V LE M F +PVI +A+EPKTK+D +K+ ++L+KLAEEDPTFK  TD ETGQT+IAGMGELHL+ILVDR+RREFKV+ NVG PQV++RET  K  E EGK+++QSGG+GQ+G V ++ EP  + KG+EFVD I GG IPREYI  V AG++ AM  G +AG+PM D++ TLFDG +HEVDSSEMAFKIA S+  K A K   PVLLEPIM +EV  PE+Y GD MGD+SSRRG IEG  QR   Q + AKVPL  MFGY+TDLRS SQGR NY M+F  Y E P+++   +
  S:     1 MARLVALDRVRNIGIMAHIDAGKTTTTERILYYTGRLHRMGEVHDGGATMDWMEQEKERGITITSAATTCFWTPKFGNYQGINHRINIIDTPGHVDFTVEVERSLRVLDGAVALFCAVGGVEPQSETVWRQANKYGVPRIAYINKMDRTGANFFDAVKSIRERLGANPVPLQIPIGEGEMFAGFVDLIRMKGIIYDKEDGSTYQEVEIPHDLQNEAKAWRINMLEAVSEHDDTLLEKYLNGEDITDEEVRKVLRQATLQVTIIPILCGSSFKNKGVQFMLDAVIEYLASPVDVPAVEGHHPRTEEPISRKPTDEEPFAALAFKIATDPFVGKLTFFRVYSGVLKAGSYVLNTITGKKERVGRVLQMHSNKREDIEAVYCGDIAAAVGLKDVKTGDTLCDENNPVVLEKMVFPEPVIQIAIEPKTKSDSDKLGMSLAKLAEEDPTFKVKTDEETGQTLIAGMGELHLEILVDRLRREFKVDANVGKPQVAYRETIRKSVEFEGKFVRQSGGKGQFGLVNLKVEPLEEGKGYEFVDAIKGGVIPREYIPAVNAGIQEAMKGGVVAGFPMQDVRVTLFDGKYHEVDSSEMAFKIAGSIGFKGAAKKADPVLLEPIMKVEVVTPEEYLGDVMGDLSSRRGHIEGMGQRAGAQFVAAKVPLSSMFGYSTDLRSMSQGRANYSMEFECYREVPRNIAESL 694
>gi|116050019|ref|YP_791167.1| elongation factor G [Pseudomonas aeruginosa UCBPP-PA14] >gi|115585240|gb|ABJ11255.1| translation elongation factor G [Pseudomonas aeruginosa UCBPP-PA14] (702 aa)
Score = 2127, Expect = 0.0e+00, Identities = 404/685 (58%), Positives = 514/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  +  +RN GI+AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +         N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+ +VNKMD+ GA+F R V  I+ RLG   VPIQL IGAE +F+G IDL++ K +Y+ D  +     E+ IP + +   ++ RAH+VE  A  +D+LM  YLEG+E+SI +IK  +R+  +  Q  P + GS+FKNKG+ L+LDAV+D+LP+P ++P  +    D  E      A DD PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R+EI+E+RAGDI A+IG+KD TTG+TL      + LE M F  PVIS+AVEPKTKADQEKM IALSKLA+EDP+F+  TD ET QTII+GMGELHLDI+VDRMRREF VE N+G PQV++RET     E+EGK+++QSGGRGQ+GH  IRF P  +  +G EF +++VGG IPRE+I  +Q G+E+ M +G LAGYP+I +KAT++DGS+H+VDSSEMAFKIAAS+A K+  +    VLLEP+M +EV  PE Y GD MGD++ RRGLI+G E     +VI+A+VPL EMFGYATD+RS SQGR +Y M+F  YAE P SV   I+A
  S:     1 MARTTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMVQEQERGITITSAATTAFWQGSTKQFPHRYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGVEPQSETVWRQANKYHVPRLAYVNKMDRQGADFLRVVAQIKLRLGHVPVPIQLAIGAEENFSGQIDLVKMKAIYWNDDDQGTSYREEEIPAELRALAEEWRAHMVEAAAEANDELMNKYLEGEELSIEEIKAGLRQRTLANQIVPAVLGSSFKNKGVPLVLDAVIDYLPAPSEIPAIRGTDPDDEEKHDERHADDDEPFSALAFKIATDPFVGTLTFARVYSGVLTSGDAVLNSVKGKKERVGRMVQMHANQRDEIKEVRAGDIAALIGMKDVTTGDTLCAIDKPIILERMDFPDPVISVAVEPKTKADQEKMGIALSKLAQEDPSFRVKTDEETAQTIISGMGELHLDIIVDRMRREFGVEANIGKPQVAYRETIRNTCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLEFHNEVVGGVIPREFIPAIQKGIEDQMQNGVLAGYPLIGLKATVYDGSYHDVDSSEMAFKIAASMATKQLSQKGGAVLLEPVMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDTPAGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFVRYAEVPASVAEAIVA 698
>gi|83648855|ref|YP_437290.1| translation elongation factor G [Hahella chejuensis KCTC 2396] >gi|119368674|sp|Q2S909|EFG1_HAHCH Elongation factor G 1 (EF-G 1) >gi|83636898|gb|ABC32865.1| translation elongation factor G [Hahella chejuensis KCTC 2396] (699 aa)
Score = 2127, Expect = 0.0e+00, Identities = 398/687 (57%), Positives = 521/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AH+DAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W           +N+IDTPGHVDFT+EVERSLRVLDGA+ VL    GV+PQTETVWRQA++YEVPR++FVNKMD+ GANFER V+ ++ RLG   VP+Q+ IGAE++F G++DL++ K   ++   +    E + IP   +++  ++R  LVE  A  +D  M  YLE  E++  +IK  IR   +  +  PVL GSAFKNKG++ +LDAV+++LPSP +V   +   +DG  V +  SDD  PF  LAFK+ATDPFVG LTF+RVYSGVL+SG+ V N  K+KKER+ R+V+MH+ NR EI+E+RAGDI A+IGLKD TTG+TL D    + LE M+F  PVIS+AVEPK+KADQEKM IAL KLA+EDP+F+  TD ETGQTII+GMGELHLDI+VDRMRREFKVE N+G PQV++RE      E+EGK+++QSGGRGQYGHV I+FEP  + +G EFV++IVGG +P+EY+  +Q G+E  M +G LAGYP++ +KAT+FDGS+H+VDS+EMAFKIAAS+A K+       VLLEPIM +EV  PE+  GD +GD++ RRGLI+G ++  + +V+ A+VPL EMFGYATDLRS +QGR  Y M+F+ YAE P +V   II+ +
  S:     1 MARKTPIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWAGMQQQFDQHRVNIIDTPGHVDFTIEVERSLRVLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRMVFVNKMDRAGANFERVVKQLKDRLGATPVPLQMTIGAEDEFKGVVDLVKMKSIIWNEADQGMTFEYQEIPADLQEKCAKLREQLVEAAAEANDDYMNKYLEEGELTEEEIKAGIRARTLANEIVPVLGGSAFKNKGVQAVLDAVIEYLPSPTEVKAIEGILDDGETVAVRKSDDNEPFSALAFKIATDPFVGTLTFIRVYSGVLESGTGVYNPVKSKKERIGRMVQMHSNNREEIKEVRAGDIAAMIGLKDVTTGDTLCDPNNIITLERMEFPDPVISVAVEPKSKADQEKMGIALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDIIVDRMRREFKVEANIGKPQVAYREAIRNTCEIEGKFVRQSGGRGQYGHVWIKFEPRAEGEGLEFVNEIVGGVVPKEYVPAIQKGIEEQMQNGILAGYPLLALKATVFDGSYHDVDSNEMAFKIAASMATKQLAGKGGAVLLEPIMKVEVVTPEENMGDVVGDLNRRRGLIQGMDESVSGKVVNAEVPLAEMFGYATDLRSATQGRATYTMEFAQYAEAPNNVAEAIISAR 697
>gi|159899795|ref|YP_001546042.1| translation elongation factor G [Herpetosiphon aurantiacus ATCC 23779] >gi|159892834|gb|ABX05914.1| translation elongation factor G [Herpetosiphon aurantiacus ATCC 23779] (701 aa)
Score = 2127, Expect = 0.0e+00, Identities = 405/684 (59%), Positives = 527/684 (77%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW----KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY-------GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           M R+  L   RN GI+AHIDAGKTTT+ERILF++GR +KIGE H+G + MDWMEQE+ERGITIT+AAT+  W    +   +N+IDTPGHVDFT EVERSLRVLDG + V DA  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GANF+R+VQ I  RLG K VPIQLPIGAE+ F GIIDL+E K  F+  D GK +  EE+ IP +  ++ K  R +++E +A  DD+LM  YLEG+E+ + +++R +R   IG +  PVLCGSA KNKG++ +LDAVV  LPSP+++P  KA         ED   +   A ++APF GL FK+  DPFVG+L + RVYSG L++GSYV N  KNK+ERV RL++MHA +R EI+E+ AGDI A++G KDT TG+T+      V LE+++F +PVIS+A+EPKTKADQ+KMSIALS+LAEEDPTF+  TD ETGQTII GMGELHL+++VDRM REFKVE NVG PQV++RE+  +  +++ K+++QSGG+GQYGHVK++FEP+ + +G+ FV+ IVGG +PREY+  V+AG+  AM +G +AGYP++D+KATLFDGS+H+VDSSEMAFKIAAS+ALK+  +   P +LEPIM IEV VPE Y G  +GD++SRRG IEG E R N QV++  VPL  MFGY  DLRS +QGR  Y M+F HY   P+++  E++
  S:     1 MPRSTPLDRVRNIGIIAHIDAGKTTTTERILFYTGRNYKIGEVHEGAATMDWMEQERERGITITAAATTAHWEYAEQRYQINIIDTPGHVDFTAEVERSLRVLDGGVVVFDAVAGVEPQSETVWRQADKYNVPRICFVNKMDRMGANFDRTVQMIVDRLGAKPVPIQLPIGAEDRFQGIIDLMENKAIFYMDDVGKVQ--EEREIPAELAEKAKAAREYMLEAIAETDDELMMLYLEGEELQVPELRRALRAATIGNKLVPVLCGSALKNKGVQRMLDAVVLLLPSPLEIPVTKAVRPGVDSEAEDAEFIERPADENAPFTGLVFKIMADPFVGKLAYFRVYSGKLETGSYVLNTTKNKRERVGRLLQMHANHREEIKEVYAGDIAAVVGPKDTFTGDTICSPDDPVVLESIKFPEPVISVAIEPKTKADQDKMSIALSRLAEEDPTFRLNTDVETGQTIIRGMGELHLEVIVDRMMREFKVEANVGKPQVAYRESITRSVDIDSKFVRQSGGKGQYGHVKVKFEPSGEGEGYIFVNGIVGGVVPREYVPAVEAGIREAMETGVIAGYPVVDVKATLFDGSYHDVDSSEMAFKIAASMALKDGVRKGGPQILEPIMKIEVIVPEDYMGSVIGDVNSRRGRIEGMEARGNAQVVRGFVPLANMFGYVNDLRSQTQGRATYSMEFHHYEPIPRNLQEELV 696
>gi|144900881|emb|CAM77745.1| Elongation factor G (EF-G) [Magnetospirillum gryphiswaldense MSR-1] (694 aa)
Score = 2126, Expect = 0.0e+00, Identities = 398/685 (58%), Positives = 510/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEE-KVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKA--YGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKID--VQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  L  +RN GIMAHIDAGKTTT+ERIL+++G+ +KIGE H+G + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFT+EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GANF R V  I  RLG + + + LPIG E+ F G++DL+    V + D       E+ PIPD   ++  + RA L+E     DD+ M  YL GKE S+  +K CIRKG +   F PVLCGSAFKNKG++ LLDAVVD+LP+PVD+P  K   YG + +E+   ++DD PF GLAFK+  DPFVG LTFVRVYSGV+++GSYV+N  K K+ERV R++ MHA +R E++E RAGDI A  GLKDTTTG+TL D      V LE M+F +PVI +AVEPK+KADQEKM +AL++LA EDP+F+  TD E+GQT+I GMGELHL+ILVDRM+REFKVE NVGAPQV++RET +K ++V+  + KQ+GG GQ+  VKIRFEP  K +GF F + ++GG +P+EY+  V+ G+ +AM +G +AG+P+ID KATL DG++H+VDSS +AF+IAA  A +E      P LLEP+M++EV  PE Y GD +GD++SRRG + G +QR N +VI A VPL  MFGY   LRS SQGR  Y M F HY+E P +V  EI A
  S:     1 MARTTPLERYRNIGIMAHIDAGKTTTTERILYYTGKSYKIGEVHEGTATMDWMEQEQERGITITSAATTAFWNDHRINIIDTPGHVDFTIEVERSLRVLDGAVTVFDSVAGVEPQSETVWRQADKYGVPRICFVNKMDRIGANFYRCVDMIIDRLGARPLVMHLPIGEESGFVGMVDLLRNCAVIWKDESLGAHFEDAPIPDDLVEKAAEYRAQLIETAVEMDDRAMELYLGGKEPSLDVLKACIRKGTLARVFVPVLCGSAFKNKGVQTLLDAVVDYLPAPVDIPAIKGVKYGTE-DEIAKHSTDDEPFAGLAFKIMNDPFVGSLTFVRVYSGVVEAGSYVQNTVKEKRERVGRMLLMHANSREEVKEARAGDIVAFAGLKDTTTGDTLCDPTPSALVILERMEFPEPVIEVAVEPKSKADQEKMGMALARLAAEDPSFRVSTDAESGQTVIKGMGELHLEILVDRMKREFKVEANVGAPQVAYRETISKAADVDYTHKKQTGGSGQFARVKIRFEPAEKGEGFVFSNTVIGGSVPKEYVPGVEKGIRSAMDNGVIAGFPLIDFKATLTDGAYHDVDSSVLAFEIAARAAFREGIAKAGPKLLEPMMSVEVVTPEDYMGDVIGDLNSRRGQVNGMDQRGNARVISAMVPLANMFGYVNTLRSMSQGRAQYTMTFDHYSEVPNNVAEEIRA 690
>gi|119502919|ref|ZP_01625004.1| translation elongation factor G [marine gamma proteobacterium HTCC2080] >gi|119461265|gb|EAW42355.1| translation elongation factor G [marine gamma proteobacterium HTCC2080] (702 aa)
Score = 2126, Expect = 0.0e+00, Identities = 398/685 (58%), Positives = 515/685 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDA-PFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD---KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   +  +RN GI AH+DAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGA+ VL    GV+PQTETVWRQA++YEVPR++F+NKMD+ GA+F   V+ +++RL   AVPIQ+ IG+E +F G++DL++ K   ++    G   E  E   +P    DQV +MR +++E  A  +D+LM  YLE  E+S ADIKR +R   +  +  PVL GSAFKNKG++ +LDAV+D+LPSP +V   +   EDG   +   SDD  PF  LAFK+ATDPFVG LTF RVYSG L SG+ V N  K KKERV R+V+MHA +R EI+E+ AGDI A IGLKD TTG+TL D    V LE M+F +PVIS+AVEP+++ADQEKM +AL KLA+EDP+F+  TD ETGQTII+GMGELHLDI+VDRMRREF VE N+G PQV++RE      E+EGK+++QSGGRGQYGHV ++FEP +D    G EFV+++VGG +P+EYI  V  G+E  M +G LAGYP++ +KATL+DGSFH+VDS+EMAFKIAASLA ++  +V    LLEP+M +EV  PE + GD +GD++ RRG+I G +   + +VI A+VPL EMFGYATDLRS +QGR  Y M+F+ YAE P +V   II+
  S:     1 MARQTPIQRYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWQGMQQQYDQHRINIIDTPGHVDFTIEVERSLRVLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRMVFINKMDRAGADFGNVVEQLRERLNCNAVPIQMTIGSEENFVGVVDLVKNKSILWNEDDMGATFEYGE---VPADLVDQVGEMREYMMEAAAEANDELMEAYLEDGELSEADIKRGLRARTLANEIVPVLGGSAFKNKGVQAVLDAVIDYLPSPTEVKAIEGTLEDGETSVERHSDDEEPFAALAFKIATDPFVGTLTFFRVYSGKLTSGTAVYNSIKGKKERVGRMVQMHANSREEIKEVLAGDIAAAIGLKDVTTGDTLSDPDKAVILERMEFPEPVISVAVEPRSQADQEKMGVALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDIIVDRMRREFSVEANIGKPQVAYRERIRNTVEIEGKFVRQSGGRGQYGHVWVKFEPAEDLGADGLEFVNEVVGGSVPKEYIPAVNKGIEEQMRNGVLAGYPLLGLKATLYDGSFHDVDSNEMAFKIAASLATRQLAEVGGAALLEPVMKVEVVTPEDHMGDVVGDLNRRRGMILGMDDNASGKVINAEVPLAEMFGYATDLRSATQGRATYTMEFAQYAEAPNAVAQAIIS 697
>gi|154499817|ref|ZP_02037855.1| hypothetical protein BACCAP_03474 [Bacteroides capillosus ATCC 29799] >gi|150271415|gb|EDM98672.1| hypothetical protein BACCAP_03474 [Bacteroides capillosus ATCC 29799] (702 aa)
Score = 2126, Expect = 0.0e+00, Identities = 398/687 (57%), Positives = 523/687 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEV-LISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R V L N RN GIMAHIDAGKTTT+ERIL+++G  +KIGETHDG + MDWM QE+ERGITITSAAT+  W+          +N+IDTPGHVDFTVEVERSLRVLDG++ V+ A+ GVEPQ+ETVWRQA  Y+VPR+I+VNKMD  GA+F   +  I  RL   AVPIQLPIG+E+ F GIIDL+E    +Y+ + GK+ + E  PIP+   +  ++ R  L++  A+  D++M   LE + I    I++ +R+G I  +  PV CG++++NKG++ LLDA+VD++PSPVD+P  +    D +E     ASD+APF  LAFK+ATDPFVGRL+F+RVYSGVL +G+ V N  K +KER+ R+++MHA +R +IE + +GDI A+IGLK++TTG+TL D+K  + LE+M+F +PVI +A+EPKTKA QEKM IAL+KLAEEDPTFKT+TD ETGQTIIAGMGELHL+I+VDR+ RE+KVE NVGAPQV+++ET  K  E + KY +QSGG+GQYGHVKI  EPN+  KG+EFV++I GG IP+EYI  V AG++ AM +G LAGYP+ D+K  L  GS+HEVDSSEMAFKIA S+A KEA +  +P+LLEP+M + V VP++Y G+ +GD++ RRG+I+G E R     + A VPL  MFGYATDLRS +QGRG Y M+   Y E PKS+  +IIA +
  S:     1 MPRKVSLENTRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGTATMDWMAQEQERGITITSAATTCYWQGTKNQFPQTRINIIDTPGHVDFTVEVERSLRVLDGSVTVMCAKGGVEPQSETVWRQADHYKVPRMIYVNKMDIMGADFYHVLDMIHDRLKCNAVPIQLPIGSESSFKGIIDLVEMDADIYYDEMGKDMRVE--PIPEDMMELAQEYRTKLIDACADLSDEIMELALEEQPIPQDLIRKVLRQGTIDNKVVPVTCGTSYRNKGVQKLLDAIVDYMPSPVDIPAIQGVNPDTDEEDSRPASDEAPFSALAFKIATDPFVGRLSFIRVYSGVLNTGTAVLNSTKKQKERIGRILQMHANHREDIETVYSGDIAAVIGLKNSTTGDTLCDEKHPIILESMEFPEPVIRVAIEPKTKAGQEKMGIALAKLAEEDPTFKTYTDEETGQTIIAGMGELHLEIIVDRLLREYKVEANVGAPQVAYKETIKKTVEQDTKYARQSGGKGQYGHVKIVVEPNESGKGYEFVNEITGGVIPKEYIPAVDAGIQGAMQAGVLAGYPVEDVKVRLIYGSYHEVDSSEMAFKIAGSMAFKEACRKANPILLEPMMKVSVIVPDEYLGNVIGDLNGRRGMIQGQESRTGATQVDALVPLANMFGYATDLRSSTQGRGQYSMEPHSYVEIPKSIAEKIIAER 696
>gi|148361056|ref|YP_001252263.1| elongation factor G [Legionella pneumophila str. Corby] >gi|166201610|sp|A5IHR7.1|EFG_LEGPC Elongation factor G (EF-G) >gi|148282829|gb|ABQ56917.1| translation elongation factor G (EF-G) [Legionella pneumophila str. Corby] (694 aa)
Score = 2126, Expect = 0.0e+00, Identities = 394/675 (58%), Positives = 504/675 (74%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW-------KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA---EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           +RN GI AH+DAGKTTT+ER+L+++G  HKIGE HDG + MDWM QE+ERGITITSAAT+  W       ++  +N+IDTPGHVDF +EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA++Y VPRI+FVNKMD+ GANF R V  I+QRLG   V +QLPIGAE +F G+IDLI+ K   +D  +E K    +   IP   K   ++ RAH++E  A + ++LM  YLEG+E + A+IK+ +R   I  +  PV CGSAFKNKG++ +LD V+++LPSP D+P  +   E G+E+    S D PF  LAFK+ATDPFVG LT+ R YSG+LKSG  V N  K KKER+ RL++MHA +R EI+E+RAGDI A +GLK  TTG+TL D    V LE M F  PVI++AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII GMGELHL+I+VDRM+REF VE NVG PQV++RET  +  E EGK+++QSGGRGQYGHV ++ EP +  KG+EF++ IVGG IP+EYI  V  G++  M +G +AGYP++D+K TLFDGSFHEVDSSEMA KIA S   K+      PVLLEPIM++EV  PE Y GD MGD++ RRGL++G E     ++++A+VPL EMFGY+TDLRS +QGR  Y M+F  YAE P ++   II
  S:     8 YRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGAATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVLDGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGSTPVVLQLPIGAEEEFKGVIDLIKMKAIHWD--EENKGMTFKYVDIPADLKATCEEYRAHIIEAAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVIEYLPSPTDIPDIQGVDEHGDEIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILKSGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKVVILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKIEPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFHEVDSSEMALKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQGMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAII 691
>gi|52840571|ref|YP_094370.1| elongation factor G [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|62286659|sp|Q5ZYP6|EFG_LEGPH Elongation factor G (EF-G) >gi|52627682|gb|AAU26423.1| translation elongation factor G (EF-G) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (694 aa)
Score = 2125, Expect = 0.0e+00, Identities = 394/675 (58%), Positives = 504/675 (74%)
  Q:    10 FRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW-------KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA---EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           +RN GI AH+DAGKTTT+ER+L+++G  HKIGE HDG + MDWM QE+ERGITITSAAT+  W       ++  +N+IDTPGHVDF +EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA++Y VPRI+FVNKMD+ GANF R V  I+QRLG   V +QLPIGAE +F G+IDLI+ K   +D  +E K    +   IP   K   ++ RAH++E  A + ++LM  YLEG+E + A+IK+ +R   I  +  PV CGSAFKNKG++ +LD V+++LPSP D+P  +   E G+ +    S D PF  LAFK+ATDPFVG LT+ R YSG+LKSG  V N  K KKER+ RL++MHA +R EI+E+RAGDI A +GLK  TTG+TL D    V LE M F  PVI++AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII GMGELHL+I+VDRM+REF VE NVG PQV++RET  +  E EGK+++QSGGRGQYGHV ++ EP +  KG+EF++ IVGG IP+EYI  V  G++  M +G +AGYP++D+K TLFDGSFHEVDSSEMAFKIA S   K+      PVLLEPIM++EV  PE Y GD MGD++ RRGL++G E     ++++A+VPL EMFGY+TDLRS +QGR  Y M+F  YAE P ++   II
  S:     8 YRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGAATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVLDGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGSTPVVLQLPIGAEEEFKGVIDLIKMKAIHWD--EENKGMTFKYVDIPADLKSTCEEYRAHIIEAAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVIEYLPSPTDIPDIQGVDEHGDVIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILKSGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKVVILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKIEPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFHEVDSSEMAFKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQGMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAII 691
>gi|124024054|ref|YP_001018361.1| elongation factor G [Prochlorococcus marinus str. MIT 9303] >gi|166220160|sp|A2CC86.1|EFG_PROM3 Elongation factor G (EF-G) >gi|123964340|gb|ABM79096.1| Elongation factor G [Prochlorococcus marinus str. MIT 9303] (691 aa)
Score = 2125, Expect = 0.0e+00, Identities = 400/688 (58%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTT +ERILF+SG +HK+GE HDG +V DWM QE+ERGITIT+AA S +W +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   A+PIQLPIGAE D +GIIDL++ K + +     +  EE  IPD  K+   + RA L+E VA  D++L+  +LE +E+S A +   IR+GV+     P+LCGSAFKNKG++LLLDAVVD+LP+PVDVP  +    +G E +  + D+APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  KN+KER+SRL+ + A +R E++ +RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP +   GFEFV+KIVGG +P+EYIKP ++G+     SG +AGYP+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV +PE + G  +GD+SSRRG +EG    D +  +++KVPL EMFGYAT LRS +QGRG + M+FSHY E P++V   II+  +
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTCTERILFYSGVVHKMGEVHDGAAVTDWMAQERERGITITAAAISTTWNDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKNRLKANAIPIQLPIGAEGDLSGIIDLVKNKAFIYKDDLGKDIEETEIPDHMKELAAEWRAKLMECVAETDEELIEVFLETEELSEAQLASGIREGVLNHGLVPLLCGSAFKNKGVQLLLDAVVDYLPAPVDVPPIQGLLPNGKEAVRPSDDNAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVLNSTKNEKERISRLIILKADDREEVDALRAGDLGAVLGLKNTTTGDTLCTTDDPIVLETLYIPEPVISVAVEPKTKGDMEKLSKALLSLAEEDPTFRVSTDPETSQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASSKGEGKFARQTGGKGQYGHVVIEMEPGEPGSGFEFVNKIVGGIVPKEYIKPAESGMRETCESGVIAGYPLIDVKVTMVDGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEIPEDFLGSIIGDLSSRRGQVEGQSIDDGLSKVQSKVPLAEMFGYATQLRSMTQGRGIFSMEFSHYEEVPRNVAEAIISKNQ 688
>gi|191163796|ref|ZP_03025667.1| translation elongation factor G [Geobacter sp. M21] >gi|190994961|gb|EDV70418.1| translation elongation factor G [Geobacter sp. M21] (692 aa)
Score = 2124, Expect = 0.0e+00, Identities = 397/688 (57%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE---VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+ +WK+  +N+IDTPGHVDFT+EVERSLRVLDGA+AV  +  GVEPQ+ETVWRQA +Y VPR+ F+NKMD+ GA+F R V  I+ RL    VP+Q+PIG+E ++ G++DLI  K + + D       +   IP    +Q ++ R  L+EEV++ DD LM  YL G+EIS  ++K  IR+  +  +  PV+CGS+FKNKG++ LLDAV+D++P+P D+P  +  G D N    +   ASD  PF  L FK+ TDPFVG+L F RVYSGV++SGSYV N  K K+ER+ R++KMHA  R EI+E+ AGDI A +GLK TTTG+TL  +   V LE+++F +PVIS+A+EPKTKADQEK+ ++L KLA EDP+F+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVG PQV++RET  K+ + EGK+++QSGGRGQ+GHV +  EP +  KG+EFVD I GG +PREYI  V  G++ A+ +G +AG+P++DIK TL DGS+HEVDSSEMAFKIA S+  KE  +  SP++LEPIM++EV VPE+Y GD +GD++SRRG I G E R   QV+ + VPL +MFGY+TDLRS +QGR  Y M F HY   PKSV  EI+A  K
  S:     1 MARQVSLEMTRNIGIMAHIDAGKTTTTERILYYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCNWKDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCSVGGVEPQSETVWRQADKYHVPRLAFINKMDRIGADFFRGVAMIKDRLKANPVPLQIPIGSEENYKGVVDLILMKGIVWNDESMGATYDVIDIPADLVEQAQEYRDALIEEVSSHDDVLMEKYLGGEEISNEELKAAIRQCTLDIKICPVICGSSFKNKGVQNLLDAVLDYMPAPTDIPAIQ--GVDANTEAPIERHASDSEPFAALGFKIMTDPFVGQLCFFRVYSGVIQSGSYVYNATKGKRERIGRILKMHANKREEIKEVYAGDIAAAVGLKYTTTGDTLCAEDHAVILESIEFPEPVISIAIEPKTKADQEKLGLSLGKLASEDPSFRVKTDEETGQTIISGMGELHLEIIVDRLFREFKVEANVGKPQVAYRETITKKVKAEGKFVRQSGGRGQFGHVWLEVEPQEAGKGYEFVDAIKGGVVPREYIPAVDKGIKEALDNGVMAGFPVVDIKVTLVDGSYHEVDSSEMAFKIAGSMGFKEGCQKASPIILEPIMSVEVVVPEEYMGDVIGDLNSRRGRIMGMEGRAGAQVVASMVPLAQMFGYSTDLRSATQGRATYSMTFDHYEPVPKSVAEEIVAKVK 691
>gi|33864048|ref|NP_895608.1| elongation factor G [Prochlorococcus marinus str. MIT 9313] >gi|46576262|sp|Q7V501|EFG_PROMM Elongation factor G (EF-G) >gi|33635632|emb|CAE21956.1| Elongation factor G, EF-G [Prochlorococcus marinus str. MIT 9313] (691 aa)
Score = 2123, Expect = 0.0e+00, Identities = 403/688 (58%), Positives = 520/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF--DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTT +ERILF+SG +HK+GE HDG +V DWM QE+ERGITIT+AA S +W +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   A+PIQLPIGAE D +GIIDL++ K + +  D GKE   EE  IPD  K+   + R+ L+E VA  D++L+  +LE +E+S A +   IR+GV+     P+LCGSAFKNKG++LLLDAVVD+LP+PVDVP  +    +G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL+ GSYV N  KN+KER+SRL+ + A +R E++ +RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  LAEEDPTF+  TDPET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S+ EGK+ +Q+GG+GQYGHV I  EP +   GFEFV+KIVGG +P+EYIKP ++G+     SG +AGYP+ID+K T+ DGS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV +PE + G  +GD+SSRRG +EG    D +  +++KVPL EMFGYAT LRS +QGRG + M+FSHY E P++V   II+  +
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTCTERILFYSGVVHKMGEVHDGAAVTDWMAQERERGITITAAAISTTWNDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKNRLKANAIPIQLPIGAEGDLSGIIDLVKNKAFIYKDDLGKE--IEETEIPDHMKEIAAEWRSKLMECVAETDEELIEVFLETEELSEAQLASGIREGVLNHGLVPLLCGSAFKNKGVQLLLDAVVDYLPAPVDVPPIQGLLPNGKEAVRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLEKGSYVLNSTKNEKERISRLIILKADDREEVDALRAGDLGAVLGLKNTTTGDTLCTTDDPIVLETLYIPEPVISVAVEPKTKGDMEKLSKALLSLAEEDPTFRVSTDPETSQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASSKGEGKFARQTGGKGQYGHVVIEMEPGEPGSGFEFVNKIVGGIVPKEYIKPAESGMRETCESGVIAGYPLIDVKVTMVDGSYHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEIPEDFLGAIIGDLSSRRGQVEGQSIDDGLSKVQSKVPLAEMFGYATQLRSMTQGRGIFSMEFSHYEEVPRNVAEAIISKNQ 688
>gi|183981034|ref|YP_001849325.1| elongation factor G, FusA1 [Mycobacterium marinum M] >gi|183174360|gb|ACC39470.1| elongation factor G, FusA1 [Mycobacterium marinum M] (701 aa)
Score = 2123, Expect = 0.0e+00, Identities = 404/680 (59%), Positives = 505/680 (74%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY--GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGE HDG + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +Y+VPRI FVNKMDK GA+F  SV+++++RLG   +PIQLP+G+E DF G++DL+E   KV+  D    EK +   IP   +++  + R  L+E VA  D+ L+  YL G+E++ A+IK  IRK  I  + +PVLCGSAFKNKG++ +LDAV+D+LPSP+DVP A  +  G++  EV+   S D PF  LAFKVAT PF G+LT+VRVYSG + SGS V N  K KKER+ +L +MH+   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+S+++ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV+++ET  +  E VE  + KQ+GG GQ+  V I  EP        +EF  K+ GGRIPREYI  V AG ++AM  G LAGYP++++K TL DG+FHEVDSSEMAFKIA S  LK+A     PV+LEPIMA+EVT PE Y GD +GD++SRRG I+  E+R   +V+KA VPL EMFGY  DLRS +QGR NY M F  YAE P +V  EIIA
  S:     9 DLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGAATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMEERLGANVIPIQLPVGSEGDFEGVVDLVEMKAKVWSADAKLGEKYDVVDIPADLQEKADEYRTKLLEAVAETDEALLEKYLGGEELTEAEIKGAIRKLTITSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPAAIGHVPGKEDEEVVRKPSTDEPFSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINSTKGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLSDPNNQIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDQETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIKRLVEKVEFTHKKQTGGSGQFAKVLISIEPFTGEDGATYEFESKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLDGAFHEVDSSEMAFKIAGSQVLKKAAAAAHPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVVKAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIA 696
>gi|152988276|ref|YP_001348583.1| elongation factor G [Pseudomonas aeruginosa PA7] >gi|150963434|gb|ABR85459.1| translation elongation factor G [Pseudomonas aeruginosa PA7] (730 aa)
Score = 2123, Expect = 0.0e+00, Identities = 401/685 (58%), Positives = 513/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR+  +  +RN GI+AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +         N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+ +VNKMD+ GA+F R V  I+QRLG   VPIQL IGAE +F+G +DL++ K +Y+ D  +     E+ IP + +   ++ RAH+VE  A  +D+LM  YLEG+E+S+ +IK  +R+  +  Q  P + GS+FKNKG+ L+LDAV+D+LP+P ++P  K    D  E      A D  PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R EI+E+RAGDI A+IG+KD TTG+TL      + LE M F  PVIS+AVEPKTKADQEKM IALSKLA+EDP+F+  TD ET QTII+GMGELHLDI+VDRMRREF VE N+G PQV++RET     E+EGK+++QSGGRGQ+GH  IRF P  +  +G EF +++VGG IPRE+I  +Q G+E+ M +G LAGYP++ +KAT++DGS+H+VDSSEMAFKIAAS+A K+  +    VLLEP+M +EV  PE Y GD MGD++ RRGLI+G E     +VI+A+VPL EMFGYATD+RS SQGR +Y M+F  YAE P SV   I+A
  S:    29 MARSTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMVQEQERGITITSAATTAFWQGSTKQFPQRYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGVEPQSETVWRQANKYHVPRLAYVNKMDRQGADFLRVVAQIKQRLGHTPVPIQLAIGAEENFSGQVDLVKMKAIYWNDDDQGTSYREEEIPAELRALAEEWRAHMVEAAAEANDELMNKYLEGEELSVEEIKAGLRQRTLANQIVPAVLGSSFKNKGVPLVLDAVIDYLPAPSEIPAIKGTDPDDEEKHDERHADDSEPFSALAFKIATDPFVGTLTFARVYSGVLTSGDAVLNSVKRKKERVGRMVQMHANQREEIKEVRAGDIAALIGMKDVTTGDTLCAIDKPIILERMDFPDPVISVAVEPKTKADQEKMGIALSKLAQEDPSFRVKTDEETAQTIISGMGELHLDIIVDRMRREFGVEANIGKPQVAYRETIRNTCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLEFHNEVVGGVIPREFIPAIQKGIEDQMQNGVLAGYPLLGLKATVYDGSYHDVDSSEMAFKIAASMATKQLSQKGGAVLLEPVMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDTPAGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFVRYAEVPASVAEAIVA 726
>gi|77165790|ref|YP_344315.1| elongation factor G [Nitrosococcus oceani ATCC 19707] >gi|90110701|sp|Q3J8R1|EFG_NITOC Elongation factor G (EF-G) >gi|76884104|gb|ABA58785.1| translation elongation factor 2 (EF-2/EF-G) [Nitrosococcus oceani ATCC 19707] (697 aa)
Score = 2122, Expect = 0.0e+00, Identities = 395/684 (57%), Positives = 514/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +  +RN GIMAHIDAGKTTT+ERIL+++G  HK+GE HDG + MDWMEQE+ERGITITSAAT+  W   +       +N+IDTPGHVDFT+EVERSLRVLDGA+AV  A  GVEPQ+ETVWRQA++Y+VPR+ FVNKMD+ GA+F R V  I+ RLG   +PIQ+PIGAE +F G++DLI+ K   +D      A EEK IP   +    + R  ++E  A   ++LM  YLE  ++ + DI + +R   +  +  P LCGSAFKNKG++ +LDAV+ ++PSPV+VP  K   +D  E    ASD+ PF  LAFK+A+DP+VG LTF RVYSGVL SG  V N     +ER+ RL++MH+ +R EI+++ AGDI A +GLK+ TTG+TL D    + LE M+F +PVIS+A+EPKTK DQE+MSIAL KLA EDP+F+  TD E+GQTIIAGMGELHLDI+VDRMRREFKVE NVGAPQV++RET  +  E EGK+++QSGGRGQYGHV ++ EP  + KG+EFV+KIVGG +P+E+I  V  G++    +G +AGYP++DIKATL+DGS+H+VDSSEMAFKIA S+A KE  +  +PVLLEPIM +EV  PE+Y GD MGD++ RRG+++G E   + ++I+A+VPL EMFGYATDLRS +QGR NY M+FS Y E P ++   II
  S:     1 MARKTPIERYRNIGIMAHIDAGKTTTTERILYYTGVSHKLGEVHDGAATMDWMEQEQERGITITSAATTCFWSGMARQFPEHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFCAVGGVEPQSETVWRQANKYKVPRLAFVNKMDRQGADFLRVVGQIRSRLGANPIPIQIPIGAEENFEGVVDLIKMKAIHWDKSSMGMAFEEKEIPGNLQASCDEYREKMIEAAAEASEELMERYLEEGQLPLDDIVKGLRIRTLNGEIVPALCGSAFKNKGVQAMLDAVLSYMPSPVEVPPIKGVQKDETEGERHASDEEPFAALAFKIASDPYVGNLTFFRVYSGVLSSGDTVYNAASGNRERIGRLLQMHSNSREEIKDVMAGDIAAAVGLKNVTTGDTLCDPNHIILLERMEFPEPVISVAIEPKTKGDQERMSIALGKLAREDPSFRVRTDEESGQTIIAGMGELHLDIIVDRMRREFKVEANVGAPQVAYRETIRRSIEQEGKFVRQSGGRGQYGHVWLKLEPQERGKGYEFVNKIVGGTVPKEFIPAVDKGIKEQTENGVIAGYPVVDIKATLYDGSYHDVDSSEMAFKIAGSMAFKEGVQKANPVLLEPIMKVEVVTPEEYMGDVMGDLNRRRGMVQGMEDSLSGKIIRAEVPLAEMFGYATDLRSATQGRANYTMEFSKYNEAPSNIAGAII 693
>gi|124514446|gb|EAY55959.1| Translation elongation factor [Leptospirillum sp. Group II UBA] (692 aa)
Score = 2120, Expect = 0.0e+00, Identities = 400/683 (58%), Positives = 512/683 (74%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD----GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           R   L   RN GIMAHIDAGKTTT+ERILF++G +H++GE H+G +VMDWMEQE+ERGITITSAAT+  WK+  +N+IDTPGHVDFT+EVERSLRVLDGAIAV D+  GVEPQ+ETVWRQA +Y VPRI F+NKMD+ GA+F  SVQ++  RL  K +P+Q+PIG E++F G+IDL+E +  F+D    G K    E   IP+  K+   + R  LVE VA  DD+LM  +L G +IS +++K  +RK  I  +  PVLCG+AFKNKGI+LLLDAV+D+LPSPVDVP       +   E+   ASD  PF GLAFK+ TDPFVG+LTF RVYSG L++GSYV N  K  KER+ RL+ MHA  R +I+E+ AGDI A +GLK+T TG+TL D+   + LE + F +PVIS+A+EPKTKADQEK+S++L KL++EDP+ +  TD ET QTI++GMGELHL+I+VDR++REFKV+ NVG PQV++RET N     EGKYI+Q+GGRGQYGHV +  EP  +  GF F +KIVGG +P+EYI  ++ G+  A+  G LAGYP++D+K  L  GS+H+VDSSEMAFKIA S+A+K+  K     +LEPIM +EV VPE+Y GDTMGD++SRRG I G   R   QVI+A VPL  MFGYATDLRS +QGRG + M F+ Y + PK V +EIIA
  S:     2 RQYPLEKTRNIGIMAHIDAGKTTTTERILFYTGMLHRMGEVHEGTTVMDWMEQERERGITITSAATTCFWKDNRINIIDTPGHVDFTIEVERSLRVLDGAIAVFDSVQGVEPQSETVWRQADKYRVPRIAFMNKMDRIGADFYTSVQTMVDRLKAKPIPVQIPIGKESEFVGVIDLLEMRGIFYDDETLGAKYIVRE---IPEDMKELASEYREKLVESVAELDDELMEKFLNGSDISSSELKAALRKITISMKGTPVLCGAAFKNKGIQLLLDAVIDYLPSPVDVPDIIGIDPKTEQEITRKASDSEPFSGLAFKIMTDPFVGQLTFFRVYSGKLEAGSYVYNSTKKVKERIGRLLLMHADKREDIKEVSAGDIAAAVGLKNTMTGDTLCDEASPIILEVIDFPEPVISVAIEPKTKADQEKLSLSLGKLSQEDPSLRINTDEETAQTILSGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETINSAVSSEGKYIRQTGGRGQYGHVVLEIEPLERGLGFVFENKIVGGVVPKEYIPAIEKGVVEALQGGVLAGYPVVDLKVALVFGSYHDVDSSEMAFKIAGSMAVKDGVKKAKATILEPIMKVEVIVPEEYLGDTMGDLNSRRGKILGMHNRSGAQVIEALVPLAGMFGYATDLRSMTQGRGLFSMLFNSYEQVPKVVADEIIA 687
>gi|74316420|ref|YP_314160.1| translation elongation factor 2 (EF-2/EF-G) [Thiobacillus denitrificans ATCC 25259] >gi|90110736|sp|Q3SLQ2|EFG_THIDA Elongation factor G (EF-G) >gi|74055915|gb|AAZ96355.1| translation elongation factor G [Thiobacillus denitrificans ATCC 25259] (696 aa)
Score = 2120, Expect = 0.0e+00, Identities = 393/687 (57%), Positives = 514/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MART  +  +RN GI AHIDAGKTTT+ERILF++G+ HKIGE HDG + MDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y VPR+ FVNKMD++GA+F +  + ++ RL    VPIQ+PIGAE+ F G++DL++ K +Y+ D  +  K + + IP    D  K+ R  ++E  A   ++LM  YLE  ++  ADI   +R   I  +  P++CG+AFKNKG++ +LD V++ +P+P D+P  K   E+G      A+D+  F  LAFKVATDP+VG+L F RVYSGV+ SG  + N  K +KER+ R+++MHA  R EI+E+RAGDI A +GLKD TTG+TL D    + LE M+F +PVI +AVEPKTKADQEKM IAL +LA+EDP+F+  TD E+GQTII+GMGELHL+ILVDRM+REF VE NVGAPQV++RE   KE E EGK+ KQSGG+GQYGHV I+  PN+  KGFEF+D I GG +PRE+I  V+ GL  A+ +G LAG+P++D+K TLFDGS+H+VDSSE+AFK+AA LA K+  +  SPVLLEP+MA+EV  PE Y GD MGD++ RRG+I+G +    ++++KA+VPL EMFGY+TDLRS SQGR  Y M+F HY+E PKSV   IIA K
  S:     1 MARTTPIERYRNIGISAHIDAGKTTTTERILFYTGKSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWKGMDGKFPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRSGADFFKVYEQMRARLKANPVPIQVPIGAEDKFEGVVDLVKMKAIYWDDASQGMKFDLRDIPANLVDTCKKWREAMLEAAAESSEELMNKYLEEGDLPEADIIAALRARTIASEIVPMMCGTAFKNKGVQAMLDKVIELMPAPTDIPPVKGELENGEAGERQATDEEKFSALAFKVATDPYVGQLIFFRVYSGVVNSGDTIYNPVKGRKERIGRILQMHANQREEIKEVRAGDIAAAVGLKDVTTGDTLCDLNAPITLERMEFPEPVIHVAVEPKTKADQEKMGIALGRLAQEDPSFRVRTDEESGQTIISGMGELHLEILVDRMKREFGVEANVGAPQVAYREAIRKEVEQEGKHAKQSGGKGQYGHVWIKMGPNEAGKGFEFIDAIKGGTVPREFIPAVEKGLREALNNGVLAGFPVVDVKVTLFDGSYHDVDSSELAFKLAAILAFKDGMRKASPVLLEPMMAVEVETPEDYMGDVMGDLNRRRGIIQGMDDAAGIKLVKAEVPLAEMFGYSTDLRSMSQGRATYSMEFKHYSEAPKSVAEAIIAKK 696
>gi|148322298|gb|EDK87548.1| elongation factor EF2 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (693 aa)
Score = 2120, Expect = 0.0e+00, Identities = 402/683 (58%), Positives = 511/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK--VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI--SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR + L   RN GIMAHIDAGKTTT+ERILF++G   K+GE H+G++ MDWMEQE+ERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A  GV+PQ+ETVWRQA +Y+VPRI F NKMD+ GANF+  V  I+++LG   VPIQ+PIGAE+ F G++DLIE K  V+  D    +  + K I  + +++ ++ R +++E +   DD LM  +  G+EI+  +I + +R   I     PV+CG+AFKNKGI+ LLDA+V+++P+P DV   +       ++LI    SD+APF  LAFKV TDPFVGRLTF RVY+G ++ G+ V N  K KKER+ R+++MHA  R EIE +  GDI A +GLKDTTTG+TL  +   + LE M+F +PVIS+AVEPKTK DQEKM IALSKLAEEDPTFK  TD ETGQTII+GMGELHL+I+VDRM+REFKVE NVG PQV++RET  +  + E KY KQSGGRGQYGHVKI  EPN  K FEFV+KI GG IPREYI  V+ G + A+ SG +AGYP++D+K TL+DGS+HEVDSSEMAFKIA S+ALK+A     PV+LEP+  +EVT PE+Y GD +GD++SRRG++ G   R+  ++I AKVPL EMFGYATDLRS SQGR  Y  +FS Y + P S+  +I
  S:     1 MARKISLDMTRNVGIMAHIDAGKTTTTERILFYTGVERKLGEVHEGQATMDWMEQEQERGITITSAATTCFWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFSAVDGVQPQSETVWRQADKYKVPRIAFFNKMDRIGANFDMCVSDIKEKLGSNPVPIQIPIGAEDQFEGVVDLIEMKEIVWPVDSDNGQHFDVKDIRAELQEKAEEARQYMLESIVETDDVLMEKFFGGEEITKEEIIKGLRHATIENTIVPVVCGTAFKNKGIQALLDAIVNYMPAPTDVAMVEGRDPKNPDILIDREMSDEAPFASLAFKVMTDPFVGRLTFFRVYAGFVEKGATVLNSTKGKKERMGRILQMHANKREEIEHVYCGDIAAAVGLKDTTTGDTLCAEDAPIVLEQMEFPEPVISVAVEPKTKNDQEKMGIALSKLAEEDPTFKVRTDEETGQTIISGMGELHLEIIVDRMKREFKVESNVGKPQVAYRETITQSCDQEVKYAKQSGGRGQYGHVKIILEPNPGKEFEFVNKITGGVIPREYIPAVEKGCKEALESGVIAGYPLVDVKVTLYDGSYHEVDSSEMAFKIAGSMALKQAAAKAKPVILEPVFKVEVTTPEEYMGDIIGDLNSRRGMVSGMIDRNGAKIITAKVPLSEMFGYATDLRSKSQGRATYSWEFSEYLQVPASIQKQI 687
>gi|41410240|ref|NP_963076.1| elongation factor G [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118465719|ref|YP_883624.1| elongation factor G [Mycobacterium avium 104] >gi|166219683|sp|A0QL36.1|EFG_MYCA1 Elongation factor G (EF-G) >gi|62286677|sp|Q73SD2|EFG_MYCPA Elongation factor G (EF-G) >gi|41399074|gb|AAS06692.1| FusA [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167006|gb|ABK67903.1| translation elongation factor G [Mycobacterium avium 104] (701 aa)
Score = 2120, Expect = 0.0e+00, Identities = 402/680 (59%), Positives = 507/680 (74%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGE HDG + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +Y+VPRI FVNKMDK GA+F  SV+++++RLG   +PIQ+P+G+E DF G++DL+E   KV+  +    EK +   IP   +++ ++ R  L+E VA  D+ L+  YL G+E++I +IK  IRK  I  + +PVLCGSAFKNKG++ +LDAV+D+LPSP+DVP A+ +     E LI+   S D PF  LAFKVAT PF G+LT+VRVYSG + SGS V N  K KKER+ +L +MH+   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+S+++ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV+++ET  ++ E VE  + KQ+GG GQ+  V I  EP        +EF +K+ GGRIPREYI  V AG ++AM  G LAGYP++++K TL DG+FHEVDSSEMAFKIA S  LK+A     PV+LEPIMA+EVT PE Y GD +GD++SRRG I+  E+R   +V+KA VPL EMFGY  DLRS +QGR NY M F  YAE P +V  EIIA
  S:     9 DLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGAATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMEERLGANVIPIQIPVGSEGDFEGVVDLVEMKAKVWSAEAKLGEKYDVVDIPADLQEKAEEYRTKLLEAVAETDEALLDKYLGGEELTIEEIKGAIRKLTISSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPPAEGHVPGKEEELITRKPSTDEPFSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINSTKGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLSDPNHQIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDQETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIRRKVENVEYTHKKQTGGSGQFAKVIINLEPFTGEDGATYEFENKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLDGAFHEVDSSEMAFKIAGSQVLKKAAAQAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVVKAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIA 696
>gi|158319540|ref|YP_001512047.1| translation elongation factor G [Alkaliphilus oremlandii OhILAs] >gi|166919585|sp|A8MLD7.1|EFG_ALKOO Elongation factor G (EF-G) >gi|158139739|gb|ABW18051.1| translation elongation factor G [Alkaliphilus oremlandii OhILAs] (690 aa)
Score = 2119, Expect = 0.0e+00, Identities = 403/687 (58%), Positives = 510/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDD-APFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDN-VQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R + L   RN GIMAHIDAGKTTT+ERILF++G+I K+ ETH+G + MDWMEQEKERGITITSAAT+  WK   +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GV+PQ+ETVWRQA +Y VPR+ F+NKMD  GA+F +++  I+ RLG   VP+QLPIG E+ F GI+DLI+     +     +  E   IP+  K+  ++ R  LVE  A  D++LM  YLEG+E++  +I   IR+G +  QF PV+CGS++KNKG++LLLDAVV ++PSP+D+P  K    D  E +   SDD  PF  LAFK+  DP+VG+L F RVYSGVL +GS+V N  K K+ER+ R+++MHA  R E+  + AGDI A +GLKDTTTG+TL D    V LE+M F +PVI +AVEPKTKA QEKM IAL KLAEEDPTFKT+TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVG PQV+++ET  +  EVE KY +QSGGRGQYGHVKIR  P +  KG+EF +++VGG IP+EYI  V AG++ AM +G L GY ++D++  L+DGS+H+VDSSEMAFKIA S+A K+  +    VLLEP M +EVT PE Y G+ +GD++SRRG IEG E R N +QVI A VPL EMFGYATDLRS +QGR  Y M F HY   P S+  +I A+K
  S:     1 MPRQISLEKTRNIGIMAHIDAGKTTTTERILFYAGKIRKVAETHEGGAQMDWMEQEKERGITITSAATTCQWKEHKVNIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVQPQSETVWRQADKYRVPRMAFINKMDILGADFYQTIGMIKDRLGTNPVPLQLPIGKEDTFVGIVDLIKMNAVIYKDDLGQDMETTEIPEDMKELAREYREKLVEAAAETDEELMMKYLEGEELTEEEIVAGIRRGTVNVQFTPVICGSSYKNKGVQLLLDAVVAYMPSPLDIPAIKGITPDDEEEVERHSDDNEPFSALAFKIMADPYVGKLAFFRVYSGVLDAGSHVLNSTKGKRERIGRILQMHANTREEVSTVYAGDIAAAVGLKDTTTGDTLCDPDHVVILESMVFPEPVIHVAVEPKTKAGQEKMGIALQKLAEEDPTFKTYTDEETGQTIIAGMGELHLEIIVDRLLREFKVEANVGKPQVAYKETITQAVEVECKYARQSGGRGQYGHVKIRVIPQEPGKGYEFANQVVGGTIPKEYIPAVDAGIQGAMQAGVLGGYEVVDVRVELYDGSYHDVDSSEMAFKIAGSMAFKDGMRKGKAVLLEPYMKVEVTTPEDYMGEVIGDLNSRRGKIEGMEARSNGMQVINAYVPLSEMFGYATDLRSKTQGRATYSMHFDHYEAVPASIAEKITASK 690
>gi|163813878|ref|ZP_02205272.1| hypothetical protein COPEUT_00031 [Coprococcus eutactus ATCC 27759] >gi|158450748|gb|EDP27743.1| hypothetical protein COPEUT_00031 [Coprococcus eutactus ATCC 27759] (689 aa)
Score = 2118, Expect = 0.0e+00, Identities = 391/670 (58%), Positives = 506/670 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK------------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFE---PNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAHIDAGKTT +ERIL+++G  +KIG+THDG + MDWMEQE+ERGITITSAAT+  W                +N+IDTPGHVDFTVEVERSLRVLDGA+ V DA+ GVEPQ+E VWRQA  Y VPR+ F+NKMDK GA+F  SVQ+I  RLG  A+P+Q+PIG E+DF G+IDL E + Y++   K E  E   IPD  K+   +   +LVE++   DD LM  YLEG+E SI ++K+ +R+  I C+  PV  GSA+KNKG++ +LD V++++P+P D+P       DGNEV+  +SDD PF  LAFK+ TDPFVG+L F RVYSG L SGSYV N  K+KKERV R+V+MHA  R EI+++ +GDI A +G K TTTG+T+ D++  V LE+M+F +PVI LA+EPKTK DQ KM  AL+KLAEEDPTFK  TD ETGQTIIAGMGELHL+++VDR+ REFKVE NVGAPQV+++ETF K  +++ KY KQSGGRGQYGH K++FE   PN ++ F+F   +VGG IP+EYI  V  G+E A  +G L GYP++ + A ++DGS+HEVDSSEMAF IA S+A KEA     PVLLEPIM +EVT+PE+Y GD +G ++++RG IEG +     ++++A VPL EMFGY+T+LRS +QGRGNY M F  YA+ PKS+  ++IA
  S:     1 MAHIDAGKTTLTERILYYTGVNYKIGDTHDGTATMDWMEQEQERGITITSAATTCHWTLEDHHKPKAGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFDAKAGVEPQSENVWRQADTYNVPRMAFINKMDKMGADFFYSVQTIIDRLGKNAIPVQIPIGKESDFIGLIDLFEMEAYYYKDDKGEDIEITTIPDDLKELADKWHENLVEKICELDDDLMMMYLEGEEPSIDEMKKVLRRATIACEAVPVFLGSAYKNKGVQKMLDGVIEYMPAPTDIPDITGVDPDGNEVVRHSSDDEPFSALAFKIMTDPFVGKLAFFRVYSGTLNSGSYVLNATKDKKERVGRIVQMHANARKEIDKVYSGDIAAAVGFKLTTTGDTICDEQHPVILESMEFPEPVIELAIEPKTKNDQGKMGEALAKLAEEDPTFKAHTDKETGQTIIAGMGELHLEVIVDRLLREFKVEANVGAPQVAYKETFTKPVDIDSKYAKQSGGRGQYGHCKVKFEPMDPNGEETFKFESTVVGGAIPKEYIPAVGEGIEEAAKAGILGGYPVLGVHANVYDGSYHEVDSSEMAFHIAGSMAFKEAMAKADPVLLEPIMKVEVTMPEEYLGDVIGSLNAKRGQIEGMDDIGGGKIVRAFVPLAEMFGYSTELRSSTQGRGNYSMFFEKYAQCPKSIQEKVIA 685
>gi|118616549|ref|YP_904881.1| elongation factor G [Mycobacterium ulcerans Agy99] >gi|166220152|sp|A0PM41.1|EFG_MYCUA Elongation factor G (EF-G) >gi|118568659|gb|ABL03410.1| elongation factor G, FusA1 [Mycobacterium ulcerans Agy99] (701 aa)
Score = 2118, Expect = 0.0e+00, Identities = 403/680 (59%), Positives = 505/680 (74%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY--GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGE HDG + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +Y+VPRI FVNKMDK GA+F  SV+++++RLG   +PIQLP+G+E DF G++DL+E   KV+  D    EK +   IP   +++  + R  L+E VA  D+ L+  YL G+E++ A+IK  IRK  I  + +PVLCGSAFKNKG++ +LDAV+D+LPSP+DVP A  +  G++  EV+   S D PF  LAFKVAT PF G+LT+VRVYSG + SGS V N  K KKER+ +L +MH+   + +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+S+++ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV+++ET  +  E VE  + KQ+GG GQ+  V I  EP        +EF  K+ GGRIPREYI  V AG ++AM  G LAGYP++++K TL DG+FHEVDSSEMAFKIA S  LK+A     PV+LEPIMA+EVT PE Y GD +GD++SRRG I+  E+R   +V+KA VPL EMFGY  DLRS +QGR NY M F  YAE P +V  EIIA
  S:     9 DLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGAATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMEERLGANVIPIQLPVGSEGDFEGVVDLVEMKAKVWSADAKLGEKYDVVDIPADLQEKADEYRTKLLEAVAETDEALLEKYLGGEELTEAEIKGAIRKLTITSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPAAIGHVPGKEDEEVVRKPSTDEPFSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINSTKGKKERLGKLFQMHSNKESPVETASAGHIYAVIGLKDTTTGDTLSDPNNQIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDQETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIKRLVEKVEFTHKKQTGGSGQFAKVLISIEPFTGEDGATYEFESKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLDGAFHEVDSSEMAFKIAGSQVLKKAAAAAHPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVVKAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIA 696
>gi|189347706|ref|YP_001944235.1| translation elongation factor G [Chlorobium limicola DSM 245] >gi|189341853|gb|ACD91256.1| translation elongation factor G [Chlorobium limicola DSM 245] (704 aa)
Score = 2117, Expect = 0.0e+00, Identities = 398/679 (58%), Positives = 505/679 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK---------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSV 679
           M R VDL   RN GIMAHIDAGKTTT+ERIL+++GR+H++GE HDG + MDWMEQEKERGITITSAAT+  W          N  +N+IDTPGHVDFTVEVERSLRVLDGA+A+  A  GVEPQ+ETVWRQA++Y VPRI +VNKMD+TGANF  +V++I++RLG   VP+Q+PIG    F G +DLI  K   ++        E  IP   +++ +  R +++E V+  DD L+  YL G+EI+  +++  +RK  +     PVLCGS+FKNKG++ +LDAVV++L SPVDV   + +     E V     D+ PF GLAFK+ATDPFVG+LTF RVYSGVLK+GSYV N    KKER+ R+++MH+  R +I+ + AGDI A +GLKD  TG+T+ D+   V LE M F +PVI +A+EPKTKAD +K+ ++L+KLAEEDPTFK  TD ETGQT+IAGMGELHL+ILVDR++REFKVE NVG PQV++RET  K  E EGK+++QSGG+GQ+G V ++ EP  + KG+EFVD I GG IPREYI  V AG++ AM +G +AG+PM DIK TL DG +HEVDSSEMAFKIA S+  K A K   PVLLEPIM +EV  PE+Y GD MGD+SSRRG IEG  QR   Q + +KVPL  MFGY+TDLRS SQGR NY M+F  Y E P+S+
  S:     1 MTRLVDLDKVRNIGIMAHIDAGKTTTTERILYYTGRLHRMGEVHDGGATMDWMEQEKERGITITSAATTCFWIPKFGNYSGINHRINIIDTPGHVDFTVEVERSLRVLDGAVALFCAVGGVEPQSETVWRQANKYGVPRIAYVNKMDRTGANFFDTVKAIRERLGANPVPLQIPIGEGEIFAGFVDLIRMKGIIYNKDDGSTYNEVEIPHDLQNEARTWRINMLEAVSEVDDTLLEKYLNGEEITEQEVRSVLRKATLKVTIIPVLCGSSFKNKGVQFMLDAVVEYLASPVDVGAVEGHHPKTEESVSREPKDEEPFAGLAFKIATDPFVGKLTFFRVYSGVLKAGSYVLNTMTGKKERIGRILQMHSNKREDIDCVYAGDIAAAVGLKDVRTGDTICDESNPVVLEKMVFPEPVIEIAIEPKTKADNDKLGMSLAKLAEEDPTFKVKTDEETGQTLIAGMGELHLEILVDRLKREFKVEANVGKPQVAYRETIRKTVEFEGKFVRQSGGKGQFGLVVLKVEPLEEGKGYEFVDAIKGGVIPREYIPAVNAGVQQAMKNGVVAGFPMQDIKVTLLDGKYHEVDSSEMAFKIAGSIGFKGAAKKADPVLLEPIMKVEVVTPEEYLGDVMGDLSSRRGHIEGMGQRAGAQFVNSKVPLSAMFGYSTDLRSMSQGRANYSMEFECYREVPRSI 690
>gi|123966922|ref|YP_001012003.1| elongation factor G [Prochlorococcus marinus str. MIT 9515] >gi|166220161|sp|A2BYN5.1|EFG_PROM5 Elongation factor G (EF-G) >gi|123201288|gb|ABM72896.1| Elongation factor G [Prochlorococcus marinus str. MIT 9515] (691 aa)
Score = 2117, Expect = 0.0e+00, Identities = 403/688 (58%), Positives = 514/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE HDG +V DWM+QE+ERGITIT+AA S SW++  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +  + I++RL   A PIQLPIGAE D  GIIDL+  K Y +        EE PIPD+ KD+  + R+ L+E VA  D++L+  +L+  E++   +K+ IR+GV+     PVLCGSAFKNKG++L+LDAVVD+LP+PVDV   +    +G E +  + D+APF  LAFKV +DP+ G+LTFVR+YSGVL  GSYV N  K+ KER+SRLV + A  R E++E+RAGD+ A++GLK+TTTG+TL      + LE +   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+  TD ET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S  EGKY +Q+GG+GQYGHV I  EP +  KGFEFV+KIVGG +P+EYI P   G++    SG LAGYP+ID+K TL DGSFH+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV  P+ + G  +GD+SSRRG +EG    D +  ++AKVPL EMFGYAT LRS +QGRG + M+F++Y E P++V   II+  +
  S:     1 MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHDGAAVTDWMDQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVNKQIKERLKANAFPIQLPIGAEGDLTGIIDLVSNKAYLYKNDLGTDIEEAPIPDEMKDEALEWRSKLMESVAENDEELIEIFLDKGELTEDQLKKGIREGVLKHGLVPVLCGSAFKNKGVQLVLDAVVDYLPAPVDVKPIQGVLPNGKEDIRPSDDNAPFSALAFKVMSDPY-GKLTFVRMYSGVLSKGSYVMNSTKDAKERISRLVILKADEREEVDELRAGDLGAVLGLKNTTTGDTLCTTDDPIVLETLFIPEPVISVAVEPKTKGDMEKLSKALQALSEEDPTFRVSTDQETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRSSSRGEGKYARQTGGKGQYGHVVIEMEPAEVGKGFEFVNKIVGGTVPKEYIGPASNGMKETCESGVLAGYPLIDVKVTLVDGSFHDVDSSEMAFKIAGSMAFKDGVKKCNPVLLEPMMKVEVESPDDFLGSVIGDLSSRRGQVEGQSVDDGLSKVQAKVPLAEMFGYATQLRSMTQGRGIFSMEFANYEEVPRNVAEAIISKNQ 688
>gi|15828005|ref|NP_302268.1| elongation factor G [Mycobacterium leprae TN] >gi|13432128|sp|P30767|EFG_MYCLE Elongation factor G (EF-G) >gi|13093558|emb|CAC30832.1| elongation factor G [Mycobacterium leprae] (701 aa)
Score = 2116, Expect = 0.0e+00, Identities = 396/680 (58%), Positives = 508/680 (74%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY--GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGE HDG + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +YEVPRI FVNKMDK GA+F  SV+++Q+RLG   +PIQLP+G+E DF G++DL+E   KV+  +    EK +   IP   +++ ++ R +L+E VA  D+ L+  Y  G+E+++A+IK  IRK  I  + +PVLCGSAFKNKG++ +LDAV+D+LPSP+DVP A  +  G++  E++   S D P   LAFKVAT PF G+LT+VRVYSG + SGS V N  K KKER+ +L +MH+   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+S+++ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV+++ET  +  E VE  + KQ+GG GQ+  V I+ EP        +EF +K+ GGRIPREYI  V+AG  +AM  G LAGYP++++K TL DG++H+VDSSE+AFKIA S  LK+A     PV+LEPIMA+EVT PE Y GD +GD+ SRRG I+  ++R   +V++A VPL EMFGY  DLRS +QGR NY M F+ Y+E P +V  EIIA
  S:     9 DLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGAATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYEVPRICFVNKMDKIGADFYFSVRTMQERLGANVIPIQLPVGSEGDFEGVVDLVEMKAKVWSTEAKLGEKYDVVGIPTDLQEKAEEYRTNLLETVAETDEALLEKYFSGEELTVAEIKGAIRKLTISSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPAAIGHVPGKEDEEIVRKPSTDEPLSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINATKGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLADPNNQIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIRRVVETVEYTHKKQTGGSGQFAKVIIKLEPFSGENGATYEFENKVTGGRIPREYIPSVEAGARDAMQYGVLAGYPLVNLKVTLLDGAYHDVDSSEIAFKIAGSQVLKKAAAQAQPVILEPIMAVEVTTPEDYMGDVIGDLHSRRGQIQAMKERAGTRVVRAHVPLSEMFGYVGDLRSKTQGRANYSMVFNSYSEVPANVSKEIIA 696
>gi|164686524|ref|ZP_02210552.1| hypothetical protein CLOBAR_00091 [Clostridium bartlettii DSM 16795] >gi|164604393|gb|EDQ97858.1| hypothetical protein CLOBAR_00091 [Clostridium bartlettii DSM 16795] (688 aa)
Score = 2116, Expect = 0.0e+00, Identities = 405/683 (59%), Positives = 505/683 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR   L   RN GIMAHIDAGKTTT+ERILF++GR HKIGETH+G S MDWMEQEKERGITITSAAT+ +WK+  +N+IDTPGHVDFTVEVERSLRVLDG++AV  A+ GVEPQ+E VWRQA  Y+VPRI FVNKMD  GANF   V+ +++RLG  AVP+QLPIG E+ F GIIDL++     ++       +E  IP   ++   + R  LVE VA  D++LM  YLEG+E +  +IK  IRK  I C+  PV CG+A++NKG++ ++DAV+D+LP+P D+P  K    DG E    +SDD PF  LAFK+ TDPFVG+L F RVYSG L+SGSYV N  KNK+ER+ R+++MHA  R EI E+ AGDI A +GLKDTTTG+TL D    + LE+M+F +PVI +A+EPK+KA QEKM  AL KLAEEDPTF+  TD ETGQTII GMGELHL+I+VDR+ REFKVE NVGAPQV++RET  K  +VE KY KQSGGRGQYGHVK+R  P +   G+ F +K VGG +P+EY+ P   G++ AM +G +AGYP++D+   L+DGS+HEVDSSEMAFK+A S+A+KEA K    VLLEP   +EV  PE+Y GD MG I+S+RGLI+G E R   QVI A VPL EMFGY+T+LRS +QGR  Y M F HY + P  V  +I
  S:     1 MARNFPLERTRNIGIMAHIDAGKTTTTERILFYTGRTHKIGETHEGASQMDWMEQEKERGITITSAATTTTWKDHRINIIDTPGHVDFTVEVERSLRVLDGSVAVFCAKGGVEPQSENVWRQAETYKVPRIAFVNKMDILGANFYNVVEMMKERLGSNAVPVQLPIGKEDTFQGIIDLVKMDAIIYEDDLGTVMDETEIPADMQELAAEWREKLVEAVAETDEELMMKYLEGEEFTEEEIKAAIRKATIACEMNPVFCGTAYRNKGVQPVIDAVIDYLPAPTDIPSIKGVLPDGTEAERHSSDDEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVLNATKNKRERIGRILQMHANTRQEITEVYAGDIAAAVGLKDTTTGDTLCDPNNAIILESMEFPEPVIDVAIEPKSKAAQEKMGTALQKLAEEDPTFRVRTDEETGQTIIGGMGELHLEIIVDRLLREFKVEANVGAPQVAYRETITKPVDVEYKYSKQSGGRGQYGHVKLRVTPQEPGAGYIFENKTVGGSVPKEYVGPTDMGIQGAMQAGVVAGYPVVDVAVELYDGSYHEVDSSEMAFKMAGSMAMKEALKKGDSVLLEPYFKVEVVTPEEYMGDVMGGINSKRGLIQGMEARAGAQVINAFVPLSEMFGYSTELRSTTQGRATYTMIFDHYEQVPAGVAKKI 684
>gi|120553649|ref|YP_958000.1| translation elongation factor G [Marinobacter aquaeolei VT8] >gi|166201612|sp|A1TYJ4.1|EFG_MARAV Elongation factor G (EF-G) >gi|120323498|gb|ABM17813.1| translation elongation factor 2 (EF-2/EF-G) [Marinobacter aquaeolei VT8] (701 aa)
Score = 2116, Expect = 0.0e+00, Identities = 397/684 (58%), Positives = 518/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED-GNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-----NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +  +RN GI AH+DAGKTTT+ERIL+++GR HK+GETHDG S  DWMEQE+ERGITITSAA +  W+          +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++YEVPR++FVNKMD+ GANF R V+ I+ RLG   VPIQLPIGAE+DF GI+DL+  K +Y+ +  +    E + IP+  K + ++ R  ++E  A  +++ M  YLEG+E++  +IK+ +R   I  +     CGSAFKNKG++ +LDAV++FLP+P +V   +   +D G E      DDAPF  LAFK+ATDPFVG LTF RVYSG L+SG+ V N  K KKERV R+V+MHA +R EI+E+ AGDI A IGLK+ TTG+TL D+   + LE M+F +PVIS+AVEPK+KADQEKM +AL KLA+EDP+F+  TD E+GQTII+GMGELHLDI+VDRMRREFKVE N+G PQV++RE   K  +VEGK+++QSGGRGQYGHVK++ EP        + F FV++IVGG +P+EYI  VQ G+E  M +G LAGYP++ IKATL+DGS+H+VDS+EMAFKIA S+A+K+     +P LLEPIM +EV  PE Y GD +GD++ RRGL++G ++    +VI+A+VPL EMFGYATDLRS +QGR +Y M+FS Y E P ++   II
  S:     1 MARKTPIKRYRNIGICAHVDAGKTTTTERILYYTGRSHKMGETHDGASTTDWMEQEQERGITITSAAVTTFWQGMDKQYPEHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVEPQSETVWRQANKYEVPRMVFVNKMDRAGANFMRVVEQIRNRLGATTVPIQLPIGAEDDFEGIVDLLRMKAIYWNEADQGMTYELRDIPESMKAEAEKAREQMIEAAAEANEEYMDKYLEGEELTYEEIKKGLRDRTIANEIVLATCGSAFKNKGVQAVLDAVIEFLPAPDEVKAIRGEVDDEGTEETRPVDDDAPFAALAFKIATDPFVGTLTFFRVYSGKLESGNAVFNSVKGKKERVGRMVQMHANDREEIKEVLAGDIAAAIGLKNVTTGDTLCDENNKIVLERMEFPEPVISVAVEPKSKADQEKMGVALGKLAQEDPSFRVRTDEESGQTIISGMGELHLDIIVDRMRREFKVEANIGKPQVAYRECIRKPVDVEGKFVRQSGGRGQYGHVKVKLEPLPLDDEDGENFIFVNEIVGGVVPKEYIPAVQQGIEEQMQNGCLAGYPLLGIKATLYDGSYHDVDSNEMAFKIAGSMAMKKGALEANPALLEPIMKVEVVTPEDYMGDVVGDLNRRRGLVQGMDEGPAGKVIRAEVPLSEMFGYATDLRSATQGRASYAMEFSRYMEAPSNIAEAII 698
>gi|67157005|ref|ZP_00418367.1| Translation elongation factor G:Small GTP-binding protein domain [Azotobacter vinelandii AvOP] >gi|67085682|gb|EAM05154.1| Translation elongation factor G:Small GTP-binding protein domain [Azotobacter vinelandii AvOP] (700 aa)
Score = 2115, Expect = 0.0e+00, Identities = 400/684 (58%), Positives = 517/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF---DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  +  +RN GI AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPRI++VNKMD+ GANF R V+ I++RLG   VP+QL IGAE++F G IDL++ K  ++   D G   + EE  IP + +D   + R+++VE  A  +++LM  YLE  E+S+ +IK  +R   + C+  P +CGS+FKNKG+ L+LDAV+DFLP+P DVP  K    D  E+     ASDD PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R EI+E+RAGDI A+IG+KD  TG+TL   +  + LE M F +PVI +AVEPKTKADQEKM IAL KLA+EDP+F+  TD E+GQTII GMGELHLDI+VDRMRREF VE N+G PQV++RE    + E+EGK+++QSGGRGQ+GH  IRFEP ++  +G  F  ++VGG +P+EYI  +Q G+E  M +G +AGYP+I +KAT+FDGS+H+VDS+EMAFKIAAS+A K+  +    VLLEPIM +EV  PE+Y GD MGD++ RRGLI+G E   + +VI+A+VPL EMFGYATD+RS SQGR +Y M+FS YAE P ++   ++
  S:     1 MARTTPINRYRNIGICAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMVQEQERGITITSAATTAFWQGSTKQYDKYRVNIIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRIVYVNKMDRAGANFLRVVEQIKKRLGHTPVPVQLAIGAEDNFQGQIDLLKMKAIYWNEDDQGTSYREEE--IPAELQDLADEYRSNMVEAAAEANEELMNKYLEDGELSVEEIKLGLRLRTLACEIVPAVCGSSFKNKGVPLVLDAVIDFLPAPDDVPAIKGVNPDHEEIEDERHASDDEPFSALAFKIATDPFVGTLTFARVYSGVLSSGDSVLNSVKGKKERVGRMVQMHANTREEIKEVRAGDIAALIGMKDVITGDTLCSIEKPIILERMDFPEPVIHVAVEPKTKADQEKMGIALGKLAQEDPSFRVKTDEESGQTIIGGMGELHLDIIVDRMRREFGVEANIGKPQVAYREAIRNKCEIEGKFVRQSGGRGQFGHCWIRFEPAEEGVEGLVFASEVVGGVVPKEYIPAIQKGVEEQMQNGVVAGYPLISLKATVFDGSYHDVDSNEMAFKIAASMATKQLAQKGGAVLLEPIMKVEVVTPEEYMGDVMGDLNRRRGLIQGMEDSVSGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFSKYAEAPANIAEAVV 696
>gi|192361290|ref|YP_001981205.1| translation elongation factor G [Cellvibrio japonicus Ueda107] >gi|190687455|gb|ACE85133.1| translation elongation factor G [Cellvibrio japonicus Ueda107] (706 aa)
Score = 2115, Expect = 0.0e+00, Identities = 393/688 (57%), Positives = 518/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA---EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDA-PFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD---KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           M+R   +  +RN GI AH+DAGKTTT+ER+LF++G  HK+GE HDG +  DWM QE+ERGITITSAA +  WK  +       +N+IDTPGHVDFT+EVERSLRVLDGA+ VL    GV+PQTETVWRQA++YEVPR++FVNKMD+TGANF R V+ ++ RLG   VP+Q+ IGAE+ F G++DL++ +   ++  +E++    E  PIP   ++Q + +R  L+E  A   D LM  YL G+E++ ADIK  IR   +  +  PV+ GSAFKNKG++ +LDAV+++LP+P +V   +   +DG  V    +DD+ PF  LAFK+ATDPFVG LTF+RVYSGVL SG  V N  K KKERV R+V+MHA  R+EI+E+ AGDI A+IGLKD TTG+TL D    + LE M F +PVI +AVEPKTKADQEKM +ALSKLA+EDP+F+  TD ETGQTII GMGELHLDI+VDRM+REF VE N+G PQV++RE    + E+EGK+++QSGGRGQYGH  IRFEP  D   +G EFV++IVGG +P+EY+  +Q G+   M +G LAGYP++ +KA++FDGS+H+VDSSEMAFKIAAS+A K+  ++   VLLEPIM +EV  PE+  GD +GD++ RRG+I G ++  + +V+ A+VPL EMFGYAT LRS +QGR  Y M+F  YAE P++V  E+IA  K
  S:     1 MSRKTPIARYRNIGICAHVDAGKTTTTERVLFYTGLSHKLGEVHDGAATTDWMVQEQERGITITSAAITTFWKGMAGQFDEHRVNVIDTPGHVDFTIEVERSLRVLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRLVFVNKMDRTGANFLRVVEQLKTRLGANPVPLQMTIGAEDQFKGVVDLVKMQSIIWN--EEDQGMTFEYGPIPADLREQCEALREQLIEAAAESSDALMEKYLGGEELTEADIKTGIRARTLAGEIIPVVGGSAFKNKGVQAMLDAVIEYLPAPTEVKAIEGVLDDGETVAQRKADDSEPFSALAFKIATDPFVGSLTFIRVYSGVLNSGDAVLNSVKQKKERVGRMVQMHANQRSEIKEVLAGDIAAVIGLKDVTTGDTLCDMNHPIVLERMDFPEPVIHVAVEPKTKADQEKMGVALSKLAQEDPSFRVRTDEETGQTIIGGMGELHLDIIVDRMKREFGVEANIGKPQVAYREAIRNKCEIEGKFVRQSGGRGQYGHCWIRFEPGADEGAEGLEFVNEIVGGVVPKEYVPAIQKGIAEQMQNGVLAGYPLLGLKASVFDGSYHDVDSSEMAFKIAASMATKKLAQLGGAVLLEPIMKVEVVTPEENMGDVVGDLNRRRGMILGMDESVSGKVVNAEVPLAEMFGYATSLRSATQGRATYTMEFLKYAEAPRNVAEEVIARGK 700
>gi|194334864|ref|YP_002016724.1| translation elongation factor G [Prosthecochloris aestuarii DSM 271] >gi|194312682|gb|ACF47077.1| translation elongation factor G [Prosthecochloris aestuarii DSM 271] (704 aa)
Score = 2115, Expect = 0.0e+00, Identities = 387/683 (56%), Positives = 509/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW---------KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR V L   RN GIMAHIDAGKTTT+ERIL+++GR+HK+GE HDG + MDWMEQEKERGITITSAAT+  W         KN  +N+IDTPGHVDFTVEVERSLRVLDGA+A+  A  GVEPQ+ETVWRQA++Y VPR+ +VNKMD+ GA+F  +V+SI++RLG   VP+Q+PIG    F G++DLI  K   +D       EE  IP   + + K  R +++E V+  D+ L+  YLEG++I+  ++++ +R+  +     P LCGS+FKNKG++ +LD VV+ LPSPVDV     +  D +E ++    D+APF GLAFK+ATDPFVG+LTF RVYSGVLK+GSY+ N    KKER+ RL++MH+  R ++ E+ AGDI A +G+KD  TG+T+ D+   + LE M F +PVI +A+EPKTKAD +K+ ++L+KLAEEDPTF+  +D ETGQT+IAGMGELHL++LVDR++REFKVE NVG PQV++RET  K  + EGK+++QSGG+GQ+G V ++ EP  + KG+EFVD I GG IP+EYI  V  G++ AM  G +AGYP+ D+K TL+DG +H+VDSSEMAFKIA S+  K A +   PVLLEP+M +EV  PE+Y GD MGD+SSRRG IEG   R   Q +KAKVPL EMFGY+T LRS +QGR NY M+F  Y E PK++   +
  S:     1 MARQVGLDKVRNIGIMAHIDAGKTTTTERILYYTGRLHKMGEVHDGGATMDWMEQEKERGITITSAATTCFWEPRYGIYKGKNHRINIIDTPGHVDFTVEVERSLRVLDGAVALFCAVGGVEPQSETVWRQANKYNVPRVAYVNKMDRVGADFFETVKSIKERLGANPVPVQIPIGQGEMFAGVVDLIRMKGIIYDKEDGSTYEEVAIPHDLESEAKHWRINMLEAVSEVDETLLEKYLEGEDITEDEVRKVLRQATLAGTIIPTLCGSSFKNKGVQFMLDTVVECLPSPVDVGNVAGHHPDTDEDIVREPKDEAPFAGLAFKIATDPFVGKLTFFRVYSGVLKAGSYILNSTTGKKERIGRLLQMHSNKREDLTEVHAGDIAAAVGMKDVKTGDTMCDEAKPIILEKMVFPEPVIQIAIEPKTKADSDKLGMSLAKLAEEDPTFRVSSDEETGQTLIAGMGELHLEVLVDRLKREFKVEANVGQPQVAYRETIKKAVDHEGKFVRQSGGKGQFGLVNLKVEPLEQGKGYEFVDAIKGGVIPKEYIPAVSNGIQEAMKDGVIAGYPVQDVKVTLYDGKYHDVDSSEMAFKIAGSIGFKGAVRKADPVLLEPLMKVEVITPEEYLGDVMGDLSSRRGHIEGMGDRAGAQFVKAKVPLSEMFGYSTVLRSMTQGRANYTMEFEQYHEVPKNIAEAL 694
>gi|124483372|emb|CAM32559.1| Elongation factor G 1 (EF-G 1) protein [Herbaspirillum seropedicae] (701 aa)
Score = 2114, Expect = 0.0e+00, Identities = 394/687 (57%), Positives = 518/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQ--RDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  WK  +       +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y+VPR+ FVNKMD+TGANF +  + ++ RL    +P+Q+PIGAE +F G+IDL++ + +Y+ D  +  K + + IP+  K   ++ R +LVE  A   + LM  YLE  +++ A+IK  IR+  I  +  P++CG+AFKNKG++ +LD VV++LPSPVD+P      ED   V+  A DD  F  LAFK+ATDPFVG+L F+R YSG L SG  V N  K+KKER+ R+V+MHA  R EI+E+ AGDI A++GLKDTTTG+TL DDK  V LE M F +PVIS AVEPKTKADQEKM +AL++LA EDP+F+  TD E+GQTIIAGMGELHLDI+VDRM+REF VE  VG PQV++RET  K   E EGK++KQSGGRGQYGHV ++ EP +  KGFEFVD I GG +PRE+I  V+ G+   + +G LAGYP++D+K TLF GS+H+VDS+E AF++A S+A KE  +  SPV+LEP+MA+EV  PE Y G  MGD+SSRRG+++G ++      ++IKA+VPL EMFGY+T LRS +QGR  Y M+F HY+E PK+V++ I+ +K
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERVLFYTGVNHKIGEVHDGAATMDWMEQEQERGITITSAATTCYWKGMANNFPAHHINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYEQMRARLKANPIPMQVPIGAEENFEGVIDLVKMRAIYWDDASQGMKFDYRDIPEHLKADAQKWRENLVETAAEASEDLMNKYLEEGDLTEAEIKGAIRQRTISGEIVPMMCGTAFKNKGVQAMLDGVVEYLPSPVDIPPVPGLNEDDEPVVREAKDDEKFSALAFKIATDPFVGQLCFIRCYSGTLNSGDTVLNSVKSKKERIGRIVQMHANQREEIKEMMAGDIAAVVGLKDTTTGDTLCDDKAMVVLERMVFPEPVISQAVEPKTKADQEKMGLALNRLAAEDPSFRVRTDEESGQTIIAGMGELHLDIIVDRMKREFNVEATVGKPQVAYRETIRKTCEESEGKFVKQSGGRGQYGHVVLKIEPQEAGKGFEFVDAIKGGTVPREFIPAVEKGVRETLNTGVLAGYPVVDVKVTLFFGSYHDVDSNENAFRMAGSMAFKEGCRRASPVILEPMMAVEVETPEDYAGTVMGDLSSRRGMVQGMDEIAGGGGKIIKAEVPLSEMFGYSTTLRSATQGRATYSMEFKHYSEAPKNVIDAIVTSK 699
>gi|160945273|ref|ZP_02092499.1| hypothetical protein FAEPRAM212_02792 [Faecalibacterium prausnitzii M21/2] >gi|158443004|gb|EDP20009.1| hypothetical protein FAEPRAM212_02792 [Faecalibacterium prausnitzii M21/2] (698 aa)
Score = 2113, Expect = 0.0e+00, Identities = 393/677 (58%), Positives = 520/677 (76%)
  Q:    11 RNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           RN GIMAHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWM QE+ERGITITSAAT+  W +                +N+IDTPGHVDFTVEV+RSLRVLDG++ VL A+ GVEPQ+ETVWRQA  Y+VPR+++VNKMD  GA+F R ++ +  RL    V IQLPIG E+ F GI+DL++   +VY+ D G + + E  PIP+   +Q ++ R  LVE VA  D++LM  YLEG+EI+  ++K+ IRK  I     PV+CGS++KN+G++ LLDA+VD++P+P DV   K    +  E     +SDDAPF  LAFK+ATDPFVG+L + RVYSG +++G+ V N  K+ KER+ R+++MH+ +R +I+   AGDI A++GLK+TTTG+TL D+   + LE+M+F +PVI +A+EPKTKA  EKM IAL+KLAEEDPTFKT+TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV++RET  KE+  E KY +QSGG+GQYGHVKI+ EPN+  KG+EFV+ IVGG IP+EYI  +  G++ AM +G LAGYP++D+K TL+DGS+HEVDSSEMAF IA S+A K+A +   P++ EPIM + V VP++Y GD +GD+++RRG I+G E     Q + A VPL +MFGYATDLRS +QGRG YVM+ SHY   PK++ ++IIA +
  S:     3 RNIGIMAHIDAGKTTTTERILYYTGINHKIGEVHDGGATMDWMVQEQERGITITSAATTCYWSHSETQKDPVAFKKNRHRINIIDTPGHVDFTVEVQRSLRVLDGSVTVLAAKGGVEPQSETVWRQADEYKVPRMVYVNKMDTMGADFFRCIKMLHDRLHANGVAIQLPIGQEDTFRGIVDLVDMNAEVYYDDMGNDMRTE--PIPEDMVEQAEEYRNILVEAVAENDEELMEKYLEGEEITREELKKAIRKETIANTLVPVVCGSSYKNRGVQKLLDAIVDYMPAPTDVEDIKGVNPETEEQETRPSSDDAPFAALAFKIATDPFVGKLAYFRVYSGKVEAGTTVYNSVKDSKERMGRILQMHSNHRKDIDCCYAGDIAAVVGLKNTTTGDTLCDENHPIILESMKFPEPVIRVAIEPKTKAGNEKMGIALAKLAEEDPTFKTYTDEETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYRETIRKEANQETKYARQSGGKGQYGHVKIKIEPNEPGKGYEFVNAIVGGAIPKEYIPAIDNGIQGAMKAGVLAGYPVVDVKVTLWDGSYHEVDSSEMAFSIAGSMAFKDAMRKADPIITEPIMKVAVIVPDEYLGDVIGDLNARRGQIQGMEAMAGTQRVNAFVPLAQMFGYATDLRSKTQGRGQYVMEPSHYEPVPKNIADQIIAGR 695
>gi|33594748|ref|NP_882391.1| elongation factor G [Bordetella parapertussis 12822] >gi|46576481|sp|Q7W2F8|EFG1_BORPA Elongation factor G 1 (EF-G 1) >gi|33564824|emb|CAE39767.1| elongation factor G [Bordetella parapertussis] (700 aa)
Score = 2113, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 514/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNV----QVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTT+ERILF++G  HK+GETHDG + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y VPR+ FVNKMD+TGANF +    ++ RL    VPI +PIGAE+ F G++DL++ K   +D   +  K E   IP + +    + R  LVE  A   ++LM  YLE   +   DI   +R+  I  +  P+LCG+AFKNKG++ +LDAV+D+LPSP D+P      +DGN +  SA D   F  LAFK+ +DPFVG+LTFVRVYSGVLKSG  V N  K KKER+ RL++MHA NR EI+E+ AGDI A++GLKD TTGETL D    + LE M+F +PVIS AVEPK+KADQEKM +ALS+LA+EDP+F+  +D E+GQTII+GMGELHL+ILVDRMRREF VE NVG PQV++RET  K   EVEGK++KQSGGRGQYGHV ++ EP     G+EFVD I GG +PREYI  V  G++  + +G LAGYP++D+KATLF GS+H+VDS+E AFK+AAS+A KE  +  SPVLLEP+MA+EV  PE Y G  MGD+SSRRG+++G    D++    + IKA+VPL EMFGYAT+LRS +QGR  Y M+F HYAE PK+V +E+IA +
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKLGETHDGSATMDWMEQEQERGITITSAATTAFWRGMAGNYPEYRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYDQLKTRLRANPVPIVIPIGAEDSFTGVVDLVKMKAIIWDEASQGTKFEYGDIPAELEGTANEWREKLVEAAAESSEELMNKYLETGSLDEDDINVALRQRTIAGEIQPMLCGTAFKNKGVQRMLDAVIDYLPSPADIPPVDGQDDDGNPIKRSADDAEKFSALAFKLMSDPFVGQLTFVRVYSGVLKSGDTVYNPIKGKKERIGRLLQMHANNREEIKEVLAGDIAAVVGLKDVTTGETLCDIDSHILLERMEFPEPVISQAVEPKSKADQEKMGLALSRLAQEDPSFRVRSDEESGQTIISGMGELHLEILVDRMRREFGVEANVGKPQVAYRETIRKNCDEVEGKFVKQSGGRGQYGHVVLKLEPLPPGGGYEFVDAIKGGVVPREYIPAVDKGIQETLPAGILAGYPVVDVKATLFFGSYHDVDSNENAFKMAASMAFKEGMRRASPVLLEPMMAVEVETPEDYAGTVMGDLSSRRGMVQGM---DDIVGGGKTIKAEVPLAEMFGYATNLRSLTQGRATYTMEFKHYAEAPKNVADEVIAAR 698
>gi|145225652|ref|YP_001136330.1| elongation factor G [Mycobacterium gilvum PYR-GCK] >gi|189027863|sp|A4T1R3.1|EFG_MYCGI Elongation factor G (EF-G) >gi|145218138|gb|ABP47542.1| translation elongation factor 2 (EF-2/EF-G) [Mycobacterium gilvum PYR-GCK] (700 aa)
Score = 2113, Expect = 0.0e+00, Identities = 407/685 (59%), Positives = 505/685 (73%)
  Q:     1 MARTV--DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE--EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MA+ V  DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGETHDG S  DWMEQE+ERGITITSAA +  W    +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +Y+VPRI FVNKMDK GA+F  +V++I++RLG + + IQLPIGAENDF GIIDL+E K   + G     EK E + IP    D+ ++ R  L+E VA  D+ L+  Y  G+E+SI +IK  IRK  +  + +PVLCGSAFKNKG++ +LDAV+D+LPSP+DV     +  +  + +IS   S D PF  LAFK+A  PF G+LT+VRVYSG ++SGS V N  K KKER+ +L +MHA   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+  A+ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV++RET  ++ E VE  + KQ+GG GQ+  V I  EP        +EF +K+ GGRIPREYI  V AG ++AM  G LAGYP+++IK TL DG+FHEVDSSEMAFK+A S  LK+A +   PV+LEPIMA+EV  PE Y GD +GD++SRRG I+  E+R   +V+KA+VPL EMFGY  DLRS +QGR NY M F  YAE P +V  EIIA
  S:     1 MAQDVLTDLSKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGASTTDWMEQEQERGITITSAAVTCFWNQNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFTVRTIEERLGARPLVIQLPIGAENDFIGIIDLVEMKAKVWRGETALGEKYEVEEIPADLADKAEEYRTKLIEAVAETDEALLEKYFGGEELSIDEIKGAIRKLTVASELYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVESVTGHVPNKEDEVISRKPSTDEPFSALAFKIAVHPFFGKLTYVRVYSGTVESGSQVINSTKGKKERLGKLFQMHANKENPVERASAGHIYAVIGLKDTTTGDTLCDANQQIVLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIRRKVEKVEFTHKKQTGGSGQFAKVLIDLEPFSGEDGATYEFENKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNIKVTLLDGAFHEVDSSEMAFKVAGSQVLKKAAQAAQPVILEPIMAVEVITPEDYMGDVIGDLNSRRGQIQAMEERSGARVVKAQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIA 695
>gi|196178501|gb|EDX73500.1| translation elongation factor G [Microcoleus chthonoplastes PCC 7420] (691 aa)
Score = 2112, Expect = 0.0e+00, Identities = 393/688 (57%), Positives = 516/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART+ L   RN GI AHIDAGKTTT+ERILF+SG +HK+GE H+G +V DWMEQE+ERGITIT+AA S +W +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA RY+VPRI FVNKMD+TGANF +  + ++ R+   AV IQ+PIG+E+DF+GI+DL++ +   +        ++  IP++ ++  ++ R  L+E VA  D+ L+  YL  +E++ A+I+  +RKG I     PVLCGSAFKN+G++LLLD VVD+LPSP +VP  +    DG      A D+AP   LAFK+ +DP+ GRLTF+RVYSG+L+ GSY+ N  K++KER+SRL+ + +  R E++E+RAGD+ A IGLK TTTG+T+  ++  + LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REFKVE NVGAPQV++RET  K  + EGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +PRE+I P + G++ A  SG LAGYP+ID+KATL DGS+H+VDSSEMAFKIA S+A+K      +PVLLEP+M +EV VPE + GD MGD++SRRG IEG    + +  + AKVPL EMFGYATD+RS +QGRG + M+FS+Y E P++V   IIA  K
  S:     1 MARTIPLEKIRNIGIAAHIDAGKTTTTERILFYSGIVHKLGEVHEGTAVTDWMEQERERGITITAAAISTNWLDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFVNKMDRTGANFFKVYEQLRDRMRTNAVAIQIPIGSESDFHGIVDLVQMRARIYTNDLGTDMQDTEIPEKVQELAQEYRVKLIEAVAETDEALLEKYLAEEELTEAEIRSALRKGTIAGTIVPVLCGSAFKNRGVQLLLDGVVDYLPSPQEVPPIQGLLPDGTTDNRPAKDEAPLSALAFKIMSDPY-GRLTFMRVYSGILRKGSYILNSTKDQKERISRLIILKSNERIEVDELRAGDLGAAIGLKQTTTGDTICGEEAPIILESLYIPEPVISVAVEPKTKQDMEKLSKALQSLSEEDPTFRVSIDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKSVQAEGKFIRQSGGKGQYGHVVIELEPGETGSGFEFVSKIVGGSVPREFISPAEQGMKEACESGILAGYPLIDVKATLVDGSYHDVDSSEMAFKIAGSMAIKNGVTKAAPVLLEPMMKVEVEVPEDFLGDVMGDLNSRRGQIEGMGTDEGIAKVSAKVPLAEMFGYATDIRSKTQGRGIFSMEFSNYDEVPRNVAEAIIAKSK 688
>gi|33599019|ref|NP_886579.1| elongation factor G [Bordetella bronchiseptica RB50] >gi|46576497|sp|Q7WRC7|EFG1_BORBR Elongation factor G 1 (EF-G 1) >gi|33575065|emb|CAE30528.1| elongation factor G [Bordetella bronchiseptica RB50] (700 aa)
Score = 2112, Expect = 0.0e+00, Identities = 401/687 (58%), Positives = 512/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQ-RDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTT+ERILF++G  HK+GETHDG + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y VPR+ FVNKMD+TGANF +    ++ RL    VPI +PIGAE+ F G++DL++ K   +D   +  K E   IP + +    + R  LVE  A   ++LM  YLE   +   DI   +R+  I  +  P+LCG+AFKNKG++ +LDAV+D+LPSP D+P      +DGN +  SA D   F  LAFK+ +DPFVG+LTFVRVYSGVLKSG  V N  K KKER+ RL++MHA NR EI+E+ AGDI A++GLKD TTGETL D    + LE M+F +PVIS AVEPK+KADQEKM +ALS+LA+EDP+F+  +D E+GQTII+GMGELHL+ILVDRMRREF VE NVG PQV++RET  K   EVEGK++KQSGGRGQYGHV ++ EP     G+EFVD I GG +PREYI  V  G++  + +G LAGYP++D+KATLF GS+H+VDS+E AFK+AAS+A KE  +  SPVLLEP+MA+EV  PE Y G  MGD+SSRRG+++G +      + IKA+VPL EMFGYAT+LRS +QGR  Y M+F HYAE PK+V +E+IA +
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKLGETHDGSATMDWMEQEQERGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYDQLKTRLRANPVPIVIPIGAEDSFTGVVDLVKMKAIIWDEASQGTKFEYGDIPAELEGTANEWREKLVEAAAESSEELMNKYLETGSLDEDDINVALRQRTIAGEIQPMLCGTAFKNKGVQRMLDAVIDYLPSPADIPPVDGQDDDGNPIKRSADDAEKFSALAFKLMSDPFVGQLTFVRVYSGVLKSGDTVYNPIKGKKERIGRLLQMHANNREEIKEVLAGDIAAVVGLKDVTTGETLCDIDSHILLERMEFPEPVISQAVEPKSKADQEKMGLALSRLAQEDPSFRVRSDEESGQTIISGMGELHLEILVDRMRREFGVEANVGKPQVAYRETIRKNCDEVEGKFVKQSGGRGQYGHVVLKLEPLPPGGGYEFVDAIKGGVVPREYIPAVDKGIQETLPAGILAGYPVVDVKATLFFGSYHDVDSNENAFKMAASMAFKEGMRRASPVLLEPMMAVEVETPEDYAGTVMGDLSSRRGMVQGMDDIVGGGKTIKAEVPLAEMFGYATNLRSLTQGRATYTMEFKHYAEAPKNVADEVIAAR 698
>gi|77359197|ref|YP_338772.1| elongation factor G [Pseudoalteromonas haloplanktis TAC125] >gi|90110679|sp|Q3ILP5|EFG1_PSEHT Elongation factor G 1 (EF-G 1) >gi|76874108|emb|CAI85329.1| protein chain elongation factor EF-G, GTP-binding [Pseudoalteromonas haloplanktis TAC125] (704 aa)
Score = 2112, Expect = 0.0e+00, Identities = 402/687 (58%), Positives = 512/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKG--FEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MART  L  +RN GI AH+DAGKTTT+ERILF++G  HKIGETHDG + MDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERSLRVLDGA+ VL A  GV+PQTETVWRQA++YEVPR+IFVNKMD+TGA+F   V  ++ RLG   VPIQLPIGAE+ F G+IDLI+ K   ++   +      + IP + ++   + R+HLVE  A   ++LM  YLEG+E+S A+IK  +R+  +     P+ CGSAFKNKG++ +LD VV+++P+P  V Q +   EDG E    A D APF  LAFK+ATDPFVG LTF RVYSG +K G  V N  K+K+ER+ R+V+MH+ +R EI+E+ AGDI A IGLKD TTGETL D K  + LE M+F +PVIS+AVEP+T ADQ+KM IAL KLA EDP+F+  TD E+GQ II+GMGELHLDILV+RM+REF VE NVG PQV++RE      +VEGK+I+QSGGRGQYGHV ++ EP     D+   +EFV++ VGG IP+EY+  V  G++  M+ G LAGYP++ +KATL+DGSFH+VDS+EMAFKIA SLA+K+     SPVLLEP+M +EV  PE   GD +GD++ RRG+IEG E     ++ I A+VPL EMFGYATDLRS +QGR +Y M+F  YAE  K V   II+ +
  S:     1 MARTTPLERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGETHDGAATMDWMEQEQERGITITSAATTCFWKGMDAQFDAHRINIIDTPGHVDFTIEVERSLRVLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMIFVNKMDRTGADFFAVVDQVKSRLGATPVPIQLPIGAEDGFKGVIDLIKMKAINWNEADQGMTFTYEAIPAELQELADEWRSHLVESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVPMTCGSAFKNKGVQAVLDCVVEYMPAPTQVKQIQGILEDGTEEERPADDKAPFAALAFKIATDPFVGTLTFFRVYSGTVKQGDAVYNPVKSKRERLGRIVQMHSNSREEIKEVFAGDIAAAIGLKDVTTGETLCDPKSIITLERMEFPEPVISVAVEPRTIADQDKMGIALGKLAAEDPSFRVQTDEESGQIIISGMGELHLDILVERMKREFSVECNVGKPQVAYREAIRSTVKVEGKFIRQSGGRGQYGHVWLKLEPMDITDDEAPIYEFVNETVGGSIPKEYVPAVDKGIQEQMSQGVLAGYPLLGVKATLYDGSFHDVDSNEMAFKIAGSLAMKQGALQASPVLLEPVMKVEVLTPEANMGDVVGDLNRRRGMIEGMEDALGGLKQINAQVPLSEMFGYATDLRSATQGRASYSMEFLKYAEASKHVAETIISAR 701
>gi|581337|emb|CAA78673.1| elongation factor G [Mycobacterium leprae] (701 aa)
Score = 2112, Expect = 0.0e+00, Identities = 395/680 (58%), Positives = 507/680 (74%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE--EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAY--GEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGE HDG + MDWMEQE+ERGITITSAAT+  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +YEVPRI FVNKMDK GA+F  SV+++Q+RLG   +PIQLP+G+E DF G++DL+E   KV+  +    EK +   IP   +++ ++ R +L+E VA  D+ L+  Y  G+E+++A+IK  IRK  I  + +PVLCGSAFKNKG++ +LDAV+D+LPSP+DVP A  +  G++  E++   S D P   LAFKVAT PF G+LT+VRVYSG + SGS V N  K KKER+ +L +MH+   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+S+++ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV+++ET  +  E VE  + KQ+GG GQ+  V I+ EP        +EF +K+ GGRIPREYI  V+AG  +AM  G LA YP++++K TL DG++H+VDSSE+AFKIA S  LK+A     PV+LEPIMA+EVT PE Y GD +GD+ SRRG I+  ++R   +V++A VPL EMFGY  DLRS +QGR NY M F+ Y+E P +V  EIIA
  S:     9 DLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGAATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYEVPRICFVNKMDKIGADFYFSVRTMQERLGANVIPIQLPVGSEGDFEGVVDLVEMKAKVWSTEAKLGEKYDVVGIPTDLQEKAEEYRTNLLETVAETDEALLEKYFSGEELTVAEIKGAIRKLTISSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPAAIGHVPGKEDEEIVRKPSTDEPLSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINATKGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLADPNNQIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIRRVVETVEYTHKKQTGGSGQFAKVIIKLEPFSGENGATYEFENKVTGGRIPREYIPSVEAGARDAMQYGVLAAYPLVNLKVTLLDGAYHDVDSSEIAFKIAGSQVLKKAAAQAQPVILEPIMAVEVTTPEDYMGDVIGDLHSRRGQIQAMKERAGTRVVRAHVPLSEMFGYVGDLRSKTQGRANYSMVFNSYSEVPANVSKEIIA 696
>gi|110833243|ref|YP_692102.1| elongation factor (EF) [Alcanivorax borkumensis SK2] >gi|119368709|sp|Q0VSL8|EFG_ALCBS Elongation factor G (EF-G) >gi|110646354|emb|CAL15830.1| elongation factor (EF) [Alcanivorax borkumensis SK2] (699 aa)
Score = 2111, Expect = 0.0e+00, Identities = 404/688 (58%), Positives = 525/688 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA----EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L  +RN GI AH+DAGKTTT+ERILF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++YEVPRI+FVNKMD+ GA+F+     I++RLG   VPIQ  IGAE++F G++DLI  K  F++   EE      EEK IPD  KD+  ++R  + E  A   ++LM  YLE  ++S  +IK  +R+ V+  +    LCGSAFKNKG++ LLDAV++FLP+P +V   +    DG  V    +SDD PF  LAFK+ATDPFVG LTF+RVYSGVL SG  V N  + KKERV RL++MHA +R EI+E+ AGDI A +G+KD TTG+TL D K  + LE M+F +PVIS+AVEPK+KADQEKM +AL +LA+EDP+F+  TD ETGQTII+GMGELHLDILVDRMRREFKVE N+GAPQV++RETF + ++V+GK++KQSGGRGQYGHVK++FEP ++D+ F+F ++I GG +P+EY   VQ G++  + +G LAGYP++ +KATL+DGS+HEVDS+E AF++A +LA+K A K    VLLEPIM +E   PE Y GD MGD++ RRG+++G E     ++I+A+VPL EMFGYATDLRS SQGR +Y M+F  YAE PK++ +E+I+ KK
  S:     1 MARKTPLNRYRNIGICAHVDAGKTTTTERILFYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTTFWQGMDQQYDQHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVEPQSETVWRQANKYEVPRIVFVNKMDRAGADFDSVCNQIRKRLGASVVPIQYNIGAEDNFKGVVDLIRMKAIFWN---EEDMGMTYEEKDIPDDIKDRCDELREQMTEAAAEGSEELMEKYLEEGDLSNDEIKAGLRQQVLANEIVLGLCGSAFKNKGVQALLDAVIEFLPAPDEVKAIQGVLPDGETVEARKSSDDEPFSALAFKIATDPFVGSLTFIRVYSGVLNSGDSVLNSVREKKERVGRLLQMHANSREEIKEVLAGDIAACVGMKDVTTGDTLCDLKNPIVLERMEFPEPVISVAVEPKSKADQEKMGLALGRLAQEDPSFRVKTDEETGQTIISGMGELHLDILVDRMRREFKVEANIGAPQVAYRETFTRGADVDGKFVKQSGGRGQYGHVKVKFEPIDRDEEFQFEEQIHGGSVPKEYFGAVQKGIDEQLQAGVLAGYPILGVKATLYDGSYHEVDSNENAFRMAGALAVKNAAKEAGAVLLEPIMKVEAVTPEDYMGDVMGDLNRRRGIVQGMEDTMAGKIIRAEVPLSEMFGYATDLRSMSQGRASYSMEFLKYAEAPKNIADEVISGKK 698
>gi|119468171|ref|ZP_01611297.1| protein chain elongation factor EF-G, GTP-binding [Alteromonadales bacterium TW-7] >gi|119448164|gb|EAW29428.1| protein chain elongation factor EF-G, GTP-binding [Alteromonadales bacterium TW-7] (704 aa)
Score = 2111, Expect = 0.0e+00, Identities = 399/687 (58%), Positives = 512/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-----NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MART  L  +RN GI+AH+DAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERSLRVLDGA+ VL A  GV+PQTETVWRQA++YEVPR+IFVNKMD+TGA+F   V  ++ RLG   VPIQLP+GAE+DF G+IDLI+ KV  ++   +      + IP    +  ++ R+HLVE  A   ++LM  YLEG+E+S A+IK  +R+  +  +  PV CGSAFKNKG++ +LD VV+++PSP  V Q +   EDG E    A D APF  LAFK+ATDPFVG LTF RVYSG +K G  V N  K+K+ER+ R+V+MH+ +R EI+E+ AGDI A IGLKD TTGETL      + LE M+F +PVIS+AVEP+T ADQ+KM IAL KLA EDP+F+  TD E+GQTII+GMGELHLDI+VDRM+REF VE NVG PQVS+RE      EVEGK+I+QSGGRGQYGHV ++ EP     +    +EFV++ VGG +P+EYI  V  G++  M+ G LAGYP++ +KATL+DGSFH+VDS+EMAFKIA SLA+++     +PVLLEP+M +EV  P+   GD +GD++ RRG+IEG E     ++ I A+VPL EMFGYAT LRS +QGR +Y M+F  YAE  K V + II+ +
  S:     1 MARTTPLERYRNIGIVAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWKGMDAQFDAHRINIIDTPGHVDFTIEVERSLRVLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMIFVNKMDRTGADFLAVVSQVKSRLGATPVPIQLPVGAEDDFKGVIDLIKMKVINWNEADQGMTFTYEAIPADLLESAEEWRSHLVESAAEASEELMDKYLEGEELSEAEIKNALRQRTLANEIVPVTCGSAFKNKGVQAVLDGVVEYMPSPEQVKQIQGILEDGTEEERPADDKAPFAALAFKIATDPFVGTLTFFRVYSGTVKQGDAVYNPVKSKRERLGRIVQMHSNSREEIKEVYAGDIAAAIGLKDVTTGETLCAPNSIITLERMEFPEPVISVAVEPRTIADQDKMGIALGKLAAEDPSFRVQTDEESGQTIISGMGELHLDIIVDRMKREFSVECNVGKPQVSYREAIRSTVEVEGKFIRQSGGRGQYGHVWLKLEPMDISDDDSPIYEFVNETVGGSVPKEYIPAVDKGIQEQMSQGVLAGYPLLGVKATLYDGSFHDVDSNEMAFKIAGSLAMRDGALKANPVLLEPLMKVEVITPDSNMGDVVGDLNRRRGMIEGMEDALGGLKQINAQVPLSEMFGYATALRSATQGRASYSMEFLKYAEASKQVADTIISAR 701
>gi|167768225|ref|ZP_02440278.1| hypothetical protein CLOSS21_02781 [Clostridium sp. SS2/1] >gi|167709749|gb|EDS20328.1| hypothetical protein CLOSS21_02781 [Clostridium sp. SS2/1] (687 aa)
Score = 2111, Expect = 0.0e+00, Identities = 392/672 (58%), Positives = 507/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK---NCS---------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTTT+ERIL+++G  +KIG+THDG + MDWMEQE+ERGITITSAAT+  W    +C          +N+IDTPGHVDFTVEVERSLRVLDGA+AV  A+ GVEPQ+E VWRQA  Y VPR+ F+NKMD  GANF  +V  ++ RLG     +QLPIG E+DF GIIDL E + Y ++  K E      IP+  K++ +     L+E++   DD LM  YLEG+E S+ D+K  +RKG   C+  PV CG+A++NKG++ LLDA+++F+P+P D+P  K   EDGNEV   +SDD PF  LAFK+ TDPFVG+L F RVYSG  KSGSYV N  KNKKERV R+++MHA  R E++ + +GDI A +G K TTTG+T+ D++  V LE+M+F +PVI +A+EPKTK DQ KM+ AL+KLAEEDPTF+  TD ETGQTII+GMGELHL+I+VDR+ REFKVE NVGAPQV+++ETF K  +V+ KY KQSGGRGQYGH K+ FEP   N ++ F+F   +VGG IP+EYI  V  G+E A  SG L G+P++ +KAT++DGS+H+VDSSEMAF IA S+A KEA +    +LLEPIM +EVT+PE+Y GD +GDI+SRRG IEG +   + ++++A VPL EMFGY+TDLRS +QGRGNY M F  Y   PK+V  +++A K
  S:     1 MAHIDAGKTTTTERILYYTGVNYKIGDTHDGTATMDWMEQEQERGITITSAATTCHWTLQDHCKPKKGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVAVFCAKGGVEPQSENVWRQADTYNVPRMAFINKMDILGANFYGAVDQMKDRLGANVAVLQLPIGKEDDFKGIIDLFEMEAYIYNDEKGEDISIVEIPEDMKEEAELYHTELIEKICELDDDLMMQYLEGEEPSVDDLKAALRKGTCECKAVPVCCGTAYRNKGVQKLLDAIIEFMPAPTDIPAIKGVDEDGNEVERHSSDDEPFSALAFKIMTDPFVGKLAFFRVYSGTCKSGSYVLNATKNKKERVGRILQMHANKREELDIVYSGDIAAAVGFKSTTTGDTICDEQHPVILESMEFPEPVIDVAIEPKTKGDQGKMAEALAKLAEEDPTFRAHTDHETGQTIISGMGELHLEIIVDRLLREFKVEANVGAPQVAYKETFTKAVDVDSKYAKQSGGRGQYGHCKVHFEPMDANGEELFKFESTVVGGSIPKEYIPAVGEGIEEAAQSGILGGFPVLGVKATVYDGSYHDVDSSEMAFHIAGSMAFKEAMQKAGAILLEPIMRVEVTMPEEYMGDVIGDINSRRGRIEGMDDIASGKMVRAFVPLSEMFGYSTDLRSRTQGRGNYSMFFEKYEPVPKNVQEKVLADK 687
>gi|187476536|ref|YP_784560.1| elongation factor G [Bordetella avium 197N] >gi|119368668|sp|Q2L2H1|EFG1_BORA1 Elongation factor G 1 (EF-G 1) >gi|115421122|emb|CAJ47606.1| elongation factor G [Bordetella avium 197N] (700 aa)
Score = 2111, Expect = 0.0e+00, Identities = 399/687 (58%), Positives = 514/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTT+ERILF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y VPR+ FVNKMD+TGANF +  + ++ RL    VPI +PIGAE+ F G+IDL++ K   +D   +  K E   IP + +   ++ R  LVE  A   ++LM  YLE   +  A+I   IR+  I  +  P+LCG+AFKNKG++ +LDAV+++LPSP+D+P      +DGNEV   A D   F  LAFK+ +DPFVG+LTFVRVYSGVLKSG  V N  K KKER+ R+++MHA NR EI+E+ AGDI A++GLKD TTGETL D    V LE M+F +PVIS AVEPK+KADQEKM +ALS+LA+EDP+F+  +D E+GQTII+GMGELHL+ILVDRM+REF VE NVG PQV++RET  K   EVEGK++KQSGGRGQYGHV ++ EP     G+EFVD I GG +PREYI  V  G++  + +G LAGYP++D+K TLF GS+H+VDS+E AFK+A S+A KE  +  SPVLLEP+MA+EV  PE Y G  MGD+SSRRG+++G +      ++IKA+VPL EMFGYAT+LRS +QGR  Y M+F HY+E PK+V +E+IA +
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWRGMAGNFPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYEQLRTRLRANPVPIVIPIGAEDTFTGVIDLVKMKAIIWDEASQGTKFEYADIPAELQASAEEWREKLVEAAAESSEELMNKYLETGTLEEAEINAAIRQRTIAGEIHPMLCGTAFKNKGVQRMLDAVIEYLPSPIDIPPVDGTDDDGNEVQRRADDSEKFSALAFKLMSDPFVGQLTFVRVYSGVLKSGDTVYNPIKGKKERIGRILQMHANNREEIKEVLAGDIAAVVGLKDVTTGETLCDIDAHVTLERMEFPEPVISQAVEPKSKADQEKMGLALSRLAQEDPSFRVRSDEESGQTIISGMGELHLEILVDRMKREFGVEANVGKPQVAYRETIRKTCDEVEGKFVKQSGGRGQYGHVVLKVEPLAPGGGYEFVDAIKGGVVPREYIPAVDKGIQETLPAGILAGYPVVDVKVTLFFGSYHDVDSNENAFKMAGSMAFKEGMRKASPVLLEPMMAVEVETPEDYAGGVMGDLSSRRGMVQGMDDMVGGGKIIKAEVPLAEMFGYATNLRSLTQGRATYTMEFKHYSEAPKNVADEVIAAR 698
>gi|108804977|ref|YP_644914.1| translation elongation factor 2 (EF-2/EF-G) [Rubrobacter xylanophilus DSM 9941] >gi|119368763|sp|Q1AU26|EFG_RUBXD Elongation factor G (EF-G) >gi|108766220|gb|ABG05102.1| translation elongation factor G [Rubrobacter xylanophilus DSM 9941] (715 aa)
Score = 2110, Expect = 0.0e+00, Identities = 400/683 (58%), Positives = 514/683 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW-----------------------KNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETL--VDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           +A+   L   RN GIMAHIDAGKTTT+ERIL ++G  HK+GE HDG +VMDWM QE+ERGITITSAAT+V W                       +   +N+IDTPGHVDFTVEVERSLRVLDGAIA+ D+  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GA+F  +V++++QRLG   VP+QLPIGAE DF GI+DL+E K   +      + +E  IP++ +++ ++ R  L+E  A  D+++M  YLEG+EI    I+  +RK  +  Q  PV  GSAFKNKGI+ LLD V+D+LPSP+DVP  +    DG E      ++AP   LAFKV  DP VG+LT++RVYSG LK+GSYV N  K  +ERV RL++MHA  R + +E+ AG++ A +GL +T+TG+TL  VDD   + LE M F +PVI  A+EPKTKADQEK+S AL +LAEEDPTF+  TD ETGQT+IAGMGELHL+I++DR+ REFKV+ N+G PQV++RET  +  E VEG++++Q+GGRGQYGH  I  EP+ + G+EF D+IVGG IPR+YI  V  G+  A+ SG LAGYP++D+K  L DGS+HEVDSSEMAF+IA S+A KEA K   PVLLEPIMA+EVTVPE++ GD MGD+SSRRG I+G + R N QVI+A VPL EMFGYAT LRS +QGR  + MQF HYAE P+++  +I
  S:     5 VAKKTPLRRVRNIGIMAHIDAGKTTTTERILLYTGLTHKLGEVHDGNAVMDWMAQERERGITITSAATTVFWGGIEGSAKNGKKDSQEGRHSRIPEQYRINIIDTPGHVDFTVEVERSLRVLDGAIALFDSVAGVEPQSETVWRQADKYRVPRIAFVNKMDRIGADFYHAVETMRQRLGANPVPVQLPIGAEADFVGIVDLVEMKAIIYKDDLGAEWDETEIPEELRERAEEYRERLIEAAAEHDEEVMVAYLEGEEIEPDRIRAALRKATLELQITPVFVGSAFKNKGIQPLLDGVIDYLPSPLDVPPVRGKTLDGEEASREPDEEAPLAALAFKVQADPHVGKLTYIRVYSGTLKAGSYVMNTTKGVRERVGRLLQMHANTREQRDEVYAGELVAAVGLSNTSTGDTLVAVDDPHPIVLEQMVFPEPVIDQAIEPKTKADQEKLSQALQRLAEEDPTFRVRTDEETGQTVIAGMGELHLEIILDRLTREFKVDANIGKPQVAYRETIRRRVEGVEGRFVRQTGGRGQYGHAIINMEPH-EGGYEFEDRIVGGVIPRDYIPAVDKGIREALESGVLAGYPVVDVKVELVDGSYHEVDSSEMAFQIAGSMAAKEALKRARPVLLEPIMAVEVTVPEEFMGDVMGDLSSRRGQIQGMDSRGNSQVIRAMVPLAEMFGYATSLRSRTQGRATFTMQFDHYAEVPQNIAEKI 712
>gi|160894094|ref|ZP_02074872.1| hypothetical protein CLOL250_01648 [Clostridium sp. L2-50] >gi|156864127|gb|EDO57558.1| hypothetical protein CLOL250_01648 [Clostridium sp. L2-50] (689 aa)
Score = 2109, Expect = 0.0e+00, Identities = 390/672 (58%), Positives = 507/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK------------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFE---PNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTT +ERIL+++G  +KIG+THDG + MDWMEQE+ERGITITSAAT+  W                +N+IDTPGHVDFTVEVERSLRVLDGA+ V DA+ GVEPQ+E VWRQA  Y VPR+ F+NKMDK GA+F  SVQ+I  RLG  A+P+Q+PIG E+DF G+IDL E   Y++   K E  E   IPD  K+   +   +LVE++   DD LM  YLEG+E SI ++K+ +R+  I C+  PV  GSA+KNKG++ +LD V++++P+P D+P       +GN+V+  +SD+ PF  LAFK+ TDPFVG+L F RVYSG L SGSYV N  K+KKERV R+V+MHA  R EI+++ AGDI A +G K TTTG+T+ D++  V LE+M+F +PVI LA+EPKTK DQ KM  AL+KLAEEDPTF+  TD ETGQTIIAGMGELHL+++VDR+ REFKVE NVGAPQV+++ETF K  +V+ KY KQSGGRGQYGH K++FE   PN ++ F+F   +VGG IP+EYI  V  G+E A  +G L GYP++ + A ++DGS+HEVDSSEMAF IA S+A K+A    +PVLLEPIM +EVT+PE+Y GD +G ++++RG IEG +     ++++A VPL EMFGY+T+LRS +QGRGNY M F  YA+ PKSV  ++IA K
  S:     1 MAHIDAGKTTLTERILYYTGVNYKIGDTHDGTATMDWMEQEQERGITITSAATTCHWTLEDHHKPKAGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFDAKAGVEPQSENVWRQADTYNVPRMAFINKMDKMGADFFYSVQTIIDRLGKNAIPVQIPIGKESDFIGLIDLFEMDAYYYKDDKGEDIEITTIPDDLKELADKWHENLVEKICELDDDLMMMYLEGEEPSIDEMKKVLRRATIACEAVPVFLGSAYKNKGVQKMLDGVIEYMPAPTDIPDITGVDPEGNDVVRHSSDEEPFAALAFKIMTDPFVGKLAFFRVYSGTLNSGSYVLNATKDKKERVGRIVQMHANARKEIDKVYAGDIAAAVGFKVTTTGDTICDEQHPVILESMEFPEPVIELAIEPKTKNDQGKMGEALAKLAEEDPTFRAHTDKETGQTIIAGMGELHLEVIVDRLLREFKVEANVGAPQVAYKETFTKAVDVDSKYAKQSGGRGQYGHCKVKFEPMDPNGEETFKFESTVVGGAIPKEYIPAVGEGIEEAAKAGILGGYPVLGVHANVYDGSYHEVDSSEMAFHIAGSMAFKDAMAKANPVLLEPIMKVEVTMPEEYLGDVIGSLNAKRGQIEGMDDIGGGKIVRAFVPLAEMFGYSTELRSSTQGRGNYSMFFERYAQCPKSVQEKVIAEK 687
>gi|83312232|ref|YP_422496.1| translation elongation factor [Magnetospirillum magneticum AMB-1] >gi|119368739|sp|Q2W2I8|EFG_MAGMM Elongation factor G (EF-G) >gi|82947073|dbj|BAE51937.1| Translation elongation factor [Magnetospirillum magneticum AMB-1] (694 aa)
Score = 2108, Expect = 0.0e+00, Identities = 396/685 (57%), Positives = 509/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEE-KVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKA--YGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKID--VQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MART  L  +RN GIMAHIDAGKTTT+ERIL+++G+ +KIGE H+G + MDWMEQE+ERGITITSAAT+  W++  +N+IDTPGHVDFT+EVERSLRVLDGA+ V D+  GVEPQ+ETVWRQA +Y VPRI FVNKMD+ GANF R V  I  RLG + + + LPIG E+ + G++DL+    V + D     + E++PIP    ++  Q RA L+E     DD+ M  YL G+E S   ++ CIRKG I   F PVLCGSAFKNKG++ LLDAV+D+LP+PVD+P  K   YG + +E+   ++DD PF GLAFK+  DPFVG LTFVRVYSGV++SGSY++N  K K+ERV R++ MHA +R EI+E RAGDI A  GLKDTTTG+TL D      V LE M+F +PVI +AVEPK+KADQEKM IAL++LA EDP+F+  +D E+GQT+I GMGELHL+ILVDRM+REFKVE NVGAPQV++RET +K  EV+  + KQ+GG GQ+  VKIRFEP  K  G+ F +K++GG +P+EY+  V  G+ +AM +G +AG+PMID KATL DG++H+VDSS +AF+IA+  A +E      P LLEP+M +EV  PE Y GD +GD++SRRG +   +QR N +VI A VPL  MFGY   LRS SQGR  Y M F HY+E P++V +EI A
  S:     1 MARTTPLERYRNIGIMAHIDAGKTTTTERILYYTGKSYKIGEVHEGTATMDWMEQEQERGITITSAATTAFWRDHRVNIIDTPGHVDFTIEVERSLRVLDGAVTVFDSVAGVEPQSETVWRQADKYGVPRICFVNKMDRIGANFYRCVDMIVDRLGARPLVMHLPIGEESGYIGLVDLLRNVAVIWKDESLGAEFEDQPIPADLVEKAAQYRAQLIETAVEMDDEAMEQYLGGEEPSFEVLQACIRKGTISRTFVPVLCGSAFKNKGVQPLLDAVIDYLPAPVDIPAIKGVKYGTE-DEIAKHSTDDEPFAGLAFKIMNDPFVGSLTFVRVYSGVVESGSYIQNTVKEKRERVGRMLLMHANSREEIKEARAGDIVAFAGLKDTTTGDTLCDPTPSSLVVLERMEFPEPVIEVAVEPKSKADQEKMGIALARLAAEDPSFRVTSDVESGQTVIKGMGELHLEILVDRMKREFKVEANVGAPQVAYRETISKAYEVDYTHKKQTGGSGQFARVKIRFEPGEKGAGYVFENKVIGGSVPKEYVPGVDKGIRSAMDNGVIAGFPMIDFKATLTDGAYHDVDSSVLAFEIASRAAFREGIAKAGPKLLEPMMKVEVVTPEDYLGDVIGDLNSRRGQVNDMDQRGNARVITAMVPLANMFGYVNTLRSMSQGRAQYSMTFDHYSEVPQNVSDEIRA 690
>gi|160872570|ref|ZP_02062702.1| translation elongation factor G [Rickettsiella grylli] >gi|159121369|gb|EDP46707.1| translation elongation factor G [Rickettsiella grylli] (704 aa)
Score = 2107, Expect = 0.0e+00, Identities = 393/687 (57%), Positives = 518/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISAS--DDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQ--RDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           M R   +  +RN GI+AHIDAGKTTT+ERILF++G  HK+GE H+G +VMDWM QE+ERGITITSAAT+  W   +       +N+IDTPGHVDFT+EVERSLRVLDGA  V  A  GVEPQ+ETVWRQA++Y+VPR+ FVNKMD+ GA+F R V+ I++RLG + VP+ +PIGAE +F G+IDL++ K  ++D   +  + E + IPD  K++ +     L+E VA   +++   YL G + ++ +IK+ +R   +  +  PVLCGSAFKNKG++ +LDAV+++LP+P DVP  K   +D  + L      D+APF  LAFK+ATDPFVG L + RVYSGV+KSG  V N  K+KKER+ R+V+MHA  R EI+E+RAGDI A +GLK TTTG+TL +    + LE M+F +PVIS+AVEPKTKADQEKMSIALSKLA+EDP+F+   D E+GQTII+GMGELHL+I+VDRM+REF VE NVG PQV++RET  K  E EGK+++QSGGRGQYGHV I+ EP    KG+EF + IVGG +PREYI  V  G++  + +G +AGYP++D+K TLFDG++H+VDSSEMAFKIA S+A KE  +  SPVLLEPIM +EV  PE+Y GD MGD++ RRG+++G E+      ++I+A+VPL EMFGYATDLRS +QGR  Y M+F  Y E P ++ + II  K
  S:     1 MDRQTPIERYRNIGIIAHIDAGKTTTTERILFYTGVSHKLGEVHEGTAVMDWMAQEQERGITITSAATTCFWDGMAHQFPQHRINIIDTPGHVDFTIEVERSLRVLDGACVVFCAVSGVEPQSETVWRQANKYQVPRLAFVNKMDRAGADFLRVVEQIEKRLGGRPVPLHIPIGAEENFEGVIDLVQMKAIYWDENTQGMRFEYQEIPDALKEECQAWHEKLIETVAEVSEEMTERYLNGGKFTLDEIKKALRVLTLDNKIVPVLCGSAFKNKGVQAMLDAVIEYLPAPNDVPPIKGILDDAEQTLAERPPVDEAPFAALAFKIATDPFVGSLVYFRVYSGVVKSGDTVYNPVKSKKERIGRIVQMHANTREEIKEVRAGDIAAAVGLKYTTTGDTLSEMNHIITLERMEFPEPVISVAVEPKTKADQEKMSIALSKLAQEDPSFRVRVDEESGQTIISGMGELHLEIIVDRMKREFSVEANVGKPQVAYRETIRKPVEQEGKFVRQSGGRGQYGHVWIKLEPLEAGKGYEFENAIVGGVVPREYIPAVDKGIKEQLENGVIAGYPVVDVKVTLFDGTYHDVDSSEMAFKIAGSMAFKEGARKASPVLLEPIMKVEVVTPEEYMGDVMGDLNRRRGILQGMEELPAGAGKMIRAEVPLSEMFGYATDLRSATQGRATYTMEFGKYNEAPATIADSIIRKK 700
>gi|146281167|ref|YP_001171320.1| elongation factor G [Pseudomonas stutzeri A1501] >gi|166220164|sp|A4VHM7.1|EFG_PSEU5 Elongation factor G (EF-G) >gi|145569372|gb|ABP78478.1| elongation factor G [Pseudomonas stutzeri A1501] (706 aa)
Score = 2107, Expect = 0.0e+00, Identities = 402/684 (58%), Positives = 520/684 (76%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK-------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVL--ISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFE-PNKD------KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  +  +RN GI AH+DAGKTTT+ERILF++G  HK+GE HDG +  DWM QE+ERGITITSAA +  W+       N  +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPRI++VNKMD+ GANF R V  I+QRLG   VP+QL IG+E +F G IDLI+ K +Y+ D  K     E+ IP +  D  ++ R++++E  A  +++LM  YLEG E++I +IK  +R+  I C+  P +CGS+FKNKG+ L+LDAV+D+LP+P ++P  +    D  E +    ASDD PF  LAFK+ATDPFVG LTF RVYSGVL SG  V N  K KKERV R+V+MHA  R+EI+E RAGDI A+IG+KD TTG+TL   +  + LE M F +PVIS+AVEPKTKADQEKM IAL KLA+EDP+F+  TD ETGQTII+GMGELHLDILVDRMRREF VE N+G PQVS+RET  K++ E+EGK+++QSGGRGQ+GH  IRF  P+ D      +G  F +++VGG +P+EYI  +Q G+E  M +G +AGYP+I +KAT+FDGS+H+VDS+EMAFK+AAS+A K+  +     +LEPIM +EV  PE Y GD MGD++ RRGLI+G E   + +VI+A+VPL EMFGYATD+RS SQGR +Y M+FS YAE P ++V  ++
  S:     1 MARTTPINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVHDGAATTDWMVQEQERGITITSAAVTTFWQGSRGQYDNYRVNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRIVYVNKMDRQGANFLRVVGQIKQRLGHTPVPVQLAIGSEENFAGQIDLIKMKAIYWNDDDKGTTYREEEIPAELMDLAEEYRSNMIEAAAEANEELMNKYLEGGELTIEEIKAGLRQRTIACEIVPAVCGSSFKNKGVPLVLDAVIDYLPAPTEIPPIQGVNPDNEEQVDERHASDDEPFSALAFKIATDPFVGTLTFTRVYSGVLSSGDSVINSVKGKKERVGRMVQMHANQRDEIKECRAGDIAALIGMKDVTTGDTLCSIEKPIILERMDFPEPVISVAVEPKTKADQEKMGIALGKLAQEDPSFRVQTDEETGQTIISGMGELHLDILVDRMRREFNVEANIGKPQVSYRETITKDNVEIEGKFVRQSGGRGQFGHCWIRFSTPDVDEKGNITEGLVFTNEVVGGVVPKEYIPAIQKGIEEQMKNGVVAGYPLIGLKATVFDGSYHDVDSNEMAFKVAASMATKQLAQKGGGKVLEPIMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDSVSGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFSKYAEAPANIVETLV 702
>gi|196242036|ref|ZP_03140794.1| translation elongation factor G [Cyanothece sp. PCC 7425] >gi|196213912|gb|EDY08573.1| translation elongation factor G [Cyanothece sp. PCC 7425] (706 aa)
Score = 2107, Expect = 0.0e+00, Identities = 409/688 (59%), Positives = 508/688 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKN---------------CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART  L   RN GI AHIDAGKTTT+ERILF+SG +HKIGE H+G +V DWM QE+ERGITIT+AA + +W                   +N+IDTPGHVDFT+EVERS+RVLDG IAV  +  GV+PQ+ETVWRQA+RY VPRI+FVNKMD+TGANF R    I+ RL   AVPIQLPIGAE+   G+IDL+  + Y +        EE  IP   ++Q  + R  LVE VA  DD LM  YLEG++++  +I+  +R+G I     P+LCGSAFKNKG++LLLDAV+D+LP+P +VP  +    DG EV   A D  P  GLAFK+ +DP+ GRLTFVRVYSG+LK GSYV N  K KKER+SRL+ + A +R E++E+RAGD+ A +GLKDT TG+TL DD   V LE++   +PVIS+AVEPKTK D EK+S AL  L+EEDPTF+   DPET QT+IAGMGELHL+ILVDRM REF V  NVGAPQV++RET  K    EGK+I+QSGG+GQYGHV I  EP +   GFEFV KIVGG +P+EYI P + G++ A  SG LAGYP+ID+K T+ DGSFHEVDSSEMAFKIA S+A+K+A    +PVLLEP+M +EV VPE + G  MGD+ SRRG IEG    + +  + AKVPL+ MFGYATD+RS +QGRG + M+FSHY E P++V   IIA  K
  S:     1 MARTTPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHEGNTVTDWMVQERERGITITAAAITTAWTKRDPQNPTQPMPGALEHKINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQANRYSVPRIVFVNKMDRTGANFYRVYDQIRDRLRANAVPIQLPIGAEDTLRGLIDLVRMRAYLYKNDIGTDIEETEIPADMQEQADEFRTKLVEAVAEADDVLMEKYLEGEDLTEEEIRAGLRQGTIAGTIVPMLCGSAFKNKGVQLLLDAVIDYLPAPTEVPAIQGTLPDGTEVERKADDAQPLAGLAFKIMSDPY-GRLTFVRVYSGILKKGSYVLNSTKGKKERISRLIVLKADDRIEVDELRAGDLGAALGLKDTFTGDTLCDDSAPVILESLFIPEPVISVAVEPKTKQDMEKLSKALQSLSEEDPTFRVSVDPETNQTVIAGMGELHLEILVDRMLREFNVGANVGAPQVAYRETVRKPVRTEGKFIRQSGGKGQYGHVVIELEPGDPGSGFEFVSKIVGGVVPKEYIGPAEQGMKEACESGILAGYPVIDLKVTMVDGSFHEVDSSEMAFKIAGSMAIKDAVMKANPVLLEPMMKVEVEVPEDFLGSVMGDLISRRGQIEGQTATEGIAKVTAKVPLERMFGYATDIRSNTQGRGIFSMEFSHYEEVPRNVAEAIIAKNK 703
>gi|194335442|ref|YP_002017236.1| translation elongation factor G [Pelodictyon phaeoclathratiforme BU-1] >gi|194307919|gb|ACF42619.1| translation elongation factor G [Pelodictyon phaeoclathratiforme BU-1] (704 aa)
Score = 2107, Expect = 0.0e+00, Identities = 392/683 (57%), Positives = 506/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK---------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNE-VLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR VDL   RN GIMAHIDAGKTTT+ERIL+++GR+H++GE HDG + MDWM+QEKERGITITSAAT+  W          N  +N+IDTPGHVDFTVEVERSLRVLDGA+A+  A  GVEPQ+ETVWRQA++Y VPRI ++NKMD+TGANF  +V++I++RLG   VP+Q+PIG    F G +DLI  K   ++       +E  IP   +++ +  R +++E V+  DD L+  YL G++I+ ++++  +R+  +     PVLCGS+FKNKG++ +LDAVV++L SPVDV   + +     E V     D+ PF  LAFK+ATDPFVG+LTF RVYSGVLK+GSYV N    KKER+ R+++MH+  R +I+ +  GDI A +GLKD  TG+TL D+   V LE M F +PVI +A+EPKTK+D +++ ++L+KLAEEDPTFK  TD ETGQT+IAGMGELHL+ILVDR++REFKVE NVG PQV++RET  K  E EGK+++QSGG+GQ+G V +R EP  + KG+EFVD + GG IPREYI  V AG++ AM SG +AG+PM DIK TL DG +HEVDSSEMAFKIA S+  K   K   PVLLEPIM +EV  P++Y GD MGD+SSRRG IEG  QR   Q + AKVPL  MFGY+TDLRS SQGR NY M+F  Y E P+S+   +
  S:     1 MARLVDLDKVRNIGIMAHIDAGKTTTTERILYYTGRLHRMGEVHDGGATMDWMDQEKERGITITSAATTCFWMPKFGNYIGVNHRINIIDTPGHVDFTVEVERSLRVLDGAVALFCAVGGVEPQSETVWRQANKYGVPRIAYINKMDRTGANFFETVKAIRERLGANPVPLQIPIGEGEIFAGFVDLIRMKGIIYNKEDGSTYDEVEIPHDLQNEARTWRINMLEAVSEHDDTLLEKYLNGEDITESEVRNVLRQATLKVTIIPVLCGSSFKNKGVQFMLDAVVEYLASPVDVGAVEGHHPRTEEPVTREPKDEEPFAALAFKIATDPFVGKLTFFRVYSGVLKAGSYVLNTMTGKKERIGRVLQMHSNKREDIDCVYCGDIAAAVGLKDVRTGDTLCDENSPVVLEKMVFPEPVIEIAIEPKTKSDSDRLGMSLAKLAEEDPTFKVKTDDETGQTLIAGMGELHLEILVDRLKREFKVEANVGKPQVAYRETIRKSVEFEGKFVRQSGGKGQFGLVVLRVEPLEEGKGYEFVDAVKGGVIPREYIPAVNAGVQQAMKSGVVAGFPMQDIKVTLLDGKYHEVDSSEMAFKIAGSIGFKGGAKKADPVLLEPIMKVEVVTPDEYLGDVMGDLSSRRGHIEGMGQRAGAQFVNAKVPLSAMFGYSTDLRSMSQGRANYSMEFDCYREVPRSIAEAL 694
>gi|167758488|ref|ZP_02430615.1| hypothetical protein CLOSCI_00828 [Clostridium scindens ATCC 35704] >gi|167663684|gb|EDS07814.1| hypothetical protein CLOSCI_00828 [Clostridium scindens ATCC 35704] (689 aa)
Score = 2107, Expect = 0.0e+00, Identities = 389/672 (57%), Positives = 506/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK------------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTT +ERIL+++G  +KIG+TH+G + MDWMEQE+ERGITITSAAT+  W                +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+E VWRQA  Y VPR+ F+NKMD  GA+F  +V+ I+ RLG  A+ +QLPIG E+DF GIIDL+E K Y ++  K E      IP+  +D  +     LVE++ + DD LM +YLEG E S+ D+K+ +RK    C   PV CG+A++NKG++ LLDAVV+++P+P D+P      EDGNEV+  +SD+ PF  LAFK+ TDPFVG+L + RVYSG + SGSYV N  K KKERV R+++MHA  R E+E++ +GDI A IG K TTTG+T+ D++  V LE+M+F +PVI LA+EPKTKA Q K+  +L+KLAEEDPTF+  TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++E F K  +V+ KY KQSGGRGQYGH K++FEP   N ++ ++F   +VGG IP+EYI  V  G+E AM SG L G+P++ +KA ++DGS+HEVDSSEMAF IA SLA K+A K  +PVLLEPIM +EVT+PE+Y GD +GDI+SRRG +EG +     ++++A VPL EMFGY+TDLRS +QGRGNY M F  Y   PKSV  ++++ K
  S:     1 MAHIDAGKTTLTERILYYTGVNYKIGDTHEGTATMDWMEQEQERGITITSAATTCHWTLEEQTKPKKGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFCAKGGVEPQSENVWRQADTYNVPRMAFINKMDILGADFYNAVEQIKTRLGKNAICLQLPIGKEDDFKGIIDLMEMKAYIYNDEKGEDISVVDIPEDMQDDAELYHTELVEKICDLDDDLMMEYLEGNEPSVDDLKKVLRKATCECTAVPVCCGTAYRNKGVQKLLDAVVEYMPAPTDIPAITGVDEDGNEVVRHSSDEEPFSALAFKIMTDPFVGKLAYFRVYSGSINSGSYVLNATKGKKERVGRILQMHANKREELEKVYSGDIAAAIGFKFTTTGDTICDERHPVILESMEFPEPVIELAIEPKTKASQGKLGESLAKLAEEDPTFRAHTDHETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKEAFTKPVDVDSKYAKQSGGRGQYGHCKVKFEPMDVNGEETYKFESTVVGGAIPKEYIPAVGEGIEEAMKSGILGGFPVVGLKANVYDGSYHEVDSSEMAFHIAGSLAFKDAMKKSAPVLLEPIMKVEVTMPEEYMGDVIGDINSRRGRVEGMDDLGGGKIVRAYVPLSEMFGYSTDLRSRTQGRGNYSMFFEKYEPVPKSVQEKVLSIK 687
>gi|33594476|ref|NP_882120.1| elongation factor G [Bordetella pertussis Tohama I] >gi|46576273|sp|Q7VTD5|EFG_BORPE Elongation factor G (EF-G) >gi|33564551|emb|CAE43868.1| elongation factor G [Bordetella pertussis Tohama I] (700 aa)
Score = 2106, Expect = 0.0e+00, Identities = 401/687 (58%), Positives = 513/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNV----QVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTT+ERILF++G  HK+GETHDG + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y VPR+ FVNKMD+TGANF +    ++ RL    VPI +PIG E+ F G++DL++ K   +D   +  K E   IP + +    + R  LVE  A   ++LM  YLE   +   DI   +R+  I  +  P+LCG+AFKNKG++ +LDAV+D+LPSP D+P      +DGN +  SA D   F  LAFK+ +DPFVG+LTFVRVYSGVLKSG  V N  K KKER+ RL++MHA NR EI+E+ AGDI A++GLKD TTGETL D    + LE M+F +PVIS AVEPK+KADQEKM +ALS+LA+EDP+F+  +D E+GQTII+GMGELHL+ILVDRMRREF VE NVG PQV++RET  K   EVEGK++KQSGGRGQYGHV ++ EP     G+EFVD I GG +PREYI  V  G++  + +G LAGYP++D+KATLF GS+H+VDS+E AFK+AAS+A KE  +  SPVLLEP+MA+EV  PE Y G  MGD+SSRRG+++G    D++    + IKA+VPL EMFGYAT+LRS +QGR  Y M+F HYAE PK+V +E+IA +
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKLGETHDGSATMDWMEQEQERGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYDQLKTRLRANPVPIVIPIGVEDSFTGVVDLVKMKAIIWDEASQGTKFEYGDIPAELEGTANEWREKLVEAAAESSEELMNKYLETGSLDEDDINVALRQRTIAGEIQPMLCGTAFKNKGVQRMLDAVIDYLPSPADIPPVDGQDDDGNPIKRSADDAEKFSALAFKLMSDPFVGQLTFVRVYSGVLKSGDTVYNPIKGKKERIGRLLQMHANNREEIKEVLAGDIAAVVGLKDVTTGETLCDIDSHILLERMEFPEPVISQAVEPKSKADQEKMGLALSRLAQEDPSFRVRSDEESGQTIISGMGELHLEILVDRMRREFGVEANVGKPQVAYRETIRKNCDEVEGKFVKQSGGRGQYGHVVLKLEPLPPGGGYEFVDAIKGGVVPREYIPAVDKGIQETLPAGILAGYPVVDVKATLFFGSYHDVDSNENAFKMAASMAFKEGMRRASPVLLEPMMAVEVETPEDYAGTVMGDLSSRRGMVQGM---DDIVGGGKTIKAEVPLAEMFGYATNLRSLTQGRATYTMEFKHYAEAPKNVADEVIAAR 698
>gi|94500499|ref|ZP_01307030.1| translation elongation factor G [Oceanobacter sp. RED65] >gi|94427289|gb|EAT12268.1| translation elongation factor G [Oceanobacter sp. RED65] (697 aa)
Score = 2106, Expect = 0.0e+00, Identities = 398/684 (58%), Positives = 516/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF---DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  +  +RN GI AH+DAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W   S       +N+IDTPGHVDFT+EVERSLRVLDGA+ VL    GV+PQTETVWRQA++YEVPR++FVNKMD+TGA+F   V+ +++RLG   VPIQ+ IGAE DF G++DL++ K   +   D G   + E+  IP    D     R  L+E  A   ++LM  YLE  ++S  +IK+ +R+  +  +   V CGSAFKNKG++ +LDAV+++LPSP +V   +   +D  E + +  A D APF  LAFK+ATDPFVG LTFVRVYSGVL +G  V N  K KKERV R+V+MH+ NR EI+E+RAGDI A+IG+KD TTG+TL D    + LE M+F +PVIS+AVEPK+KADQEKM IAL KLA+EDP+F+  TD E+GQTII+GMGELHLD+LVDRM+REF VE N+G PQV++RE      E+  K+ KQSGGRGQYGHV IRFEPN+ +  EFV++IVGG IP+EYI  V+ G+++ M +G LAGYP++ +KATLFDGSFH+VDS+EMAFKIAAS+A KE  +   P LLEP+M++EV  PE+Y GD +GD++ RRGL++G ++  + +++ A+VPL EMFGYATDLRS +QGR  Y M+F  YAE P +V   II
  S:     1 MARTTPINRYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWSGMSQQFDQHRINIIDTPGHVDFTIEVERSLRVLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRMVFVNKMDRTGADFFMVVEQLKKRLGANPVPIQINIGAEEDFKGVVDLVKMKAIMWNEEDKGMTYQLED--IPADLVDTANDYREQLLEAAAEASEELMDKYLEEGDLSEEEIKQALRQRTLDNEIVLVTCGSAFKNKGVQAVLDAVIEYLPSPTEVKAIEGVLDDAKESVETREADDKAPFAALAFKIATDPFVGTLTFVRVYSGVLNAGDSVYNPVKGKKERVGRMVQMHSNNREEIKEVRAGDIAALIGMKDVTTGDTLCDFNNKITLERMEFPEPVISVAVEPKSKADQEKMGIALQKLAQEDPSFRVETDEESGQTIISGMGELHLDVLVDRMKREFSVEANIGKPQVAYREHITTTCEINKKFAKQSGGRGQYGHVVIRFEPNEGEELEFVNEIVGGTIPKEYIPAVERGIQDQMKNGVLAGYPLLGLKATLFDGSFHDVDSNEMAFKIAASMATKELAREGKPALLEPVMSVEVVTPEEYMGDVVGDLNRRRGLVQGMDESPSGKLVTAEVPLSEMFGYATDLRSATQGRATYAMEFKKYAEAPNNVAEAII 694
>gi|163859276|ref|YP_001633574.1| elongation factor G [Bordetella petrii DSM 12804] >gi|163263004|emb|CAP45307.1| elongation factor G [Bordetella petrii] (700 aa)
Score = 2105, Expect = 0.0e+00, Identities = 399/687 (58%), Positives = 512/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTT+ERILF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+  +       +N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y VPR+ FVNKMD+TGANF +    ++ RL    VPI +PIGAE+ F G+IDL++ K   +D   +  K +   IP + +    + R  LVE  A   ++LM  YLE   +  A+I   IR+  I  +  P+LCG+AFKNKG++ +LDAV+D+LPSP+D+P      ++GNE+   A D      LAFK+ +DPFVG+LTFVRVYSG+LKSG  V N  K KKERV RL++MHA NR EI+E+ AGDI A++GLKD TTGETL D    + LE M+F +PVIS AVEPK+KADQEKM +ALS+LA+EDP+F+  +D E+GQTII+GMGELHL+ILVDRM+REF VE NVG PQV++RET  K   EVEGK++KQSGGRGQYGHV ++ EP     G+EFVD I GG +PREYI  V  G++  + +G LAGYP++D+KATLF GS+H+VDS+E AFK+AAS+A KE  +  SPVLLEP+MA+EV  PE Y G  MGD+SSRRG+++G E      + IKA+VPL EMFGYAT+LRS +QGR  Y M+F HY+E PK+V +E+IA +
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYDQLKTRLRANPVPIVIPIGAEDSFKGVIDLVKMKAIIWDEASQGTKFDYVDIPAELEGAANEWREKLVEAAAESTEELMNKYLETGSLDEAEINTAIRQRTIAGEIQPMLCGTAFKNKGVQRMLDAVIDYLPSPIDIPPVAGQDDEGNEISRKADDGEKMSALAFKLMSDPFVGQLTFVRVYSGILKSGDTVYNPIKGKKERVGRLLQMHANNREEIKEVLAGDIAAVVGLKDVTTGETLCDVDSHILLERMEFPEPVISQAVEPKSKADQEKMGLALSRLAQEDPSFRVRSDEESGQTIISGMGELHLEILVDRMKREFGVEANVGKPQVAYRETIRKTCEEVEGKFVKQSGGRGQYGHVVLKLEPLEPGGGYEFVDAIKGGVVPREYIPAVDKGIQETLPAGILAGYPVVDVKATLFFGSYHDVDSNENAFKMAASMAFKEGMRKASPVLLEPMMAVEVETPEDYAGTVMGDLSSRRGMVQGMEDMVGGGKTIKAEVPLAEMFGYATNLRSLTQGRATYTMEFKHYSEAPKNVADEVIAAR 698
>gi|32328846|emb|CAE00448.1| elongation factor G [Pseudoalteromonas haloplanktis TAC125] (704 aa)
Score = 2104, Expect = 0.0e+00, Identities = 401/687 (58%), Positives = 511/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKG--FEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MART  L  +RN GI AH+DAGKTTT+ERILF++G  HKIGETHDG + MDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERSLRVLDGA+ VL A  GV+PQTETVWRQA++YEVPR+IFVNKMD+TGA+F   V  ++ RLG   VPIQLPIGAE+ F G+IDLI+ K   ++   +      + IP + ++   + R+ LVE  A   ++LM  YLEG+E+S A+IK  +R+  +     P+ CGSAFKNKG++ +LD VV+++P+P  V Q +   EDG E    A D APF  LAFK+ATDPFVG LTF RVYSG +K G  V N  K+K+ER+ R+V+MH+ +R EI+E+ AGDI A IGLKD TTGETL D K  + LE M+F +PVIS+AVEP+T ADQ+KM IAL KLA EDP+F+  TD E+GQ II+GMGELHLDILV+RM+REF VE NVG PQV++RE      +VEGK+I+QSGGRGQYGHV ++ EP     D+   +EFV++ VGG IP+EY+  V  G++  M+ G LAGYP++ +KATL+DGSFH+VDS+EMAFKIA SLA+K+     SPVLLEP+M +EV  PE   GD +GD++ RRG+IEG E     ++ I A+VPL EMFGYATDLRS +QGR +Y M+F  YAE  K V   II+ +
  S:     1 MARTTPLERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGETHDGAATMDWMEQEQERGITITSAATTCFWKGMDAQFDAHRINIIDTPGHVDFTIEVERSLRVLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMIFVNKMDRTGADFFAVVDQVKSRLGATPVPIQLPIGAEDGFKGVIDLIKMKAINWNEADQGMTFTYEAIPAELQELADEWRSQLVESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVPMTCGSAFKNKGVQAVLDCVVEYMPAPTQVKQIQGILEDGTEEERPADDKAPFAALAFKIATDPFVGTLTFFRVYSGTVKQGDAVYNPVKSKRERLGRIVQMHSNSREEIKEVFAGDIAAAIGLKDVTTGETLCDPKSIITLERMEFPEPVISVAVEPRTIADQDKMGIALGKLAAEDPSFRVQTDEESGQIIISGMGELHLDILVERMKREFSVECNVGKPQVAYREAIRSTVKVEGKFIRQSGGRGQYGHVWLKLEPMDITDDEAPIYEFVNETVGGSIPKEYVPAVDKGIQEQMSQGVLAGYPLLGVKATLYDGSFHDVDSNEMAFKIAGSLAMKQGALQASPVLLEPVMKVEVLTPEANMGDVVGDLNRRRGMIEGMEDALGGLKQINAQVPLSEMFGYATDLRSATQGRASYSMEFLKYAEASKHVAETIISAR 701
>gi|91774632|ref|YP_544388.1| elongation factor G [Methylobacillus flagellatus KT] >gi|119368742|sp|Q1H4P0|EFG_METFK Elongation factor G (EF-G) >gi|91708619|gb|ABE48547.1| translation elongation factor 2 (EF-2/EF-G) [Methylobacillus flagellatus KT] (697 aa)
Score = 2104, Expect = 0.0e+00, Identities = 399/687 (58%), Positives = 509/687 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSL-------NLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   +  +RN GI AHIDAGKTTTSERILF++G  HK+GE HDG +  DWMEQE+ERGITITS+A +  WK   L       N+IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++++VPR+ FVNKMD+TGANF + V+ ++ RL    VP+ +PIGAE++F G++DLI+ K +Y+ D  +  K E K IP    D   + R  +VE  A   ++LM  YLE  E+S A+I   +R+  I  +  P+LCGSAFKNKG++ +LDAV+DFLPSPVD+P      E G  +   A D+  F  LAFK+ +DPFVG+LTFVRVYSGVL  G  V N    +KER+ R+V+M A  RNEIEEIRAGDI A IGLK+ TTGETL      + LE M F +PVIS+A+EPKTK+DQEKM +ALS+LA+EDP+F+  TD ET QTII+GMGELHL+I+VDRM+REF VE NVGAPQV++RE   K  EVEGK++KQSGG+GQYGHV I+ EPN+  KG+EF+D+I GG +PRE+I  V  GL   + SG LAG+P++D+K TLFDGS+H+VDS+E AFK+AAS+A K+  +   PVLLEPIMA+EV  PE Y GD MGD+SSRRG+I+G +      + I+A+VPL EMFGYAT +RS +QGR  Y M+F HYAE P++V   II  K
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTSERILFYTGVTHKLGEVHDGAATTDWMEQEQERGITITSSAVTCFWKGMDLSRPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQANKHKVPRLAFVNKMDRTGANFFKVVEQMKLRLQANPVPVVIPIGAEDNFAGVVDLIKMKAIYWDDASQGMKFEYKDIPADLLDTANEWREKMVESAAEASEELMNKYLESGELSEAEIIAGLRQRTIATEIQPMLCGSAFKNKGVQRMLDAVLDFLPSPVDIPDVVGESESGEPLTRKADDNEHFSALAFKLMSDPFVGQLTFVRVYSGVLTKGETVYNSTSGRKERIGRIVQMSANERNEIEEIRAGDIAACIGLKEVTTGETLCSIDHPIILERMVFPEPVISVAIEPKTKSDQEKMGLALSRLAQEDPSFRVRTDEETNQTIISGMGELHLEIIVDRMKREFNVEANVGAPQVAYREAIKKPVEVEGKFVKQSGGKGQYGHVWIKMEPNEPGKGYEFIDQIKGGTVPREFIPAVDKGLRETIPSGVLAGFPVVDVKVTLFDGSYHDVDSNENAFKMAASMAFKDGMRKADPVLLEPIMAVEVETPEDYMGDVMGDLSSRRGVIQGMDDLVGGGKAIRAEVPLSEMFGYATTVRSLTQGRATYSMEFKHYAEAPRNVAEAIINKK 697
>gi|189501214|ref|YP_001960684.1| translation elongation factor G [Chlorobium phaeobacteroides BS1] >gi|189496655|gb|ACE05203.1| translation elongation factor G [Chlorobium phaeobacteroides BS1] (704 aa)
Score = 2103, Expect = 0.0e+00, Identities = 390/683 (57%), Positives = 511/683 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK---------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEI 683
           MAR V L N RN GIMAHIDAGKTTT+ERIL+++GR+H++GE HDG + MDWMEQEKERGITITSAAT+  W+            +N+IDTPGHVDFTVEVERSLRVLDGA+A+  A  GVEPQ+ETVWRQA++Y+VPRI +VNKMD+ GA+F  +V+++++RLG   VPIQ+PIG    F G++DLI  K   +D       EE  IP   + + K  R +++E V+  D+ L+  YLEG++I+ A++++ +R+  +     P LCGS+FKNKG++ +LDAV+++LPSPVDV     +   G++  IS   SDD PF GLAFK+ATDPFVG+LTF RVYSGVL++GSYV N    KKERV RL++MH+  R + + + AGDI A +GLKD  TG+TL D    + LE M F +PVI +A+EPKTKAD +K+ ++L KLAEEDPTF+  +D ETGQT+IAGMGELHL++LVDR++REFKVE NVG PQV++RET     E EGK+++QSGG+GQ+G V I+ EP  + KG+EFVD I GG +P+EYI  V AG++ AM  G +AGYP+ D+K TL+DG +H+VDSSEM+FKIA S+  K A +  +PVLLEPIM +EV  PE+Y GD MGD+SSRRG I+G  +R   Q +KA VPL +MFGY+T LRS +QGR NY M+F  Y E PKSV   +
  S:     1 MARQVGLANVRNIGIMAHIDAGKTTTTERILYYTGRLHRMGEVHDGGATMDWMEQEKERGITITSAATTCFWEPKGGNFVDVKHRINIIDTPGHVDFTVEVERSLRVLDGAVALFCAVGGVEPQSETVWRQANKYKVPRIAYVNKMDRVGADFYAAVKAVKERLGANPVPIQIPIGQGEIFAGVVDLIRMKGIIYDKEDGSTFEEVEIPHDLETEAKHWRINMLEAVSEVDETLLEKYLEGEDITEAEVRKVLREATLNGSIIPALCGSSFKNKGVQFMLDAVIEYLPSPVDVGSVTGH-HPGDDSGISRKPSDDEPFAGLAFKIATDPFVGKLTFFRVYSGVLEAGSYVLNALTGKKERVGRLMQMHSNKREDRDAVFAGDIAAAVGLKDVKTGDTLCDAGKPIVLEKMVFPEPVIQIAIEPKTKADSDKLGVSLGKLAEEDPTFRVSSDEETGQTLIAGMGELHLEVLVDRLKREFKVEANVGQPQVAYRETIRGTVEHEGKFVRQSGGKGQFGLVNIKVEPLEEGKGYEFVDAIKGGVVPKEYIPAVSAGIQEAMKDGVVAGYPVQDVKVTLYDGKYHDVDSSEMSFKIAGSIGFKGAARKANPVLLEPIMKVEVITPEEYLGDVMGDLSSRRGHIDGMGERAGAQFVKASVPLAQMFGYSTVLRSMTQGRANYTMEFECYNEVPKSVAEAL 694
>gi|196193245|gb|EDX88204.1| translation elongation factor G [Alcanivorax sp. DG881] (699 aa)
Score = 2103, Expect = 0.0e+00, Identities = 400/688 (58%), Positives = 522/688 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI-SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP-NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   L  +RN GI AH+DAGKTTT+ERILF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++YEVPRI+FVNKMD+ GA+F+     I++RLG   VPIQ  IGAE++F G++DLI  K +Y+ +       EEK IPD  K +  ++R  + E  A   ++LM  YLE  ++S  DIK  +R+ V+  +    LCGSAFKNKG++ LLDAV++FLP+P +V   +    DG  V    +SDD PF  LAFK+ATDPFVG LTF+RVYSGVL SG  V N  + KKERV RL++MHA +R EI+E+ AGDI A +G+KD TTG+TL D K  + LE M+F  PVIS+AVEPK+KADQEKM +AL +LA+EDP+F+  TD ETGQTII+GMGELHLDILVDRM+REFKVE N+GAPQV++RETF + ++V+GK++KQSGGRGQYGHVK++FEP ++D+ F+F ++I GG +P+EY   VQ G++  + +G LAGYP++ +KATL+DGS+HEVDS+E AF++A +LA+K A K    VLLEP+M +E   PE Y GD MGD++ RRG+++G E     ++I+A+VPL EMFGYATDLRS SQGR +Y M+F  YAE PK++ +E+I+ KK
  S:     1 MARKTPLNRYRNIGICAHVDAGKTTTTERILFYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTTFWQGMDQQYDQHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVEPQSETVWRQANKYEVPRIVFVNKMDRAGADFDSVCNQIRKRLGASVVPIQYNIGAEDNFKGVVDLIRMKAIYWSEDDMGMTYEEKDIPDDIKARCDELREQMTEAAAEGSEELMEKYLEEGDLSNDDIKAGLRQQVLANEIVLGLCGSAFKNKGVQALLDAVIEFLPAPDEVKAIQGVLPDGETVEARKSSDDEPFSALAFKIATDPFVGSLTFIRVYSGVLNSGDSVMNSVREKKERVGRLLQMHANSREEIKEVLAGDIAACVGMKDVTTGDTLCDMKSPIVLERMEFPDPVISVAVEPKSKADQEKMGLALGRLAQEDPSFRVKTDEETGQTIISGMGELHLDILVDRMKREFKVEANIGAPQVAYRETFTRAADVDGKFVKQSGGRGQYGHVKVKFEPIDRDEEFQFEEQIHGGSVPKEYFGAVQKGIDEQLQAGVLAGYPILGVKATLYDGSYHEVDSNENAFRMAGALAVKNAAKEAGAVLLEPMMKVEAVTPEDYMGDVMGDLNRRRGIVQGMEDTMAGKIIRAEVPLSEMFGYATDLRSMSQGRASYSMEFLKYAEAPKNIADEVISGKK 698
>gi|167031497|ref|YP_001666728.1| elongation factor G [Pseudomonas putida GB-1] >gi|166857985|gb|ABY96392.1| translation elongation factor G [Pseudomonas putida GB-1] (714 aa)
Score = 2101, Expect = 0.0e+00, Identities = 396/684 (57%), Positives = 517/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK-------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEV----------LISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKES-EVEGKYIKQSGGRGQYGHVKIRF-EPNKD------KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  +  +RN GI AH+DAGKTTT+ERILF++G  HK+GE HDG +  DWM QE+ERGITITSAA +  WK       N  +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+++VNKMD+ GANF R V  I+ RLG   VP+QL IG+E++F G +DLI+ K +Y+ D  K     E+ IP    +  ++ R+++VE  A   ++LM  YLEG+E+++ +IK  +R   +  +  P +CGS+FKNKG+ L+LDAV+D+LP+P ++P  +    D  E+          +  A DD PF  LAFK+ATDPFVG LTFVRVYSGVL SG  V N  K KKERV R+V+MHA  R EI+E+RAGDI A+IG+KD TTGETL +    + LE M F +PVISL+VEPKTKADQEKM IAL KLA+EDP+F+  TD ETGQTII+GMGELHLDILVDRM+REF VE N+G PQVS+RE   K + E+EGK+++QSGGRGQ+GH  IRF EP  D      +G  F +++VGG IP+E+I P+Q G+E  M +G +AGYP+I +KA +FDGS+H+VDS+EMAFKIAAS+A K+       V+LEPIM +EV  PE Y GD MGD++ RRGL++G ++  + +V++A+VPL EMFGYATD+RS SQGR +Y M+FS YAE P ++V  ++
  S:     1 MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVHDGAATTDWMVQEQERGITITSAAVTTFWKGSVGQYDNYRVNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKNRLGHTPVPVQLAIGSEDNFQGQVDLIKMKAIYWNDDDKGTTYREEEIPADMLELAQEWRSNMVEAAAESSEELMNKYLEGEELTVEEIKAGLRARTLASEIVPAVCGSSFKNKGVPLVLDAVIDYLPAPTEIPAIQGINPDDKELDKEDPAVRKDVRHADDDEPFSALAFKIATDPFVGTLTFVRVYSGVLTSGDSVINSVKGKKERVGRMVQMHANQREEIKEVRAGDIAALIGMKDVTTGETLCNADKPIILERMDFPEPVISLSVEPKTKADQEKMGIALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDILVDRMKREFNVEANIGKPQVSYREKITKSNVEIEGKFVRQSGGRGQFGHCWIRFSEPEVDEKGNITEGLVFSNEVVGGVIPKEFIAPIQKGIEEQMKNGVVAGYPLIGLKAAVFDGSYHDVDSNEMAFKIAASMATKQLATKGGGVVLEPIMKVEVVTPEDYLGDVMGDLNRRRGLVQGMDESVSGRVVRAEVPLGEMFGYATDVRSMSQGRASYSMEFSKYAEAPSNIVEALV 710
>gi|157826661|ref|YP_001495725.1| elongation factor G [Rickettsia bellii OSU 85-389] >gi|166220167|sp|A8GV17.1|EFG_RICB8 Elongation factor G (EF-G) >gi|48474233|sp|Q8KTB0|EFG_RICBE Elongation factor G (EF-G) >gi|22087318|gb|AAM90927.1|AF502177_1 elongation factor G [Rickettsia bellii] >gi|157801965|gb|ABV78688.1| elongation factor G [Rickettsia bellii OSU 85-389] (697 aa)
Score = 2101, Expect = 0.0e+00, Identities = 396/681 (58%), Positives = 503/681 (73%)
  Q:     7 LINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE-EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG-EDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP----------NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           L N RN GI AHIDAGKTTT+ERIL+++G+ HKIGE H+G + MDWMEQE+ERGITITSAAT+  W++  +N+IDTPGHVDFT+EVERSLRVLDGA+AV D   GVEPQ+ETVWRQA +Y VPR+ FVNKMD+ GA+F R V  I+ RLG K + IQLPIG E +F G++DL++ + V + D     +   + IPD  K + ++ RA+L++ V   DD++M  YL G+E++  +IK+ IRKG I   F+PVLCGSAFKNKG++ LLDAVVD+LPSP+D+   K      G E     S   PF  LAFK+  DPFVG LTF+RVYSG + SG+ V N  KNK+E++ R++ MHA NR +++E  AGDI A+ GLKDTTTG+TL D+   V LE M+F +PVI LAVEPK+K DQEKM +ALS+LA EDP+F+T TD ETGQT+I GMGELHL+I++DRMRREFKVE N+GAPQV++RET  K  E++  + KQSGG GQ+  VKI FEP          +K+K F F  KIVGG +P+EYI  V+ GL N   +G +AGYPMID KATL DG+FH+VDSS +AF+IAA  A +E     +P LLEPIM +EV  P++Y GD +GD++SRRG ++G E R N QVIKA VPL EMFGY   LRS SQGR  Y M F+HY + P  V + I A K
  S:     5 LENIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHEGGATMDWMEQEQERGITITSAATTCRWQDKQINIIDTPGHVDFTIEVERSLRVLDGAVAVFDGVAGVEPQSETVWRQADKYNVPRMCFVNKMDRMGADFYRCVDMIKDRLGAKPLVIQLPIGIEENFKGVVDLVKMQAVVWKDESLGAEYSYQEIPDDMKAKAEEYRANLLDMVVELDDKIMEKYLSGEEVTEEEIKKLIRKGTISAAFYPVLCGSAFKNKGVQPLLDAVVDYLPSPIDIATVKGVEVSTGEEKDFPISVSEPFSALAFKIMNDPFVGSLTFIRVYSGKITSGTTVINTVKNKREKIGRMLLMHANNREDVKEASAGDIVALAGLKDTTTGDTLSDEDKKVILERMEFPEPVIELAVEPKSKVDQEKMGLALSRLAAEDPSFRTSTDQETGQTVIKGMGELHLEIIIDRMRREFKVEANIGAPQVAYRETITKACEIDYTHKKQSGGAGQFARVKIIFEPLKDVKDLKEEDKNKSFIFESKIVGGAVPKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLIDGAFHDVDSSVLAFEIAAKAAFREGMPKGNPKLLEPIMKVEVITPDEYMGDVIGDLNSRRGQVQGMEPRGNAQVIKAYVPLAEMFGYVNTLRSLSQGRAQYSMVFNHYDQVPTQVADTIKAKK 697
>gi|108797959|ref|YP_638156.1| elongation factor G [Mycobacterium sp. MCS] >gi|119867056|ref|YP_937008.1| elongation factor G [Mycobacterium sp. KMS] >gi|126433622|ref|YP_001069313.1| elongation factor G [Mycobacterium sp. JLS] >gi|166220149|sp|A3PV95.1|EFG_MYCSJ Elongation factor G (EF-G) >gi|166220150|sp|A1UBL0.1|EFG_MYCSK Elongation factor G (EF-G) >gi|119368745|sp|Q1BDD4|EFG_MYCSS Elongation factor G (EF-G) >gi|108768378|gb|ABG07100.1| translation elongation factor 2 (EF-2/EF-G) [Mycobacterium sp. MCS] >gi|119693145|gb|ABL90218.1| translation elongation factor 2 (EF-2/EF-G) [Mycobacterium sp. KMS] >gi|126233422|gb|ABN96822.1| translation elongation factor 2 (EF-2/EF-G) [Mycobacterium sp. JLS] (701 aa)
Score = 2101, Expect = 0.0e+00, Identities = 401/680 (58%), Positives = 503/680 (73%)
  Q:     6 DLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE--EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           DL   RN GIMAHIDAGKTTT+ERIL+++G  +KIGETHDG S  DWMEQE+ERGITITSAA +  W +  +N+IDTPGHVDFTVEVERSLRVLDGA+AV D + GVEPQ+E VWRQA +Y+VPRI FVNKMDK GA+F  +V++I++RLG   + IQLPIGAENDF GIIDL+E K   + G     EK E + IP +  D+  + R  L+E VA  D+ L+  Y  G+E+++ +IK  IRK  +  + +PVLCGSAFKNKG++ +LDAVVD+LPSP+DV   + +  +  + LI+   S D PF  LAFK+A  PF G+LT+VRVYSG ++SGS V N  K KKER+ +L +MHA   N +E   AG I A+IGLKDTTTG+TL D    + LE+M F  PVI +A+EPKTK+DQEK+  A+ KLAEEDPTFK   D ETGQT+I GMGELHLDILVDRMRREFKVE NVG PQV++RET  ++ E VE  + KQ+GG GQ+  V I  EP        +EF +K+ GGRIPREYI  V AG ++AM  G LAGYP++++K TL DG++HEVDSSEMAFK+A S  LK+A +   PV+LEPIMA+EVT PE Y G+ +GD++SRRG I+  E+R   +V+KA+VPL EMFGY  DLRS +QGR NY M F  YAE P +V  EIIA
  S:     9 DLNKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGASTTDWMEQEQERGITITSAAVTCFWNDNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFTVRTIEERLGATPLVIQLPIGAENDFIGIIDLVEMKAKVWRGETALGEKYEVEDIPAELADKADEYRTKLLEAVAETDEALLEKYFGGEELTVEEIKGAIRKLTVNSELYPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVESVQGHVPNKEDELITRKPSVDEPFSALAFKIAVHPFFGKLTYVRVYSGTVESGSQVINSTKGKKERLGKLFQMHANKENPVERASAGHIYAVIGLKDTTTGDTLSDANQQIVLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIKRKVEKVEFTHKKQTGGSGQFAKVLIDLEPFSGEDGATYEFENKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNVKVTLLDGAYHEVDSSEMAFKVAGSQVLKKAAQAAQPVILEPIMAVEVTTPEDYMGEVIGDLNSRRGQIQAMEERAGARVVKAQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIA 696
>gi|152998274|ref|YP_001343109.1| translation elongation factor G [Marinomonas sp. MWYL1] >gi|150839198|gb|ABR73174.1| translation elongation factor G [Marinomonas sp. MWYL1] (697 aa)
Score = 2101, Expect = 0.0e+00, Identities = 394/684 (57%), Positives = 513/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFF---DGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS-ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +  +RN GI AH+DAGKTTT+ER+LF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W   +       +N+IDTPGHVDFT+EVERSLRVLDGA+ VL    GV+PQTETVWRQA++YEVPR++FVNKMD+TGA+F   V+ ++ RLG  AVPIQ+ +GAE DF G+IDL+  K   +   D G     E+  IP+   D+ ++ R H+VE  A   +QLM  YLE  ++S+ +IK  +R   +  +   V CGSAFKNKG++ +LDAVV++LPSP++V   +   EDG  V+   A+D+ PF  LAFK+ATDPFVG LTF+RVYSGVL+SG  V N  K K+ER+ R+V+MHA NR EI+E+ AGDI A++G+K  TTG+TL D K  V LE M+F +PVIS+AVEPK++ADQ+KM++AL KLA+EDP+F+  T  ETGQTII+GMGELHLDILVDRMRREFKVE N+G PQVS+RE   KE  V  K+++QSGGRGQYGHV ++  P +  G EFV++IVGG IP+EYI  V+ G+   M +G +AGYP++ IK  L DGSFH+VDS+EMAFKIAAS  L++      P +LEP+M +EV  PE+Y GD MGD++ RRGL++G +   + ++I+A+VPL EMFGYATD+RS SQGR +Y M+F  YAE P SV + II
  S:     1 MARKTPINRYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWSGMNKQFEEHRVNIIDTPGHVDFTIEVERSLRVLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRMVFVNKMDRTGADFFSVVRQLKTRLGANAVPIQINVGAEEDFRGVIDLVVMKTIVWNEEDQGMTFTLED--IPEDLLDEAQEWREHMVEAAAEASEQLMDKYLEEGDLSVEEIKSGLRIRTLSNEIVLVTCGSAFKNKGVQAVLDAVVEYLPSPLEVKAIEGTLEDGETVVTRVANDEDPFSSLAFKIATDPFVGTLTFIRVYSGVLRSGDAVYNSVKQKRERIGRMVQMHANNREEIKEVLAGDIAALVGMKFATTGDTLCDMKDVVVLERMEFPEPVISVAVEPKSQADQDKMAVALGKLAQEDPSFRVETHEETGQTIISGMGELHLDILVDRMRREFKVEANIGKPQVSYREKIRKEVVVNHKFVRQSGGRGQYGHVVMKLIPTEKDGLEFVNEIVGGAIPKEYIPAVEKGVSEQMKNGVIAGYPLLGIKVVLIDGSFHDVDSNEMAFKIAASQGLRKGAVDADPCVLEPVMKVEVVTPEEYMGDVMGDLNRRRGLVQGMDDSPSGKIIRAEVPLGEMFGYATDVRSLSQGRASYAMEFEKYAEAPASVADAII 693
>gi|160937573|ref|ZP_02084934.1| hypothetical protein CLOBOL_02464 [Clostridium bolteae ATCC BAA-613] >gi|158439642|gb|EDP17392.1| hypothetical protein CLOBOL_02464 [Clostridium bolteae ATCC BAA-613] (689 aa)
Score = 2101, Expect = 0.0e+00, Identities = 393/673 (58%), Positives = 501/673 (74%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW---KNCS---------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAHIDAGKTTT+ERIL+++G  +KIG+TH+G + MDWM QE+ERGITITSAAT+  W   +NC          +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+E VWRQA  Y VPR+ F+NKMD  GANF  +V  I+ RLG  A+ IQLPIG E+DF GIIDL E K Y ++  K +      IP+  +D  +  R+ LVE++   DD LM  YLEG+E S  D+K+ +RK    C   PV CG+A++NKG++ LLDAV++F+PSP+D+P  K    DGNEV   +SDD PF  LAFK+ TDPFVG+L F RVYSG L SGSYV N  K KKERV R+++MHA  RNE++ + +GDI A +G K T+TG+T+ D+K  V LE+M+F +PVI +A+EPKTKA Q+KM  AL KLAEEDPTF+  TD ETGQTII+GMGELHLDI+VDR+ REF VE NVGAPQV+++ETF K  +V+ KY KQSGGRGQYGH K+ F P   N ++ F+F   +VGG IP+EYI  V  G+E A  +G L G+P++ + A ++DGS+HEVDSSEMAF IA S+A KEA    +P+LLEPIM +EVT+PE Y GD +GDI+SRRG IEG E     ++++A VPL EMFGY+TDLRS +QGRGNY M F  Y   PK+V  ++++  K
  S:     1 MAHIDAGKTTTTERILYYTGVNYKIGDTHEGTATMDWMAQEQERGITITSAATTCHWTLQENCKPKPGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFCAKGGVEPQSENVWRQADTYNVPRMAFINKMDILGANFYGAVDQIKTRLGKNAICIQLPIGKEDDFKGIIDLFEMKAYIYNDDKGDDISIIDIPEDMQDDAELYRSELVEKICELDDDLMMTYLEGEEPSNDDLKKALRKATCECAAIPVCCGTAYRNKGVQKLLDAVIEFMPSPLDIPSIKGTDLDGNEVERHSSDDEPFAALAFKIMTDPFVGKLAFFRVYSGSLNSGSYVLNATKGKKERVGRILQMHANKRNELDRVYSGDIAAAVGFKVTSTGDTICDEKNPVILESMEFPEPVIDIAIEPKTKASQDKMGDALVKLAEEDPTFRVRTDEETGQTIISGMGELHLDIIVDRLLREFNVEANVGAPQVAYKETFTKAVDVDSKYAKQSGGRGQYGHCKVHFTPMEANAEETFKFTSSVVGGAIPKEYIPAVGEGIEEACKTGILGGFPVLGVHADVYDGSYHEVDSSEMAFHIAGSMAFKEAMHKGNPILLEPIMKVEVTMPEDYMGDVIGDINSRRGRIEGMEDIGGGKMVRAYVPLSEMFGYSTDLRSRTQGRGNYSMFFDKYEPVPKNVQEKVLSDHK 688
>gi|114319616|ref|YP_741299.1| translation elongation factor 2 (EF-2/EF-G) [Alkalilimnicola ehrlichei MLHE-1] >gi|119368710|sp|Q0ABH8|EFG_ALHEH Elongation factor G (EF-G) >gi|114226010|gb|ABI55809.1| translation elongation factor 2 (EF-2/EF-G) [Alkalilimnicola ehrlichei MLHE-1] (699 aa)
Score = 2100, Expect = 0.0e+00, Identities = 401/684 (58%), Positives = 515/684 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPN-KDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MAR   +  +RN GIMAHIDAGKTT +ERILF++G  HKIGETH+G +VMDWM QE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGAIAV  A  GVEPQ+ETVWRQA++YEVPR+ FVNKMD+ GANF R V+ I+ RL    VP+QLPIGAE++F G++DL+  K +Y+ +       E+  +P +  D+  + R  LVE  A  D++LM  YLEG E+++ +I R +R   +  +  P  CGSAFKNKG++ LLD V+++LPSPVDVP  +   +D +  + +    DD PF  LAFK+ATDP+VG LTF RVYSGV+++G  V N  K KKER+ R+V+MHA +R EI+E+RAGDI A +GLKD TTG+TL D    + LE M+F  PVIS+AVEPKTK DQEKM +AL KLA+EDP+F+  TD E+GQTII+GMGELHLDI+VDR++REFKVE NVGAPQV++RET  K  E EGK+++QSGGRGQYGHV +R  P  ++ G+EFV+ IVGG +P+EYI  V  G   A+ +G LAG+P ID+K  L+DGS+H+VDSSE AFKIA S+A+KE      PVLLEPIM +EV  PE+Y GD MGD++ RRG ++G E   + ++I+A+VPLKEMFGYATDLRS +QGR +YVM F  Y E P S+ +EII
  S:     1 MARKTPIERYRNIGIMAHIDAGKTTATERILFYTGISHKIGETHEGAAVMDWMSQEQERGITITSAATTAFWQGMDQQYPQHRINIIDTPGHVDFTIEVERSLRVLDGAIAVFCAVGGVEPQSETVWRQATKYEVPRMAFVNKMDRAGANFGRVVEQIRTRLKATPVPLQLPIGAEDEFKGVVDLVRMKAIYWNEEDMGVTYEQTDVPAELADEAAEAREFLVEAAAEADEELMDKYLEGGELTVEEINRGLRARTLANEIVPAFCGSAFKNKGVQALLDGVIEYLPSPVDVPAIEGELDDADGTVATRKPGDDQPFAALAFKIATDPYVGTLTFFRVYSGVVQTGDTVFNPVKGKKERLGRIVQMHANSREEIKEVRAGDIAAAVGLKDVTTGDTLCDINNKITLERMEFPDPVISVAVEPKTKGDQEKMGMALGKLAQEDPSFQVRTDEESGQTIISGMGELHLDIIVDRLKREFKVEANVGAPQVAYRETIRKTVEQEGKFVRQSGGRGQYGHVHLRISPQERNAGYEFVNSIVGGVVPKEYIPSVDKGAYEALENGILAGFPAIDVKVELYDGSYHDVDSSEAAFKIAGSMAMKEGFMKADPVLLEPIMRVEVVTPEEYMGDVMGDLNRRRGTVQGMEDGPSGKIIRAQVPLKEMFGYATDLRSATQGRASYVMFFDEYQEAPASIADEII 695
>gi|154503768|ref|ZP_02040828.1| hypothetical protein RUMGNA_01592 [Ruminococcus gnavus ATCC 29149] >gi|153795868|gb|EDN78288.1| hypothetical protein RUMGNA_01592 [Ruminococcus gnavus ATCC 29149] (689 aa)
Score = 2100, Expect = 0.0e+00, Identities = 388/672 (57%), Positives = 506/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW---KNCS---------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTTT+ERIL+++G  HKIG TH+G + MDWMEQE+ERGITITSAAT+  W   +NC          +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+E VWRQA  Y VPR+ F+NKMD  GANF  +V+ I+ RLG  A+ IQLPIG E++F GIIDL E K Y ++  K +      IP++ ++  +     LVE++   DD LM  YLEG+E S+ ++K  +RK    C   PV CG+A++NKG++ LLDAV++F+PSP+D+P      EDGNEV   +SDD PF  L FK+ TDPFVG+L + RVYSG + SGSYV N  K KKERV R+++MHA  R E++++ +GDI A IG K +TTG+T+ D++  V LE+M+F +PVI LA+EPKTKA Q K+  +L+KLAEEDPTF+  TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++E+  K  +++ KY KQSGGRGQYGH K++FEP   N ++ ++F   +VGG IP+EYI  V  G+E AM SG L G+P++ + A ++DGS+HEVDS+EMAF IA SLA K+A K  SPVLLEPIM +EVT+PE+Y GD +GDI+SRRG IEG +     ++++A VPL EMFGY+TDLRS +QGRGNY M F  Y + PKSV  ++++ K
  S:     1 MAHIDAGKTTTTERILYYTGVNHKIGNTHEGNATMDWMEQEQERGITITSAATTCHWTLQENCKPKEGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFCAKGGVEPQSENVWRQADTYNVPRMAFINKMDILGANFYGTVEQIKTRLGKNAICIQLPIGKEDEFKGIIDLFEMKAYIYNDDKGDDISIIDIPEEMQEDAELYHTELVEKICELDDDLMMAYLEGEEPSVEELKAALRKATCTCDAIPVCCGTAYRNKGVQKLLDAVIEFMPSPLDIPAITGVDEDGNEVERHSSDDEPFSALVFKIMTDPFVGKLAYFRVYSGTMNSGSYVLNATKEKKERVGRILQMHANKREELDKVYSGDIAAAIGFKYSTTGDTICDEQHPVILESMEFPEPVIELAIEPKTKASQGKLGESLAKLAEEDPTFRAHTDQETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKESITKAVDIDSKYAKQSGGRGQYGHCKVKFEPMDVNGEEVYKFESTVVGGAIPKEYIPAVGEGIEEAMKSGILGGFPVVGVHANVYDGSYHEVDSNEMAFHIAGSLAFKDAMKQASPVLLEPIMKVEVTMPEEYMGDIIGDINSRRGRIEGMDDLGGGKIVRAFVPLSEMFGYSTDLRSRTQGRGNYSMFFDSYEQVPKSVQEKVLSNK 687
>gi|148244326|ref|YP_001219020.1| translation elongation factor EF-G [Candidatus Vesicomyosocius okutanii HA] >gi|166220184|sp|A5CXN7.1|EFG_VESOH Elongation factor G (EF-G) >gi|146326153|dbj|BAF61296.1| translation elongation factor EF-G [Candidatus Vesicomyosocius okutanii HA] (700 aa)
Score = 2100, Expect = 0.0e+00, Identities = 399/684 (58%), Positives = 508/684 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKA-EEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLI--SASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  L  +RN GIMAHIDAGKTTT+ERIL ++GR H+IGE HDG + MDWMEQE+ERGITITSAAT+  WK          +N+IDTPGHVDFT+EVERSL+VLD A AV  A  GVEPQ+ETVWRQA++Y VPRI FVNKMD++GA+F R  + I+ RLG   VP+Q+ IGAE  F G+IDLI  K  F++   +    E + IP + +   K+    +VE  A  +D+LM  YLE  ++S  DIK+ IR   I  +  P+ CGSAFKNKG++ +LDA++ ++PSP+DV       +D +E ++   A D+ PF  LAFK+ATDPFVG LTF RVYSGVL++G +V N  K KKER+ R+V+MH+  R+EI+E+RAGDI A IGLKD TTG+TL D K  + LE M+F +PVI+LAVEPKTKADQEKM IAL KLA EDP+F+  TD E+GQTIIAGMGELHLDI+VDRM REF VE NVGAPQVS+RE      E + K++KQSGGRGQYGHV +R EP +   G+EFVD+I GG IP+EY+  V  G++  M +G LAG+P++DIK T++DGS+H+VDS+E+AFKIAAS  L E  K+ +P LLEP+MA+EV  PE Y GD MGDI+ RRG++   E     + +KA+VPL EMFGY+ DLRS +QGR NY M+F+ Y   PK+V +EII
  S:     1 MARTTPLDRYRNVGIMAHIDAGKTTTTERILLYTGRTHRIGEVHDGSATMDWMEQEQERGITITSAATTCFWKGMDGQFEDHRVNIIDTPGHVDFTIEVERSLKVLDSACAVFCAVGGVEPQSETVWRQANKYNVPRIGFVNKMDRSGADFLRVCKQIKTRLGGNPVPMQIAIGAEESFEGVIDLISMKAIFWNEVDQGATYETRDIPIELQGLAKEQYEFMVESAAEANDELMEKYLEESKLSNHDIKKGIRLRAIKSEIIPMFCGSAFKNKGVQAVLDAMIMYMPSPLDVDAITGISDDKDETVVPRKADDNEPFAALAFKIATDPFVGNLTFFRVYSGVLEAGDFVYNSSKGKKERIGRMVQMHSNERDEIKEVRAGDIAAAIGLKDVTTGDTLCDMKEKIILERMEFPEPVIALAVEPKTKADQEKMGIALGKLAAEDPSFRVSTDEESGQTIIAGMGELHLDIIVDRMVREFDVECNVGAPQVSYREAITTMVEHQHKFVKQSGGRGQYGHVYLRIEPQEPGTGYEFVDEIKGGVIPKEYMPAVNKGVQEQMENGVLAGFPLVDIKVTVYDGSYHDVDSNEIAFKIAASKCLSEGVKMANPQLLEPMMAVEVLTPEDYMGDVMGDINRRRGIVSAMEDMPAGKQVKAEVPLAEMFGYSNDLRSITQGRANYSMEFAKYTAAPKNVADEII 695
>gi|153852625|ref|ZP_01994062.1| hypothetical protein DORLON_00035 [Dorea longicatena DSM 13814] >gi|149754267|gb|EDM64198.1| hypothetical protein DORLON_00035 [Dorea longicatena DSM 13814] (689 aa)
Score = 2100, Expect = 0.0e+00, Identities = 388/672 (57%), Positives = 506/672 (75%)
  Q:    16 MAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWK------------NCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAHIDAGKTT +ERIL+++G  +KIG+TH+G + MDWMEQE+ERGITITSAAT+  W                +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+E VWRQA  Y VPR+ F+NKMD  GA+F  +V  I+ RLG  A+ +QLPIG E+DF GIIDL+E K Y ++  K +      IP+   D  +     +VE++ + DD LM  YLEG+E SI D+K+ +RK    C   PV CGSA++NKG++ LLDA+V+++P+P D+P  +   EDGN+V+  +SD+ PF  LAFK+ TDPFVG+L + RVYSG + SGSYV N  KNKKERV R+++MHA  R E++++ +GDI A IG K T+TG+T+ D++  V LE+M+F +PVI LA+EPKTKA Q K+  +L+KLAEEDPTF+  TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++E F K  +++ KY KQSGGRGQYGH K++FEP   N ++ F+F   +VGG IP+EYI  V  G+E AM SG L G+P++ +KA ++DGS+HEVDSSEMAF IA SLA K+A K  SPVLLEPIM +EVT+PE+Y GD +GDI+SRRG IEG +     ++++  VPL EMFGY+TDLRS +QGRGNY M F  Y   PKSV  +I+++K
  S:     1 MAHIDAGKTTLTERILYYTGVNYKIGDTHEGTATMDWMEQEQERGITITSAATTCHWTLEEFTKPKKGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFCAKGGVEPQSENVWRQADTYNVPRMAFINKMDILGADFYNAVDQIKTRLGKNAICLQLPIGKEDDFKGIIDLMEMKAYIYNDDKGDDITVTDIPEDMADDAELYHTEMVEKICDLDDDLMMQYLEGEEPSIDDMKKALRKATCECTAVPVCCGSAYRNKGVQKLLDAIVEYMPAPTDIPPIEGVDEDGNDVVRHSSDEEPFSALAFKIMTDPFVGKLAYFRVYSGTMNSGSYVLNATKNKKERVGRILQMHANKREELDKVYSGDIAAAIGFKFTSTGDTICDEQHPVILESMEFPEPVIELAIEPKTKASQGKLGESLAKLAEEDPTFRAHTDQETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKEAFTKPVDIDSKYAKQSGGRGQYGHCKVKFEPMDVNGEETFKFESTVVGGAIPKEYIPAVGEGIEEAMQSGILGGFPVVGLKANVYDGSYHEVDSSEMAFHIAGSLAFKDAMKKASPVLLEPIMRVEVTMPEEYMGDVIGDINSRRGRIEGMDDLGGGKIVRGFVPLSEMFGYSTDLRSRTQGRGNYSMFFEKYEPVPKSVQEKILSSK 687
>gi|166031395|ref|ZP_02234224.1| hypothetical protein DORFOR_01084 [Dorea formicigenerans ATCC 27755] >gi|166028800|gb|EDR47557.1| hypothetical protein DORFOR_01084 [Dorea formicigenerans ATCC 27755] (705 aa)
Score = 2100, Expect = 0.0e+00, Identities = 391/685 (57%), Positives = 507/685 (74%)
  Q:     3 RTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSW---KNCS---------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEP---NKDKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           R   L   RN GIMAHIDAGKTT +ERIL+++G  +KIG+TH+G + MDWMEQE+ERGITITSAAT+  W   +NC          +N+IDTPGHVDFTVEVERSLRVLDGA+ V  A+ GVEPQ+E VWRQA  Y VPR+ F+NKMD  GA+F  +V  I+ RLG  A+ +QLPIG E+DF GIIDL+E K Y ++  K        IP+  KD  +     +VE++   DD+LM  YLE +  S+  +K  +RK    C   PV CGSA++NKG++ +LDAV++++P+P D+P  +   EDGN V+  +SD+ PF  LAFK+ TDPFVG+L + RVYSG + SGSYV N  KNKKERV R+++MHA  R E++++ +GDI A IG K TTTG+T+ D++  V LE+M+F +PVI LA+EPKTKA Q K+  +L+KLAEEDPTF+  TD ETGQTIIAGMGELHL+I+VDR+ REFKVE NVGAPQV+++E F K  +V+ KY KQSGGRGQYGH K++FEP   N ++ F+F   +VGG IP+EYI  +  G+E AM SG L G+P++ I A ++DGS+HEVDSSEMAF IA SLA K+A K   PVLLEPIM +EVT+PE+Y GD +GDI+SRRG IEG +     +++   VPL EMFGY+TDLRS +QGRGNY M F  Y + PKSV  ++++ K
  S:     4 RQYPLERTRNIGIMAHIDAGKTTLTERILYYTGVNYKIGDTHEGTATMDWMEQEQERGITITSAATTCHWTLEENCKPKPGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFCAKGGVEPQSENVWRQADTYNVPRMAFINKMDILGADFYNAVDQIRTRLGKNAIVLQLPIGKEDDFKGIIDLMEMKAYIYNDDKGNDITITDIPEDMKDDAELYHTEMVEKICELDDELMMMYLEDEIPSVDQLKAALRKATCECTAVPVTCGSAYRNKGVQKMLDAVIEYMPAPTDIPPIEGVDEDGNNVVRHSSDEEPFSALAFKIMTDPFVGKLAYFRVYSGTMNSGSYVLNATKNKKERVGRILQMHANKREELDKVYSGDIAAAIGFKFTTTGDTICDEQHPVILESMEFPEPVIELAIEPKTKASQGKLGESLAKLAEEDPTFRAHTDQETGQTIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKEAFTKAVDVDSKYAKQSGGRGQYGHCKVKFEPMDVNGEETFKFESTVVGGAIPKEYIPKIGEGIEEAMQSGLLGGFPVVGIHANVYDGSYHEVDSSEMAFHIAGSLAFKDAMKKADPVLLEPIMKVEVTMPEEYMGDVIGDINSRRGRIEGMDDLGGGKIVHGYVPLAEMFGYSTDLRSRTQGRGNYSMFFEKYEQVPKSVQEKVLSNK 703
>gi|119899709|ref|YP_934922.1| elongation factor G [Azoarcus sp. BH72] >gi|166201580|sp|A1KB30.1|EFG_AZOSB Elongation factor G (EF-G) >gi|119672122|emb|CAL96036.1| elongation factor EF-G [Azoarcus sp. BH72] (698 aa)
Score = 2100, Expect = 0.0e+00, Identities = 396/688 (57%), Positives = 507/688 (73%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLN-------LIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKE-EKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD-KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MAR   +  +RN GI AHIDAGKTTT+ERIL+++G  HKIGE HDG + MDWM QE+ERGITITSAAT+  WK   LN       +IDTPGHVDFT+EVERS+RVLDGA  V  A  GV+PQ+ETVWRQA++Y+VPR+ FVNKMD++GANF + V  ++ RL    VPI LPIGAE  F G++DLI+ K   +D   +  K E + IP + +   +  R  +VE  A  ++ LM +YLE  ++S   IK  +R   I C+  P+LCG+AFKNKG++ +LDAV++FLPSPVD+P      ++  EV   A D   F  LAFK+ TDPFVG+LTFVRVYSGVL SG  V N  KNKKER+ R+++MHA  R EI+E+ AGDI A +GLK+ TTGETL D    + LE M F  PVI +AVEPKTK DQEKM IAL +LA EDP+F+  TD E+GQTII+GMGELHL+I+VDRM+REF VE NVGAPQV++RE   K  E EGK++KQSGGRGQYGHV I+ EPN+  KG+EFVD I GG +PREYI  V  GL+  + +G LAG+P++D+K TLFDGS+H+VDS+E AFK+AAS+A K+A +  +P+LLEP+MA+ V  PE Y G+ MGD+S RRG+++G +     ++ IKA+VPL EMFGYAT LRS +QGR  Y M+F HY+E PKSV   +I+ +K
  S:     1 MARKTPIERYRNIGISAHIDAGKTTTTERILYYTGVNHKIGEVHDGAATMDWMAQEQERGITITSAATTCFWKGMDLNFPEHRFNIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQATKYKVPRLAFVNKMDRSGANFYKVVDQMKMRLKANPVPIVLPIGAEEGFKGVVDLIKMKAIIWDEASQGMKFEYQDIPAELQGDAETWREQMVEAAAEANEDLMNEYLENGDLSEEKIKLGLRTRTIACEIQPMLCGTAFKNKGVQRMLDAVIEFLPSPVDIPPVAGVDDNEKEVTRKADDKEKFAALAFKLMTDPFVGQLTFVRVYSGVLNSGETVLNSVKNKKERIGRILQMHANEREEIKEVLAGDIAACVGLKEVTTGETLCDPSAPIILERMVFPDPVIHVAVEPKTKGDQEKMGIALGRLAAEDPSFRVRTDEESGQTIISGMGELHLEIIVDRMKREFNVEANVGAPQVAYREAIRKAVEQEGKFVKQSGGRGQYGHVWIKLEPNETGKGYEFVDAIKGGVVPREYIPAVDKGLQETLPNGVLAGFPVVDVKVTLFDGSYHDVDSNENAFKMAASMAFKDAMRKANPILLEPMMAVVVETPEDYMGNVMGDLSGRRGIVQGMDDLPGGMKEIKAEVPLAEMFGYATQLRSLTQGRATYSMEFKHYSEAPKSVAEAVISNRK 698
>gi|28899545|ref|NP_799150.1| elongation factor G [Vibrio parahaemolyticus RIMD 2210633] >gi|31076639|sp|Q87L45|EFG1_VIBPA Elongation factor G 1 (EF-G 1) >gi|28807781|dbj|BAC61034.1| elongation factor G [Vibrio parahaemolyticus RIMD 2210633] (699 aa)
Score = 2099, Expect = 0.0e+00, Identities = 404/687 (58%), Positives = 517/687 (75%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS-------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQR-DNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATK 687
           MAR   + ++RN GI AH+DAGKTTT+ERILF++G  HKIGE HDG + MDWMEQE+ERGITITSAAT+  W+          +N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA +Y VPR++FVNKMD+ GA+F R V  I+ RLG   VPIQL +GAE DF G+IDLI+ K + + D  +      + IP    D  ++ R H++E  A   ++LM  YLE  E++ A+IK+ +R   +  +     CGSAFKNKG++ +LDAV++FLPSP DVP  K   E  NE+   A D+ PF  LAFK+ATDPFVG LTF+RVYSGV+ SG  V N  K KKER  R+V+MHA  R EI+E+RAGDI A IGLKD TTG+TL D    V LE M+F +PVI +AVEP++KADQEKM IAL KLA EDP+F+  TD ETGQT+I+GMGELHLDI+VDRM+REF V+ NVG PQV++RET   ++EVEGK+++QSGGRGQYGHV ++ EP++  +GF FVD+IVGG IP+EYI  V  G+E  M SG LAGYP++DIKATLFDGS+H+VDSSEMAFKIA S+A K+      PV+LEP+M +EVT PE + GD +GD++ RRG+IEG ++    +++I+A+VPL EMFGYATDLRS +QGR +Y M+F+ YAE PK+  ++IIA +
  S:     1 MARKTPIEHYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVHDGAATMDWMEQEQERGITITSAATTTFWRGMEAQFPEHRVNIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVEPQSETVWRQADKYHVPRMVFVNKMDRAGADFLRVVDQIKNRLGANPVPIQLNVGAEEDFRGVIDLIKMKMINWNDADQGMSFTYEDIPADMIDLAEEWRNHMIESAAEASEELMDKYLEEGELTEAEIKQALRTRTLNNEIVLATCGSAFKNKGVQAVLDAVIEFLPSPSDVPAIKGVDEKDNEIERHADDNEPFSALAFKIATDPFVGTLTFMRVYSGVVNSGDAVYNSVKEKKERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCDQSHKVILERMEFPEPVIQIAVEPRSKADQEKMGIALGKLAAEDPSFRVETDDETGQTLISGMGELHLDIIVDRMKREFSVDCNVGKPQVAYRETIRGKAEVEGKFVRQSGGRGQYGHVWVKLEPSEPGEGFVFVDEIVGGVIPKEYISSVAKGIEEQMNSGVLAGYPVLDIKATLFDGSYHDVDSSEMAFKIAGSMAFKKGALEAQPVILEPMMNVEVTTPEDWMGDVVGDLNRRRGMIEGMDEGVAGLKIIRAQVPLSEMFGYATDLRSATQGRASYSMEFNEYAEVPKNFADKIIAER 697
>gi|170722550|ref|YP_001750238.1| translation elongation factor G [Pseudomonas putida W619] >gi|169760553|gb|ACA73869.1| translation elongation factor G [Pseudomonas putida W619] (703 aa)
Score = 2098, Expect = 0.0e+00, Identities = 390/684 (57%), Positives = 512/684 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEK-VYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEII 684
           MART  +  +RN GI+AH+DAGKTTT+ERILF++G  HK+GE HDG + MDWM QE+ERGITITSAAT+  W+  +         N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+ ++NKMD+ GA+F R V+ I +RLG   VPIQL IG+E +F G IDL++ K +Y+ D        E+ IPD+ K    + RAH+VE  A  +D+L   +L+G+E+SI +IK  +R+  I  +  P + GS+FKNKG+ L+LDAV+D+LP+P ++P  K    D  +  +   A D+ PF  LAFK+ATDPFVG LTF RVYSGVL SG+ V N  K KKER+ R+V+MHA  R EI+++ AGDI A+IG+KD TTG+TL D    + LE M F  PVIS+AVEPKTKADQEKM IAL KLA+EDP+F+  TD ETGQTII+GMGELHLDI+VDRMRREF VE N+G PQV++RE      E+EG++++QSGGRGQYGH  IRF P  +  +G EF+++IVGG +PREYI  +Q G+E  M +G LAGYP+I +KA +FDGS+H+VDS+EMA+KIAAS+A K+  +    VLLEP+M +EV  PE+Y GD MGD+S RRG+I+  ++    +VI+A+VPL EMFGYAT +RS +QGR +Y M+F+ YAE P S+ + I+
  S:     1 MARTTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMAQEQERGITITSAATTAFWQGSTKQFADKYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGVEPQSETVWRQANKYHVPRLAYINKMDRQGADFLRVVKQIDKRLGHHPVPIQLAIGSEENFIGQIDLVKMKAIYWNDADHGTTYREEEIPDELKALADEWRAHMVEAAAEANDELTTKFLDGEELSIDEIKAALRQRTIANEIVPTILGSSFKNKGVPLMLDAVIDYLPAPSEIPAIKGTDPDDEDKHLERHADDNEPFSALAFKIATDPFVGTLTFARVYSGVLSSGNAVLNSVKGKKERIGRMVQMHANQRAEIKDVCAGDIAALIGMKDVTTGDTLCDMDKPIILERMDFPDPVISVAVEPKTKADQEKMGIALGKLAQEDPSFRVRTDEETGQTIISGMGELHLDIIVDRMRREFNVEANIGKPQVAYREKIRNTCEIEGRFVRQSGGRGQYGHCWIRFAPGDEGKEGLEFINEIVGGVVPREYIPAIQKGIEEQMKNGVLAGYPLISLKAAVFDGSYHDVDSNEMAYKIAASMATKQLSQKGGAVLLEPVMKVEVVTPEEYQGDIMGDLSRRRGMIQDGDETPAGKVIRAEVPLGEMFGYATSMRSMTQGRASYTMEFTRYAEAPASIADGIV 697
>gi|72382913|ref|YP_292268.1| elongation factor G [Prochlorococcus marinus str. NATL2A] >gi|90110704|sp|Q46IW3|EFG_PROMT Elongation factor G (EF-G) >gi|72002763|gb|AAZ58565.1| translation elongation factor 2 (EF-2/EF-G) [Prochlorococcus marinus str. NATL2A] (691 aa)
Score = 2098, Expect = 0.0e+00, Identities = 396/685 (57%), Positives = 510/685 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNK-DKGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIA 685
           MAR   L   RN GI AHIDAGKTT +ERILF+SG +HK+GE HDG +V DWM QE+ERGITIT+AA S +W +  +N+IDTPGHVDFT+EVERS+RVLDG IAV  A  GV+PQ+ETVWRQA RY VPR++FVNKMD+TGA+F +    I+ RL   AVPIQLPIGAEND  GIIDL+E K Y +     +  E+  +P    D V   R+ L+E +A  +++L+  +LE  E++I  +K  IR+GV+     P+LCGSAFKNKG++LLLDAVV++LP+PVDVP  +    +G E +  + D APF  LAFKV  DP+ G+LTFVR+YSGVL+ GSYV N  K+ KER+SRL+ + A +R E++E+RAGD+ A++GLK+TTTG+TL   +  + LE +   +PVIS+AVEPKTK+D EK+  AL+ L+EEDPTF+  TD ET QT+IAGMGELHL+ILVDRM REFKVE N+GAPQVS+RET    S  EGK+ +Q+GG+GQYGHV I  EP +   GFEFV+KIVGG +P+EYIKP ++G+     SG +AGYP+ID+K TL DGS+H+VDSSEMAFKIA S+A K+  K C+PVLLEP+M +EV VPE + G  +GD+SSRRG +EG    D    +++KVPL EMFGYAT LRS +QGRG + M+FS Y E P++V   II+
  S:     1 MARAFPLERVRNIGIAAHIDAGKTTCTERILFYSGVVHKMGEVHDGAAVTDWMAQERERGITITAAAISTTWDDHRINIIDTPGHVDFTIEVERSMRVLDGVIAVFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAVPIQLPIGAENDLKGIIDLVENKAYIYKDDLGKDIEQTEVPSDMVDLVSDWRSKLMESIAETEEELLEAFLENGELTIEQLKSGIREGVLKHGVVPMLCGSAFKNKGVQLLLDAVVNYLPAPVDVPPIQGLLPNGKEAVRPSDDGAPFSALAFKVMADPY-GKLTFVRMYSGVLEKGSYVLNSTKDAKERISRLIILKADDREEVDELRAGDLGAVLGLKNTTTGDTLCASEEAIVLETLYIPEPVISVAVEPKTKSDMEKLGKALTSLSEEDPTFRVSTDQETNQTVIAGMGELHLEILVDRMLREFKVEANIGAPQVSYRETIRASSSGEGKFARQTGGKGQYGHVVIEVEPGEPGTGFEFVNKIVGGSVPKEYIKPAESGMRETCESGVIAGYPLIDVKVTLVDGSYHDVDSSEMAFKIAGSMAFKDGIKKCNPVLLEPMMKVEVEVPEDFLGSIIGDLSSRRGQVEGQSIEDGQSKVQSKVPLAEMFGYATQLRSMTQGRGIFSMEFSTYEEVPRNVAEAIIS 685
>gi|77461303|ref|YP_350810.1| elongation factor G [Pseudomonas fluorescens PfO-1] >gi|90110707|sp|Q3K5Y5|EFG_PSEPF Elongation factor G (EF-G) >gi|77385306|gb|ABA76819.1| translation elongation factor 2 (EF-2/EF-G) [Pseudomonas fluorescens PfO-1] (701 aa)
Score = 2097, Expect = 0.0e+00, Identities = 402/688 (58%), Positives = 512/688 (74%)
  Q:     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVMDWMEQEKERGITITSAATSVSWKNCS--------LNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQLPIGAENDFNGIIDLIE-EKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGEDGNEVLIS--ASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKD--KGFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
           MART  +  +RN GI+AH+DAGKTTT+ER+LF++G+ HK+GE HDG +  DWM QE+ERGITITSAA +  WK            N+IDTPGHVDFT+EVERSLRVLDGA+ V     GVEPQ+ETVWRQA++Y VPR+++VNKMD+ GANF R +  I+QRLG   VPIQL IG+E++F G IDLI  + VY+ D  K      K IP    +  ++ R ++VE  A   ++LM  YLEG+E+SIA+IK  +R+  I  +    +CGS+FKNKG+ L+LDAV+DFLP+P D+P  K    D  E  +   ASDD PF  LAFK+ATDPFVG LTFVRVYSGVL SG  V N  K KKERV R+V+MHA  R EI+E+RAGDI A+IG+KD TTGETL +    + L  M F +PVIS+AVEPKTK DQEKM IAL KLA+EDP+F+  TD ETGQTII+GMGELHLDILVDRMRREF VE N+G PQVS+RE   K  E+EGK+++QSGGRGQ+GH  IRF P  +  +G +F++++VGG +P+EYI  +Q G+E  M +G +AGYP+I +KAT+FDGS+H+VDS+EMAFK+AAS+A K+  +     LLEPIMA+EV  PE Y GD MGD++ RRG+I+G E   + +VI+A+VPL EMFGYATD+RS SQGR +Y M+F  Y   P  +V  +  TKK
  S:     1 MARTTPISRYRNIGIVAHVDAGKTTTTERVLFYTGKSHKMGEVHDGAATTDWMVQEQERGITITSAAITAFWKGSEKQYPHEHRFNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRLVYVNKMDRAGANFLRVIGQIKQRLGHTPVPIQLAIGSEDNFQGQIDLINMQAVYWNDSDKGMVPVRKEIPADMLELAEEWRNNMVEAAAEASEELMNKYLEGEELSIAEIKAALRQRTIAGEIVLAVCGSSFKNKGVPLVLDAVIDFLPAPTDIPAIKGSNPDNEEEEMERHASDDEPFAALAFKIATDPFVGTLTFVRVYSGVLNSGDGVINSVKGKKERVGRMVQMHANAREEIKEVRAGDIAALIGMKDVTTGETLCNADKPIILVRMDFPEPVISVAVEPKTKDDQEKMGIALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDILVDRMRREFNVEANIGKPQVSYRERITKNCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLQFLNEVVGGVVPKEYIPAIQKGIEEQMKNGVVAGYPLIGLKATVFDGSYHDVDSNEMAFKVAASMATKQLAQKGGGELLEPIMAVEVVTPEDYMGDVMGDLNRRRGMIQGMEDTVSGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFKKYDTAPSHIVESV--TKK 699
>gi|124026655|ref|YP_001015770.1| elongation factor G [Prochlorococcus marinus str. NATL1A] >gi|166220159|sp|A2C4U6.1|EFG_PROM1 Elongation factor G (EF-G) >