>gi|13507967|ref|NP_109916.1| 30S ribosomal protein S6 [Mycoplasma pneumoniae M129] >gi|2500412|sp|P75543|RS6_MYCPN 30S ribosomal protein S6 >gi|1674305|gb|AAB96251.1| ribosomal protein S6 [Mycoplasma pneumoniae M129] (215 aa)
Score = 1128, Expect = 8.4e-122, Identities = 215/215 (100%), Positives = 215/215 (100%)
  Q:     1 MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKMGNFDSVQANPYRPRFKRFNAEHVNQRQNQQNNNNNRFDRNRNRQHNRFKDKQ 215
           MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKMGNFDSVQANPYRPRFKRFNAEHVNQRQNQQNNNNNRFDRNRNRQHNRFKDKQ
  S:     1 MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKMGNFDSVQANPYRPRFKRFNAEHVNQRQNQQNNNNNRFDRNRNRQHNRFKDKQ 215
>gi|12044942|ref|NP_072752.1| 30S ribosomal protein S6 [Mycoplasma genitalium G37] >gi|1351004|sp|P47336|RS6_MYCGE 30S ribosomal protein S6 >gi|3844677|gb|AAC71308.1| ribosomal protein S6 [Mycoplasma genitalium G37] >gi|166078987|gb|ABY79605.1| ribosomal protein S6 [synthetic Mycoplasma genitalium JCVI-1.0] (208 aa)
Score = 707, Expect = 6.2e-73, Identities = 135/200 (67%), Positives = 159/200 (79%)
  Q:     1 MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKMGNFDSVQANPYRPRFKRFNAEHVNQRQNQQNNNNNRF 200
           M YNIILLVDG+LSLEQANQV +K Q+ L      ++EYLGLKELAYPIKKQLSAHYYRW F G++  TK+FKR ANINKQ++RELIIN E++YGYL S+NPKKQQL+LQK  KY+EIIA ENNP+NPD PVTSGLAS +PRLSR EK ++ + E W VV + GNFD+VQ NPYRPR KRF     NQ+ +Q NNN  RF
  S:     1 MHYNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKSEYLGLKELAYPIKKQLSAHYYRWSFHGESNCTKEFKRAANINKQIIRELIINREKDYGYLGSVNPKKQQLSLQKLTKYNEIIASENNPDNPDAPVTSGLASVKPRLSRVEKQKERELEKWTVVHQSGNFDTVQINPYRPRIKRFLQN--NQQTSQANNNQPRF 198
>gi|66880321|ref|ZP_00405303.1| COG0360: Ribosomal protein S6 [Mycoplasma genitalium G-37] (157 aa)
Score = 591, Expect = 1.4e-59, Identities = 110/157 (70%), Positives = 130/157 (82%)
  Q:     1 MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELW 157
           M YNIILLVDG+LSLEQANQV +K Q+ L      ++EYLGLKELAYPIKKQLSAHYYRW F G++  TK+FKR ANINKQ++RELIIN E++YGYL S+NPKKQQL+LQK  KY+EIIA ENNP+NPD PVTSGLAS +PRLSR EK ++ + E W
  S:     1 MHYNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKSEYLGLKELAYPIKKQLSAHYYRWSFHGESNCTKEFKRAANINKQIIRELIINREKDYGYLGSVNPKKQQLSLQKLTKYNEIIASENNPDNPDAPVTSGLASVKPRLSRVEKQKERELEKW 157
>gi|31544819|ref|NP_853397.1| 30S ribosomal protein S6 [Mycoplasma gallisepticum R] >gi|61215679|sp|Q7NAM1|RS6_MYCGA 30S ribosomal protein S6 >gi|31541665|gb|AAP56965.1| RpsF [Mycoplasma gallisepticum R] (191 aa)
Score = 258, Expect = 7.1e-21, Identities = 65/163 (39%), Positives = 96/163 (58%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKMG 164
           +Y I+L+V G L+  QA  VN++ +      E +  EYLG K L YPIKK+++AHY+    + D +S  ++KR A+I   VLR LI+N E+E+GY AS N KK  LA QK+A+Y++I+ +    EN    +         R SR EKA    +E+W + +K G
  S:     3 KYEIMLMVSGQLNQNQAQAVNDELKAVFGKTE-ITEEYLGQKTLEYPIKKEVTAHYFNLFLTSDGKSVHEYKRLASIRTDVLRILILNTEKEFGYRASQNAKKVALAKQKQARYNDIMKQVQ--ENGYFQIKGS-----KRNSRVEKA--GAKEVWMLREKFG 155
>gi|4220414|gb|AAD12413.1| Homology to ribosomal protein S6 X04022 [Mycoplasma genitalium] (75 aa)
Score = 222, Expect = 9.8e-17, Identities = 43/58 (74%), Positives = 48/58 (82%)
  Q:     1 MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYY 58
           M YNIILLVDG+LSLEQANQV +K Q+ L      ++EYLGLKELAYPIKKQLSAHYY
  S:    18 MHYNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKSEYLGLKELAYPIKKQLSAHYY 75
>gi|26553568|ref|NP_757502.1| 30S ribosomal protein S6 [Mycoplasma penetrans HF-2] >gi|32171557|sp|Q8EWT7|RS6_MYCPE 30S ribosomal protein S6 >gi|26453574|dbj|BAC43906.1| ribosomal protein S6 [Mycoplasma penetrans HF-2] (145 aa)
Score = 218, Expect = 3.2e-16, Identities = 46/103 (44%), Positives = 66/103 (64%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKF-SGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKK 104
           +Y I+L+VDGS+   +A  V    +  L     L+ E +GLK+LAYPI K+   +YY + F + D  S ++F+R   + K+VLR LIINLE++YGY A  NPKK
  S:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKK 106
>gi|13358118|ref|NP_078392.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971291|ref|ZP_02553568.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168281887|ref|ZP_02689554.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308036|ref|ZP_02690711.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762224|ref|YP_001752638.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189045593|sp|B1AJJ4.1|RS6_UREP2 30S ribosomal protein S6 >gi|13959537|sp|Q9PPT6|RS6_UREPA 30S ribosomal protein S6 >gi|11357046|pir||C82875 ribosomal protein S6 UU554 [imported] - Ureaplasma urealyticum >gi|6899560|gb|AAF30967.1|AE002154_3 ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827801|gb|ACA33063.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902615|gb|EDT48904.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675944|gb|EDT87849.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701168|gb|EDU19450.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 6 str. ATCC 27818] (160 aa)
Score = 216, Expect = 5.2e-16, Identities = 52/121 (42%), Positives = 77/121 (63%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKF-SGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARE 122
           +Y I+L+V G L  EQAN+V  + + TL N E  +  Y G+++LAY I K  +A+ Y + F + D     +F+R A INK VLR +IINLE++YGY A++N KK    +Q+  K  E+ AR+
  S:     3 KYEIMLVVRGDLDQEQANKVANELKATLKNTEVKENNYDGVQQLAYEINKLKTAYRYVYNFETTDVSLINEFRRLAIINKNVLRHIIINLEKDYGYKATVNTKK----VQRNEKRAEVYARQ 120
>gi|167940729|ref|ZP_02527804.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 8] >gi|167958956|ref|ZP_02546028.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973252|ref|ZP_02555529.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974088|ref|ZP_02556365.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975516|ref|ZP_02557793.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988274|ref|ZP_02569945.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337926|ref|ZP_02694541.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 10] >gi|168362595|ref|ZP_02695774.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808138|ref|ZP_02829197.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 2] >gi|195867987|ref|ZP_03079983.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903342|gb|EDT49631.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208983|gb|EDU06026.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019152|gb|EDU57192.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998246|gb|EDU67343.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659855|gb|EDX53235.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660321|gb|EDX53582.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (160 aa)
Score = 213, Expect = 1.1e-15, Identities = 48/105 (45%), Positives = 69/105 (65%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKF-SGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQ 106
           +Y I+L+V G L  EQAN+V  + + TL N E  +  Y G+++LAY I K  +A+ Y + F + D     +F+R A INK VLR +IINLE++YGY A++N KK Q
  S:     3 KYEIMLVVRGDLDQEQANKVANELKATLKNTEVKENNYEGVQQLAYEINKLKTAYRYVYNFETTDVSLINEFRRLAIINKNVLRHIIINLEKDYGYKATVNAKKVQ 108
>gi|126654886|ref|ZP_01726420.1| 30S ribosomal protein S6 [Cyanothece sp. CCY0110] >gi|126623621|gb|EAZ94325.1| 30S ribosomal protein S6 [Cyanothece sp. CCY0110] (126 aa)
Score = 133, Expect = 1.9e-06, Identities = 33/90 (36%), Positives = 49/90 (54%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           QY +I ++   LS EQ NQ   K Q+ LT  N   LQT+  G + LAYPI+K++   Y ++ +  D       +R   + + VLR L I L+
  S:     4 QYEMIFILRPDLSEEQVNQAVTKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYVQFNYQADGSQIAPLERMMRLGEDVLRYLTIKLD 95
>gi|172037638|ref|YP_001804139.1| 30s ribosomal protein S6 [Cyanothece sp. ATCC 51142] >gi|171699092|gb|ACB52073.1| 30s ribosomal protein S6 [Cyanothece sp. ATCC 51142] (119 aa)
Score = 129, Expect = 5.4e-06, Identities = 31/90 (34%), Positives = 48/90 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y +I ++   LS EQ NQ   K Q+ LT  N   LQT+  G + LAYPI+K++   Y ++ +  D       +R   + + V+R L I L+
  S:     4 HYEMIFILRPDLSEEQVNQAVAKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYVQFNYQADGSQVAPLERMMRLGEDVMRYLTIKLD 95
>gi|148377542|ref|YP_001256418.1| 30S ribosomal protein S6 [Mycoplasma agalactiae PG2] >gi|148291588|emb|CAL58974.1| 30S ribosomal protein S6 [Mycoplasma agalactiae PG2] (145 aa)
Score = 129, Expect = 6.2e-06, Identities = 32/107 (29%), Positives = 57/107 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEK--QQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLA 108
           +Y I+L++D ++ +  AN++ E    ++ +  V  L+        LAYPI K   A Y  +     ++   +F R ANI K + R+++INL+ E G+  S    K ++A
  S:     3 KYEIMLIIDPAIDMAMANEIVESVFDKKNINKVVKLENS-----TLAYPINKSSKAQYVVYTLEAKSELIAEFTRRANIAKFIWRQMVINLDTEKGFQRSKKAFKHRIA 106
>gi|50364895|ref|YP_053320.1| 30S ribosomal protein S6 [Mesoplasma florum L1] >gi|81391993|sp|Q6F237|RS6_MESFL 30S ribosomal protein S6 >gi|50363451|gb|AAT75436.1| 30S ribosomal protein S6 [Mesoplasma florum L1] (290 aa)
Score = 129, Expect = 6.6e-06, Identities = 28/68 (41%), Positives = 37/68 (54%)
  Q:    40 LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQL 107
           LGL E AY I  +   HY+        ++ K+F+R ANI K V+R LIIN E E GY  S+   K  +
  S:    41 LGLIEFAYKINHKKKGHYFVVIVEATAEAIKEFERIANIEKNVVRTLIINTENEQGYEQSVQLSKTDM 108
>gi|193216924|ref|YP_002000166.1| ribosomal protein S6 [Mycoplasma arthritidis 158L3-1] >gi|193002247|gb|ACF07462.1| ribosomal protein S6 [Mycoplasma arthritidis 158L3-1] (160 aa)
Score = 124, Expect = 2.2e-05, Identities = 34/93 (36%), Positives = 49/93 (52%)
  Q:     3 YNIILLVDGSLSLEQANQV-NEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           Y I++L +   +LEQ +++     +++ T +E L+       ELAYPI K   A YY      D Q   +  R  NI K +LR LIINL+ E G
  S:     4 YEIMILANPDSTLEQVSELLFSVLKKSDTKIEKLERS-----ELAYPIHKLTRATYYLVTVKSDPQLMAELTRKLNIAKFILRSLIINLDSEKG 92
>gi|160916103|ref|ZP_02078310.1| hypothetical protein EUBDOL_02130 [Eubacterium dolichum DSM 3991] >gi|158431827|gb|EDP10116.1| hypothetical protein EUBDOL_02130 [Eubacterium dolichum DSM 3991] (97 aa)
Score = 120, Expect = 5.8e-05, Identities = 28/92 (30%), Positives = 49/92 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           +Y I+ +V+ SL    + +V +   + +T+ EG     +  G+KE AY IK     HY     + +N+   +F+R A IN  V+R +++  E E
  S:     3 KYEIMYIVNASLDEAASQKVMDSLHKIITDHEGTIDNVDDWGVKEFAYEIKHMNKGHYVVINVTANNEGIHEFERLARINPNVVRYMVVKTEAE 96
>gi|148265698|ref|YP_001232404.1| 30S ribosomal protein S6 [Geobacter uraniireducens Rf4] >gi|189045470|sp|A5G7R3.1|RS6_GEOUR 30S ribosomal protein S6 >gi|146399198|gb|ABQ27831.1| SSU ribosomal protein S6P [Geobacter uraniireducens Rf4] (128 aa)
Score = 118, Expect = 1.1e-04, Identities = 30/102 (29%), Positives = 52/102 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPK 103
            Y  I +V   L  E+   ++ K Q  + +++G   + E  G ++LAYPI K     YY  +F GD+    + +R   ++ +V+R   + LE+E    A+I  K
  S:     3 MYETIFIVQPDLGEEEMKGISTKVQDVIASMKGDFKRLEDWGPRKLAYPINKFARGRYYYLRFDGDSALIAELERRLRLDDKVIRYQSVKLEKEVALAAAIPTK 106
>gi|158520027|ref|YP_001527897.1| ribosomal protein S6 [Desulfococcus oleovorans Hxd3] >gi|158508853|gb|ABW65820.1| ribosomal protein S6 [Desulfococcus oleovorans Hxd3] (168 aa)
Score = 118, Expect = 1.2e-04, Identities = 27/89 (30%), Positives = 45/89 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY--LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           +Y  I + D  LS E   Q+ EK    +    G+  E+   G + LAY I+K+   HY R  F GD  + +  +    I+++VL+ + + L
  S:     3 RYETIFIADPDLSPENQAQLFEKATTLIDANSGVLVEFDEWGTRRLAYEIRKKPRGHYVRLDFCGDGATVQGLENAFRIDERVLKFMTVFL 93
>gi|110003928|emb|CAK98268.1| putative 30s ribosomal protein s6 [Spiroplasma citri] (149 aa)
Score = 114, Expect = 3.0e-04, Identities = 23/59 (38%), Positives = 37/59 (62%)
  Q:    41 GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLAS 99
           G+K+L YPIKK+   +Y     +  + +  +F R ++I + VLR L+IN E+E GY+ S
  S:    42 GIKDLVYPIKKKTKGYYGVLIVNTTSVNIDEFVRISHIEQDVLRILVINTEKEKGYIQS 100
>gi|190571063|ref|YP_001975421.1| 30s ribosomal protein s6 [Wolbachia pipientis] >gi|190357335|emb|CAQ54765.1| 30s ribosomal protein s6 [Wolbachia pipientis] (257 aa)
Score = 113, Expect = 4.5e-04, Identities = 25/75 (33%), Positives = 41/75 (54%)
  Q:    12 SLSLEQANQVNEKQQQTLTNVEG---LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLREL 86
           S  +  +NQ+N+  +  L N+E    ++ EY GL + AYPI K  S HY     S  +    +F+R   +N+ ++R L
  S:   156 SFKIVDSNQLNKTLEVLLKNIEASGLIKYEYWGLLDFAYPINKMKSGHYCMMCISFTSSIMDEFERRVKLNENIIRHL 233
>gi|196243625|ref|ZP_03142354.1| ribosomal protein S6 [Cyanothece sp. PCC 8802] >gi|196208542|gb|EDY03332.1| ribosomal protein S6 [Cyanothece sp. PCC 8802] (124 aa)
Score = 111, Expect = 6.6e-04, Identities = 28/89 (31%), Positives = 49/89 (55%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y +I ++  SLS EQ NQ   K +  L   NV+ LQ +  G + LAYPIK+ +   Y +  + G+       +R   ++++V+R + + +E
  S:     5 YEMIYILRPSLSEEQVNQEVNKYRDFLNDYNVKDLQVKIWGKRRLAYPIKRFIDGIYVQMNYQGEGNQVAPLERAMRLSEEVIRYMTLKVE 95
>gi|177664942|ref|ZP_02940743.1| ribosomal protein S6 [Cyanothece sp. PCC 8801] >gi|172076053|gb|EDT61466.1| ribosomal protein S6 [Cyanothece sp. PCC 8801] (124 aa)
Score = 111, Expect = 6.9e-04, Identities = 28/89 (31%), Positives = 49/89 (55%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y +I ++  SLS EQ NQ   K +  L   NV+ LQ +  G + LAYPIK+ +   Y +  + G+       +R   ++++V+R + + +E
  S:     5 YEMIYILRPSLSEEQVNQEVNKYRDFLNEYNVKDLQVKIWGKRRLAYPIKRFIDGIYVQMNYQGEGNQVAPLERAMRLSEEVIRYMTLKVE 95
>gi|116750609|ref|YP_847296.1| ribosomal protein S6 [Syntrophobacter fumaroxidans MPOB] >gi|166227396|sp|A0LN59.1|RS6_SYNFM 30S ribosomal protein S6 >gi|116699673|gb|ABK18861.1| SSU ribosomal protein S6P [Syntrophobacter fumaroxidans MPOB] (147 aa)
Score = 110, Expect = 8.6e-04, Identities = 25/93 (26%), Positives = 50/93 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL--GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREY 94
           +Y    ++D  L  E    V+EK +  +    G    Y+  G K+LAYP+KK+    Y   +++GD++   + +R   ++++VL+ + + L+  Y
  S:     3 KYETFFIIDPDLPDEVTAAVDEKIKSVVGANGGDVVSYVPWGKKKLAYPVKKRSRGLYVLMEYAGDSRLVAELERNMRLDERVLKFITVKLDDRY 97
>gi|58584757|ref|YP_198330.1| ribosomal protein S6 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75497804|sp|Q5GSD6|RS6_WOLTR 30S ribosomal protein S6 >gi|58419073|gb|AAW71088.1| Ribosomal protein S6 [Wolbachia endosymbiont strain TRS of Brugia malayi] (260 aa)
Score = 109, Expect = 1.1e-03, Identities = 24/82 (29%), Positives = 44/82 (53%)
  Q:    13 LSLEQANQVNEKQQQTLTNVEG---LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREY 94
             + + NQ N+  +  L N+E    ++ EY GL + AYPI K  S HY     S  +    +F R   +N+ ++R L +++++ +
  S:   160 FGMAEPNQSNKTLEMLLDNIEASGLIKYEYWGLLDFAYPINKMKSGHYCIMCISSTSNIMDEFVRRIKLNENIIRHLSVHVDKFF 244
>gi|67921027|ref|ZP_00514546.1| Ribosomal protein S6 [Crocosphaera watsonii WH 8501] >gi|67857144|gb|EAM52384.1| Ribosomal protein S6 [Crocosphaera watsonii WH 8501] (111 aa)
Score = 108, Expect = 1.6e-03, Identities = 26/89 (29%), Positives = 47/89 (52%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y +I ++   LS +Q NQ     ++ LT  N   L+ +  G + LAYPI+K++   Y ++ +  D       +R   + ++V+R L I L+
  S:     5 YEMIFILRPDLSEDQVNQALNSYKEFLTTNNATNLEVKIWGKRRLAYPIQKKVDGIYVQFNYEADGTQIAPLERMMRLGEEVMRYLTIRLD 95
>gi|114800162|ref|YP_760858.1| ribosomal protein S6 [Hyphomonas neptunium ATCC 15444] >gi|123323137|sp|Q0C085.1|RS6_HYPNA 30S ribosomal protein S6 >gi|114740336|gb|ABI78461.1| ribosomal protein S6 [Hyphomonas neptunium ATCC 15444] (112 aa)
Score = 106, Expect = 2.5e-03, Identities = 21/56 (37%), Positives = 31/56 (55%)
  Q:    36 QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           +TEY GL+ LAYPIKKQ   HY      G   +  + +R   I + V+R + + +E
  S:    39 KTEYWGLRSLAYPIKKQRKGHYSLINIDGPADAIHELERRQRIAEDVMRYMTVRVE 94
>gi|167730536|emb|CAO81448.1| 30S ribosomal protein S6 [Candidatus Cloacamonas acidaminovorans] (95 aa)
Score = 106, Expect = 2.7e-03, Identities = 26/86 (30%), Positives = 48/86 (55%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           Y +++++  +LS ++AN +N+     +T   G  ++ +  G + LAYPIKK    +Y+   F  D+   K  K   NIN+ ++R L +
  S:     5 YELMVILVPTLSADEANAINDSLMALVTENGGEIIKIDPWGKRMLAYPIKKFREGYYFVDYFRVDSLVIKKLKALFNINENIIRYLFV 92
>gi|42521680|ref|NP_967060.1| 30S ribosomal protein S6 [Bdellovibrio bacteriovorus HD100] >gi|61215582|sp|Q6MRP3|RS6_BDEBA 30S ribosomal protein S6 >gi|39574210|emb|CAE77714.1| 30S ribosomal protein S6 [Bdellovibrio bacteriovorus HD100] (152 aa)
Score = 106, Expect = 2.7e-03, Identities = 27/82 (32%), Positives = 44/82 (53%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLR 84
           Y +++L+    SLE+   + +K + T+ + +G     E  G + LA PI K   A Y+   F  D Q+  + +RT  IN +VLR
  S:    10 YEVVVLMHPDASLEEQKDLFKKNKATIESYKGSINSLETWGKRTLATPIGKLKKAIYFHSTFEADTQAIAELERTMRINDKVLR 93
>gi|83311202|ref|YP_421466.1| ribosomal protein S6 [Magnetospirillum magneticum AMB-1] >gi|123542046|sp|Q2W5G8.1|RS6_MAGMM 30S ribosomal protein S6 >gi|82946043|dbj|BAE50907.1| Ribosomal protein S6 [Magnetospirillum magneticum AMB-1] (144 aa)
Score = 106, Expect = 2.8e-03, Identities = 26/89 (29%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQT--EYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + +    +S  Q   + E+    +T   G  +  EY GL+ +AY +KK    HY        + + K+ +R  +IN+ VLR L I +E
  S:     4 YECVFIARQDISTPQVETLTEELSNIITQGGGSVSKKEYWGLRNIAYRVKKNRKGHYVLLNIDAPSAAVKEMERQMSINEDVLRTLTIRVE 94
>gi|124009488|ref|ZP_01694164.1| ribosomal protein S6 [Microscilla marina ATCC 23134] >gi|123984937|gb|EAY24900.1| ribosomal protein S6 [Microscilla marina ATCC 23134] (124 aa)
Score = 106, Expect = 2.9e-03, Identities = 27/90 (30%), Positives = 48/90 (53%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTN--VEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           Y  + ++   LS EQ     EK Q+ L +   E +  ++ G+K+LAYPIKK+ S  Y   +F   +   K  +     +++V+R + I L++
  S:     6 YETVFILTPVLSDEQIKDTVEKFQKILADNGAEIVHVDHWGMKKLAYPIKKKTSGVYTVVEFKAPSTIVKALETEYRRDERVMRHICIVLDK 97
>gi|160892969|ref|ZP_02073757.1| hypothetical protein CLOL250_00506 [Clostridium sp. L2-50] >gi|156865052|gb|EDO58483.1| hypothetical protein CLOL250_00506 [Clostridium sp. L2-50] (96 aa)
Score = 105, Expect = 3.4e-03, Identities = 30/92 (32%), Positives = 48/92 (52%)
  Q:     2 QYNIILLVDGSL-------SLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           +Y + L+V+  +       ++E+     EK   T+TNVE       GLK+LAY I+K   A+YY  +F  +       +    I + VLR L + L+ E
  S:     3 KYELTLVVNAKIDEDARTAAVEKVKAYIEKANATITNVEDC-----GLKKLAYEIQKMGEAYYYFIQFDAEADVPAQLEANVRIMEPVLRYLCVRLDAE 96
>gi|152990908|ref|YP_001356630.1| 30S ribosomal protein S6 [Nitratiruptor sp. SB155-2] >gi|166227355|sp|A6Q464.1|RS6_NITSB 30S ribosomal protein S6 >gi|151422769|dbj|BAF70273.1| 30S ribosomal protein S6 [Nitratiruptor sp. SB155-2] (128 aa)
Score = 105, Expect = 3.5e-03, Identities = 27/90 (30%), Positives = 49/90 (54%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y  + ++  +L+ E++    E  ++ + N  G  + TE LG+++LAYPI+K    HYY   F+  + +  + +R   I + V+R L I  E
  S:     3 HYETLFVLKPTLTDEESKAKFEFIKEVIQNNGGEIVATEDLGVRKLAYPIQKFERGHYYIIYFTAPSHTVLELERIYRITEDVIRFLTIKYE 94
>gi|186898668|ref|ZP_02971632.1| ribosomal protein S6 [Cyanothece sp. PCC 7424] >gi|186693945|gb|EDU18557.1| ribosomal protein S6 [Cyanothece sp. PCC 7424] (176 aa)
Score = 105, Expect = 4.0e-03, Identities = 27/91 (29%), Positives = 47/91 (51%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           Y ++ ++   L  EQ  Q   + +  LT  E   +Q +Y G + LAYPIKK     Y +  + GD +     +R   ++ +V+R L I L+++
  S:     5 YEMVYILRPDLLEEQVQQEINRYRDFLTENEAQEVQIKYWGKRRLAYPIKKLQDGFYVQMNYQGDGKQIAPLERMMRLSDEVIRYLTIKLDKD 97
>gi|196196188|gb|EDX91147.1| ribosomal protein S6 [Alcanivorax sp. DG881] (113 aa)
Score = 104, Expect = 4.2e-03, Identities = 27/87 (31%), Positives = 44/87 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ LV    S EQ + + E+    +T+ +G   + E  G ++LAYPI K   AHY       D ++  + + T   N  V+R L+I
  S:     3 HYEVVFLVHPDQS-EQVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHYVMLNIECDGETLGELENTFRFNDAVIRHLVI 90
>gi|110835052|ref|YP_693911.1| 30S ribosomal protein S6 [Alcanivorax borkumensis SK2] >gi|123345339|sp|Q0VMF9.1|RS6_ALCBS 30S ribosomal protein S6 >gi|110648163|emb|CAL17639.1| 30S ribosomal protein S6 [Alcanivorax borkumensis SK2] (113 aa)
Score = 104, Expect = 4.3e-03, Identities = 27/87 (31%), Positives = 44/87 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ LV    S EQ + + E+    +T+ +G   + E  G ++LAYPI K   AHY       D ++  + + T   N  V+R L+I
  S:     3 HYEVVFLVHPDQS-EQVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHYVMLNIECDGETLGELENTFRFNDAVIRHLVI 90
>gi|171853616|emb|CAM11487.1| 30S ribosomal protein S6 [Candidatus Phytoplasma australiense] (93 aa)
Score = 104, Expect = 4.5e-03, Identities = 24/87 (27%), Positives = 48/87 (55%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           +Y I+ ++  +L   +  ++N+  +   +      L+ + +GLK+LAYPI      +YY +    DN++  +F R   I ++V+R +II
  S:     3 KYEIMYILRPNLDNNEVKKINDHLESVFSKKPSTILEKKEIGLKDLAYPINNHKKGYYYWFITQTDNEAVLEFNRIVKITEEVIRFIII 91
>gi|149279560|ref|ZP_01885689.1| 30S ribosomal protein S6 [Pedobacter sp. BAL39] >gi|149229596|gb|EDM34986.1| 30S ribosomal protein S6 [Pedobacter sp. BAL39] (120 aa)
Score = 104, Expect = 4.7e-03, Identities = 33/116 (28%), Positives = 62/116 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTN--VEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDE 117
           QY  ++++   LS E A +   K  + +T+   E +Q +  GL++LAYPI+K+ S  ++  ++    +     +     +++VLR L I L+R   +  + N KK+  A  K+ K +E
  S:     3 QYETVIVLTPLLSEEVAKEAIAKFSKIITDSGAEIVQEDNWGLRKLAYPIEKKASGFFHLTEYKSSGELITKLELALKRDERVLRFLTIRLDR---HAVAYNEKKRSGAFNKKPKKEE 117
>gi|78224040|ref|YP_385787.1| 30S ribosomal protein S6 [Geobacter metallireducens GS-15] >gi|91207916|sp|Q39RR2|RS6_GEOMG 30S ribosomal protein S6 >gi|78195295|gb|ABB33062.1| SSU ribosomal protein S6P [Geobacter metallireducens GS-15] (118 aa)
Score = 104, Expect = 5.1e-03, Identities = 25/92 (27%), Positives = 48/92 (52%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           +Y  +++V   L  ++   +N K    +  ++G   + E  G+++LAYPI K     YY  +F GD     + +R   ++ +VLR   + +E+E
  S:     4 KYETVVIVQPDLGDDELKGLNAKVTDIIATMKGDLHRLEDWGVRKLAYPINKSARGRYYYVRFDGDAALIAELERRLRLDDKVLRYQSVKIEKE 97
>gi|39995771|ref|NP_951722.1| 30S ribosomal protein S6 [Geobacter sulfurreducens PCA] >gi|61215651|sp|Q74FE4|RS6_GEOSL 30S ribosomal protein S6 >gi|39982535|gb|AAR33995.1| ribosomal protein S6 [Geobacter sulfurreducens PCA] (117 aa)
Score = 103, Expect = 5.6e-03, Identities = 23/83 (27%), Positives = 44/83 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLR 84
            Y  I++V   L  ++   +  K    + + +G+  + E  G+++LAYP+KK +   YY  +F GD     + +R   ++ +VLR
  S:     4 MYETIVIVQPELGDDELKGLTAKVTDIIGSFKGVLHRLEDWGVRKLAYPVKKSVRGRYYYVRFDGDAPLIAELERRLRLDDKVLR 88
>gi|30248222|ref|NP_840292.1| 30S ribosomal protein S6 [Nitrosomonas europaea ATCC 19718] >gi|61215748|sp|Q82XQ6|RS6_NITEU 30S ribosomal protein S6 >gi|30180107|emb|CAD84109.1| Ribosomal protein S6 [Nitrosomonas europaea ATCC 19718] (146 aa)
Score = 103, Expect = 5.7e-03, Identities = 29/105 (27%), Positives = 50/105 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQ 106
            Y I+ +V    S EQ + + E+    +T   G   + E  G ++L YPI+K   AHY       D +S  + + +   N  +LR L+I +    G + + +P  Q+
  S:     3 HYEIVFIVHPDQS-EQVSAMTERYSNIVTGRSGKIHRLEDWGRRQLTYPIQKLHKAHYVLMNIECDQESLNELEHSFKFNDAILRHLVIRMN---GPITTPSPMMQE 105
>gi|189425663|ref|YP_001952840.1| ribosomal protein S6 [Geobacter lovleyi SZ] >gi|189421922|gb|ACD96320.1| ribosomal protein S6 [Geobacter lovleyi SZ] (122 aa)
Score = 103, Expect = 6.5e-03, Identities = 25/92 (27%), Positives = 49/92 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           +Y  I ++   L+ +    V +K Q  + +++G   + +  G ++LAY I+K     YY  +F G  Q   + +R   ++++VLR L +N+  E
  S:     3 KYETIFILQPDLAEDDVKSVTDKVQDVVASLKGDFHRLDDWGTRKLAYAIRKFPRGRYYYLRFDGGAQLVAELERRLRLDEKVLRFLSVNITDE 96
>gi|149194316|ref|ZP_01871413.1| 30S ribosomal protein S6 [Caminibacter mediatlanticus TB-2] >gi|149135491|gb|EDM23970.1| 30S ribosomal protein S6 [Caminibacter mediatlanticus TB-2] (111 aa)
Score = 102, Expect = 7.6e-03, Identities = 22/90 (24%), Positives = 51/90 (56%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y  +++V  +L+ E+   + +  ++ +++ +G  +  + +G++ELAYPI+K    HYY   +    ++  + +R    N++VLR + +  E
  S:     5 HYETMVIVKPTLTDEEKEAIIDNIKKVISDFKGEVVAVDNIGVRELAYPIEKFERGHYYIIYYKAPAEAVIELERQLRYNEEVLRFMTVKYE 96
>gi|167754092|ref|ZP_02426219.1| hypothetical protein ALIPUT_02380 [Alistipes putredinis DSM 17216] >gi|167658717|gb|EDS02847.1| hypothetical protein ALIPUT_02380 [Alistipes putredinis DSM 17216] (114 aa)
Score = 102, Expect = 7.7e-03, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDN 66
           Y  + +V   LS  Q  +V +K Q  +T   G  + +E  GLK+LAYPI+K+ +  Y+  +F+G+ 
  S:     4 YETVFIVTPVLSDAQVKEVADKFQGVITENGGQIVNSEAWGLKKLAYPIQKKTTGFYFLIEFTGEG 69
>gi|47459062|ref|YP_015924.1| 30S ribosomal protein S6 [Mycoplasma mobile 163K] >gi|47458391|gb|AAT27713.1| 30S ribosomal protein s6 [Mycoplasma mobile 163K] (154 aa)
Score = 102, Expect = 8.8e-03, Identities = 28/97 (28%), Positives = 47/97 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLA 98
           +Y I+++ D     E+ + + +   Q    +E    E L   ELAY +    +AHY+            +F R ANI+K + R ++INL+ E  YL+
  S:     4 KYEILIMTDPK---EEKSVIEKFTNQIFKKIEKF--EQLERTELAYKVNHSSTAHYFLVNVEAKGPEITEFNRRANISKTIWRTMVINLDTE-KYLS 94
>gi|145618654|ref|ZP_01774711.1| ribosomal protein S6 [Geobacter bemidjiensis Bem] >gi|144945032|gb|EDJ80100.1| ribosomal protein S6 [Geobacter bemidjiensis Bem] >gi|197088497|gb|ACH39768.1| ribosomal protein S6 [Geobacter bemidjiensis Bem] (134 aa)
Score = 101, Expect = 1.1e-02, Identities = 26/92 (28%), Positives = 46/92 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
            Y  I +V   L  E+   ++ K Q  + ++ G   + E  G ++LAYPI K     Y+  +F GD+    + +R   ++ +V+R   + LE E
  S:     4 MYETIYIVQPDLGDEEIKALSTKVQDVIASMNGDFKRVEDWGTRKLAYPINKNPRGRYFYLRFDGDSGLIAELERRLRLDDKVIRYQSVKLETE 97
>gi|169832353|ref|YP_001718335.1| ribosomal protein S6 [Candidatus Desulforudis audaxviator MP104C] >gi|169639197|gb|ACA60703.1| ribosomal protein S6 [Candidatus Desulforudis audaxviator MP104C] (94 aa)
Score = 100, Expect = 1.2e-02, Identities = 26/87 (29%), Positives = 45/87 (51%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY--LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           QY ++ ++   L  E++ Q+ EK  + +T+ +G  TE    G + LAY IK     HY   K   ++ + ++  R   I   +LR +II
  S:     3 QYEVMYILKPDLEDEESTQLIEKFSKIITDRDGEITELNRWGKRRLAYEIKDYREGHYVVMKCRAEHAAAQELDRVFRITDGLLRHMII 91
>gi|88800241|ref|ZP_01115808.1| 30S ribosomal protein S6 [Reinekea sp. MED297] >gi|88776956|gb|EAR08164.1| 30S ribosomal protein S6 [Reinekea sp. MED297] (139 aa)
Score = 100, Expect = 1.3e-02, Identities = 28/87 (32%), Positives = 43/87 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+LLV    S EQ   + E+    +T+  G   + E  G ++LA+PI+    AHY        +++  D K T   N  +LR LI+
  S:     3 HYEIVLLVHPDQS-EQVPAMVERYTTVVTDAGGTVHRNEDWGRRQLAFPIQDLHKAHYILLNVEVSDETIDDLKTTFRFNDAILRSLIM 90
>gi|71894543|ref|YP_278651.1| 30S ribosomal protein S6 [Mycoplasma synoviae 53] (163 aa)
Score = 100, Expect = 1.4e-02, Identities = 30/94 (31%), Positives = 51/94 (54%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           +Y I++LV    S   A+ V E   +++ + +  + E L   ELAY I K   A Y+      + ++  +F R +NINK++ R L++NL+ E G
  S:     4 KYEIMVLVGPKTS---ASTV-ESFLKSVFHDDFKKAEKLERTELAYEINKTKHAQYFLVNLETERKNIAEFIRLSNINKEIWRHLVVNLDTEKG 93
>gi|72080634|ref|YP_287692.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae 7448] >gi|91207920|sp|Q4A870|RS6_MYCH7 30S ribosomal protein S6 >gi|71913758|gb|AAZ53669.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae 7448] (241 aa)
Score = 100, Expect = 1.5e-02, Identities = 21/56 (37%), Positives = 32/56 (57%)
  Q:    40 LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           L    LAYPI+K   A Y+  + +      ++F R ANI +++ R LI+NL+ E G
  S:    38 LETTNLAYPIRKSKIAQYFLVELNAPTNLIEEFVRRANITREIWRYLIVNLDSEKG 93
>gi|167646474|ref|YP_001684137.1| ribosomal protein S6 [Caulobacter sp. K31] >gi|189045459|sp|B0SWL1.1|RS6_CAUSK 30S ribosomal protein S6 >gi|167348904|gb|ABZ71639.1| ribosomal protein S6 [Caulobacter sp. K31] (126 aa)
Score = 99, Expect = 1.5e-02, Identities = 28/89 (31%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    +S +QA  +NE+ +  L    G   + EY GL+ L Y IKK    HY          + K+ +R   IN+ VLR + I +E
  S:     4 YEHVVIARQDISPQQAEALNEQLKALLEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPAAAVKEMERQLLINEDVLRFMTIRVE 94
>gi|95930452|ref|ZP_01313188.1| ribosomal protein S6 [Desulfuromonas acetoxidans DSM 684] >gi|95133492|gb|EAT15155.1| ribosomal protein S6 [Desulfuromonas acetoxidans DSM 684] (121 aa)
Score = 99, Expect = 1.7e-02, Identities = 26/82 (31%), Positives = 44/82 (53%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLR 84
           Y  +L+V+  +  ++   V EK +  LT  N E L+ +  G K LAYP+KK     Y    F+ +N   K+F+R   ++  V++
  S:     4 YETVLIVNPQIVGDEYTAVIEKFKGVLTDQNAEILKVDEWGTKRLAYPVKKCEQGTYVLINFNAENVVIKEFERRMRLDDAVIK 87
>gi|148887425|sp|Q4A5N1|RS6_MYCS5 30S ribosomal protein S6 >gi|144575157|gb|AAZ43940.2| 30S ribosomal protein S6 [Mycoplasma synoviae 53] (156 aa)
Score = 99, Expect = 1.8e-02, Identities = 22/60 (36%), Positives = 34/60 (56%)
  Q:    36 QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           + E L   ELAY I K   A Y+      + ++  +F R +NINK++ R L++NL+ E G
  S:    27 KAEKLERTELAYEINKTKHAQYFLVNLETERKNIAEFIRLSNINKEIWRHLVVNLDTEKG 86
>gi|54020446|ref|YP_115819.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae 232] >gi|81378667|sp|Q600Z6|RS6_MYCH2 30S ribosomal protein S6 >gi|53987619|gb|AAV27820.1| 30s ribosomal protein S6 [Mycoplasma hyopneumoniae 232] (241 aa)
Score = 98, Expect = 2.1e-02, Identities = 21/56 (37%), Positives = 31/56 (55%)
  Q:    40 LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           L    LAYPI+K   A Y+    +      ++F R ANI +++ R LI+NL+ E G
  S:    38 LETTNLAYPIRKSKIAQYFLVDLNAPTNLIEEFVRRANITREIWRYLIVNLDSEKG 93
>gi|83589001|ref|YP_429010.1| 30S ribosomal protein S6 [Moorella thermoacetica ATCC 39073] >gi|91207918|sp|Q2RM72|RS6_MOOTA 30S ribosomal protein S6 >gi|83571915|gb|ABC18467.1| SSU ribosomal protein S6P [Moorella thermoacetica ATCC 39073] (98 aa)
Score = 98, Expect = 2.1e-02, Identities = 27/91 (29%), Positives = 43/91 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY--LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           Y ++ ++   L  E    V EK  Q +T+  G  T     G K +AY ++K    +Y   +F G     ++ +R   I+  V+R LI  LE E
  S:     4 YEVVFVIRPDLEAEATTAVVEKFTQLITDQGGQVTRVDQWGKKRMAYEVRKYREGYYVLVEFKGTPAVAQELERVLKISDDVIRYLITRLEEE 96
>gi|153810613|ref|ZP_01963281.1| hypothetical protein RUMOBE_00994 [Ruminococcus obeum ATCC 29174] >gi|149833792|gb|EDM88873.1| hypothetical protein RUMOBE_00994 [Ruminococcus obeum ATCC 29174] (95 aa)
Score = 98, Expect = 2.2e-02, Identities = 27/87 (31%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           +Y + L+V   +  E  + V EK +  +    G   + E  G K+LAY I+K     YY  +F  D Q   + +R   I   VLR L++
  S:     3 KYELALVVSAKVEDEVRDAVVEKAKSYIARYNGNVTEVEEWGKKKLAYEIQKMHEGFYYFIQFEADAQCPAEVERHVRIMDNVLRYLVV 91
>gi|46579369|ref|YP_010177.1| 30S ribosomal protein S6 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603073|ref|YP_967473.1| 30S ribosomal protein S6 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166226826|sp|A1VF30.1|RS6_DESVV 30S ribosomal protein S6 >gi|61215612|sp|Q72DH3|RS6_DESVH 30S ribosomal protein S6 >gi|46448783|gb|AAS95436.1| ribosomal protein S6 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563302|gb|ABM29046.1| SSU ribosomal protein S6P [Desulfovibrio vulgaris subsp. vulgaris DP4] (101 aa)
Score = 98, Expect = 2.4e-02, Identities = 20/78 (25%), Positives = 42/78 (53%)
  Q:    13 LSLEQANQVNEKQQQTLTNV------EGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           LS E A    E    TL+ V        +  ++ G+++LAYP++KQ+  +Y R +++    +  + +R   I+  + + + + L
  S:    10 LSPELAADAREALLTTLSGVVEREQGSMITADHWGMRDLAYPVRKQMRGYYVRLEYTAPGATVAELERIIRISDGIFKFVTVKL 93
>gi|144899045|emb|CAM75909.1| 30S ribosomal protein S6 [Magnetospirillum gryphiswaldense MSR-1] (144 aa)
Score = 98, Expect = 2.5e-02, Identities = 23/89 (25%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  ++L    +S  Q   + ++    L    G   + E+ GL+ +AY +KK   AHY        + + K+ +R  ++N+ VLR L + ++
  S:     4 YECVILARQEVSAPQVETLIDEMAGVLAQGGGTVAKKEFWGLRNIAYRVKKNRKAHYVLLNLDSPSAAVKEMERQMSLNEDVLRVLTVRVD 94
>gi|86130270|ref|ZP_01048870.1| 30S ribosomal protein S6 [Cellulophaga sp. MED134] >gi|85818945|gb|EAQ40104.1| 30S ribosomal protein S6 [Dokdonia donghaensis MED134] (113 aa)
Score = 98, Expect = 2.6e-02, Identities = 24/91 (26%), Positives = 51/91 (56%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y  + +++  LS +Q  +  +K +  L     + +  E  GLK+LAYPI+ + S  Y+  +F+ D Q+  D++     +++V+R L + +++
  S:     3 HYETVFILNPVLSDDQIKETVKKYEGLLKEKGAKMISKEDWGLKKLAYPIQNKKSGFYHLLEFTVDGQAINDYELAFRRDERVMRYLTVAMDK 95
>gi|191163072|ref|ZP_03024949.1| ribosomal protein S6 [Geobacter sp. M21] >gi|190995855|gb|EDV71306.1| ribosomal protein S6 [Geobacter sp. M21] (134 aa)
Score = 97, Expect = 2.6e-02, Identities = 26/92 (28%), Positives = 45/92 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
            Y  I +V   L  E+   ++ K Q  +  + G   + E  G ++LAYPI K     Y+  +F GD+    + +R   ++ +V+R   + LE E
  S:     4 MYETIYIVQPDLGDEEIKALSTKVQDVVAGMNGDFKRLEDWGTRKLAYPINKNPRGRYFYLRFDGDSGLIAELERRLRLDDKVIRYQSVKLETE 97
>gi|148260512|ref|YP_001234639.1| ribosomal protein S6 [Acidiphilium cryptum JF-5] >gi|166226792|sp|A5FYN8.1|RS6_ACICJ 30S ribosomal protein S6 >gi|146402193|gb|ABQ30720.1| SSU ribosomal protein S6P [Acidiphilium cryptum JF-5] (158 aa)
Score = 97, Expect = 2.8e-02, Identities = 22/89 (24%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +L+    ++ +Q + + +     + +  G   + EY GL+ LAY IKK    HY       +  +  + +R   +N+ VLR + + +E
  S:     4 YECVLIARSEITQQQVDTIADAVTAQVESESGAVKKREYWGLRNLAYRIKKNRKGHYVLLGLDAEPATISEMERQLGLNEDVLRFMTVRVE 94
>gi|114332339|ref|YP_748561.1| 30S ribosomal protein S6 [Nitrosomonas eutropha C91] >gi|122313013|sp|Q0ADI6.1|RS6_NITEC 30S ribosomal protein S6 >gi|114309353|gb|ABI60596.1| SSU ribosomal protein S6P [Nitrosomonas eutropha C91] (144 aa)
Score = 97, Expect = 2.8e-02, Identities = 27/89 (30%), Positives = 43/89 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y II +V    S EQ + + E+    +T   G   + E  G ++L YPI+K   AHY       D +S  + + +   N  +LR L+I +
  S:     3 HYEIIFIVHPDQS-EQVSAMIERYSNMITERSGGIHRLEDWGRRQLTYPIQKLHKAHYILMNIECDQESLNELEHSFKFNDAILRHLVIRM 92
>gi|16125915|ref|NP_420479.1| ribosomal protein S6 [Caulobacter crescentus CB15] >gi|24212335|sp|Q9A7Q1|RS6_CAUCR 30S ribosomal protein S6 >gi|13423077|gb|AAK23647.1| ribosomal protein S6 [Caulobacter crescentus CB15] (126 aa)
Score = 97, Expect = 3.2e-02, Identities = 27/89 (30%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    +S +QA  +NE+ +  +    G   + EY GL+ L Y IKK    HY          + K+ +R   IN+ VLR + I +E
  S:     4 YEHVVIARQDISPQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPAPAVKEMERQLLINEDVLRFMTIRVE 94
>gi|94501372|ref|ZP_01307892.1| ribosomal protein S6 [Oceanobacter sp. RED65] >gi|94426485|gb|EAT11473.1| ribosomal protein S6 [Oceanobacter sp. RED65] (137 aa)
Score = 97, Expect = 3.2e-02, Identities = 27/89 (30%), Positives = 41/89 (46%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ LV    S EQ   + E+   ++    G   + E  G + LAYPI+K   AHY       DN +  +   T   N  V+R ++I +
  S:     3 HYEIVFLVHPDQS-EQVPSMIERYTGSIKEAGGQIHRLEDWGRRHLAYPIQKIHKAHYVLMNIECDNDTLAELNNTFRFNDAVIRSMVIRM 92
>gi|169184426|ref|ZP_02844723.1| ribosomal protein S6 [Thauera sp. MZ1T] >gi|169008611|gb|EDS55417.1| ribosomal protein S6 [Thauera sp. MZ1T] (128 aa)
Score = 97, Expect = 3.3e-02, Identities = 26/91 (28%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ +  +T   G   + E  G +++AYPI+K   AHY       D ++  + + +   N  VLR L I +++
  S:     3 HYEIVFIVHPDQS-EQVPAMVERYKSIVTTRNGQIHRLEDWGRRQMAYPIQKVHKAHYVLMNIECDGETLAELEHSFKFNDAVLRHLTIKMKK 94
>gi|110598898|ref|ZP_01387147.1| ribosomal protein S6 [Chlorobium ferrooxidans DSM 13031] >gi|110339489|gb|EAT58015.1| ribosomal protein S6 [Chlorobium ferrooxidans DSM 13031] (133 aa)
Score = 96, Expect = 3.7e-02, Identities = 26/88 (29%), Positives = 43/88 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL--GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           Y   +++DG L  E      E  Q+ +T   G  +  L  G ++ AYPIKK+   +Y   +F+G      + ++     + +LR LII L
  S:     7 YECTVIIDGGLQDEAITAAMELVQRVITEKGGSISGVLEIGRRKTAYPIKKRTIGYYAHIEFTGAPGVIAEIEKVLRYEEDLLRYLIIQL 96
>gi|78186004|ref|YP_374047.1| 30S ribosomal protein S6 [Pelodictyon luteolum DSM 273] >gi|91207927|sp|Q3B6M7|RS6_PELLD 30S ribosomal protein S6 >gi|78165906|gb|ABB23004.1| SSU ribosomal protein S6P [Pelodictyon luteolum DSM 273] (133 aa)
Score = 96, Expect = 3.7e-02, Identities = 25/88 (28%), Positives = 42/88 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL--GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           Y   +++DG L  E      E  Q+ +T   G  +  L  G ++ AYPIKK+    Y   +F+       + +R     + +LR LI++L
  S:     7 YECTVIIDGGLQDEAIAAAMEMVQKVITEKGGSISSVLDIGRRKTAYPIKKKTIGSYAHIEFTAATPVIAEIERVLRYEEVLLRYLIVHL 96
>gi|146329026|ref|YP_001210005.1| ribosomal protein S6 [Dichelobacter nodosus VCS1703A] >gi|166226827|sp|A5EXN1.1|RS6_DICNV 30S ribosomal protein S6 >gi|146232496|gb|ABQ13474.1| ribosomal protein S6 [Dichelobacter nodosus VCS1703A] (108 aa)
Score = 96, Expect = 3.9e-02, Identities = 27/87 (31%), Positives = 43/87 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ LV    S EQ + + E+ +  +   +G   + E  G + LAYPI+K + AHY       D Q+  + +     N  +LR +II
  S:     3 HYEIVFLVHPDQS-EQVSAMVERYRAQIEAAQGKVHRLEDWGRRVLAYPIQKLVKAHYILMNIECDRQTLAELESNFRFNDAILRHMII 90
>gi|149203936|ref|ZP_01880904.1| ribosomal protein S6 [Roseovarius sp. TM1035] >gi|149142378|gb|EDM30423.1| ribosomal protein S6 [Roseovarius sp. TM1035] (141 aa)
Score = 96, Expect = 4.0e-02, Identities = 31/129 (24%), Positives = 58/129 (44%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVP 131
           Y  +++    LS  QA  + E     LT   G  ++ EY G+K +AY I K    HY   K    + + ++ +R   ++  V+R L + ++         + +   + +QKR +  +   R + P+  D P
  S:     4 YEHVMIARQDLSSAQAEGLIEHFGAVLTENGGTLVEHEYWGVKTMAYKINKNRKGHYAFLKSDAPSSAVQEMERLMRLHDDVMRVLTVKVD--------AHEEGPSVQMQKRDERGDRPDRGDRPDRGDRP 126
>gi|167836329|ref|ZP_02463212.1| 30S ribosomal protein S6 [Burkholderia thailandensis MSMB43] (124 aa)
Score = 96, Expect = 4.1e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQATLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|182679259|ref|YP_001833405.1| ribosomal protein S6 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182635142|gb|ACB95916.1| ribosomal protein S6 [Beijerinckia indica subsp. indica ATCC 9039] (151 aa)
Score = 96, Expect = 4.1e-02, Identities = 25/89 (28%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + L    +S +Q   + E+ +  + + +G   + EY G+K LAY IKK   AH+          +  + +R   IN+ VLR + + +E
  S:     4 YEHVYLARQDISAQQVEALTEQLKSVIESFQGKVTKVEYWGVKSLAYRIKKNRKAHFSLLNIEAPAAALTEMERQMGINEDVLRFMTLRVE 94
>gi|167562479|ref|ZP_02355395.1| 30S ribosomal protein S6 [Burkholderia oklahomensis EO147] >gi|167569663|ref|ZP_02362537.1| 30S ribosomal protein S6 [Burkholderia oklahomensis C6786] (124 aa)
Score = 96, Expect = 4.3e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|53719094|ref|YP_108080.1| 30S ribosomal protein S6 [Burkholderia pseudomallei K96243] >gi|53723581|ref|YP_103060.1| 30S ribosomal protein S6 [Burkholderia mallei ATCC 23344] >gi|67640204|ref|ZP_00439019.1| COG0360: Ribosomal protein S6 [Burkholderia mallei GB8 horse 4] >gi|76810465|ref|YP_333811.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1710b] >gi|83721320|ref|YP_442700.1| 30S ribosomal protein S6 [Burkholderia thailandensis E264] >gi|121600145|ref|YP_993214.1| 30S ribosomal protein S6 [Burkholderia mallei SAVP1] >gi|124386277|ref|YP_001026011.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10229] >gi|126440551|ref|YP_001059287.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 668] >gi|126450631|ref|YP_001080722.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10247] >gi|126453081|ref|YP_001066555.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106a] >gi|134277876|ref|ZP_01764591.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 305] >gi|161355145|ref|ZP_02101025.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106b] >gi|161370253|ref|ZP_02109820.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1710a] >gi|167002904|ref|ZP_02268694.1| 30S ribosomal protein S6 [Burkholderia mallei PRL-20] >gi|167581639|ref|ZP_02374513.1| 30S ribosomal protein S6 [Burkholderia thailandensis TXDOH] >gi|167619759|ref|ZP_02388390.1| 30S ribosomal protein S6 [Burkholderia thailandensis Bt4] >gi|167719190|ref|ZP_02402426.1| 30S ribosomal protein S6 [Burkholderia pseudomallei DM98] >gi|167738192|ref|ZP_02410966.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 14] >gi|167815381|ref|ZP_02447061.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 91] >gi|167823789|ref|ZP_02455260.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 9] >gi|167845332|ref|ZP_02470840.1| 30S ribosomal protein S6 [Burkholderia pseudomallei B7210] >gi|167893874|ref|ZP_02481276.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 7894] >gi|167902328|ref|ZP_02489533.1| 30S ribosomal protein S6 [Burkholderia pseudomallei NCTC 13177] >gi|167910566|ref|ZP_02497657.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 112] >gi|167918592|ref|ZP_02505683.1| 30S ribosomal protein S6 [Burkholderia pseudomallei BCC215] >gi|194314250|ref|YP_002009548.1| 30S ribosomal protein S6 [Burkholderia mallei ATCC 10399] >gi|194506009|ref|YP_002035579.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1655] >gi|194510644|ref|YP_002023174.1| 30S ribosomal protein S6 [Burkholderia pseudomallei Pasteur 52237] >gi|194515116|ref|YP_002050747.1| 30S ribosomal protein S6 [Burkholderia pseudomallei S13] >gi|194525592|ref|YP_002061122.1| 30S ribosomal protein S6 [Burkholderia mallei FMH] >gi|194529772|ref|YP_002065293.1| 30S ribosomal protein S6 [Burkholderia mallei JHU] >gi|194570889|ref|YP_002105889.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 406e] >gi|194575121|ref|YP_002110005.1| 30S ribosomal protein S6 [Burkholderia mallei 2002721280] >gi|123536854|sp|Q2SWJ9.1|RS6_BURTA 30S ribosomal protein S6 >gi|166226807|sp|A3MKD6.1|RS6_BURM7 30S ribosomal protein S6 >gi|166226808|sp|A2S242.1|RS6_BURM9 30S ribosomal protein S6 >gi|166226809|sp|A1V4R1.1|RS6_BURMS 30S ribosomal protein S6 >gi|166226810|sp|A3NW34.1|RS6_BURP0 30S ribosomal protein S6 >gi|166226811|sp|A3NAB6.1|RS6_BURP6 30S ribosomal protein S6 >gi|61215454|sp|Q62JQ9|RS6_BURMA 30S ribosomal protein S6 >gi|61215467|sp|Q63UY6|RS6_BURPS 30S ribosomal protein S6 >gi|91207904|sp|Q3JRJ2|RS6_BURP1 30S ribosomal protein S6 >gi|52209508|emb|CAH35460.1| putative 30S ribosomal protein S6 [Burkholderia pseudomallei K96243] >gi|52427004|gb|AAU47597.1| ribosomal protein S6 [Burkholderia mallei ATCC 23344] >gi|76579918|gb|ABA49393.1| ribosomal protein S6 [Burkholderia pseudomallei 1710b] >gi|83655145|gb|ABC39208.1| ribosomal protein S6 [Burkholderia thailandensis E264] >gi|121228955|gb|ABM51473.1| 30S ribosomal protein S6 [Burkholderia mallei SAVP1] >gi|124294297|gb|ABN03566.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10229] >gi|126220044|gb|ABN83550.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 668] >gi|126226723|gb|ABN90263.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106a] >gi|126243501|gb|ABO06594.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10247] >gi|134251526|gb|EBA51605.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 305] >gi|147749602|gb|EDK56676.1| 30S ribosomal protein S6 [Burkholderia mallei FMH] >gi|147753782|gb|EDK60847.1| 30S ribosomal protein S6 [Burkholderia mallei JHU] >gi|148027373|gb|EDK85394.1| 30S ribosomal protein S6 [Burkholderia mallei 2002721280] >gi|157807511|gb|EDO84681.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 406e] >gi|157936797|gb|EDO92467.1| 30S ribosomal protein S6 [Burkholderia pseudomallei Pasteur 52237] >gi|160699626|gb|EDP89596.1| 30S ribosomal protein S6 [Burkholderia mallei ATCC 10399] >gi|169654724|gb|EDS87417.1| 30S ribosomal protein S6 [Burkholderia pseudomallei S13] >gi|184210030|gb|EDU07073.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1655] (124 aa)
Score = 95, Expect = 4.5e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|194246578|ref|YP_002004217.1| 30S ribosomal protein S6 [Candidatus Phytoplasma mali] >gi|193806935|emb|CAP18367.1| 30S ribosomal protein S6 [Candidatus Phytoplasma mali] (94 aa)
Score = 95, Expect = 4.6e-02, Identities = 18/54 (33%), Positives = 31/54 (57%)
  Q:    35 LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           +Q++ LGLK+LAY I K    +Y     +   Q  ++F R   IN+ ++R ++I
  S:    38 IQSKELGLKDLAYCIDKHYKGYYVSMFLNAMPQMIEEFNRVVKINEDIIRSIVI 91
>gi|148284319|ref|YP_001248409.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Boryong] >gi|166227358|sp|A5CCY7.1|RS6_ORITB 30S ribosomal protein S6 >gi|146739758|emb|CAM79616.1| 30S ribosomal protein S6 [Orientia tsutsugamushi Boryong] (118 aa)
Score = 95, Expect = 4.6e-02, Identities = 23/82 (28%), Positives = 44/82 (53%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLR 84
           Y ++L+V   LS  + +++ ++    ++N EG  ++ EY G++ LAY I +   AHY     S +N   +  K     N +++R
  S:     4 YELVLIVRPELSSTEIDKLTDELTSIISNYEGKLVKHEYWGMRSLAYKINRNQRAHYIMLAISANNNILQKLKNKIKNNLEIIR 87
>gi|78066643|ref|YP_369412.1| 30S ribosomal protein S6 [Burkholderia sp. 383] >gi|161524573|ref|YP_001579585.1| 30S ribosomal protein S6 [Burkholderia multivorans ATCC 17616] >gi|167586986|ref|ZP_02379374.1| ribosomal protein S6 [Burkholderia ubonensis Bu] >gi|189350671|ref|YP_001946299.1| small subunit ribosomal protein S6 [Burkholderia multivorans ATCC 17616] >gi|91207905|sp|Q39FJ8|RS6_BURS3 30S ribosomal protein S6 >gi|77967388|gb|ABB08768.1| SSU ribosomal protein S6P [Burkholderia sp. 383] >gi|160342002|gb|ABX15088.1| ribosomal protein S6 [Burkholderia multivorans ATCC 17616] >gi|189334693|dbj|BAG43763.1| small subunit ribosomal protein S6 [Burkholderia multivorans ATCC 17616] (124 aa)
Score = 95, Expect = 5.1e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|170733233|ref|YP_001765180.1| ribosomal protein S6 [Burkholderia cenocepacia MC0-3] >gi|169816475|gb|ACA91058.1| ribosomal protein S6 [Burkholderia cenocepacia MC0-3] (124 aa)
Score = 95, Expect = 5.1e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|189183703|ref|YP_001937488.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Ikeda] >gi|189180474|dbj|BAG40254.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Ikeda] (118 aa)
Score = 95, Expect = 5.2e-02, Identities = 23/82 (28%), Positives = 44/82 (53%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLR 84
           Y ++L+V   LS  + +++ ++    ++N EG  ++ EY G++ LAY I +   AHY     S +N   +  K     N +++R
  S:     4 YELVLIVRPELSSTEIDKLTDELTSIISNYEGKLVKHEYWGMRSLAYKINRNQRAHYIMLAISANNNILQKLKNKIKNNLEIIR 87
>gi|91783363|ref|YP_558569.1| 30S ribosomal protein S6 [Burkholderia xenovorans LB400] >gi|170692292|ref|ZP_02883455.1| ribosomal protein S6 [Burkholderia graminis C4D1M] >gi|187923776|ref|YP_001895418.1| ribosomal protein S6 [Burkholderia phytofirmans PsJN] >gi|122970480|sp|Q13ZH2.1|RS6_BURXL 30S ribosomal protein S6 >gi|91687317|gb|ABE30517.1| SSU ribosomal protein S6P [Burkholderia xenovorans LB400] >gi|170142722|gb|EDT10887.1| ribosomal protein S6 [Burkholderia graminis C4D1M] >gi|187714970|gb|ACD16194.1| ribosomal protein S6 [Burkholderia phytofirmans PsJN] (124 aa)
Score = 95, Expect = 5.6e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKSTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|118579196|ref|YP_900446.1| 30S ribosomal protein S6 [Pelobacter propionicus DSM 2379] >gi|166227361|sp|A1AM18.1|RS6_PELPD 30S ribosomal protein S6 >gi|118501906|gb|ABK98388.1| SSU ribosomal protein S6P [Pelobacter propionicus DSM 2379] (129 aa)
Score = 95, Expect = 5.6e-02, Identities = 24/89 (26%), Positives = 47/89 (52%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           +Y  I ++   LS +    V +K Q  +T+ +G   + E  G+++LAYPI K     Y   ++ G  +   + +R   ++++VLR   +N+
  S:     3 KYETIYILQPDLSEDDIKVVADKVQDVITSYKGDFQRLEDWGIRKLAYPINKCARGRYLYLRYDGGREMIAELERRLRLDEKVLRFQSVNI 93
>gi|7388214|sp|O68126|RS6_RHOCA 30S ribosomal protein S6 >gi|3128364|gb|AAC16216.1| potential 30S ribosomal protein S6 [Rhodobacter capsulatus] (144 aa)
Score = 95, Expect = 5.7e-02, Identities = 26/89 (29%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +L+    LS  QA  + E     + +  G  L TEY G+K +AY I K    HY   +    + + ++ +R A ++  V+R L I ++
  S:     4 YEHVLIARQDLSNAQAEGLIEHFSTVIGDNGGKVLGTEYWGVKTMAYKINKNRKGHYGFLRTDAPSAAVQEMERLARLHDDVMRVLTIKVD 94
>gi|15612232|ref|NP_223885.1| 30S ribosomal protein S6 [Helicobacter pylori J99] >gi|7388226|sp|Q9ZJY1|RS6_HELPJ 30S ribosomal protein S6 >gi|4155764|gb|AAD06741.1| 30S RIBOSOMAL PROTEIN S6 [Helicobacter pylori J99] (142 aa)
Score = 95, Expect = 5.8e-02, Identities = 26/90 (28%), Positives = 45/90 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG-LQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y  + ++  +L  E+     E  ++ +T   G ++T   +G++ LAY IKK    +YY   F  D     + +R   IN+ VLR ++I  E
  S:     3 HYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKADPSMILELERLYRINEDVLRFIVIKYE 94
>gi|194563187|ref|YP_002098210.1| Ribosomal protein S6 [Burkholderia dolosa AUO158] >gi|124894811|gb|EAY68691.1| Ribosomal protein S6 [Burkholderia dolosa AUO158] (133 aa)
Score = 94, Expect = 5.9e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:    12 HYEIVFIVHPDQS-EQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 103
>gi|115351862|ref|YP_773701.1| 30S ribosomal protein S6 [Burkholderia ambifaria AMMD] >gi|134295904|ref|YP_001119639.1| 30S ribosomal protein S6 [Burkholderia vietnamiensis G4] >gi|170703444|ref|ZP_02894215.1| ribosomal protein S6 [Burkholderia ambifaria IOP40-10] >gi|171321590|ref|ZP_02910521.1| ribosomal protein S6 [Burkholderia ambifaria MEX-5] >gi|172060832|ref|YP_001808484.1| ribosomal protein S6 [Burkholderia ambifaria MC40-6] >gi|122323036|sp|Q0BEQ6.1|RS6_BURCM 30S ribosomal protein S6 >gi|166226812|sp|A4JEV1.1|RS6_BURVG 30S ribosomal protein S6 >gi|115281850|gb|ABI87367.1| SSU ribosomal protein S6P [Burkholderia ambifaria AMMD] >gi|134139061|gb|ABO54804.1| SSU ribosomal protein S6P [Burkholderia vietnamiensis G4] >gi|170131642|gb|EDT00199.1| ribosomal protein S6 [Burkholderia ambifaria IOP40-10] >gi|171093123|gb|EDT38340.1| ribosomal protein S6 [Burkholderia ambifaria MEX-5] >gi|171993349|gb|ACB64268.1| ribosomal protein S6 [Burkholderia ambifaria MC40-6] (124 aa)
Score = 94, Expect = 5.9e-02, Identities = 27/91 (29%), Positives = 44/91 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T   G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|163815609|ref|ZP_02206982.1| hypothetical protein COPEUT_01784 [Coprococcus eutactus ATCC 27759] >gi|158449246|gb|EDP26241.1| hypothetical protein COPEUT_01784 [Coprococcus eutactus ATCC 27759] (96 aa)
Score = 94, Expect = 6.0e-02, Identities = 27/92 (29%), Positives = 43/92 (46%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY--LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           +Y + L+V   +  E    V +K +  +       T+    GLK+LAY I+K   A+YY  +F  D       +    I + VLR L + L+ E
  S:     3 KYELTLVVSAKIDEEARTAVVDKVKSYIEKANATITDVNECGLKKLAYEIQKMGEAYYYFIQFDADADVPAQLEANIRIMESVLRYLCVRLDAE 96
>gi|186475676|ref|YP_001857146.1| ribosomal protein S6 [Burkholderia phymatum STM815] >gi|184192135|gb|ACC70100.1| ribosomal protein S6 [Burkholderia phymatum STM815] (124 aa)
Score = 94, Expect = 6.1e-02, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKTTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNIECDQATLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|89054113|ref|YP_509564.1| 30S ribosomal protein S6 [Jannaschia sp. CCS1] >gi|122498966|sp|Q28RX3.1|RS6_JANSC 30S ribosomal protein S6 >gi|88863662|gb|ABD54539.1| SSU ribosomal protein S6P [Jannaschia sp. CCS1] (117 aa)
Score = 94, Expect = 6.1e-02, Identities = 25/89 (28%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    LS  QA  +NE     L +  G  + TEY G+K +AY I K    HY   +    + + ++ +R   ++  V+R L I ++
  S:     4 YEHVMIARQDLSNAQAEALNEHFGAVLADNGGTVVDTEYWGVKTMAYKINKNRKGHYSYLRTDAPSDAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|71891874|ref|YP_277603.1| 30S ribosomal subunit protein S6 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|91207902|sp|Q493V5|RS6_BLOPB 30S ribosomal protein S6 >gi|71795980|gb|AAZ40731.1| 30S ribosomal subunit protein S6 [Candidatus Blochmannia pennsylvanicus str. BPEN] (117 aa)
Score = 94, Expect = 6.7e-02, Identities = 24/86 (27%), Positives = 43/86 (50%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           Y I+ +V   LS EQ + +  +    +TN +G   + E  G ++LAYP+ K   A+Y          + K+     + NK ++R +I+
  S:     4 YEIVFMVHPDLS-EQISSIINRYTTIVTNAQGKVHRIENWGRRQLAYPVNKLCKAYYVLLNIEVSQDTVKELNDDFHFNKNIIRSMIV 90
>gi|196478429|gb|ACG77957.1| ribosomal protein S6 [Phenylobacterium zucineum HLK1] (222 aa)
Score = 94, Expect = 6.9e-02, Identities = 24/89 (26%), Positives = 45/89 (50%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    +S +QA  +N++ +  +    G   + EY GL+ L Y IKK    HY          + K+ +R  +IN+ VLR + + ++
  S:   106 YEHVVISRQDISPQQAEALNDQLKALIEQGGGSVAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPADAVKEMERQLSINEDVLRYMTVRVD 196
>gi|145600834|ref|YP_001164910.1| 30S ribosomal protein S6 [Yersinia pestis Pestoides F] >gi|166227404|sp|A4TRM5.1|RS6_YERPP 30S ribosomal protein S6 >gi|145212530|gb|ABP41937.1| SSU ribosomal protein S6P [Yersinia pestis Pestoides F] (130 aa)
Score = 94, Expect = 6.9e-02, Identities = 25/89 (28%), Positives = 42/89 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+TN  G   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPISKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRV 92
>gi|160881892|ref|YP_001560860.1| ribosomal protein S6 [Clostridium phytofermentans ISDg] >gi|160430558|gb|ABX44121.1| ribosomal protein S6 [Clostridium phytofermentans ISDg] (95 aa)
Score = 94, Expect = 7.1e-02, Identities = 26/87 (29%), Positives = 44/87 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           +Y + L+V+  +  E  N   E  ++ +T   G     +  G K LAY I+K    +YY  KF GD+ +  + ++   I + V+R L I
  S:     3 KYELALVVNAKIEDEAKNATVEAVKELITRFGGNITNVDDWGKKRLAYEIQKMKEGYYYFIKFDGDSTTPSEVEQRIRIMENVIRFLCI 91
>gi|107028947|ref|YP_626042.1| 30S ribosomal protein S6 [Burkholderia cenocepacia AU 1054] >gi|116689895|ref|YP_835518.1| 30S ribosomal protein S6 [Burkholderia cenocepacia HI2424] >gi|123179949|sp|Q1BH36.1|RS6_BURCA 30S ribosomal protein S6 >gi|166226806|sp|A0K7Z8.1|RS6_BURCH 30S ribosomal protein S6 >gi|105898111|gb|ABF81069.1| SSU ribosomal protein S6P [Burkholderia cenocepacia AU 1054] >gi|116647984|gb|ABK08625.1| SSU ribosomal protein S6P [Burkholderia cenocepacia HI2424] (124 aa)
Score = 94, Expect = 7.4e-02, Identities = 27/91 (29%), Positives = 44/91 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T   G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94
>gi|188535073|ref|YP_001908870.1| 30S ribosomal protein S6 [Erwinia tasmaniensis] >gi|188030115|emb|CAO98001.1| 30S ribosomal protein S6 [Erwinia tasmaniensis] (131 aa)
Score = 93, Expect = 7.7e-02, Identities = 25/89 (28%), Positives = 42/89 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+T  EG   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSATITGAEGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRV 92
>gi|89068232|ref|ZP_01155642.1| Ribosomal protein S6 [Oceanicola granulosus HTCC2516] >gi|89046149|gb|EAR52207.1| Ribosomal protein S6 [Oceanicola granulosus HTCC2516] (118 aa)
Score = 93, Expect = 7.7e-02, Identities = 29/93 (31%), Positives = 45/93 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL-EREYG 95
           Y  + +    LS  QA  + E   Q L + +G  + TEY G+K +AY I K    HY   K      + ++ +R   ++  V+R L I + E E G
  S:     4 YEHVFIARQDLSNAQAEGLIEHFSQVLADNDGKVVDTEYWGVKTMAYKINKNRKGHYAFLKTDAPAPAVQEMERLMRLHDDVMRVLTIRVDEHEEG 99
>gi|162149103|ref|YP_001603564.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] >gi|187598781|ref|ZP_02985030.1| ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] >gi|189045471|sp|A9H1N0.1|RS6_GLUDA 30S ribosomal protein S6 >gi|161787680|emb|CAP57276.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] >gi|187489181|gb|EDU27133.1| ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] (161 aa)
Score = 93, Expect = 8.1e-02, Identities = 24/89 (26%), Positives = 41/89 (46%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + +    +S +Q   V +     L    G   + EY GL+ LAY IKK    HY         ++ K+ +R   +N+ V+R L + ++
  S:     4 YETVFIARNDVSQQQVEAVADGIAALLETDGGAVKKREYWGLRSLAYRIKKNRKGHYMLLGLDAKPETIKEIERQLGLNEDVMRVLTLRVD 94
>gi|16123685|ref|NP_406998.1| 30S ribosomal protein S6 [Yersinia pestis CO92] >gi|22124559|ref|NP_667982.1| 30S ribosomal protein S6 [Yersinia pestis KIM] >gi|45440396|ref|NP_991935.1| 30S ribosomal protein S6 [Yersinia pestis biovar Microtus str. 91001] >gi|51594790|ref|YP_068981.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis IP 32953] >gi|77958749|ref|ZP_00822777.1| COG0360: Ribosomal protein S6 [Yersinia bercovieri ATCC 43970] >gi|77961292|ref|ZP_00825133.1| COG0360: Ribosomal protein S6 [Yersinia mollaretii ATCC 43969] >gi|77973976|ref|ZP_00829519.1| COG0360: Ribosomal protein S6 [Yersinia frederiksenii ATCC 33641] >gi|77977622|ref|ZP_00833066.1| COG0360: Ribosomal protein S6 [Yersinia intermedia ATCC 29909] >gi|108806087|ref|YP_650003.1| 30S ribosomal protein S6 [Yersinia pestis Antiqua] >gi|108813443|ref|YP_649210.1| 30S ribosomal protein S6 [Yersinia pestis Nepal516] >gi|123440773|ref|YP_001004765.1| 30S ribosomal protein S6 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|153950227|ref|YP_001402593.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis IP 31758] >gi|153997316|ref|ZP_02022416.1| 30S ribosomal protein S6 [Yersinia pestis CA88-4125] >gi|162419609|ref|YP_001605263.1| 30S ribosomal protein S6 [Yersinia pestis Angola] >gi|165928153|ref|ZP_02223985.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937530|ref|ZP_02226093.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. IP275] >gi|166011303|ref|ZP_02232201.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214044|ref|ZP_02240079.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401345|ref|ZP_02306845.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420582|ref|ZP_02312335.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423107|ref|ZP_02314860.1| ribosomal protein S6 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170025999|ref|YP_001722504.1| ribosomal protein S6 [Yersinia pseudotuberculosis YPIII] >gi|186893799|ref|YP_001870911.1| ribosomal protein S6 [Yersinia pseudotuberculosis PB1/+] >gi|123246054|sp|Q1CBW4.1|RS6_YERPA 30S ribosomal protein S6 >gi|123372931|sp|Q1CEH0.1|RS6_YERPN 30S ribosomal protein S6 >gi|166227403|sp|A1JIS8.1|RS6_YERE8 30S ribosomal protein S6 >gi|167011250|sp|A7FMW5.1|RS6_YERP3 30S ribosomal protein S6 >gi|24212313|sp|Q8ZB81|RS6_YERPE 30S ribosomal protein S6 >gi|61216169|sp|Q66FA2|RS6_YERPS 30S ribosomal protein S6 >gi|21957359|gb|AAM84233.1|AE013667_6 30S ribosomal subunit protein S6 [Yersinia pestis KIM] >gi|45435253|gb|AAS60812.1| 30S ribosomal protein S6 [Yersinia pestis biovar Microtus str. 91001] >gi|51588072|emb|CAH19678.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis IP 32953] >gi|108777091|gb|ABG19610.1| SSU ribosomal protein S6P [Yersinia pestis Nepal516] >gi|108778000|gb|ABG12058.1| SSU ribosomal protein S6P [Yersinia pestis Antiqua] >gi|115349164|emb|CAL22127.1| 30S ribosomal protein S6 [Yersinia pestis CO92] >gi|122087734|emb|CAL10519.1| 30S ribosomal protein S6 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|149288953|gb|EDM39033.1| 30S ribosomal protein S6 [Yersinia pestis CA88-4125] >gi|152961722|gb|ABS49183.1| ribosomal protein S6 [Yersinia pseudotuberculosis IP 31758] >gi|162352424|gb|ABX86372.1| ribosomal protein S6 [Yersinia pestis Angola] >gi|165914635|gb|EDR33249.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. IP275] >gi|165919840|gb|EDR37141.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989687|gb|EDR41988.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204839|gb|EDR49319.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961388|gb|EDR57409.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049370|gb|EDR60778.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057277|gb|EDR67023.1| ribosomal protein S6 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752533|gb|ACA70051.1| ribosomal protein S6 [Yersinia pseudotuberculosis YPIII] >gi|186696825|gb|ACC87454.1| ribosomal protein S6 [Yersinia pseudotuberculosis PB1/+] (130 aa)
Score = 93, Expect = 8.9e-02, Identities = 25/89 (28%), Positives = 42/89 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+TN  G   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRV 92
>gi|194559000|ref|YP_002094026.1| Ribosomal protein S6 [Burkholderia cenocepacia PC184] >gi|124872791|gb|EAY64507.1| Ribosomal protein S6 [Burkholderia cenocepacia PC184] (133 aa)
Score = 93, Expect = 9.0e-02, Identities = 27/91 (29%), Positives = 44/91 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ + T+T   G   + E  G ++LAY I+K   AHY       D  +  + +     N  VLR LI+ +++
  S:    12 HYEIVFIVHPDQS-EQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 103
>gi|33593752|ref|NP_881396.1| 30S ribosomal protein S6 [Bordetella pertussis Tohama I] >gi|161609278|ref|NP_888459.2| 30S ribosomal protein S6 [Bordetella bronchiseptica RB50] >gi|161610393|ref|NP_884697.2| 30S ribosomal protein S6 [Bordetella parapertussis 12822] >gi|61215726|sp|Q7VV89|RS6_BORPE 30S ribosomal protein S6 >gi|61215731|sp|Q7W7P8|RS6_BORPA 30S ribosomal protein S6 >gi|61215737|sp|Q7WL35|RS6_BORBR 30S ribosomal protein S6 >gi|33563825|emb|CAE43069.1| 30s ribosomal protein s6 [Bordetella pertussis Tohama I] (126 aa)
Score = 93, Expect = 9.1e-02, Identities = 26/87 (29%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ +V    S EQ   + E+ Q  +T   G   + E  G ++LAYPI+K + AHY          +  + + +   N  VLR L+I
  S:     3 HYEVVFIVHPDQS-EQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQATLDELEHSFRYNDAVLRHLVI 90
>gi|15896955|ref|NP_350304.1| 30S ribosomal protein S6 [Clostridium acetobutylicum ATCC 824] >gi|24212323|sp|Q97CX2|RS6_CLOAB 30S ribosomal protein S6 >gi|15026830|gb|AAK81644.1|AE007867_11 Ribosomal protein S6 [Clostridium acetobutylicum ATCC 824] (95 aa)
Score = 93, Expect = 9.2e-02, Identities = 29/91 (31%), Positives = 45/91 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           +Y  + +++ SL  E  N   EK +  +TN  G     +  G ++LAY I K     Y    F  D Q  K+  R   I+  ++R LII+LE+
  S:     3 KYETLFILNPSLDEEGINTNVEKFKSVITNGGGEVENVDLWGKRKLAYEIDKVNEGIYVLVNFQSDAQLPKELDRVFRISDSIIRHLIISLEK 95
>gi|85707089|ref|ZP_01038177.1| ribosomal protein S6 [Roseovarius sp. 217] >gi|85668375|gb|EAQ23248.1| ribosomal protein S6 [Roseovarius sp. 217] (150 aa)
Score = 93, Expect = 9.2e-02, Identities = 25/89 (28%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    LS  QA  + E     LT+  G  ++ EY G+K +AY I K    HY   K    + + ++ +R   ++  V+R L I ++
  S:     4 YEHVMIARQDLSSAQAEGLIEHFGAVLTDNGGTLVEHEYWGVKTMAYKINKNRKGHYAFLKTDAPSSAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|85374299|ref|YP_458361.1| 30S ribosomal protein S6 [Erythrobacter litoralis HTCC2594] >gi|84787382|gb|ABC63564.1| ribosomal protein S6 [Erythrobacter litoralis HTCC2594] (126 aa)
Score = 93, Expect = 9.4e-02, Identities = 26/89 (29%), Positives = 39/89 (43%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  I L    LS  Q + +       +   +G   +TE  GLK LAY I +   AH+      G      + +R   IN+ V+R + I +E
  S:     9 YEHIFLARQDLSQSQVDALAATATDIIEKNDGKVTKTETWGLKNLAYKIDRNRKAHFVMLNIEGPGSVVAELERQTRINEDVIRYMTIRVE 99
>gi|78356457|ref|YP_387906.1| 30S ribosomal protein S6 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|91207914|sp|Q312D5|RS6_DESDG 30S ribosomal protein S6 >gi|78218862|gb|ABB38211.1| SSU ribosomal protein S6P [Desulfovibrio desulfuricans G20] (101 aa)
Score = 93, Expect = 9.5e-02, Identities = 22/81 (27%), Positives = 41/81 (50%)
  Q:    13 LSLEQANQVNEKQQQTLTNV------EGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           LS E  +Q  E     LT V        L  ++ G+++LAYP++K +  +Y R +++    S  + +R   I   + + + + L  E
  S:    10 LSPELGSQPREDLLAVLTGVIEREQGSVLAVDHWGMRDLAYPVRKHMRGYYVRLEYAVAGPSVAELERIIRITDGIYKFVTVKLADE 96
>gi|183600322|ref|ZP_02961815.1| hypothetical protein PROSTU_03884 [Providencia stuartii ATCC 25827] >gi|188020112|gb|EDU58152.1| hypothetical protein PROSTU_03884 [Providencia stuartii ATCC 25827] (131 aa)
Score = 92, Expect = 1.0e-01, Identities = 25/89 (28%), Positives = 43/89 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+TN +G   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEAIDELETNFRFNDAVIRSMVMRV 92
>gi|90408974|ref|ZP_01217106.1| 30S ribosomal protein S6 [Psychromonas sp. CNPT3] >gi|90309922|gb|EAS38075.1| 30S ribosomal protein S6 [Psychromonas sp. CNPT3] (130 aa)
Score = 92, Expect = 1.0e-01, Identities = 26/87 (29%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ N + E+   ++T   G   + E  G ++LAYPI K   AHY       +     D +     N  V+R +I+
  S:     3 HYEIVFMVHPDQS-EQVNGMIERYTTSITEAGGTIHRLEDWGRRQLAYPINKLHKAHYVLMNIEAEQNVLDDLENAFRFNDAVIRTMIM 90
>gi|159184610|ref|NP_529003.1| 30S ribosomal protein S6 [Agrobacterium tumefaciens str. C58] >gi|24212301|sp|Q8UGE7|RS6_AGRT5 30S ribosomal protein S6 >gi|17739486|gb|AAL42104.1| 30S ribosomal protein S6 [Agrobacterium tumefaciens str. C58] (153 aa)
Score = 92, Expect = 1.0e-01, Identities = 27/89 (30%), Positives = 42/89 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  I L    +S +Q + + E+ +  + +  G   + E  GLK L Y IKK   AHY          +  + +R   IN+ VLR + I +E
  S:     4 YEHIFLARQDISAQQVDALVEQYKGVIESFGGKVGRVENWGLKSLTYRIKKNRKAHYALMDIDAPAAAVHEVERQMRINEDVLRYMTIAVE 94
>gi|149184752|ref|ZP_01863070.1| ribosomal protein S6 [Erythrobacter sp. SD-21] >gi|148832072|gb|EDL50505.1| ribosomal protein S6 [Erythrobacter sp. SD-21] (121 aa)
Score = 92, Expect = 1.1e-01, Identities = 28/93 (30%), Positives = 43/93 (46%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL-EREYG 95
           Y  + L    LS  Q +Q+     + +   +G   +TE  GLK LAY I +   AH+      G      + +R   IN+ V+R + I + E E G
  S:     4 YEHVFLARQDLSQAQVDQLAATATEIVEANDGKVTKTETWGLKNLAYKIDRNRKAHFVMLNIEGPGAVVAELERQTRINEDVIRYMTIRVDEHEEG 99
>gi|88704451|ref|ZP_01102165.1| 30S ribosomal protein S6 [gamma proteobacterium KT 71] >gi|88701502|gb|EAQ98607.1| 30S ribosomal protein S6 [Congregibacter litoralis KT71] (150 aa)
Score = 92, Expect = 1.1e-01, Identities = 27/87 (31%), Positives = 41/87 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+   T+T   G   + E  G ++LA+PI K   AHY        N++  +   T   N  V+R L+I
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTNTITKDGGSVHRLEDWGRRQLAFPIAKVHKAHYILMNVEASNEAMDELTTTFRYNDAVIRNLVI 90
>gi|187478665|ref|YP_786689.1| 30S ribosomal protein S6 [Bordetella avium 197N] >gi|123514609|sp|Q2KZ18.1|RS6_BORA1 30S ribosomal protein S6 >gi|115423251|emb|CAJ49784.1| 30S ribosomal protein S6 [Bordetella avium 197N] (124 aa)
Score = 92, Expect = 1.1e-01, Identities = 26/87 (29%), Positives = 43/87 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ +V    S EQ   + E+ Q  +T   G   + E  G ++LAYPI+K + AHY       +  +  + + +   N  VLR L+I
  S:     3 HYEVVFIVHPDQS-EQVPAMVERYQSLVTGQNGAVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECNQATLDELEHSFRYNDAVLRHLVI 90
>gi|94263202|ref|ZP_01287019.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] >gi|94270366|ref|ZP_01291724.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] >gi|93450832|gb|EAT01865.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] >gi|93456420|gb|EAT06540.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] (126 aa)
Score = 92, Expect = 1.2e-01, Identities = 24/109 (22%), Positives = 53/109 (48%)
  Q:     4 NIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKR 112
           ++I++  G+ +  +   V++K    ++  +G      + GLK LAYP+KK+    Y   ++  +    K+ +R   I+ ++L+ L + L+ +     ++       A Q R
  S:     6 SVIIVRPGAAAEAEITAVSDKYAAVISEYQGEVASVNHWGLKRLAYPVKKENQGFYLLLRYLCNPDGIKEMERLLRIDDRILKFLTVRLDDDLDISGAVTAADGDQADQAR 116
>gi|194684673|emb|CAR46616.1| 30S ribosomal protein S6 [Proteus mirabilis HI4320] (131 aa)
Score = 92, Expect = 1.2e-01, Identities = 27/87 (31%), Positives = 41/87 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+ +  +TN  G   + E  G ++LAYPI K   AHY         +   + + T   N  VLR +I+
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYKTAITNANGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVLRNMIM 90
>gi|152992024|ref|YP_001357745.1| 30S ribosomal protein S6 [Sulfurovum sp. NBC37-1] >gi|166227395|sp|A6Q7C9.1|RS6_SULNB 30S ribosomal protein S6 >gi|151423885|dbj|BAF71388.1| 30S ribosomal protein S6 [Sulfurovum sp. NBC37-1] (127 aa)
Score = 92, Expect = 1.2e-01, Identities = 21/86 (24%), Positives = 47/86 (54%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           Y  + +V  +L+ E+      K +  L  V+   L T+ +G+++LAYP++K    +Y    +  + ++  + +R   IN++V++ L +
  S:     4 YETLFVVKPTLTEEETAAEIAKIKDVLAKVDAELLATDDMGMRKLAYPVQKNDRGYYTVLFYKANGEAIAEIERNLKINEEVIKFLTV 91
>gi|161505108|ref|YP_001572219.1| 30S ribosomal protein S6 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189045491|sp|A9MFL1.1|RS6_SALAR 30S ribosomal protein S6 >gi|160866455|gb|ABX23078.1| hypothetical protein SARI_03242 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (131 aa)
Score = 92, Expect = 1.2e-01, Identities = 26/87 (29%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +I+
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMIM 90
>gi|94676773|ref|YP_589002.1| ribosomal protein S6 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|166226803|sp|Q1LSR2.1|RS6_BAUCH 30S ribosomal protein S6 >gi|94219923|gb|ABF14082.1| ribosomal protein S6 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (125 aa)
Score = 92, Expect = 1.2e-01, Identities = 24/89 (26%), Positives = 46/89 (51%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+L+V    S EQ +++ E+    +T+ +G   + E  G ++L+YPIKK   AHY         +   +  +    N+ ++R +I+ +
  S:     3 HYEIVLMVHPDQS-EQVSRMIERYSTVITSAQGKIHRLEDWGRRQLSYPIKKLHKAHYVLINLEASQKVMDELSKYLRFNEAIIRSMIMRV 92
>gi|157368693|ref|YP_001476682.1| 30S ribosomal protein S6 [Serratia proteamaculans 568] >gi|167011248|sp|A8G8W4.1|RS6_SERP5 30S ribosomal protein S6 >gi|157320457|gb|ABV39554.1| ribosomal protein S6 [Serratia proteamaculans 568] (132 aa)
Score = 92, Expect = 1.3e-01, Identities = 25/89 (28%), Positives = 42/89 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+TN  G   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSATITNAAGQIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRV 92
>gi|85708887|ref|ZP_01039953.1| ribosomal protein S6 [Erythrobacter sp. NAP1] >gi|85690421|gb|EAQ30424.1| ribosomal protein S6 [Erythrobacter sp. NAP1] (137 aa)
Score = 91, Expect = 1.3e-01, Identities = 26/89 (29%), Positives = 40/89 (44%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  I L    LS  Q + +     + +   EG   +TE  GLK LAY I +   AH+            ++ +R   IN+ V+R + I +E
  S:    20 YEHIFLARQDLSQAQVDALAATATEIVEANEGKVTKTETWGLKSLAYKIDRNRKAHFVMLNIDAPGSVVEELERQTRINEDVIRYMTIRVE 110
>gi|196183916|gb|EDX78892.1| ribosomal protein S6, putative [Brevundimonas sp. BAL3] (147 aa)
Score = 91, Expect = 1.3e-01, Identities = 24/79 (30%), Positives = 39/79 (49%)
  Q:    13 LSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           +S +QA  +N+  +  +    G   + EY GL+ L Y +KK   AHY          +  + +R   IN+ VLR L + +E
  S:    33 ISAQQAEALNDTIKDLIVQGGGSVAKIEYWGLRNLTYRVKKNRKAHYSLLAVDAPPAAMAEVERQLGINEDVLRWLTVRVE 113
>gi|171463203|ref|YP_001797316.1| ribosomal protein S6 [Polynucleobacter necessarius STIR1] >gi|171192741|gb|ACB43702.1| ribosomal protein S6 [Polynucleobacter necessarius STIR1] (124 aa)
Score = 91, Expect = 1.3e-01, Identities = 27/87 (31%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + ++ + TL  V G   + E  G +++AY I K   AHY       D ++ ++ +     N  VLR LII
  S:     3 HYEIVFIVHPDQS-EQVPAMIDRYKATLAAVGGKIHRMEDWGRRQMAYMIDKLAKAHYVCMNIECDQKTLEELEHAFKFNDAVLRHLII 90
>gi|194335286|ref|YP_002017080.1| ribosomal protein S6 [Pelodictyon phaeoclathratiforme BU-1] >gi|194307763|gb|ACF42463.1| ribosomal protein S6 [Pelodictyon phaeoclathratiforme BU-1] (134 aa)
Score = 91, Expect = 1.4e-01, Identities = 25/88 (28%), Positives = 42/88 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL--GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           Y   L++DG L  E         Q+ +T   G  +  L  G ++ AYPIKK+   +Y   +F+       + ++     + +LR LII+L
  S:     7 YECTLIIDGGLQDEAIAAAMALVQRVITEKGGSISSVLEIGRRKTAYPIKKKTIGYYAHIEFTAATSVIAEVEKVIRYEEDLLRYLIIHL 96
>gi|34499095|ref|NP_903310.1| 30S ribosomal protein S6 [Chromobacterium violaceum ATCC 12472] >gi|61215686|sp|Q7NRY7|RS6_CHRVO 30S ribosomal protein S6 >gi|34104946|gb|AAQ61302.1| 30S ribosomal protein S6 [Chromobacterium violaceum ATCC 12472] (124 aa)
Score = 91, Expect = 1.4e-01, Identities = 27/91 (29%), Positives = 43/91 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + E+ +  +   EG   + E  G ++LAYPI+K   AHY         ++  + +     N  VLR L I ++R
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKGMVLAAEGKIHRLEDWGRRQLAYPIQKLHKAHYVLMNVECQAETLAEIEHAFKFNDAVLRHLTIKMDR 94
>gi|37528392|ref|NP_931737.1| 30S ribosomal protein S6 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|61216269|sp|Q7MYU7|RS6_PHOLL 30S ribosomal protein S6 >gi|36787830|emb|CAE16945.1| 30S ribosomal protein S6 [Photorhabdus luminescens subsp. laumondii TTO1] (131 aa)
Score = 91, Expect = 1.4e-01, Identities = 26/89 (29%), Positives = 42/89 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+TN +G   + E  G ++LAYPI K   AHY         +   + +     N  V+R +I+ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETNFRFNDAVIRSMIMRV 92
>gi|119897009|ref|YP_932222.1| 30S ribosomal protein S6 [Azoarcus sp. BH72] >gi|166226799|sp|A1K3D0.1|RS6_AZOSB 30S ribosomal protein S6 >gi|119669422|emb|CAL93335.1| RpsF protein [Azoarcus sp. BH72] (127 aa)
Score = 91, Expect = 1.5e-01, Identities = 26/91 (28%), Positives = 44/91 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y I+ +V    S EQ   + ++ +  +T   G   + E  G ++LAYPI+K   AHY       D ++  + +     N  VLR L I +++
  S:     3 HYEIVFIVHPDQS-EQVPAMIDRYKSIVTARNGQIHRLEDWGRRQLAYPIQKVHKAHYVLMNIECDGEALGELEHAFKFNDAVLRHLTIKMKK 94
>gi|57239414|ref|YP_180550.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] >gi|58579386|ref|YP_197598.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] >gi|58617441|ref|YP_196640.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Gardel] >gi|75356738|sp|Q5FG27|RS6_EHRRG 30S ribosomal protein S6 >gi|81352829|sp|Q5HAJ4|RS6_EHRRW 30S ribosomal protein S6 >gi|57161493|emb|CAH58419.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] >gi|58417053|emb|CAI28166.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Gardel] >gi|58418012|emb|CAI27216.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] (109 aa)
Score = 91, Expect = 1.5e-01, Identities = 21/58 (36%), Positives = 28/58 (48%)
  Q:    31 NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
             E L+ EY GL + AY I K    HY        + S  +FKR   +N+ VLR L +
  S:    34 GAELLKYEYWGLLDFAYAIDKMNKGHYCMMYIRSSSTSMDEFKRKVRLNEDVLRFLCL 91
>gi|119947022|ref|YP_944702.1| ribosomal protein S6 [Psychromonas ingrahamii 37] >gi|166227370|sp|A1T038.1|RS6_PSYIN 30S ribosomal protein S6 >gi|119865626|gb|ABM05103.1| SSU ribosomal protein S6P [Psychromonas ingrahamii 37] (133 aa)
Score = 91, Expect = 1.5e-01, Identities = 26/87 (29%), Positives = 39/87 (44%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ N + E+   ++T   G   + E  G ++LAYPI K   AHY             D +     N  V+R +I+
  S:     3 HYEIVFMVHPDQS-EQVNGMIERYTASITEAGGTVHRLEDWGRRQLAYPINKLHKAHYVLMNIEAGQNVIDDLENAFRFNDSVIRNMIM 90
>gi|81298823|ref|YP_399031.1| 30S ribosomal protein S6 [Synechococcus elongatus PCC 7942] >gi|123557696|sp|Q31SC5.1|RS6_SYNP7 30S ribosomal protein S6 >gi|81167704|gb|ABB56044.1| SSU ribosomal protein S6P [Synechococcus elongatus PCC 7942] (107 aa)
Score = 91, Expect = 1.6e-01, Identities = 27/89 (30%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + ++   L+ EQ  Q   K Q  LT    E   T++ G + LAY I KQ    Y +  ++GD       +R   ++++VLR L +  E
  S:     6 YETMYILRADLTEEQVEQAIAKYQTLLTEAGAEVQDTQHRGKRRLAYLINKQREGIYVQINYTGDGSQIAPLERALRLSEEVLRFLTVKQE 96
>gi|163857369|ref|YP_001631667.1| 30S ribosomal protein S6 [Bordetella petrii DSM 12804] >gi|163261097|emb|CAP43399.1| 30S ribosomal protein S6 [Bordetella petrii] (125 aa)
Score = 91, Expect = 1.6e-01, Identities = 26/87 (29%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ +V    S EQ   + E+ Q  +T   G   + E  G ++LAYPI+K + AHY          +  + + +   N  VLR L+I
  S:     3 HYEVVFIVHPDQS-EQVPAMVERYQTLVTGQGGAVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQATLDELEHSFRYNDAVLRHLVI 90
>gi|118602662|ref|YP_903877.1| SSU ribosomal protein S6P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166227378|sp|A1AWU9.1|RS6_RUTMC 30S ribosomal protein S6 >gi|118567601|gb|ABL02406.1| SSU ribosomal protein S6P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (113 aa)
Score = 91, Expect = 1.6e-01, Identities = 30/88 (34%), Positives = 39/88 (44%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
            Y I L+V    S  Q   + EK ++ +T   G   + E  G K LAYPIKK   AHY       D +           N  +LR LII+
  S:     3 HYEITLIVHPDQS-AQVGTMMEKYKEIITTGGGKIHRKEDWGRKHLAYPIKKIYKAHYLMMNIECDQEVLDKLNYNFRFNDAILRNLIIS 91
>gi|168822479|ref|ZP_02834479.1| hypothetical protein Salentericaenterica_24047 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (124 aa)
Score = 91, Expect = 1.7e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|16763208|ref|NP_458825.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767637|ref|NP_463252.1| 30S ribosomal protein S6 [Salmonella typhimurium LT2] >gi|29144687|ref|NP_808029.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56416182|ref|YP_153257.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182835|ref|YP_219252.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|156932421|ref|YP_001436337.1| 30S ribosomal protein S6 [Enterobacter sakazakii ATCC BAA-894] >gi|161617663|ref|YP_001591628.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|168219635|ref|ZP_02644867.1| hypothetical protein Senterenterica_04536 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168226759|ref|ZP_02651990.1| hypothetical protein Sententeric_13368 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168263255|ref|ZP_02685228.1| hypothetical protein Salmentericaenterica_19425 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464724|ref|ZP_02698627.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168474037|ref|ZP_02703060.1| hypothetical protein Salmoentericaenterica_05199 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194443034|ref|YP_002043644.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450923|ref|YP_002048433.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194471096|ref|ZP_03077080.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735616|ref|YP_002117331.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|166226829|sp|A7MM76.1|RS6_ENTS8 30S ribosomal protein S6 >gi|189045492|sp|A9N518.1|RS6_SALPB 30S ribosomal protein S6 >gi|54039532|sp|P66594|RS6_SALTI 30S ribosomal protein S6 >gi|54041975|sp|P66593|RS6_SALTY 30S ribosomal protein S6 >gi|75478846|sp|Q57GJ1|RS6_SALCH 30S ribosomal protein S6 >gi|81599615|sp|Q5PJ58|RS6_SALPA 30S ribosomal protein S6 >gi|25294538|pir||AG1052 30s ribosomal protein S6 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422953|gb|AAL23211.1| 30S ribosomal subunit protein S6 [Salmonella typhimurium LT2] >gi|16505516|emb|CAD06868.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140326|gb|AAO71889.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56130439|gb|AAV79945.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62130468|gb|AAX68171.1| 30S ribosomal subunit protein S6 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|156530675|gb|ABU75501.1| hypothetical protein ESA_00200 [Enterobacter sakazakii ATCC BAA-894] >gi|161367027|gb|ABX70795.1| hypothetical protein SPAB_05526 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401697|gb|ACF61919.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194409227|gb|ACF69446.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194457460|gb|EDX46299.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711118|gb|ACF90339.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632912|gb|EDX51366.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (131 aa)
Score = 91, Expect = 1.7e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|157353058|emb|CAO44948.1| unnamed protein product [Vitis vinifera] (301 aa)
Score = 90, Expect = 1.7e-01, Identities = 27/87 (31%), Positives = 44/87 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ L+      E+   VN K Q  +   +G   +    GL+ LAY I+K  +AHY    F  + Q   DFK   + +++V+R L+I
  S:   129 HYEVVYLIHEKHD-EEVENVNSKVQDFIREKKGKLWRLNDWGLRRLAYKIQKAKNAHYILMNFELEAQWINDFKTMLDQDERVIRHLVI 216
>gi|77919595|ref|YP_357410.1| 30S ribosomal protein S6 [Pelobacter carbinolicus DSM 2380] >gi|91207926|sp|Q3A317|RS6_PELCD 30S ribosomal protein S6 >gi|77545678|gb|ABA89240.1| SSU ribosomal protein S6P [Pelobacter carbinolicus DSM 2380] (115 aa)
Score = 90, Expect = 1.8e-01, Identities = 25/92 (27%), Positives = 49/92 (53%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREY 94
           Y  I++V      ++ N V EK +  LT++    L+ +  G+++LAYP+KKQ    Y    F  D     +++R   +++ V++   + LE+ +
  S:     4 YENIMIVHPDKVADEYNAVVEKFKGVLTDLNANLLKVDEWGVRKLAYPVKKQGRGSYVLTVFEADPTIIDEYERRLRLDEAVIKFQTVLLEKGF 97
>gi|170077069|ref|YP_001733707.1| ribosomal protein S6 [Synechococcus sp. PCC 7002] >gi|169884738|gb|ACA98451.1| ribosomal protein S6 [Synechococcus sp. PCC 7002] (115 aa)
Score = 90, Expect = 1.8e-01, Identities = 25/91 (27%), Positives = 44/91 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTL--TNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLERE 93
           Y ++ ++   LS EQ  +V+ K +  L  +    LQ +  G + LAYPI+      Y +  +  D    K  +R   + + V+R L + L+ E
  S:     5 YEMMYILRPDLSEEQVQEVSSKYKTMLQDSGASDLQVQVRGKRHLAYPIQNFNDGIYIQVNYKADGSQIKAVERDMRLGEMVIRYLTMKLDAE 97
>gi|133976|sp|P02358.1|RS6_ECOLI 30S ribosomal protein S6 [Contains: 30S ribosomal protein S6, fully modified isoform; 30S ribosomal protein S6, non-modified isoform] >gi|33357883|pdb|1P6G|F Chain F, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357960|pdb|1P87|F Chain F, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754044|pdb|2AVY|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754100|pdb|2AW7|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666553|pdb|1VS5|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666605|pdb|1VS7|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138058|pdb|2I2P|F Chain F, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138129|pdb|2I2U|F Chain F, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|157836028|pdb|2QOU|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836079|pdb|2QOW|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836132|pdb|2QOY|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836183|pdb|2QP0|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429703|pdb|2QAL|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429755|pdb|2QAN|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429813|pdb|2QB9|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429865|pdb|2QBB|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429917|pdb|2QBD|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429969|pdb|2QBF|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430023|pdb|2QBH|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430076|pdb|2QBJ|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431376|pdb|2Z4K|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431429|pdb|2Z4M|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988793|pdb|2VHO|F Chain F, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 3 Of 4) >gi|168988814|pdb|2VHP|F Chain F, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 4 Of 4) (135 aa)
Score = 90, Expect = 2.0e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|124361112|gb|ABN09084.1| Ribosomal protein S6 [Medicago truncatula] (294 aa)
Score = 90, Expect = 2.0e-01, Identities = 27/87 (31%), Positives = 46/87 (52%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY--LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ L+    + E+   VNEK Q  L   +G    +   G+++LAY I+K  +AHY    F  D +   + K   + +++V+R L+I
  S:   135 HYEIVYLIHEKHA-EEVVAVNEKVQDFLREKKGRVWRFSDWGMRKLAYKIQKANNAHYILMNFEMDAKYINELKTLLDRDERVIRHLVI 222
>gi|15645860|ref|NP_208038.1| 30S ribosomal protein S6 [Helicobacter pylori 26695] >gi|2500411|sp|P56013|RS6_HELPY 30S ribosomal protein S6 >gi|2314412|gb|AAD08292.1| ribosomal protein S6 (rps6) [Helicobacter pylori 26695] (142 aa)
Score = 90, Expect = 2.0e-01, Identities = 25/90 (27%), Positives = 45/90 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG-LQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y  + ++  +L  E+     E  ++ +T   G ++T   +G++ LAY IKK    +YY   F  +     + +R   IN+ VLR ++I  E
  S:     3 HYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSMIVELERLYRINEDVLRFIVIKYE 94
>gi|77361359|ref|YP_340934.1| 30S ribosomal protein S6 [Pseudoalteromonas haloplanktis TAC125] >gi|91207933|sp|Q3IIA2|RS6_PSEHT 30S ribosomal protein S6 >gi|76876270|emb|CAI87492.1| 30S ribosomal subunit protein S6 [Pseudoalteromonas haloplanktis TAC125] (113 aa)
Score = 90, Expect = 2.1e-01, Identities = 26/87 (29%), Positives = 41/87 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+   ++T   G+  + E  G ++LAYPI K   AHY         +   + + T   N  VLR L++
  S:     3 HYEIVFMVHPDQS-EQVTGMIERYTGSITEAGGVIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPTEVISELETTFRYNDAVLRNLVM 90
>gi|193808674|emb|CAQ39377.1| 30s ribosomal protein s6-like protein, putative [Plasmodium knowlesi strain H] (247 aa)
Score = 90, Expect = 2.1e-01, Identities = 25/85 (29%), Positives = 42/85 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELI 87
           YNI LL   + ++ +  +   +    L  V+G   +  YLG + L  PIKKQ+ A+Y  + F        + KR  ++   VLR ++
  S:   127 YNIDLLFSCNYTISEIKKKIAEYMYELKLVDGENFKAVYLGKRRLVRPIKKQMEAYYVLFSFEMYPSLILEIKRKLSLQDAVLRFMV 213
>gi|188495956|ref|ZP_03003226.1| ribosomal protein S6 [Escherichia coli 53638] >gi|194439549|ref|ZP_03071623.1| ribosomal protein S6 [Escherichia coli 101-1] >gi|188491155|gb|EDU66258.1| ribosomal protein S6 [Escherichia coli 53638] >gi|194421548|gb|EDX37561.1| ribosomal protein S6 [Escherichia coli 101-1] (131 aa)
Score = 90, Expect = 2.1e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|15804789|ref|NP_290830.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 EDL933] >gi|15834430|ref|NP_313203.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. Sakai] >gi|16132022|ref|NP_418621.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12 substr. MG1655] >gi|24115554|ref|NP_710064.1| 30S ribosomal protein S6 [Shigella flexneri 2a str. 301] >gi|26251098|ref|NP_757138.1| 30S ribosomal protein S6 [Escherichia coli CFT073] >gi|30065571|ref|NP_839742.1| 30S ribosomal protein S6 [Shigella flexneri 2a str. 2457T] >gi|74314681|ref|YP_313100.1| 30S ribosomal protein S6 [Shigella sonnei Ss046] >gi|82546558|ref|YP_410505.1| 30S ribosomal protein S6 [Shigella boydii Sb227] >gi|82779398|ref|YP_405747.1| 30S ribosomal protein S6 [Shigella dysenteriae Sd197] >gi|89110920|ref|AP_004700.1| 30S ribosomal subunit protein S6 [Escherichia coli W3110] >gi|91213749|ref|YP_543735.1| 30S ribosomal protein S6 [Escherichia coli UTI89] >gi|110808115|ref|YP_691635.1| 30S ribosomal protein S6 [Shigella flexneri 5 str. 8401] >gi|117626546|ref|YP_859869.1| 30S ribosomal protein S6 [Escherichia coli APEC O1] >gi|157157810|ref|YP_001465700.1| 30S ribosomal protein S6 [Escherichia coli E24377A] >gi|157163665|ref|YP_001460983.1| 30S ribosomal protein S6 [Escherichia coli HS] >gi|168707515|ref|ZP_02739792.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4045] >gi|168718614|ref|ZP_02750891.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4206] >gi|168736513|ref|ZP_02768790.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4115] >gi|168751448|ref|ZP_02776470.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4113] >gi|168754772|ref|ZP_02779779.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4401] >gi|168760443|ref|ZP_02785450.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4501] >gi|168766480|ref|ZP_02791487.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4486] >gi|168774087|ref|ZP_02799094.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4196] >gi|168780633|ref|ZP_02805640.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4076] >gi|168784838|ref|ZP_02809845.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC869] >gi|168792166|ref|ZP_02817173.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4042] >gi|168801856|ref|ZP_02826863.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC508] >gi|170021790|ref|YP_001726744.1| ribosomal protein S6 [Escherichia coli ATCC 8739] >gi|170083646|ref|YP_001732966.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K12 substr. DH10B] >gi|170682447|ref|YP_001746595.1| ribosomal protein S6 [Escherichia coli SMS-3-5] >gi|170766562|ref|ZP_02901015.1| ribosomal protein S6 [Escherichia albertii TW07627] >gi|187734235|ref|YP_001882889.1| ribosomal protein S6 [Shigella boydii CDC 3083-94] >gi|191165624|ref|ZP_03027464.1| ribosomal protein S6 [Escherichia coli B7A] >gi|191170756|ref|ZP_03032308.1| ribosomal protein S6 [Escherichia coli F11] >gi|193066024|ref|ZP_03047082.1| ribosomal protein S6 [Escherichia coli E22] >gi|193070872|ref|ZP_03051804.1| ribosomal protein S6 [Escherichia coli E110019] >gi|194426546|ref|ZP_03059100.1| ribosomal protein S6 [Escherichia coli B171] >gi|194434603|ref|ZP_03066860.1| ribosomal protein S6 [Shigella dysenteriae 1012] >gi|195935990|ref|ZP_03081372.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. EC4024] >gi|122421451|sp|Q1R360.1|RS6_ECOUT 30S ribosomal protein S6 >gi|122956957|sp|Q0SX85.1|RS6_SHIF8 30S ribosomal protein S6 >gi|166226828|sp|A1AJA5.1|RS6_ECOK1 30S ribosomal protein S6 >gi|167011244|sp|A7ZV71.1|RS6_ECO24 30S ribosomal protein S6 >gi|167011245|sp|A8A7U6.1|RS6_ECOHS 30S ribosomal protein S6 >gi|189045466|sp|B1IT06.1|RS6_ECOLC 30S ribosomal protein S6 >gi|61236240|sp|P0A4D0|RS6_ECOL6 30S ribosomal protein S6 >gi|61236246|sp|P0A4D1|RS6_ECO57 30S ribosomal protein S6 >gi|61236252|sp|P0A4D2|RS6_SHIFL 30S ribosomal protein S6 >gi|91207789|sp|Q31TD1|RS6_SHIBS 30S ribosomal protein S6 >gi|91207790|sp|Q328J9|RS6_SHIDS 30S ribosomal protein S6 >gi|91207791|sp|Q3YUE7|RS6_SHISS 30S ribosomal protein S6 >gi|12519191|gb|AAG59396.1|AE005652_13 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 EDL933] >gi|26111530|gb|AAN83712.1|AE016771_223 30S ribosomal protein S6 [Escherichia coli CFT073] >gi|42845|emb|CAA27652.1| unnamed protein product [Escherichia coli] >gi|537041|gb|AAA97096.1| 30S ribosomal subunit protein S6 [Escherichia coli] >gi|1790644|gb|AAC77157.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12 substr. MG1655] >gi|13364653|dbj|BAB38599.1| 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 str. Sakai] >gi|24054885|gb|AAN45771.1| 30S ribosomal subunit protein S6 [Shigella flexneri 2a str. 301] >gi|30043835|gb|AAP19554.1| 30S ribosomal subunit protein S6 [Shigella flexneri 2a str. 2457T] >gi|73858158|gb|AAZ90865.1| 30S ribosomal subunit protein S6 [Shigella sonnei Ss046] >gi|81243546|gb|ABB64256.1| 30S ribosomal subunit protein S6 [Shigella dysenteriae Sd197] >gi|81247969|gb|ABB68677.1| 30S ribosomal subunit protein S6 [Shigella boydii Sb227] >gi|85676951|dbj|BAE78201.1| 30S ribosomal subunit protein S6 [Escherichia coli W3110] >gi|91075323|gb|ABE10204.1| 30S ribosomal protein S6 [Escherichia coli UTI89] >gi|110617663|gb|ABF06330.1| 30S ribosomal subunit protein S6 [Shigella flexneri 5 str. 8401] >gi|115515670|gb|ABJ03745.1| 30S ribosomal subunit protein S6 [Escherichia coli APEC O1] >gi|157069345|gb|ABV08600.1| ribosomal protein S6 [Escherichia coli HS] >gi|157079840|gb|ABV19548.1| ribosomal protein S6 [Escherichia coli E24377A] >gi|169756718|gb|ACA79417.1| ribosomal protein S6 [Escherichia coli ATCC 8739] >gi|169891481|gb|ACB05188.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K12 substr. DH10B] >gi|170124000|gb|EDS92931.1| ribosomal protein S6 [Escherichia albertii TW07627] >gi|170520165|gb|ACB18343.1| ribosomal protein S6 [Escherichia coli SMS-3-5] >gi|187431227|gb|ACD10501.1| ribosomal protein S6 [Shigella boydii CDC 3083-94] >gi|187770274|gb|EDU34118.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4196] >gi|188014482|gb|EDU52604.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4113] >gi|189001825|gb|EDU70811.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4076] >gi|189357892|gb|EDU76311.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4401] >gi|189363927|gb|EDU82346.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4486] >gi|189368955|gb|EDU87371.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4501] >gi|189375098|gb|EDU93514.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC869] >gi|189376062|gb|EDU94478.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC508] >gi|190904319|gb|EDV64028.1| ribosomal protein S6 [Escherichia coli B7A] >gi|190908980|gb|EDV68567.1| ribosomal protein S6 [Escherichia coli F11] >gi|192926347|gb|EDV80983.1| ribosomal protein S6 [Escherichia coli E22] >gi|192955818|gb|EDV86289.1| ribosomal protein S6 [Escherichia coli E110019] >gi|194415285|gb|EDX31553.1| ribosomal protein S6 [Escherichia coli B171] >gi|194417188|gb|EDX33300.1| ribosomal protein S6 [Shigella dysenteriae 1012] (131 aa)
Score = 90, Expect = 2.2e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|119952917|ref|YP_945126.1| SSU ribosomal protein S6P [Borrelia turicatae 91E135] >gi|119861688|gb|AAX17456.1| SSU ribosomal protein S6P [Borrelia turicatae 91E135] (133 aa)
Score = 89, Expect = 2.3e-01, Identities = 21/65 (32%), Positives = 35/65 (53%)
  Q:    24 KQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           K+Q T+ N        LG + L YPI+KQL   Y   +F  D+++ K+ +    + K +LR +I+
  S:    26 KKQLTVFNASDFAENSLGERALEYPIRKQLRGRYEIIEFKMDSENLKELEIQLKLIKNLLRHMIL 90
>gi|56751494|ref|YP_172195.1| 30S ribosomal protein S6 [Synechococcus elongatus PCC 6301] >gi|61216125|sp|Q5N1Z5|RS6_SYNP6 30S ribosomal protein S6 >gi|56686453|dbj|BAD79675.1| 30S ribosomal protein S6 [Synechococcus elongatus PCC 6301] (107 aa)
Score = 89, Expect = 2.3e-01, Identities = 27/89 (30%), Positives = 42/89 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y    ++   L+ EQ  Q   K Q  LT    E   T++ G + LAY I KQ    Y +  ++GD       +R   ++++VLR L +  E
  S:     6 YETTYILRADLTEEQVEQAIAKYQTPLTEAGAEVQDTQHRGKRRLAYLINKQREGIYVQINYTGDGSQIAPLERALRLSEEVLRFLTVKQE 96
>gi|21674944|ref|NP_663009.1| 30S ribosomal protein S6 [Chlorobium tepidum TLS] >gi|25009197|sp|Q8KAM1|RS6_CHLTE 30S ribosomal protein S6 >gi|21648174|gb|AAM73351.1| ribosomal protein S6 [Chlorobium tepidum TLS] (131 aa)
Score = 89, Expect = 2.3e-01, Identities = 25/89 (28%), Positives = 44/89 (49%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL--GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           QY   +++DG L  +    V E  ++T+T+  G+    L  G +++AY I+K    +Y   +F        + +R     + +LR LII L
  S:     6 QYECTVIIDGGLQDDAIAAVMELVKKTVTDKGGVINNVLEVGRRKMAYLIRKTSIGYYAHIEFDAVPSVIAEIERVFRYEEAILRFLIIQL 96
>gi|71893643|ref|YP_279089.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae J] >gi|91207921|sp|Q4AA43|RS6_MYCHJ 30S ribosomal protein S6 >gi|71851770|gb|AAZ44378.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae J] (241 aa)
Score = 89, Expect = 2.3e-01, Identities = 20/56 (35%), Positives = 30/56 (53%)
  Q:    40 LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           L    LAY I+K   A Y+    +      ++F R ANI +++ R LI+NL+ E G
  S:    38 LETTNLAYSIRKSKIAQYFLVDLNAPTNLIEEFVRRANITREIWRYLIVNLDSEKG 93
>gi|108563614|ref|YP_627930.1| 30S ribosomal protein S6 [Helicobacter pylori HPAG1] >gi|123073733|sp|Q1CS16.1|RS6_HELPH 30S ribosomal protein S6 >gi|107837387|gb|ABF85256.1| ribosomal protein S6 [Helicobacter pylori HPAG1] (142 aa)
Score = 89, Expect = 2.4e-01, Identities = 25/90 (27%), Positives = 45/90 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG-LQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y  + ++  +L  E+     E  ++ +T   G ++T   +G++ LAY IKK    +YY   F  +     + +R   IN+ VLR ++I  E
  S:     3 HYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSMILELERLYRINEDVLRFIVIKYE 94
>gi|56477751|ref|YP_159340.1| 30S ribosomal protein S6 [Azoarcus sp. EbN1] >gi|81357242|sp|Q5P2M5|RS6_AZOSE 30S ribosomal protein S6 >gi|56313794|emb|CAI08439.1| 30S Ribosomal protein S6 [Azoarcus sp. EbN1] (128 aa)
Score = 89, Expect = 2.4e-01, Identities = 24/87 (27%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ +V    S EQ   + E+ +  +T   G   + E  G +++AYPI+K   AHY       D ++  + +     N  VLR L++
  S:     3 HYEVVFIVHPDQS-EQVPAMIERYKAIVTARNGQIHRLEDWGRRQMAYPIQKVHKAHYVLMNIECDGEALGELEHAFKFNDAVLRHLVV 90
>gi|33566505|emb|CAE37761.1| 30s ribosomal protein s6 [Bordetella parapertussis] >gi|33568499|emb|CAE32411.1| 30s ribosomal protein s6 [Bordetella bronchiseptica RB50] (157 aa)
Score = 89, Expect = 2.4e-01, Identities = 26/87 (29%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y ++ +V    S EQ   + E+ Q  +T   G   + E  G ++LAYPI+K + AHY          +  + + +   N  VLR L+I
  S:    34 HYEVVFIVHPDQS-EQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQATLDELEHSFRYNDAVLRHLVI 121
>gi|42560587|ref|NP_975038.1| 30S ribosomal protein S6 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61215588|sp|Q6MUK4|RS6_MYCMS 30S ribosomal protein S6 >gi|42492083|emb|CAE76680.1| 30S ribosomal protein S6 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (137 aa)
Score = 89, Expect = 2.5e-01, Identities = 25/83 (30%), Positives = 40/83 (48%)
  Q:    35 LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDE 117
           L++  LGL +  Y I  +    Y+        Q+ K+F+R A I+K V+R L++N E    Y  S+   K  +      KY+E
  S:    36 LESNDLGLLDFTYEINHKKKGFYHVVIVEATTQAIKEFERIAKIDKNVVRTLVLNTENIQNYEQSVVLSKTDM-----TKYEE 113
>gi|114328878|ref|YP_746035.1| SSU ribosomal protein S6P [Granulibacter bethesdensis CGDNIH1] >gi|122326173|sp|Q0BPZ0.1|RS6_GRABC 30S ribosomal protein S6 >gi|114317052|gb|ABI63112.1| SSU ribosomal protein S6P [Granulibacter bethesdensis CGDNIH1] (154 aa)
Score = 89, Expect = 2.5e-01, Identities = 26/89 (29%), Positives = 41/89 (46%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQT---EYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +L+    ++ +Q   V +    +L   EG      EY GL+ LAY IKK    HY          +  + +R   +N+ VLR + I +E
  S:     4 YESVLIARNDVTQQQVESVAD-HVASLIEAEGGAIKKREYWGLRTLAYRIKKNRKGHYMLLGLDAKPATITEVERQLRLNEDVLRFMTIRVE 94
>gi|167925660|ref|ZP_02512751.1| 30S ribosomal protein S6 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (137 aa)
Score = 89, Expect = 2.6e-01, Identities = 25/83 (30%), Positives = 40/83 (48%)
  Q:    35 LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDE 117
           L++  LGL +  Y I  +    Y+        Q+ K+F+R A I+K V+R L++N E    Y  S+   K  +      KY+E
  S:    36 LESNDLGLLDFTYEINHKKKGFYHVVIVEATTQAIKEFERIAKIDKNVVRTLVLNTENIQNYEQSVVLSKTDM-----TKYEE 113
>gi|39936140|ref|NP_948416.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris CGA009] >gi|167365543|ref|ZP_02299687.1| ribosomal protein S6 [Rhodopseudomonas palustris TIE-1] >gi|192291858|ref|YP_001992463.1| ribosomal protein S6 [Rhodopseudomonas palustris TIE-1] >gi|61216210|sp|Q6N5A4|RS6_RHOPA 30S ribosomal protein S6 (RRP-S6) >gi|39649994|emb|CAE28518.1| possible 30S ribosomal protein S6 [Rhodopseudomonas palustris CGA009] >gi|192285607|gb|ACF01988.1| ribosomal protein S6 [Rhodopseudomonas palustris TIE-1] (158 aa)
Score = 89, Expect = 2.6e-01, Identities = 24/74 (32%), Positives = 36/74 (48%)
  Q:    18 ANQVNEKQQQTLTNVEGL-----QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           A QV E   Q    +EGL     +TE  GL+ L Y + K   AH+      G      + +R   IN+ V+R L + ++
  S:    16 AQQVEELTTQITGVIEGLGGKVTKTESWGLRSLTYRMNKNRKAHFVLLNIDGPAAVVSEIERQERINEDVIRYLTVRVD 94
>gi|167462795|ref|ZP_02327884.1| 30S ribosomal protein S6 [Paenibacillus larvae subsp. larvae BRL-230010] (70 aa)
Score = 89, Expect = 2.6e-01, Identities = 22/64 (34%), Positives = 36/64 (56%)
  Q:    26 QQTLTNVEGLQTEY--LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
           Q  +TN  G  T++  +G + LAY IKK    HY    F+ + +  K+  R   I+ +++R LI+N
  S:     2 QGIITNNGGEITKHDVMGKRRLAYEIKKFRDGHYVLVNFTAEPEVVKELDRVMKISDEIIRYLIVN 67
>gi|119474661|ref|ZP_01615014.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2143] >gi|119450864|gb|EAW32097.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2143] (145 aa)
Score = 89, Expect = 2.6e-01, Identities = 29/90 (32%), Positives = 40/90 (44%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y II LV    S EQ   + E+  Q +    G   + E  G + LAYPI K   AHY       D ++  +       N  VLR L+I ++
  S:     3 HYEIIFLVHPDQS-EQVPGMVERYTQAIEKNGGKIHRLEDWGRRHLAYPINKIHKAHYTLMNVEADQEAIDELTTNFRYNDAVLRNLVIKMD 93
>gi|54778759|gb|AAV39593.1| ribosomal protein S6 [synthetic construct] (158 aa)
Score = 89, Expect = 2.7e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:    27 HYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 114
>gi|88806419|ref|ZP_01121936.1| 30S ribosomal protein S6 [Robiginitalea biformata HTCC2501] >gi|88783251|gb|EAR14423.1| 30S ribosomal protein S6 [Robiginitalea biformata HTCC2501] (112 aa)
Score = 89, Expect = 2.8e-01, Identities = 22/91 (24%), Positives = 50/91 (54%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y  + +++  LS  Q  +  +K +  LT    + +  E  GLK+LAYPI+ + S  Y+ ++F+   +    +++    +++++R L + L++
  S:     3 HYETVFILNPVLSDTQIEETVKKFENFLTKNGAKMVSKEDWGLKKLAYPIQHKKSGFYHLFEFTAPGEVIGPYEQEFKRDERIMRFLTVKLDK 95
>gi|15640393|ref|NP_230020.1| 30S ribosomal protein S6 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121590972|ref|ZP_01678292.1| ribosomal protein S6 [Vibrio cholerae 2740-80] >gi|121730195|ref|ZP_01682585.1| ribosomal protein S6 [Vibrio cholerae V52] >gi|147675449|ref|YP_001218635.1| 30S ribosomal protein S6 [Vibrio cholerae O395] >gi|153216649|ref|ZP_01950556.1| ribosomal protein S6 [Vibrio cholerae 1587] >gi|153225586|ref|ZP_01954790.1| ribosomal protein S6 [Vibrio cholerae MAK 757] >gi|153820255|ref|ZP_01972922.1| ribosomal protein S6 [Vibrio cholerae NCTC 8457] >gi|153827636|ref|ZP_01980303.1| ribosomal protein S6 [Vibrio cholerae MZO-2] >gi|153830466|ref|ZP_01983133.1| ribosomal protein S6 [Vibrio cholerae 623-39] >gi|194531361|ref|YP_002066820.1| ribosomal protein S6 [Vibrio cholerae MO10] >gi|189045594|sp|A5F3K3.1|RS6_VIBC3 30S ribosomal protein S6 >gi|13959535|sp|Q9KUZ2|RS6_VIBCH 30S ribosomal protein S6 >gi|9654783|gb|AAF93539.1| ribosomal protein S6 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547198|gb|EAX57325.1| ribosomal protein S6 [Vibrio cholerae 2740-80] >gi|121628053|gb|EAX60598.1| ribosomal protein S6 [Vibrio cholerae V52] >gi|124114160|gb|EAY32980.1| ribosomal protein S6 [Vibrio cholerae 1587] >gi|124117275|gb|EAY36018.1| ribosomal protein S6 [Vibrio cholerae MAK 757] >gi|125617289|gb|EAZ45862.1| ribosomal protein S6 [Vibrio cholerae MO10] >gi|126509206|gb|EAZ71800.1| ribosomal protein S6 [Vibrio cholerae NCTC 8457] >gi|146317332|gb|ABQ21871.1| ribosomal protein S6 [Vibrio cholerae O395] >gi|148874068|gb|EDL72203.1| ribosomal protein S6 [Vibrio cholerae 623-39] >gi|149737886|gb|EDM52791.1| ribosomal protein S6 [Vibrio cholerae MZO-2] >gi|150423625|gb|EDN15567.1| ribosomal protein S6 [Vibrio cholerae AM-19226] (122 aa)
Score = 89, Expect = 2.8e-01, Identities = 33/117 (28%), Positives = 50/117 (42%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEI 118
            Y I+ +V    S EQ   + E+   ++T   G   + E  G ++LAYPI K   AHY       D     + +     N  VLR +I+  +      A   P     A ++R K DE+
  S:     3 HYEIVFMVHPDQS-EQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAVVDELETAFRFNDAVLRNMIMRTK-----AAITEPSIMLKAREERVKRDEM 115
>gi|156081732|ref|XP_001608359.1| 30S ribosomal protein S6, puatative [Plasmodium vivax SaI-1] >gi|148800930|gb|EDL42335.1| 30S ribosomal protein S6, puatative [Plasmodium vivax] (243 aa)
Score = 88, Expect = 3.0e-01, Identities = 32/106 (30%), Positives = 51/106 (48%)
  Q:     3 YNIILLVDGSLSL-EQANQVNEKQQQT-LTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASI--NPKKQQLA 108
           YN+ LL   + ++ E   ++ E   +  L + E  +  YLG + L  PIKKQ+ A+Y  + F        + KR   +   VLR ++   E+    LA     P +Q LA
  S:   123 YNVDLLFSCNFTISEIKKKIAEYTYELKLVDGEAFRALYLGKRRLVRPIKKQMEAYYVLFSFQMYPSLIHEIKRKLRLQDAVLRFMVTKNEKTSRNLAYAENEPVRQGLA 232
>gi|50122534|ref|YP_051701.1| 30S ribosomal protein S6 [Pectobacterium atrosepticum SCRI1043] >gi|61215523|sp|Q6D135|RS6_ERWCT 30S ribosomal protein S6 >gi|49613060|emb|CAG76511.1| 30S ribosomal protein S6 [Erwinia carotovora subsp. atroseptica SCRI1043] (130 aa)
Score = 88, Expect = 3.0e-01, Identities = 24/89 (26%), Positives = 42/89 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y I+ +V    S EQ   + E+   T+T  +G   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++ +
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTATITGAQGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRV 92
>gi|103487384|ref|YP_616945.1| 30S ribosomal protein S6 [Sphingopyxis alaskensis RB2256] >gi|122984936|sp|Q1GRW0.1|RS6_SPHAL 30S ribosomal protein S6 >gi|98977461|gb|ABF53612.1| SSU ribosomal protein S6P [Sphingopyxis alaskensis RB2256] (122 aa)
Score = 88, Expect = 3.0e-01, Identities = 27/89 (30%), Positives = 45/89 (50%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG------LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + +    LS  Q + + E    T+T V G       +TE  GLK+LAY I+K    HY         ++  + +R A IN+ ++R + I ++
  S:     4 YEHVFIARQDLSQAQVDALAE----TVTGVIGEYKGQVHKTETWGLKQLAYKIQKNRKGHYVMLSAEVSGEAIAEIERQAAINEDIIRWMTIKVD 94
>gi|71083408|ref|YP_266127.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1062] >gi|91762169|ref|ZP_01264134.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1002] >gi|91207928|sp|Q4FMR5|RS6_PELUB 30S ribosomal protein S6 >gi|71062521|gb|AAZ21524.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1062] >gi|91717971|gb|EAS84621.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1002] (121 aa)
Score = 88, Expect = 3.1e-01, Identities = 28/78 (35%), Positives = 42/78 (53%)
  Q:    17 QANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII-----NLEREY 94
           Q  Q+ EK  + +   EG  +QTE  GL  LAY IKK     Y  +K  G  +   + ++   I+K +LR + +     NLE +Y
  S:    18 QVKQLTEKYSKIVEKNEGEIVQTEDWGLLNLAYIIKKNKKGIYMHFKIKGPGKIIDELEKNEAIDKNLLRYMTVKVKKFNLEAKY 102
>gi|58038781|ref|YP_190745.1| SSU ribosomal protein S6P [Gluconobacter oxydans 621H] >gi|81352549|sp|Q5FU57|RS6_GLUOX 30S ribosomal protein S6 >gi|58001195|gb|AAW60089.1| SSU ribosomal protein S6P [Gluconobacter oxydans 621H] (160 aa)
Score = 88, Expect = 3.1e-01, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    19 NQVNEKQQQTLTNVEGLQT------------EYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           N V++ Q +TL  VE ++T            E+ GL+ LAY IKK    HY          + ++ +R   +N+ VLR L + ++
  S:    12 NDVSQAQVETL--VETIETLLKDNGGSIQKREFWGLRSLAYRIKKNRKGHYVLLGLDCTPDTLRELERQLGLNEDVLRVLTLRVD 94
>gi|170789678|gb|EDT30722.1| 30S ribosomal protein S6 (RRP-S6) [Oligotropha carboxidovorans OM5] (144 aa)
Score = 88, Expect = 3.1e-01, Identities = 23/74 (31%), Positives = 37/74 (50%)
  Q:    18 ANQVNEKQQQTLTNVEGL-----QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           A QV E   Q    +EGL     +TE  G++ L Y I+K   AH+      G      + +R   IN+ ++R L + ++
  S:    16 AQQVEELTTQITGVIEGLGGKVTKTESWGVRSLTYRIQKNRKAHFVLLNIDGPATIVAEVERQERINEDIIRYLTVRVD 94
>gi|40062774|gb|AAR37668.1| ribosomal protein S6 [uncultured marine bacterium 439] (117 aa)
Score = 88, Expect = 3.2e-01, Identities = 29/88 (32%), Positives = 39/88 (44%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
            Y I L+V    S  Q   + EK ++ +T   G   + E  G K LAYPI K   AHY       D ++          N  +LR LII+
  S:     3 HYEITLIVHPDQS-SQVTTMIEKYKEIITTSGGNVHREEDWGRKHLAYPINKIYKAHYLMMNIECDQETLDKLNYNFRFNDAILRNLIIS 91
>gi|168722728|ref|ZP_02755005.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4206] (108 aa)
Score = 88, Expect = 3.3e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|91977453|ref|YP_570112.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris BisB5] >gi|123721764|sp|Q135M8.1|RS6_RHOPS 30S ribosomal protein S6 >gi|91683909|gb|ABE40211.1| SSU ribosomal protein S6P [Rhodopseudomonas palustris BisB5] (160 aa)
Score = 88, Expect = 3.3e-01, Identities = 23/72 (31%), Positives = 36/72 (50%)
  Q:    20 QVNEKQQQTLTNVEGL-----QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           QV E   Q    +EGL     +TE  GL+ L Y + K   AH+      G +    + +R   IN+ ++R L + +E
  S:    18 QVEELTTQITGVIEGLGGKVTKTEAWGLRSLTYRMNKNRKAHFVMLNIDGPSAVVAEVERQERINEDIIRYLTVRVE 94
>gi|87119508|ref|ZP_01075405.1| 30S ribosomal protein S6 [Marinomonas sp. MED121] >gi|86164984|gb|EAQ66252.1| 30S ribosomal protein S6 [Marinomonas sp. MED121] (135 aa)
Score = 88, Expect = 3.3e-01, Identities = 41/154 (26%), Positives = 59/154 (38%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL---GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEE 155
            Y I+ LV    S EQ   + E+    +T  +G Q   L   G ++LAYPI K   AHY             +   T   N  ++R L+I   R  G +  ++P K   + + R                        A  + R  RTE A+ P EE
  S:     3 HYEIVFLVHPDQS-EQVPAMVERYTNLITE-DGGQVHRLEDWGRRQLAYPINKIHKAHYVLMNIEASEAVMSELNDTFRYNDAIIRNLVI---RRKGAVTEVSPIKAAESREDRR-----------------------APREERQERTEAAETPAEE 131
>gi|114568045|ref|YP_755199.1| ribosomal protein S6 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317111|sp|Q0ATX6.1|RS6_SYNWW 30S ribosomal protein S6 >gi|114338980|gb|ABI69828.1| SSU ribosomal protein S6P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (97 aa)
Score = 88, Expect = 3.4e-01, Identities = 24/86 (27%), Positives = 42/86 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL------GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           Y ++ ++   L  EQ  +  E+ Q+ + +  G   E++      G K LAY I   +   Y  W F G  ++  +  R   I++  LR +II
  S:     4 YEMMFVLRPDLEEEQVLETKERLQKIIADFGG---EFINAADGWGKKRLAYAIDDYVEGIYSLWYFKGKPETVDELDRIIKISENFLRHIII 92
>gi|188528036|ref|YP_001910723.1| 30S ribosomal protein S6 [Helicobacter pylori Shi470] >gi|188144276|gb|ACD48693.1| 30S ribosomal protein S6 [Helicobacter pylori Shi470] (142 aa)
Score = 88, Expect = 3.4e-01, Identities = 25/90 (27%), Positives = 45/90 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG-LQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y  + ++  +L  E+     E  ++ +T   G ++T   +G++ LAY IKK    +YY   F  +     + +R   IN+ VLR ++I  E
  S:     3 HYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKANPSMILELERLYRINEDVLRFIVIKYE 94
>gi|85058323|ref|YP_454025.1| 30S ribosomal protein S6 [Sodalis glossinidius str. 'morsitans'] >gi|123520151|sp|Q2NW55.1|RS6_SODGM 30S ribosomal protein S6 >gi|84778843|dbj|BAE73620.1| 30S ribosomal protein S6 [Sodalis glossinidius str. 'morsitans'] (131 aa)
Score = 88, Expect = 3.7e-01, Identities = 26/89 (29%), Positives = 40/89 (44%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
            Y II +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + +     N  V+R +I+ +
  S:     3 HYEIIFMVHPDQS-EQVAGMIERYSALITGAEGQIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEVIDELETVFRFNDAVIRSMIMRV 92
>gi|77163755|ref|YP_342280.1| ribosomal protein S6 [Nitrosococcus oceani ATCC 19707] >gi|91207924|sp|Q3JEJ6|RS6_NITOC 30S ribosomal protein S6 >gi|76882069|gb|ABA56750.1| SSU ribosomal protein S6P [Nitrosococcus oceani ATCC 19707] (156 aa)
Score = 88, Expect = 3.7e-01, Identities = 25/90 (27%), Positives = 44/90 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y ++ LV    S EQ + + ++ +Q +    G   + E  G ++LAYPI+K   AHY         ++ ++       N  VLR+++I  E
  S:     3 HYEVVFLVHPDQS-EQLSAMMDRYRQIIETDGGCIHRLEDWGRRQLAYPIQKLYKAHYVLMNIECTPRTIEELTSAFRFNDAVLRDMVIRRE 93
>gi|86133512|ref|ZP_01052094.1| 30S ribosomal protein S6 [Tenacibaculum sp. MED152] >gi|85820375|gb|EAQ41522.1| 30S ribosomal protein S6 [Polaribacter dokdonensis MED152] (113 aa)
Score = 88, Expect = 3.7e-01, Identities = 25/91 (27%), Positives = 46/91 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTN--VEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
            Y  + +++  LS  Q  +  +K    L +   E +  E  GLK+LAYPI+K+ S  Y+ ++F    +    F+     +  V+R L + L++
  S:     3 HYETVFILNPVLSDTQIKETVQKFNDYLVSKGAEMISKEDWGLKKLAYPIQKKKSGFYHLFEFKIAGEEITAFELEFRRDDSVMRYLTVRLDK 95
>gi|119713692|gb|ABL97742.1| ribosomal protein S6 [uncultured marine bacterium EB0_41B09] (203 aa)
Score = 87, Expect = 3.8e-01, Identities = 26/88 (29%), Positives = 45/88 (51%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
            Y I+ +V    S EQ   + E+ Q+++T  +G   + E  G ++LAYPI+K   AHY         +S  + +     N  V+R L+++
  S:     3 HYEIVFIVHPDQS-EQVPSMIERIQKSVTANKGNIHRLEDWGRRQLAYPIQKIHKAHYVLMNIECSLESLAELEHNFKFNDAVIRHLVVS 91
>gi|152981661|ref|YP_001352991.1| small subunit ribosomal protein S6 [Janthinobacterium sp. Marseille] >gi|166226973|sp|A6SXJ4.1|RS6_JANMA 30S ribosomal protein S6 >gi|151281738|gb|ABR90148.1| small subunit ribosomal protein S6 [Janthinobacterium sp. Marseille] (122 aa)
Score = 87, Expect = 4.0e-01, Identities = 33/127 (25%), Positives = 56/127 (44%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENP 128
            Y I+ +V    S EQ   + E+ +  +T   G+  + E  G +++AY I+K   AHY       D ++  + +     N  VLR L + +++     A   P     A+QK     E  A+ +  E P
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKGIVTARGGVIHRVEDWGRRQMAYMIQKLAKAHYVCLNIECDGETLAEIETGFKFNDAVLRHLTVKMKK-----AETAPSPMMKAVQK-----EDAAKSHRAEAP 120
>gi|116667415|pdb|2GY9|F Chain F, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 >gi|116667467|pdb|2GYB|F Chain F, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 (95 aa)
Score = 87, Expect = 4.1e-01, Identities = 25/87 (28%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         +   + + T   N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVM 90
>gi|119471284|ref|ZP_01613787.1| 30S ribosomal protein S6 [Alteromonadales bacterium TW-7] >gi|119445750|gb|EAW27033.1| 30S ribosomal protein S6 [Alteromonadales bacterium TW-7] (113 aa)
Score = 87, Expect = 4.2e-01, Identities = 27/87 (31%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+   ++T   G   + E  G ++LAYPI K   AHY         +   + + T   N  VLR L+I
  S:     3 HYEIVFMVHPDQS-EQVAGMIERYTGSITEAGGSIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPTEVISELETTFRYNDAVLRNLVI 90
>gi|190891122|ref|YP_001977664.1| 30S ribosomal protein S6 [Rhizobium etli CIAT 652] >gi|190696401|gb|ACE90486.1| 30S ribosomal protein S6 [Rhizobium etli CIAT 652] (152 aa)
Score = 87, Expect = 4.3e-01, Identities = 25/90 (27%), Positives = 43/90 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           Y  + L    +S +Q + + E+ +  +    G   + E  GLK L Y IKK   AHY          + ++ +R   I++ VLR + I +E+
  S:     4 YEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAAIQEMERQMRISEDVLRYMTIAVEK 95
>gi|145588607|ref|YP_001155204.1| 30S ribosomal protein S6 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189045486|sp|A4SVX6.1|RS6_POLSQ 30S ribosomal protein S6 >gi|145047013|gb|ABP33640.1| SSU ribosomal protein S6P [Polynucleobacter sp. QLW-P1DMWA-1] (124 aa)
Score = 87, Expect = 4.3e-01, Identities = 26/87 (29%), Positives = 41/87 (47%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + ++ + TL    G   + E  G +++AY I K   AHY       D ++ ++ +     N  VLR LII
  S:     3 HYEIVFIVHPDQS-EQVPAMIDRYKATLAAAGGKIHRIEDWGRRQMAYMIDKLAKAHYVCMNIECDQKTLEELEHAFKFNDAVLRHLII 90
>gi|73667309|ref|YP_303325.1| 30S ribosomal protein S6 [Ehrlichia canis str. Jake] >gi|91207915|sp|Q3YRC8|RS6_EHRCJ 30S ribosomal protein S6 >gi|72394450|gb|AAZ68727.1| SSU ribosomal protein S6P [Ehrlichia canis str. Jake] (109 aa)
Score = 87, Expect = 4.3e-01, Identities = 21/58 (36%), Positives = 27/58 (46%)
  Q:    31 NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
             E L+ EY GL + AY I K    HY          S  +FKR   +N+ VLR L +
  S:    34 GAELLKYEYWGLLDFAYTIDKMNKGHYCMIYIKATPSSMDEFKRKVRLNEDVLRFLCL 91
>gi|154253798|ref|YP_001414622.1| ribosomal protein S6 [Parvibaculum lavamentivorans DS-1] >gi|189045484|sp|A7HYI2.1|RS6_PARL1 30S ribosomal protein S6 >gi|154157748|gb|ABS64965.1| ribosomal protein S6 [Parvibaculum lavamentivorans DS-1] (155 aa)
Score = 87, Expect = 4.4e-01, Identities = 17/56 (30%), Positives = 30/56 (53%)
  Q:    36 QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           +TEY GL+ LA+ +KK    HY        + +  + +R   I++ VLR + + +E
  S:    39 KTEYWGLRNLAFKVKKNRKGHYTLVNIDAPHAAVAEMERQMGISEDVLRFITVRVE 94
>gi|86357078|ref|YP_468970.1| 30S ribosomal protein S6 [Rhizobium etli CFN 42] >gi|123512430|sp|Q2KA93.1|RS6_RHIEC 30S ribosomal protein S6 >gi|86281180|gb|ABC90243.1| 30S ribosomal protein S6 [Rhizobium etli CFN 42] (152 aa)
Score = 87, Expect = 4.5e-01, Identities = 25/90 (27%), Positives = 43/90 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           Y  + L    +S +Q + + E+ +  +    G   + E  GLK L Y IKK   AHY          + ++ +R   I++ VLR + I +E+
  S:     4 YEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPPAAIQEMERQMRISEDVLRYMTIAVEK 95
>gi|89890854|ref|ZP_01202363.1| 30S ribosomal protein S6 [Flavobacteria bacterium BBFL7] >gi|89516999|gb|EAS19657.1| 30S ribosomal protein S6 [Flavobacteria bacterium BBFL7] (114 aa)
Score = 87, Expect = 4.6e-01, Identities = 25/91 (27%), Positives = 49/91 (53%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTN--VEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           QY  + +++  LS +Q  +  +K +  LT    + +  E  GLK+LAY I+ + S  Y  ++F    +   DF+     +++V+R L + L++
  S:     3 QYETVFILNPVLSDDQVKEAVKKFENFLTTRGAKMVAKEDWGLKKLAYTIENKKSGFYTLFQFEVPGEVINDFEVEFRRDERVMRYLTVKLDK 95
>gi|126739373|ref|ZP_01755066.1| ribosomal protein S6 [Roseobacter sp. SK209-2-6] >gi|126719473|gb|EBA16182.1| ribosomal protein S6 [Roseobacter sp. SK209-2-6] (117 aa)
Score = 87, Expect = 4.8e-01, Identities = 24/89 (26%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    LS  QA  + E     L + EG  + +EY G+K +AY I K    HY   +      + ++ +R   ++  V+R L I ++
  S:     4 YEHVMIARQDLSNSQAEGLIEHFGAVLADNEGKLVDSEYWGVKTMAYKINKNRKGHYSFLRTDASAAAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|87199437|ref|YP_496694.1| 30S ribosomal protein S6 [Novosphingobium aromaticivorans DSM 12444] >gi|123489788|sp|Q2G8G3.1|RS6_NOVAD 30S ribosomal protein S6 >gi|87135118|gb|ABD25860.1| SSU ribosomal protein S6P [Novosphingobium aromaticivorans DSM 12444] (120 aa)
Score = 86, Expect = 5.1e-01, Identities = 26/93 (27%), Positives = 44/93 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL-EREYG 95
           Y  + L    LS  Q + +     + + + EG   +TE  GL+ LAY I+K   AH+          +  + +R   IN+ V+R + + + E E G
  S:     4 YEHVFLARQDLSQAQVDALAAAATEIVESNEGKVTKTETWGLRSLAYKIQKNRKAHFVLLNIEASGATIAELERQTQINEDVIRYMTVRVDEHEAG 99
>gi|109946866|ref|YP_664094.1| 30S ribosomal protein S6 [Helicobacter acinonychis str. Sheeba] >gi|123362772|sp|Q17Z31.1|RS6_HELAH 30S ribosomal protein S6 >gi|109714087|emb|CAJ99095.1| 30S ribosomal protein S6 [Helicobacter acinonychis str. Sheeba] (142 aa)
Score = 86, Expect = 5.1e-01, Identities = 24/87 (27%), Positives = 44/87 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG-LQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y  + ++  +L  E+     E  ++ +T   G ++T   +G++ LAY IKK    +YY   F  +     + +R   IN+ VLR ++I
  S:     3 HYETMFILKPTLVEEEIKSKIEFYKEVITKHNGVIETSLDMGMRNLAYEIKKHKRGYYYVMYFKAEPSMILELERLYRINEDVLRFIVI 91
>gi|84517317|ref|ZP_01004671.1| ribosomal protein S6 [Loktanella vestfoldensis SKA53] >gi|84508797|gb|EAQ05260.1| ribosomal protein S6 [Loktanella vestfoldensis SKA53] (133 aa)
Score = 86, Expect = 5.1e-01, Identities = 25/89 (28%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    LS  QA  + E     L +  G  L+ EY G+K +AY I K    HY   +      + ++ +R   +N+ V+R L I ++
  S:     4 YEHVMIARQDLSNTQAEALIEHFGTILADNGGKLLENEYWGVKTMAYKINKNRKGHYALLRTDAPAPAIQEMERLMRLNEDVMRVLTIKVD 94
>gi|57237952|ref|YP_179201.1| 30S ribosomal protein S6 [Campylobacter jejuni RM1221] >gi|86150512|ref|ZP_01068737.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|148926027|ref|ZP_01809713.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CG8486] >gi|73621847|sp|Q5HU34|RS6_CAMJR 30S ribosomal protein S6 >gi|4376254|emb|CAA76675.1| ribosomal protein S6 [Campylobacter jejuni] >gi|57166756|gb|AAW35535.1| ribosomal protein S6 [Campylobacter jejuni RM1221] >gi|85839107|gb|EAQ56371.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|145845506|gb|EDK22598.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CG8486] (125 aa)
Score = 86, Expect = 5.1e-01, Identities = 25/90 (27%), Positives = 46/90 (51%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT-NVEGLQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y ++ ++  +L+ E+ N   E  ++ LT N   ++T   +G ++LAY IKK     Y+   F        + +R   I ++V+R LI+  E
  S:     3 HYEVLFILKPTLTEEEVNAKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|108803691|ref|YP_643628.1| SSU ribosomal protein S6P [Rubrobacter xylanophilus DSM 9941] >gi|108764934|gb|ABG03816.1| ribosomal protein S6 [Rubrobacter xylanophilus DSM 9941] (147 aa)
Score = 86, Expect = 5.2e-01, Identities = 21/88 (23%), Positives = 44/88 (50%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG---LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           Y ++L++   L  EQ      + +  +    G    +  + G ++LAY I  +  A+Y   +F+  +++  + KR   ++  VLR +I+ L
  S:    38 YEVMLIIIPELDEEQVQSTVSRFRTVIERTGGEVVGEPNHWGKRKLAYEIDHRSDAYYVVMEFTAGDRTLVELKRILRVSDDVLRHMIVKL 128
>gi|194366362|ref|YP_002028972.1| ribosomal protein S6 [Stenotrophomonas maltophilia R551-3] >gi|194349166|gb|ACF52289.1| ribosomal protein S6 [Stenotrophomonas maltophilia R551-3] (145 aa)
Score = 86, Expect = 5.3e-01, Identities = 26/87 (29%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+ +  + N  G   + E  G ++LAYPI+  + AHY       D     +   +   N  VLR L+I
  S:     4 HYEIVFMVHPDQS-EQVPAMIERYKSLVENGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEADQAVLNELTESFRFNDAVLRNLVI 91
>gi|15792395|ref|NP_282218.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|9297123|sp|Q9ZAH3|RS6_CAMJE 30S ribosomal protein S6 >gi|112360390|emb|CAL35187.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni NCTC 11168] (125 aa)
Score = 86, Expect = 5.3e-01, Identities = 25/90 (27%), Positives = 46/90 (51%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT-NVEGLQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y ++ ++  +L+ E+ N   E  ++ LT N   ++T   +G ++LAY IKK     Y+   F        + +R   I ++V+R LI+  E
  S:     3 HYEVLFILKPTLTEEEVNTKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|86151148|ref|ZP_01069364.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86152790|ref|ZP_01070995.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121612432|ref|YP_001000748.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81-176] >gi|153951510|ref|YP_001397814.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. doylei 269.97] >gi|157415331|ref|YP_001482587.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005668|ref|ZP_02271426.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81-176] >gi|166226817|sp|A7H2T4.1|RS6_CAMJD 30S ribosomal protein S6 >gi|166226818|sp|A1W057.1|RS6_CAMJJ 30S ribosomal protein S6 >gi|189045458|sp|A8FMC3.1|RS6_CAMJ8 30S ribosomal protein S6 >gi|85842318|gb|EAQ59564.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843675|gb|EAQ60885.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249295|gb|EAQ72256.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81-176] >gi|152938956|gb|ABS43697.1| ribosomal protein S6 [Campylobacter jejuni subsp. doylei 269.97] >gi|157386295|gb|ABV52610.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81116] (125 aa)
Score = 86, Expect = 5.3e-01, Identities = 25/90 (27%), Positives = 45/90 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY---LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
            Y ++ ++  +L+ E+ N   E  ++ LT   G + E    +G ++LAY IKK     Y+   F        + +R   I ++V+R LI+  E
  S:     3 HYEVLFILKPTLTEEEVNAKLEFVKEVLTK-NGAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|84684849|ref|ZP_01012749.1| Ribosomal protein S6 [Rhodobacterales bacterium HTCC2654] >gi|84667184|gb|EAQ13654.1| Ribosomal protein S6 [Rhodobacterales bacterium HTCC2654] (121 aa)
Score = 86, Expect = 5.3e-01, Identities = 24/89 (26%), Positives = 44/89 (49%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    LS  QA  + E     L++  G  + +EY G+K +AY I K    HY   K    + + ++ +R   ++  V+R L I ++
  S:     4 YEHVMIARQDLSNAQAEGLVEHFSTVLSDNGGKVVDSEYWGVKTMAYKINKNRKGHYAFLKTDAPSTAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|121601858|ref|YP_988809.1| 30S ribosomal protein S6 [Bartonella bacilliformis KC583] >gi|166226802|sp|A1US56.1|RS6_BARBK 30S ribosomal protein S6 >gi|120614035|gb|ABM44636.1| ribosomal protein S6 [Bartonella bacilliformis KC583] (136 aa)
Score = 86, Expect = 5.3e-01, Identities = 25/93 (26%), Positives = 42/93 (45%)
  Q:    36 QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNPENP 128
           +TE  GL+ LAY I+K   AHY          +  + +R   IN+ +LR + I +E+          +K+Q A+  R   D+   ++     P
  S:    39 RTENWGLRSLAYRIRKNRKAHYVLINIDAPAAAIAEMERQMRINEDILRYITIRVEKH---------EKEQSAMLSRPDRDDFPGKDEERPRP 122
>gi|119776196|ref|YP_928936.1| 30S ribosomal protein S6 [Shewanella amazonensis SB2B] >gi|166227380|sp|A1SA60.1|RS6_SHEAM 30S ribosomal protein S6 >gi|119768696|gb|ABM01267.1| ribosomal protein S6 [Shewanella amazonensis SB2B] (135 aa)
Score = 86, Expect = 5.3e-01, Identities = 27/101 (26%), Positives = 46/101 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINP 102
            Y I+ +V    S EQ   + E+    +T+  G   + E  G ++LAYPI+    AHY         +S ++ +     N  VLR +++   R  G +   +P
  S:     3 HYEIVFMVHPDQS-EQVAGMIERYTGVITDANGKIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEATAESVEELETAFRFNDAVLRSMVM---RTKGAITEASP 101
>gi|90416566|ref|ZP_01224497.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2207] >gi|90331765|gb|EAS46993.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2207] (153 aa)
Score = 86, Expect = 5.6e-01, Identities = 27/87 (31%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ LV    S EQ + + E+   ++   EG   + E  G ++LAYPI K   AHY         +   +   T   N  VLR L++
  S:     3 HYEIVFLVHPDQS-EQVSGMIERYTASIEAGEGKVHRMEDWGRRQLAYPINKIHKAHYILMNVECSQEVLDELSSTFRYNDAVLRSLVV 90
>gi|163797516|ref|ZP_02191467.1| Ribosomal protein S6 [alpha proteobacterium BAL199] >gi|159177265|gb|EDP61824.1| Ribosomal protein S6 [alpha proteobacterium BAL199] (158 aa)
Score = 86, Expect = 5.6e-01, Identities = 23/89 (25%), Positives = 42/89 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + +    +S  Q  Q+ E+  + +    G   + EY GL+ LAY IKK    HY  +       +  + +R   +N+ +LR L + ++
  S:     4 YESVFIARQDISSTQVEQLIEQFAEIVATGGGEVKKREYWGLRSLAYRIKKNRKGHYVLFNLDAPAAAVSEMERLMRLNEDILRYLTVKVD 94
>gi|86138736|ref|ZP_01057308.1| ribosomal protein S6 [Roseobacter sp. MED193] >gi|85824383|gb|EAQ44586.1| ribosomal protein S6 [Roseobacter sp. MED193] (117 aa)
Score = 86, Expect = 6.0e-01, Identities = 24/89 (26%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +++    LS  QA  + E     L + EG  + +EY G+K +AY I K    HY   +      + ++ +R   ++  V+R L I ++
  S:     4 YEHVMIARQDLSNSQAEGLVEHFGAVLADNEGKLVDSEYWGVKTMAYKINKNRKGHYAFLRTDAPAAAIQEMERLMRLHDDVMRVLTIKVD 94
>gi|148244752|ref|YP_001219446.1| 30S ribosomal protein S6 [Candidatus Vesicomyosocius okutanii HA] >gi|166227401|sp|A5CWD9.1|RS6_VESOH 30S ribosomal protein S6 >gi|146326579|dbj|BAF61722.1| 30S ribosomal protein S6 [Candidatus Vesicomyosocius okutanii HA] (113 aa)
Score = 86, Expect = 6.3e-01, Identities = 27/88 (30%), Positives = 40/88 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQT---EYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
            Y I L+V    S +    +++ ++  + N +G +    E  G K LAYPIKK   AHY       D +           N  +LR LII+
  S:     3 HYEITLIVHPDQSAQVGTMMDKYKE--IINADGGKIHKEEDWGRKHLAYPIKKIYKAHYLMMNIECDQEMLDKLNYNFRFNDAILRSLIIS 91
>gi|150002621|ref|YP_001297365.1| 30S ribosomal protein S6 [Bacteroides vulgatus ATCC 8482] >gi|166226801|sp|A6KWD7.1|RS6_BACV8 30S ribosomal protein S6 >gi|149931045|gb|ABR37743.1| 30S ribosomal protein S6 [Bacteroides vulgatus ATCC 8482] (114 aa)
Score = 85, Expect = 6.7e-01, Identities = 26/91 (28%), Positives = 47/91 (51%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           QY  + ++   LS  Q  +  EK +  LT    E +  E  GLK+LAYPI+K+ +  Y   +F  + Q  +  +     +++V+R L   +++
  S:     3 QYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEFKAEPQVIEKLEINFRRDERVIRFLTFKMDK 95
>gi|146310036|ref|YP_001175110.1| 30S ribosomal protein S6 [Enterobacter sp. 638] >gi|167011246|sp|A4W5S9.1|RS6_ENT38 30S ribosomal protein S6 >gi|145316912|gb|ABP59059.1| SSU ribosomal protein S6P [Enterobacter sp. 638] (131 aa)
Score = 85, Expect = 6.8e-01, Identities = 24/87 (27%), Positives = 40/87 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+    +T  EG   + E  G ++LAYPI K   AHY         ++  + +     N  V+R +++
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTGAITAAEGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVM 90
>gi|119513487|ref|ZP_01632511.1| Ribosomal protein S6 [Nodularia spumigena CCY9414] >gi|119461867|gb|EAW42880.1| Ribosomal protein S6 [Nodularia spumigena CCY9414] (113 aa)
Score = 85, Expect = 6.8e-01, Identities = 25/86 (29%), Positives = 41/86 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           Y  I ++   L  EQ  Q   K Q  LT    E ++ +  G + LAY IKK     Y +  ++G   +    +R   ++++V+R L I
  S:     5 YETIYILRPDLGEEQVEQAIAKYQGLLTEQGAENIEIQNRGKRRLAYEIKKHRDGIYVQMNYTGPGTAIAPMERAMRLSEEVIRYLTI 92
>gi|78188077|ref|YP_378415.1| 30S ribosomal protein S6 [Chlorobium chlorochromatii CaD3] >gi|91207907|sp|Q3ANR5|RS6_CHLCH 30S ribosomal protein S6 >gi|78170276|gb|ABB27372.1| SSU ribosomal protein S6P [Chlorobium chlorochromatii CaD3] (132 aa)
Score = 85, Expect = 7.1e-01, Identities = 25/88 (28%), Positives = 40/88 (45%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYL--GLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL 90
           Y    ++DG L  E         Q+ +T   G     L  G ++ AYPIKK+   +Y   +F+       + +R     +++LR LII L
  S:     7 YECTAIIDGGLQDEAVAATLAMVQRVITEKGGTINSVLDLGRRKTAYPIKKKSMGYYVHIEFNAAAPVIAEIERVLRYEEELLRYLIIQL 96
>gi|68171813|ref|ZP_00545151.1| Ribosomal protein S6 [Ehrlichia chaffeensis str. Sapulpa] >gi|88658444|ref|YP_507129.1| 30S ribosomal protein S6 [Ehrlichia chaffeensis str. Arkansas] >gi|123493682|sp|Q2GHF4.1|RS6_EHRCR 30S ribosomal protein S6 >gi|67998762|gb|EAM85476.1| Ribosomal protein S6 [Ehrlichia chaffeensis str. Sapulpa] >gi|88599901|gb|ABD45370.1| ribosomal protein S6 [Ehrlichia chaffeensis str. Arkansas] (109 aa)
Score = 85, Expect = 7.2e-01, Identities = 20/58 (34%), Positives = 27/58 (46%)
  Q:    31 NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
             E L+ EY GL + AY I K    HY          S  +FKR   +N+ +LR L +
  S:    34 GAELLKYEYWGLLDFAYTIDKMNKGHYCMIYIKATPSSMDEFKRKVRLNEDILRFLCL 91
>gi|15829082|ref|NP_326442.1| 30S ribosomal protein S6 [Mycoplasma pulmonis UAB CTIP] >gi|24212329|sp|Q98PV8|RS6_MYCPU 30S ribosomal protein S6 >gi|14090026|emb|CAC13784.1| 30S RIBOSOMAL PROTEIN S6 [Mycoplasma pulmonis] (150 aa)
Score = 85, Expect = 7.6e-01, Identities = 30/94 (31%), Positives = 47/94 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKF-SGDNQSTKDFKRTANINKQVLRELIINLEREYG 95
           +Y I++++D + ++E+A  + +   ++   VE    E L   +LAY I K   A Y      S   +   +F R ANI K   R +IINL  E G
  S:     3 KYEIVIMLDPAENIEKAQSLLKSTFKS--GVEKF--EKLEFTKLAYEINKSKVAQYVLAIVNSQGKEEINEFVRKANITKTFWRHMIINLTSEKG 93
>gi|163764984|ref|ZP_02172033.1| IstB domain protein ATP-binding protein [Bacillus selenitireducens MLS10] >gi|160354522|gb|EDP81186.1| IstB domain protein ATP-binding protein [Bacillus selenitireducens MLS10] (95 aa)
Score = 85, Expect = 7.8e-01, Identities = 23/87 (26%), Positives = 44/87 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTN--VEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           +Y I+ +V   L  +   +  E+    LTN   E  +T+ +G + LAY I+      Y   + + +  +  +F R ++IN  +LR +I+
  S:     3 KYEIMYIVRPDLEEQAVKETVERFNTILTNNGAELTETKEMGKRRLAYEIEDFTDGFYVLIQLNANKDALDEFNRLSSINDNILRSIIV 91
>gi|126701291|ref|YP_001090188.1| 30S ribosomal protein S6 [Clostridium difficile 630] >gi|145952500|ref|ZP_01801510.1| hypothetical protein CdifQ_04004251 [Clostridium difficile QCD-32g58] >gi|168695979|ref|ZP_02728256.1| 30S ribosomal protein S6 [Clostridium difficile QCD-37x79] >gi|168714873|ref|ZP_02747150.1| 30S ribosomal protein S6 [Clostridium difficile QCD-63q42] >gi|168724956|ref|ZP_02757233.1| 30S ribosomal protein S6 [Clostridium difficile QCD-76w55] >gi|168732192|ref|ZP_02764469.1| 30S ribosomal protein S6 [Clostridium difficile QCD-97b34] >gi|196124287|ref|ZP_03116036.1| 30S ribosomal protein S6 [Clostridium difficile ATCC 43255] >gi|196160203|ref|ZP_03120764.1| 30S ribosomal protein S6 [Clostridium difficile CIP 107932] >gi|196163201|ref|ZP_03123732.1| 30S ribosomal protein S6 [Clostridium difficile QCD-23m63] >gi|123066511|sp|Q181R5.1|RS6_CLOD6 30S ribosomal protein S6 >gi|115252728|emb|CAJ70572.1| 30S ribosomal protein S6 [Clostridium difficile 630] (92 aa)
Score = 85, Expect = 7.8e-01, Identities = 20/68 (29%), Positives = 34/68 (50%)
  Q:    21 VNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
           +N+ ++   T+ E ++ +  G K+LAYPI K     Y    F       K+  R   IN+ V+R +I+
  S:    23 LNKVKEVVATDGEIVKVDTWGTKKLAYPIAKFTEGFYVLVNFKSAVDVPKEIDRNLKINENVIRHMIV 90
>gi|169824838|ref|YP_001692449.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 29328] >gi|167831643|dbj|BAG08559.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 29328] (95 aa)
Score = 85, Expect = 8.0e-01, Identities = 24/90 (26%), Positives = 45/90 (50%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEY-LGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           +Y ++L+    LS E  N V  + QQ +     L+  +  G ++LAY I      +YY   F  D Q  K+ +R   +  Q++R +++ ++
  S:     3 KYELVLIFKPELSEEDRNTVFSRIQQVIDENGKLEEVHDWGKRKLAYEINYIKEGYYYIVNFDLDPQFVKEIERRCRLFDQIIRYMVVRVD 93
>gi|169198563|ref|ZP_02857872.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169087692|gb|EDS67407.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM2304] (155 aa)
Score = 85, Expect = 8.1e-01, Identities = 25/90 (27%), Positives = 43/90 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           Y  + L    +S +Q + + E+ +  +    G   + E  GLK L Y IKK   AHY          + ++ +R   I++ VLR + I +E+
  S:     4 YEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAAVQEMERQMRISEDVLRYMTIAVEK 95
>gi|116251321|ref|YP_767159.1| 30S ribosomal protein S6 [Rhizobium leguminosarum bv. viciae 3841] >gi|167358798|ref|ZP_02293448.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|166227372|sp|Q1MJ10.1|RS6_RHIL3 30S ribosomal protein S6 >gi|115255969|emb|CAK07050.1| putative 30S ribosomal protein S6 [Rhizobium leguminosarum bv. viciae 3841] >gi|167074309|gb|EDR78135.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM1325] (155 aa)
Score = 85, Expect = 8.1e-01, Identities = 25/90 (27%), Positives = 43/90 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           Y  + L    +S +Q + + E+ +  +    G   + E  GLK L Y IKK   AHY          + ++ +R   I++ VLR + I +E+
  S:     4 YEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAAVQEMERQMRISEDVLRYMTIAVEK 95
>gi|114768973|ref|ZP_01446599.1| Ribosomal protein S6 [alpha proteobacterium HTCC2255] >gi|114549890|gb|EAU52771.1| Ribosomal protein S6 [alpha proteobacterium HTCC2255] (119 aa)
Score = 85, Expect = 8.1e-01, Identities = 28/91 (30%), Positives = 45/91 (49%)
  Q:    13 LSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL-EREYGYLASINPK 103
           LS  QA  + E     L++ +G  +  EY GLK +AY I K    HY   K    + + ++ +R   +++ V+R + I + E E G    I  K
  S:    14 LSNAQAEGLIEHFSAVLSDNDGKVIDQEYWGLKTMAYKINKNRKGHYAFLKSDAPSSAVQEMERLMRLHEDVMRVMTIRVDEHEEGPSVVIQAK 107
>gi|16272491|ref|NP_438705.1| 30S ribosomal protein S6 [Haemophilus influenzae Rd KW20] >gi|42629995|ref|ZP_00155540.1| COG0360: Ribosomal protein S6 [Haemophilus influenzae R2846] >gi|53733320|ref|ZP_00156367.2| COG0360: Ribosomal protein S6 [Haemophilus influenzae R2866] >gi|68249144|ref|YP_248256.1| 30S ribosomal protein S6 [Haemophilus influenzae 86-028NP] >gi|145628928|ref|ZP_01784728.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.1-21] >gi|145630272|ref|ZP_01786053.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.4-21] >gi|145633501|ref|ZP_01789230.1| 30S ribosomal protein S6 [Haemophilus influenzae 3655] >gi|145635372|ref|ZP_01791074.1| 30S ribosomal protein S6 [Haemophilus influenzae PittAA] >gi|145637412|ref|ZP_01793071.1| 30S ribosomal protein S6 [Haemophilus influenzae PittHH] >gi|145638543|ref|ZP_01794152.1| 30S ribosomal protein S6 [Haemophilus influenzae PittII] >gi|145640520|ref|ZP_01796104.1| 30S ribosomal protein S6 [Haemophilus influenzae R3021] >gi|148827738|ref|YP_001292491.1| 30S ribosomal protein S6 [Haemophilus influenzae PittGG] >gi|166226970|sp|A5UH52.1|RS6_HAEIG 30S ribosomal protein S6 >gi|1173270|sp|P44375|RS6_HAEIN 30S ribosomal protein S6 >gi|81336449|sp|Q4QN01|RS6_HAEI8 30S ribosomal protein S6 >gi|1573532|gb|AAC22205.1| ribosomal protein S6 (rpS6) [Haemophilus influenzae Rd KW20] >gi|68057343|gb|AAX87596.1| 30S ribosomal protein S6 [Haemophilus influenzae 86-028NP] >gi|144979398|gb|EDJ89084.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.1-21] >gi|144984007|gb|EDJ91444.1| 30S ribosomal protein S6 [Haemophilus influenzae R3021] >gi|144985870|gb|EDJ92478.1| 30S ribosomal protein S6 [Haemophilus influenzae 3655] >gi|145267378|gb|EDK07380.1| 30S ribosomal protein S6 [Haemophilus influenzae PittAA] >gi|145269358|gb|EDK09302.1| 30S ribosomal protein S6 [Haemophilus influenzae PittHH] >gi|145272138|gb|EDK12046.1| 30S ribosomal protein S6 [Haemophilus influenzae PittII] >gi|145275106|gb|EDK14968.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.4-21] >gi|148718980|gb|ABR00108.1| 30S ribosomal protein S6 [Haemophilus influenzae PittGG] (125 aa)
Score = 85, Expect = 8.2e-01, Identities = 27/88 (30%), Positives = 40/88 (45%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
            Y I+ +V    S EQ   + E+   ++    G   + E  G ++LAYPI K   AHY         Q   + + T   N  VLR L+I+
  S:     3 HYEIVFMVHPDQS-EQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQQVIDELETTFRYNDAVLRSLVIH 91
>gi|83319327|ref|YP_424022.1| 30S ribosomal protein S6 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|91207919|sp|Q2ST91|RS6_MYCCT 30S ribosomal protein S6 >gi|83283213|gb|ABC01145.1| 30S ribosomal protein S6 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (137 aa)
Score = 84, Expect = 8.5e-01, Identities = 18/55 (32%), Positives = 30/55 (54%)
  Q:    35 LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIIN 89
           L++  LGL +  Y I  +    Y+        Q+ K+F+R A I+K V+R L++N
  S:    36 LESNDLGLLDFTYEINHKKKGFYHIVIVQATTQAIKEFERIAKIDKNVVRTLVLN 90
>gi|110634266|ref|YP_674474.1| 30S ribosomal protein S6 [Mesorhizobium sp. BNC1] >gi|123162195|sp|Q11H16.1|RS6_MESSB 30S ribosomal protein S6 >gi|110285250|gb|ABG63309.1| SSU ribosomal protein S6P [Mesorhizobium sp. BNC1] (148 aa)
Score = 84, Expect = 8.6e-01, Identities = 24/89 (26%), Positives = 45/89 (50%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  + L    LS +Q + + E+ +  + +  G   + E  G+K LAY IKK   A++         ++ K+ +R   I++ +LR + I +E
  S:     4 YEHVFLARQDLSAQQVDALVEQYKGVIESGGGKVGRIENWGVKSLAYRIKKNRKAYFTLMDLDAPAEAVKEMERQMGISEDILRFMTIRVE 94
>gi|182704443|ref|ZP_02956851.1| ribosomal protein S6 [Methylocella silvestris BL2] >gi|172066493|gb|EDT52621.1| ribosomal protein S6 [Methylocella silvestris BL2] (123 aa)
Score = 84, Expect = 8.8e-01, Identities = 24/82 (29%), Positives = 42/82 (51%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLR 84
           Y  I L    +S +Q   + E+ +  + ++ G   + EY G+K LAY IKK   AH+          +  + +R +++N+ VLR
  S:    39 YEHIYLARQDVSAQQVETLTEQFRGIIESLGGKIEKVEYWGVKTLAYRIKKNRKAHFTLLNIDAPAAAITEMERQSSLNEDVLR 122
>gi|94497410|ref|ZP_01303980.1| ribosomal protein S6 [Sphingomonas sp. SKA58] >gi|94423041|gb|EAT08072.1| ribosomal protein S6 [Sphingomonas sp. SKA58] (141 aa)
Score = 84, Expect = 9.1e-01, Identities = 27/104 (25%), Positives = 49/104 (47%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL-EREYGYLASINPKKQQ 106
           Y  + L    L+  Q + + E   + + +++G   + E  GL+ LAY I K   AHY             + +R   IN+ ++R + + + E E G   S+  +KQ+
  S:     4 YEHVFLARQDLAQAQVDALAETATKIVEDMDGKVTKVETWGLRSLAYKIAKNRKAHYVMLNIDAPAGVVAELERQTQINEDIIRYMTVKVDELETG--PSVMMRKQE 108
>gi|83749659|ref|ZP_00946640.1| SSU ribosomal protein S6P [Ralstonia solanacearum UW551] >gi|153886808|ref|ZP_02007962.1| ribosomal protein S6 [Ralstonia pickettii 12D] >gi|187928271|ref|YP_001898758.1| ribosomal protein S6 [Ralstonia pickettii 12J] >gi|83723661|gb|EAP70858.1| SSU ribosomal protein S6P [Ralstonia solanacearum UW551] >gi|151576982|gb|EDN41384.1| ribosomal protein S6 [Ralstonia pickettii 12D] >gi|187725161|gb|ACD26326.1| ribosomal protein S6 [Ralstonia pickettii 12J] (122 aa)
Score = 84, Expect = 9.2e-01, Identities = 26/87 (29%), Positives = 42/87 (48%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELII 88
            Y I+ +V    S EQ   + E+ + T+T+  G   + E  G ++LAY I+K   AHY         ++  + +     N  VLR LI+
  S:     3 HYEIVFIVHPDQS-EQVPAMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHYVCLNIECGKETLAELEHAFKFNDAVLRHLIV 90
>gi|166363872|ref|YP_001656145.1| 30S ribosomal protein S6 [Microcystis aeruginosa NIES-843] >gi|166086245|dbj|BAG00953.1| 30S ribosomal protein S6 [Microcystis aeruginosa NIES-843] (129 aa)
Score = 84, Expect = 9.3e-01, Identities = 25/100 (25%), Positives = 46/100 (46%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLT--NVEGLQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINP 102
           Y  + ++   L  E   Q  E+ +  +T  +   +Q +  G K LAYPIKK     Y +  +    +     +R   ++ +V+R L + L+R     A ++P
  S:     5 YETLYILRPDLGEEVVQQQVERYRTLITEHSATDIQVKVWGKKRLAYPIKKLNDGVYVQMNYQASGKQVAPMERAMRLSDEVIRYLTLKLDRVVAPPADLSP 106
>gi|86749584|ref|YP_486080.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris HaA2] >gi|123098719|sp|Q2IX91.1|RS6_RHOP2 30S ribosomal protein S6 >gi|86572612|gb|ABD07169.1| SSU ribosomal protein S6P [Rhodopseudomonas palustris HaA2] (159 aa)
Score = 84, Expect = 9.4e-01, Identities = 22/72 (30%), Positives = 36/72 (50%)
  Q:    20 QVNEKQQQTLTNVEGL-----QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           QV E   Q    +EGL     +TE  GL+ L Y + K   AH+      G +    + +R   IN+ ++R L + ++
  S:    18 QVEELTTQITGVIEGLGGKVTKTEAWGLRSLTYRMNKNRKAHFVLLNIDGPSAVVSEIERQERINEDIVRYLTVRVD 94
>gi|168183706|ref|ZP_02618370.1| ribosomal protein S6 [Clostridium botulinum Bf] >gi|182673234|gb|EDT85195.1| ribosomal protein S6 [Clostridium botulinum Bf] (94 aa)
Score = 84, Expect = 9.5e-01, Identities = 24/90 (26%), Positives = 42/90 (46%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           +Y  + +++ +L  E      EK +  + N  G     +  G ++LAY +KK    +Y    F+ D +  K+  R   I   V+R +II  E
  S:     3 KYETVFILNPALDEEGYKANVEKFKSVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTELPKELDRVFRITDTVIRHMIITQE 94
>gi|69933099|ref|ZP_00628301.1| Ribosomal protein S6 [Paracoccus denitrificans PD1222] >gi|119383642|ref|YP_914698.1| 30S ribosomal protein S6 [Paracoccus denitrificans PD1222] >gi|166227360|sp|A1B0F8.1|RS6_PARDP 30S ribosomal protein S6 >gi|119373409|gb|ABL69002.1| SSU ribosomal protein S6P [Paracoccus denitrificans PD1222] (131 aa)
Score = 84, Expect = 9.6e-01, Identities = 23/89 (25%), Positives = 43/89 (48%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLE 91
           Y  +L+    LS  QA  + E     + +  G  +  EY G++ LAY I K    HY   +    + + ++ +R A ++  V+R L + ++
  S:     4 YEHVLIARQDLSNAQAEGLIEHFSTVIADNGGKVVDNEYWGVRTLAYKINKNRKGHYAYLRSDAPSAAVQEMERLARLHDDVMRVLTVRVD 94
>gi|119502818|ref|ZP_01624903.1| Na+/solute symporter [marine gamma proteobacterium HTCC2080] >gi|119461164|gb|EAW42254.1| Na+/solute symporter [marine gamma proteobacterium HTCC2080] (151 aa)
Score = 84, Expect = 9.8e-01, Identities = 33/124 (26%), Positives = 58/124 (46%)
  Q:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGL--QTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEIIARENNP 125
            Y ++ +V    S EQ   + E+    +T   G   + E  G ++LAY I K   AHY        N++ ++   T   N  V+R L+I  + E     S+  K ++   +++++Y E  A E+ P
  S:     3 HYEVVFMVHPDQS-EQVPGMIERYSAVITKDGGTVHRLEDWGRRQLAYHINKVHKAHYILMNVEASNEAMEELSTTFRYNDAVIRNLVIRRD-ELVAEESLIMKAEKEDRERKSRYQERQAAESKP 126
>gi|146277395|ref|YP_001167554.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides ATCC 17025] >gi|166227374|sp|A4WS85.1|RS6_RHOS5 30S ribosomal protein S6 >gi|145555636|gb|ABP70249.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides ATCC 17025] (132 aa)
Score = 84, Expect = 9.9e-01, Identities = 24/90 (26%), Positives = 42/90 (46%)
  Q:     3 YNIILLVDGSLSLEQANQVNEKQQQTLTNVEG--LQTEYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLER 92
           Y  + +    LS  QA  + E     L +  G  +  EY G+K +AY I K    HY   K    + + ++ +R   ++  V+R L I +++
  S:     4 YEHVFISRQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLKSDAPSAAVQEMERLMRLHDDVMRVLTIKVDK 95