>gi|13507968|ref|NP_109917.1| single-stranded DNA binding protein [Mycoplasma pneumoniae M129] >gi|2500889|sp|P75542|SSB_MYCPN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|1674304|gb|AAB96250.1| single-stranded DNA binding protein [Mycoplasma pneumoniae M129] (166 aa)
Score = 864, Expect = 1.7e-91, Identities = 166/166 (100%), Positives = 166/166 (100%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEESDDE 166
           MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEESDDE
  S:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEESDDE 166
>gi|12044943|ref|NP_072753.1| single-strand binding protein family [Mycoplasma genitalium G37] >gi|1351118|sp|P47337|SSB_MYCGE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|3844678|gb|AAC71309.1| single-strand binding protein family [Mycoplasma genitalium G37] >gi|166079024|gb|ABY79642.1| single-strand DNA-binding protein [synthetic Mycoplasma genitalium JCVI-1.0] (160 aa)
Score = 514, Expect = 6.3e-51, Identities = 96/165 (58%), Positives = 126/165 (76%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEESDD 165
           MNRVFLFGKLSF PN+LQT+   +GA+FS+ C+DSSGFN++KS+IR+TAWGKVASF++   PG  +FVEGRL+TYK+ N  +    K TYALQV ADK++ PDE+ + E+P+ K+TV+DSPF+  K + TE E  QAFP   + + ++I PI  ND QLEEESDD
  S:     1 MNRVFLFGKLSFTPNRLQTKNGTLGATFSMECLDSSGFNNAKSFIRVTAWGKVASFIVAQNPGVMLFVEGRLTTYKITNSEN----KNTYALQVTADKIFHPDEKTTNEEPI-KSTVVDSPFMNPKASVTEAEFEQAFPHQDETDFNNITPIFENDVQLEEESDD 160
>gi|474074|emb|CAA83579.1| puative 19 kDa protein [Mycoplasma pneumoniae] (76 aa)
Score = 377, Expect = 5.4e-35, Identities = 75/75 (100%), Positives = 75/75 (100%)
  Q:    83 DPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDS 157
           DPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDS
  S:     1 DPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDS 75
>gi|13358117|ref|NP_078391.1| single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761966|ref|YP_001752637.1| single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920309|ref|ZP_02931656.1| single-strand binding protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508675|ref|ZP_02958168.1| single-strand binding protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701773|ref|ZP_02971453.1| single-strand binding protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|37999466|sp|Q9PPT7|SSB_UREPA Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|11357053|pir||B82875 single-strand binding protein UU553 [imported] - Ureaplasma urealyticum >gi|6899559|gb|AAF30966.1|AE002154_2 single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827543|gb|ACA32805.1| single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902724|gb|EDT49013.1| single-strand binding protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676146|gb|EDT88051.1| single-strand binding protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701048|gb|EDU19330.1| single-strand binding protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (166 aa)
Score = 139, Expect = 2.1e-07, Identities = 35/99 (35%), Positives = 55/99 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MN+V L G L  DP   Q  +  +  +F++A  D++  N + ++IR  AW   A+F+ T LK GD++ +EGR+ +        D N K  Y  +V AD+V
  S:     1 MNKVILIGNLVRDPEARQIPSGRLVTNFTIAVNDNTP-NANANFIRCVAWNNQANFLTTYLKKGDAIAIEGRIVSRSY----VDNNGKTNYVTEVYADQV 95
>gi|171920641|ref|ZP_02931881.1| single-strand binding protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179096|ref|ZP_02964827.1| single-strand binding protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024030|ref|ZP_02996788.1| single-strand binding protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039211|ref|ZP_02998020.1| single-strand binding protein [Ureaplasma urealyticum serovar 8] >gi|188518377|ref|ZP_03003883.1| single-strand binding protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524268|ref|ZP_03004312.1| single-strand binding protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530629|ref|ZP_03004977.1| single-strand binding protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568878|ref|ZP_03005594.1| single-strand binding protein [Ureaplasma urealyticum serovar 2] >gi|188592694|ref|ZP_03005984.1| single-strand binding protein [Ureaplasma urealyticum serovar 10] >gi|195867997|ref|ZP_03079993.1| single-strand binding protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903369|gb|EDT49658.1| single-strand binding protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208990|gb|EDU06033.1| single-strand binding protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019059|gb|EDU57099.1| single-strand binding protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998177|gb|EDU67274.1| single-strand binding protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659723|gb|EDX53103.1| single-strand binding protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660331|gb|EDX53592.1| single-strand binding protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (168 aa)
Score = 138, Expect = 3.0e-07, Identities = 52/160 (32%), Positives = 84/160 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDE--ENSLEQPVDKATV--IDSPFLAAKTNA--TENELAQAFPISL------DDEDDDINPILNNDSQLE 160
           MN+V L G L  DP   Q  +  +  +F++A  D+   N + ++IR  AW   A+F+ T LK GD++ +EGR+ +        D N K  Y  +V AD+V       +N+ +   DK  V  +   + +  T+A  + N+    F  +       DDE+D+I   +N D  LE
  S:     1 MNKVILIGNLVRDPEARQIPSGRLVTNFTVAVNDNIP-NANANFIRCVAWNNQANFLTTYLKKGDAIAIEGRIVSRSY----VDNNGKTNYVTEVYADQVQSLSRRNQNANDHNNDKVNVDTMMGAYASINTDAAFSSNQPQTNFQSTTSNSNKNDDEEDEITSWINLDDDLE 168
>gi|66880322|ref|ZP_00405304.1| hypothetical protein MgenG_01000194 [Mycoplasma genitalium G-37] (62 aa)
Score = 136, Expect = 5.0e-07, Identities = 30/57 (52%), Positives = 40/57 (70%)
  Q:   109 EQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEESDD 165
           E+P+ K+TV+DSPF+  K + TE E  QAFP   + + ++I PI  ND QLEEESDD
  S:     7 EEPI-KSTVVDSPFMNPKASVTEAEFEQAFPHQDETDFNNITPIFENDVQLEEESDD 62
>gi|189426459|ref|YP_001953636.1| single-strand binding protein [Geobacter lovleyi SZ] >gi|189422718|gb|ACD97116.1| single-strand binding protein [Geobacter lovleyi SZ] (146 aa)
Score = 135, Expect = 6.1e-07, Identities = 35/99 (35%), Positives = 54/99 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T +    ASF+LA  +     S  + +   + R+T WGK+A      L  G +V++EGRL T K  +R  D N K  Y  +++ D++
  S:     4 LNKVMLIGNLGKDPEVRYTTSGQAVASFNLATSEKFKNKSGDWEERTEWHRVTLWGKLAEIAGEYLAKGKTVYIEGRLQTRKWTDR--DGNDK--YTTEIVGDRM 104
>gi|78188206|ref|YP_378544.1| single-strand binding protein [Chlorobium chlorochromatii CaD3] >gi|78170405|gb|ABB27501.1| Single-strand binding protein [Chlorobium chlorochromatii CaD3] (172 aa)
Score = 133, Expect = 9.3e-07, Identities = 42/117 (35%), Positives = 61/117 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYR---PDEE---NSLEQPVDKATV 117
           +N+V L G L  DP    T +    A+F+LA      DSSG   +   + RI AWGK+A      LK G  V+VEGRL T   +   D    +  Y  +++   +     P E+    S  QP D++T+
  S:    17 LNKVMLIGHLGTDPELRTTTSGQSVANFTLATNENYKDSSGNLQERTEWHRIIAWGKLAEICNQYLKKGRQVYVEGRLQTRSWD---DQKTGEKKYTTEIVCSDMQMLGSPREQMGGESTMQPYDQSTL 142
>gi|21674759|ref|NP_662824.1| single-strand binding protein [Chlorobium tepidum TLS] >gi|37999707|sp|Q8KB47|SSB1_CHLTE Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|21647972|gb|AAM73166.1| single-strand binding protein [Chlorobium tepidum TLS] (162 aa)
Score = 132, Expect = 1.3e-06, Identities = 35/96 (36%), Positives = 51/96 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP + +T +     +F+LA   S GF DS         + RI AWGK+A      LK G  V++EGRL T   +   D+      YA +++ 
  S:     5 LNKVMLIGHLGNDPERRETASGQSVVNFTLAT--SEGFKDSSGNLQERTEWHRIVAWGKLADICSQYLKKGRQVYIEGRLQTRSWD---DNKTGDKKYATEIVC 103
>gi|54112683|gb|AAV28975.1| NT02FT0349 [synthetic construct] (158 aa)
Score = 129, Expect = 3.3e-06, Identities = 32/96 (33%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G+L  DP    T+   + A+ S+A  D  G N +  + R+  +GK A  +      G  +FVEGRL T    N+  D N    Y  +V+A
  S:     6 VNKVILLGRLGNDPEVRTTQNGTVVATLSIATNDGMGENITTEWHRVVIFGKSAEAIQKYANKGTQIFVEGRLRT----NKWQDKNGNMQYTTEVVA 98
>gi|56708750|ref|YP_170646.1| single-strand binding protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|89255463|ref|YP_512824.1| single-strand binding protein [Francisella tularensis subsp. holarctica] >gi|110671222|ref|YP_667779.1| single-strand binding protein [Francisella tularensis subsp. tularensis FSC198] >gi|115313992|ref|YP_762715.1| single-stranded DNA binding protein [Francisella tularensis subsp. holarctica OSU18] >gi|134302777|ref|YP_001122745.1| single-strand binding protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|156501385|ref|YP_001427450.1| single-stranded DNA binding protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009299|ref|ZP_02274230.1| single-strand binding protein [Francisella tularensis subsp. holarctica FSC200] >gi|187932294|ref|YP_001892279.1| single-strand DNA binding protein [Francisella tularensis subsp. mediasiatica FSC147] >gi|56605242|emb|CAG46385.1| Single-strand binding protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|89143294|emb|CAJ78455.1| Single-strand binding protein [Francisella tularensis subsp. holarctica LVS] >gi|110321555|emb|CAL09768.1| Single-strand binding protein [Francisella tularensis subsp. tularensis FSC 198] >gi|115128891|gb|ABI82078.1| single-stranded DNA binding protein [Francisella tularensis subsp. holarctica OSU18] >gi|134050554|gb|ABO47625.1| single-strand binding protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|134252699|gb|EBA51793.1| single stranded DNA binding protein [Francisella tularensis subsp. holarctica 257] >gi|151569600|gb|EDN35254.1| single-strand DNA binding protein [Francisella tularensis subsp. tularensis FSC033] >gi|156251988|gb|ABU60494.1| single-stranded DNA binding protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|187713203|gb|ACD31500.1| single-strand DNA binding protein [Francisella tularensis subsp. mediasiatica FSC147] (158 aa)
Score = 127, Expect = 4.4e-06, Identities = 32/96 (33%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G+L  DP    T+   + A+ S+A  D  G N +  + R+  +GK A  +      G  +FVEGRL T    N+  D N    Y  +V+A
  S:     6 VNKVILLGRLGNDPEVRTTQNGTVVATLSIATNDGMGENITTEWHRVVIFGKSAEAIQRYANKGTQIFVEGRLRT----NKWQDKNGNMQYTTEVVA 98
>gi|157121338|gb|EDO65539.1| single-strand DNA binding protein [Francisella tularensis subsp. holarctica FSC022] (158 aa)
Score = 127, Expect = 4.6e-06, Identities = 32/96 (33%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G+L  DP    T+   + A+ S+A  D  G N +  + R+  +GK A  +      G  +FVEGRL T    N+  D N    Y  +V+A
  S:     6 VNKVILLGRLGNDPEVRTTQNGTVVATLSIATNDGMGENITTEWHRVVIFGKSAEAIQRYANKGTQIFVEGRLRT----NKWQDKNGNMQYTTEVVA 98
>gi|118496739|ref|YP_897789.1| single-strand DNA binding protein [Francisella tularensis subsp. novicida U112] >gi|194324046|ref|ZP_03057821.1| single-strand binding protein [Francisella tularensis subsp. novicida FTE] >gi|118422645|gb|ABK89035.1| single-strand DNA binding protein [Francisella tularensis subsp. novicida U112] >gi|151569836|gb|EDN35490.1| single-strand binding protein [Francisella tularensis subsp. novicida GA99-3549] >gi|151572970|gb|EDN38624.1| single-strand binding protein [Francisella tularensis subsp. novicida GA99-3548] >gi|194321943|gb|EDX19426.1| single-strand binding protein [Francisella tularensis subsp. novicida FTE] (159 aa)
Score = 127, Expect = 4.8e-06, Identities = 32/96 (33%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G+L  DP    T+   + A+ S+A  D  G N +  + R+  +GK A  +      G  +FVEGRL T    N+  D N    Y  +V+A
  S:     6 VNKVILLGRLGNDPEVRTTQNGTVVATLSIATNDGMGENITTEWHRVVIFGKSAEAIQRYANKGTQIFVEGRLRT----NKWQDKNGNMQYTTEVVA 98
>gi|110599474|ref|ZP_01387712.1| single-strand binding protein [Geobacter sp. FRC-32] >gi|110549853|gb|EAT63041.1| single-strand binding protein [Geobacter sp. FRC-32] (148 aa)
Score = 126, Expect = 6.7e-06, Identities = 33/99 (33%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      ASFSLA  D     S  + +   +  IT W ++A      L  G +V++EGRL T K  +R    + K  Y  +++ +K+
  S:     4 LNKVMLIGNLGKDPEVRYTAAGTAVASFSLATTDRFKSKSGEWEEKTEWHNITLWSRLAEIAGEYLSKGKTVYIEGRLQTRKWQDR----DGKDRYTTEIVGEKM 104
>gi|146296358|ref|YP_001180129.1| single-strand binding protein [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409934|gb|ABP66938.1| single-strand binding protein [Caldicellulosiruptor saccharolyticus DSM 8903] (160 aa)
Score = 125, Expect = 8.4e-06, Identities = 38/100 (38%), Positives = 55/100 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGF---NDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           MN+V L G+L+ DP    T  N   A+F+LA   +  F   ND  + +I I AW ++A F    LK G  V V GRL         DD +++  Y  +VIA+++Y
  S:     1 MNKVILMGRLTRDPEFRLTANNTPVANFTLAV--NRRFRRENDQDADFIPIVAWSRLAEFSKNYLKKGRQVVVIGRLQLRTW----DDESNRRHYITEVIAEEIY 99
>gi|189347623|ref|YP_001944152.1| single-strand binding protein [Chlorobium limicola DSM 245] >gi|189341770|gb|ACD91173.1| single-strand binding protein [Chlorobium limicola DSM 245] (165 aa)
Score = 122, Expect = 1.9e-05, Identities = 32/96 (33%), Positives = 52/96 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP    T +    ++F++A      D++G + D   + RI AWGK+A      LK G  V++EGRL T   +   D  + +  YA +++ 
  S:     5 LNKVMLIGHLGNDPELRTTASGQSVSNFTVATSENFKDATGNWQDRTEWHRIVAWGKLAEICNQYLKKGRQVYIEGRLQTRSWD---DSKSGEKRYATEIVC 103
>gi|167626924|ref|YP_001677424.1| single-strand DNA binding protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596925|gb|ABZ86923.1| single-strand DNA binding protein [Francisella philomiragia subsp. philomiragia ATCC 25017] (162 aa)
Score = 121, Expect = 2.4e-05, Identities = 31/96 (32%), Positives = 47/96 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G+L  DP    T+     A+ S+A  D  G N +  + R+  +GK A  +      G  +F+EGRL T    N+  D N    Y  +V+A
  S:     6 VNKVILLGRLGNDPEVRTTQNGTTVATLSIATNDGMGENITTEWHRVVVFGKSAEAIQRYANKGTQLFIEGRLRT----NKWQDKNGNMQYTTEVVA 98
>gi|148266407|ref|YP_001233113.1| single-strand binding protein [Geobacter uraniireducens Rf4] >gi|146399907|gb|ABQ28540.1| single-strand binding protein [Geobacter uraniireducens Rf4] (149 aa)
Score = 121, Expect = 2.4e-05, Identities = 31/99 (31%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T +    ASFSLA  +     S  + +   +  +T W ++A      L  G +V++EGRL T K  +R    + K  Y  +++ +K+
  S:     4 LNKVMLIGNLGKDPEVRYTASGTAVASFSLATSEKFKNKSGEWEEKTEWHNVTLWARLAEIAGEYLSKGKTVYIEGRLQTRKWQDR----DGKDRYTTEIVGEKM 104
>gi|119358075|ref|YP_912719.1| single-strand binding protein [Chlorobium phaeobacteroides DSM 266] >gi|119355424|gb|ABL66295.1| single-strand binding protein [Chlorobium phaeobacteroides DSM 266] (171 aa)
Score = 121, Expect = 2.5e-05, Identities = 31/96 (32%), Positives = 49/96 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACI----DSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP    T +     +F+LA      D++G + +   + RI  WGK+A      LK G  V+VEGRL T   +   D  + +  Y  +++ 
  S:     5 LNKVMLIGHLGGDPESRNTASGQTVTNFTLATTESFKDATGTWQEKTEWHRIVTWGKLAEICSQYLKKGRQVYVEGRLQTRSWD---DQKSGEKKYTTEIVC 103
>gi|145219141|ref|YP_001129850.1| single-strand binding protein [Prosthecochloris vibrioformis DSM 265] >gi|145205305|gb|ABP36348.1| single-strand binding protein [Prosthecochloris vibrioformis DSM 265] (168 aa)
Score = 118, Expect = 6.2e-05, Identities = 32/99 (32%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP   Q  +    A+F+LA  DS    SG   +   + RI  WG++A      LK G  V++EGR+ T   +   D    +  YA  ++ +++
  S:     5 INKVTLIGNLGSDPEVRQIPSGQTVANFTLATSDSYKDNSGTMQERTEWHRIVVWGRLAEICGQYLKKGRQVYLEGRIQTRSWD---DQKTGEKKYATDIVCNEM 106
>gi|78186149|ref|YP_374192.1| single-strand binding protein [Pelodictyon luteolum DSM 273] >gi|78166051|gb|ABB23149.1| Single-strand binding protein [Pelodictyon luteolum DSM 273] (163 aa)
Score = 117, Expect = 7.8e-05, Identities = 33/95 (34%), Positives = 48/95 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP      +    A+F+LA      DSSG   +   + RI AWG++A      LK G  V+VEGR+ T   +   D    +  YA  ++
  S:     5 LNKVMLIGNLGNDPELRTIPSGQTVANFTLATSESFKDSSGAMQERTEWHRIVAWGRLAEICGQYLKKGRQVYVEGRIQTRSWD---DQKTGEKKYATDIV 102
>gi|193211941|ref|YP_001997894.1| single-strand binding protein [Chlorobaculum parvum NCIB 8327] >gi|193085418|gb|ACF10694.1| single-strand binding protein [Chlorobaculum parvum NCIB 8327] (154 aa)
Score = 117, Expect = 7.9e-05, Identities = 29/70 (41%), Positives = 40/70 (57%)
  Q:     5 FLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLST 74
            L G L  DP + +T +     +F+LA      DS+G F +   + RI AWGK+A      LK G  V++EGRL T
  S:     1 MLIGHLGSDPERRETASGQTVVNFNLATSEGYKDSTGNFQERTEWHRIVAWGKLADICSQYLKKGRQVYIEGRLQT 76
>gi|189501116|ref|YP_001960586.1| single-strand binding protein [Chlorobium phaeobacteroides BS1] >gi|189496557|gb|ACE05105.1| single-strand binding protein [Chlorobium phaeobacteroides BS1] (157 aa)
Score = 116, Expect = 8.4e-05, Identities = 34/96 (35%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS---SGFN--DSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+  L G L  DP    T +     +F+LA  +S   SG N  +   + RI AWGK+A      LK G  V+VEGRL T       D+   +  Y  ++I 
  S:     5 LNKAMLIGHLGTDPEMRVTPSGQSVVNFTLATNESFKDSGGNLQERTEWHRIVAWGKLAEICNQYLKKGRQVYVEGRLQTRSW---EDNKTGEKKYTTEIIC 103
>gi|154249361|ref|YP_001410186.1| single-strand binding protein [Fervidobacterium nodosum Rt17-B1] >gi|154153297|gb|ABS60529.1| single-strand binding protein [Fervidobacterium nodosum Rt17-B1] (136 aa)
Score = 116, Expect = 8.7e-05, Identities = 32/88 (36%), Positives = 49/88 (55%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKAT 89
           N+V L G+L+ DP   QT   N+  +F+LA   +   N    +IRI A+ K+A    T L+ G  V VEG+L   K   +++D  S++T
  S:     4 NKVVLVGRLTRDPETKQTLDGNLITTFTLAV--NRANNGEADFIRIVAFRKLAELAHTYLQKGRMVLVEGKLRINKW--KTNDGQSRST 88
>gi|160916102|ref|ZP_02078309.1| hypothetical protein EUBDOL_02129 [Eubacterium dolichum DSM 3991] >gi|158431826|gb|EDP10115.1| hypothetical protein EUBDOL_02129 [Eubacterium dolichum DSM 3991] (156 aa)
Score = 116, Expect = 9.2e-05, Identities = 34/99 (34%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+++ DP   +T +     SF++AC   I + G   +  +I   AW + A  V      G  V VEGR+ T       DD + K  Y  +V+AD V
  S:     2 INRVVLVGRMTKDPVLRKTASGASVVSFTVACDRRIKTEG-QPTADFINTVAWNRTADIVAQYTHKGSLVGVEGRIQTRSY----DDQSGKRVYVTEVVADSV 99
>gi|154498400|ref|ZP_02036778.1| hypothetical protein BACCAP_02389 [Bacteroides capillosus ATCC 29799] >gi|150272468|gb|EDM99653.1| hypothetical protein BACCAP_02389 [Bacteroides capillosus ATCC 29799] (161 aa)
Score = 116, Expect = 9.6e-05, Identities = 39/109 (35%), Positives = 54/109 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           +NR+ L G+L+ DP    T+T    ASFSLA +D   F D ++      +I + AW + A FV      G    VEGRL      +R       A    +VIA+ VY  D +   E
  S:     2 LNRIILMGRLTRDPELRHTQTGTPVASFSLA-VDRD-FKDKQTGEKATDFIDVVAWRQTAEFVSRFFTKGRLAVVEGRLQIRDWTDRDGGKRRSA----EVIAENVYFGDSKRDAE 111
>gi|125974671|ref|YP_001038581.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] >gi|196252197|ref|ZP_03150858.1| single-strand binding protein [Clostridium thermocellum DSM 4150] >gi|125714896|gb|ABN53388.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] >gi|196198330|gb|EDX93166.1| single-strand binding protein [Clostridium thermocellum DSM 4150] (138 aa)
Score = 116, Expect = 1.0e-04, Identities = 38/100 (38%), Positives = 47/100 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLAC---IDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           MN+V L G+L+ DP    T  NN   ASF+LA        G      +  I AW K A F       G  V V GRL T       DD   K  Y  +VIA+++Y
  S:     1 MNKVILMGRLTRDPELRYTTVNNTPVASFTLAVDRRFARQGEERQTDFFPIVAWDKSAEFCSKYFTKGLKVVVVGRLQT----RTWDDNEGKRHYVTEVIAEELY 101
>gi|110003929|emb|CAK98269.1| probable single-strand binding protein ssb [Spiroplasma citri] (144 aa)
Score = 115, Expect = 1.3e-04, Identities = 36/107 (33%), Positives = 57/107 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +NRV L G+L+ D     +  +    +F+LA   ++ FN+  S+I   AW K A +    LK G  + ++GRL T     R+D+ N + T  +QVIAD V   D + +
  S:     2 LNRVSLVGRLTRDLELKNSVNSKPFVAFTLAV--NNNFNNQASFIPCFAWNKTAENMARYLKKGSLIALDGRLQT-----RTDNVNGQVTTIVQVIADIVSFLDSKGT 102
>gi|150020532|ref|YP_001305886.1| single-strand binding protein [Thermosipho melanesiensis BI429] >gi|149793053|gb|ABR30501.1| single-strand binding protein [Thermosipho melanesiensis BI429] (133 aa)
Score = 114, Expect = 1.6e-04, Identities = 33/98 (33%), Positives = 57/98 (58%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           N+V L G+L+ DP   QT    + ++F+LA ++ S  ND   +IRI  + ++A FV   L  G  V VEG+L   +   +++D  +++T   ++ AD+V
  S:     4 NKVVLVGRLTRDPESRQTVNGTLISTFTLA-VNRSNRNDDVDFIRIVTFNRLAEFVQNYLTKGRLVLVEGKLRINRW--QTNDGQNRST--PEIWADQV 97
>gi|108763668|ref|YP_629331.1| single-strand binding protein [Myxococcus xanthus DK 1622] >gi|108467548|gb|ABF92733.1| single-strand binding protein [Myxococcus xanthus DK 1622] (165 aa)
Score = 114, Expect = 1.6e-04, Identities = 33/99 (33%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      A+F +A     +D +G    ++ + RI  WGK+A      LK G   +VEGRL T +  ++ +  N    Y  +V+A+ V
  S:     5 VNKVILIGNLGADPEVRFTPGGQAVANFRIATSESWVDKNGQKQERTEWHRIVVWGKLAELCGEYLKKGRQCYVEGRLQTREWTDKENRKN----YTTEVVANAV 105
>gi|115372015|ref|ZP_01459327.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115378034|ref|ZP_01465214.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115364973|gb|EAU64028.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115370980|gb|EAU69903.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] (159 aa)
Score = 114, Expect = 1.7e-04, Identities = 35/99 (35%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      A+F +A  DS    +G    ++ + RI  WGK+A      LK G   FVEGRL T +  ++ +  N    Y  +V+A  V
  S:     5 VNKVILIGNLGADPEVRFTPGGQAVANFRIATSDSWTDKNGQKQERTEWHRIVVWGKLAELCGEYLKKGRQCFVEGRLQTREWTDKENRKN----YTTEVVASSV 105
>gi|191164897|ref|ZP_03026751.1| single-strand binding protein [Geobacter sp. M21] >gi|190993998|gb|EDV69472.1| single-strand binding protein [Geobacter sp. M21] (148 aa)
Score = 114, Expect = 1.8e-04, Identities = 30/99 (30%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      ASFS+A  +        + +   +  IT W ++A      L  G +V++EGRL T K      D   K  Y  +++ +K+
  S:     4 LNKVMLIGNLGKDPEVRYTAGGTAVASFSVATTEKFKGKDGNWEEKTEWHNITLWARLAEIAGEYLSKGKTVYIEGRLQTRKWT----DKEGKDRYTTEIVGEKM 104
>gi|160934673|ref|ZP_02082059.1| hypothetical protein CLOLEP_03546 [Clostridium leptum DSM 753] >gi|156866126|gb|EDO59498.1| hypothetical protein CLOLEP_03546 [Clostridium leptum DSM 753] (150 aa)
Score = 114, Expect = 1.8e-04, Identities = 32/100 (32%), Positives = 53/100 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           +NR+ + G+L+ DP    T++N    SFS+AC     +        +  +TAW   A FV      G  + V+GRL + K  ++  D N++   A+++ AD VY
  S:     2 LNRITITGRLTHDPELRTTQSNISVTSFSIACQRNFKNGNGERETDFFDVTAWRSTAEFVTRYFSKGSLITVDGRLESRKYTDK--DGNNRV--AIEIKADNVY 101
>gi|193214794|ref|YP_001995993.1| single-strand binding protein [Chloroherpeton thalassium ATCC 35110] >gi|193088271|gb|ACF13546.1| single-strand binding protein [Chloroherpeton thalassium ATCC 35110] (174 aa)
Score = 113, Expect = 1.9e-04, Identities = 30/74 (40%), Positives = 43/74 (58%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLST 74
           +N+V L G L  DP+   T   +  A+FSLA      DS+G F +   + RI  WGK+A      L+ G  V++EG+L T
  S:     5 LNKVMLIGNLGTDPDLRVTPNGHSVANFSLATNESFKDSTGEFRERTEWHRIVVWGKLADISKQYLRKGKQVYIEGKLQT 84
>gi|194337561|ref|YP_002019355.1| single-strand binding protein [Pelodictyon phaeoclathratiforme BU-1] >gi|194310038|gb|ACF44738.1| single-strand binding protein [Pelodictyon phaeoclathratiforme BU-1] (158 aa)
Score = 113, Expect = 2.0e-04, Identities = 33/96 (34%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDP-NSKATYALQVIA 96
           +N+V L G L  DP    T +     +F+LA      D++G   +   + RI  W K+A      LK G  V+VEGRL T       DDP N +  Y  +++ 
  S:     5 LNKVMLIGHLGNDPEMKVTTSGQSRVTFTLATNENFKDNNGNLQERTEWHRIVVWAKLAEICSQYLKKGRQVYVEGRLQTRSW----DDPKNGEKRYTTEIVC 103
>gi|145620479|ref|ZP_01776509.1| single-strand binding protein [Geobacter bemidjiensis Bem] >gi|144943228|gb|EDJ78323.1| single-strand binding protein [Geobacter bemidjiensis Bem] >gi|197089696|gb|ACH40967.1| single-strand binding protein [Geobacter bemidjiensis Bem] (146 aa)
Score = 113, Expect = 2.1e-04, Identities = 30/99 (30%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      ASFS+A  +        + +   +  IT W ++A      L  G +V++EGRL T K      D   K  Y  +++ +K+
  S:     4 LNKVMLIGNLGKDPEVRYTAGGTAVASFSVATTEKFKGKDGNWEEKTEWHNITLWARLAEIAGEYLSKGKTVYIEGRLQTRKWT----DKEGKDRYTTEIVGEKM 104
>gi|121534825|ref|ZP_01666645.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] >gi|121306620|gb|EAX47542.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] (128 aa)
Score = 112, Expect = 2.5e-04, Identities = 33/99 (33%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MN+  L G+L+ DP+   T++    ASF+LA     G    ++ +I I AW K+A  V   L  G  + VEGRL       RS + +    +  +V+A  V
  S:     1 MNKAILVGRLAQDPDVRYTQSGKAVASFNLAVNRYVGQGQQQADFIPIVAWDKLAETVGNYLAKGQRILVEGRLQV-----RSYEKDGAKRWVTEVVALHV 96
>gi|172064568|ref|YP_001812218.1| single-strand binding protein [Burkholderia ambifaria MC40-6] >gi|171998053|gb|ACB68969.1| single-strand binding protein [Burkholderia ambifaria MC40-6] (188 aa)
Score = 112, Expect = 2.5e-04, Identities = 43/149 (28%), Positives = 71/149 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV----------YRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFP---------ISLDDEDDDI 149
           +N+V L G L  DP      + +  A+  LA  D      S  Y  +T W +VA F          LK G SV++EGR+ T K   +    + +  Y+ +++AD++           R  +++  EQ   +    ++     +TN +    A   P            D+ DDDI
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDYKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQMQMLGGRGGNAQRDGDDDGFEQGERRQAPANAARAPVRTNGSGPRPAAPLPDQTRSYGGGGGFDEMDDDI 174
>gi|39998207|ref|NP_954158.1| single-strand binding protein [Geobacter sulfurreducens PCA] >gi|39985153|gb|AAR36508.1| single-strand binding protein [Geobacter sulfurreducens PCA] (146 aa)
Score = 111, Expect = 3.4e-04, Identities = 30/99 (30%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      ASFSLA  +     +  F +   +  +  WG+ A      L  G +VF+EGRL T K      D + +  +  +V+ +++
  S:     4 LNKVMLIGNLGKDPEVRYTPAGTAVASFSLATTEKFKNRNGEFEEKTEWHNVVLWGRQAEIAGEYLAKGRTVFIEGRLQTRKWQ----DKDGRDRWTTEVVGERM 104
>gi|194334763|ref|YP_002016623.1| single-strand binding protein [Prosthecochloris aestuarii DSM 271] >gi|194312581|gb|ACF46976.1| single-strand binding protein [Prosthecochloris aestuarii DSM 271] (166 aa)
Score = 110, Expect = 4.2e-04, Identities = 32/96 (33%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP      +    A+F+LA      DSSG   +   + RI AWG++A      LK G  V++EG+L T   +   D       YA +++ 
  S:     5 LNKVMLIGHLGSDPELRVIPSGQSVANFTLATNESYKDSSGNLQERTEWHRIVAWGRLAEICQQYLKKGRQVYIEGKLQTRSWD---DTKTGDKRYATEIVC 103
>gi|37496691|emb|CAD92097.1| single-stranded DNA binding protein [Thermus thermophilus] (263 aa)
Score = 110, Expect = 4.9e-04, Identities = 29/102 (28%), Positives = 49/102 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRP 102
           +N+VFL G L+ DP    T      A   LA  +   G  +   ++ + AW  +A +   L+ GD +FV GRL    +N+     + +  +  +V A ++ RP
  S:   128 LNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRL----VNDSWTSSSGERRFQTRVEALRLERP 226
>gi|55980213|ref|YP_143510.1| single-stranded DNA binding protein [Thermus thermophilus HB8] >gi|62287528|sp|Q5SLP9|SSB_THET8 Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|55771626|dbj|BAD70067.1| single-stranded DNA binding protein [Thermus thermophilus HB8] (263 aa)
Score = 110, Expect = 5.1e-04, Identities = 29/102 (28%), Positives = 49/102 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRP 102
           +N+VFL G L+ DP    T      A   LA  +   G  +   ++ + AW  +A +   L+ GD +FV GRL    +N+     + +  +  +V A ++ RP
  S:   128 LNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRL----VNDSWTSSSGERRFQTRVEALRLERP 226
>gi|46200043|ref|YP_005710.1| single-strand DNA binding protein (SSB) [Thermus thermophilus HB27] >gi|46197671|gb|AAS82083.1| single-strand DNA binding protein (SSB) [Thermus thermophilus HB27] (263 aa)
Score = 110, Expect = 5.2e-04, Identities = 29/102 (28%), Positives = 49/102 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRP 102
           +N+VFL G L+ DP    T      A   LA  +   G  +   ++ + AW  +A +   L+ GD +FV GRL    +N+     + +  +  +V A ++ RP
  S:   128 LNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRL----VNDSWTSSSGERRFQTRVEALRLERP 226
>gi|8548923|gb|AAC28386.2| single stranded binding protein [Thermus thermophilus] (263 aa)
Score = 109, Expect = 5.4e-04, Identities = 29/102 (28%), Positives = 49/102 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRP 102
           +N+VFL G L+ DP    T      A   LA  +   G  +   ++ + AW  +A +   L+ GD +FV GRL    +N+     + +  +  +V A ++ RP
  S:   128 LNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRL----VNDSWTSSSGERRFQTRVEALRLERP 226
>gi|62296542|sp|O85824|SSB_THETH Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|6739548|gb|AAF27296.1|AF146075_2 SSB protein [Thermus thermophilus] (266 aa)
Score = 109, Expect = 5.7e-04, Identities = 29/102 (28%), Positives = 49/102 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRP 102
           +N+VFL G L+ DP    T      A   LA  +   G  +   ++ + AW  +A +   L+ GD +FV GRL    +N+     + +  +  +V A ++ RP
  S:   128 LNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRL----VNDSWTSSSGERRFQTRVEALRLERP 226
>gi|118578889|ref|YP_900139.1| single-strand binding protein [Pelobacter propionicus DSM 2379] >gi|118501599|gb|ABK98081.1| single-strand binding protein [Pelobacter propionicus DSM 2379] (143 aa)
Score = 109, Expect = 6.9e-04, Identities = 28/99 (28%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T +    ASF+LA  +        + +   + R+T W ++A      L  G +V++EGRL T     R  + +    Y  +++ +K+
  S:     4 LNKVMLIGNLGRDPEVRYTASGQAVASFNLATTEKFKNRNGEWEERTEWHRVTLWARLAEIAGEYLSKGKTVYIEGRLQT-----REYEKDGIKRYTTEIVGEKM 103
>gi|78221583|ref|YP_383330.1| single-strand binding protein [Geobacter metallireducens GS-15] >gi|78192838|gb|ABB30605.1| Single-strand binding protein [Geobacter metallireducens GS-15] (147 aa)
Score = 108, Expect = 7.0e-04, Identities = 30/99 (30%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T      ASFSLA  +     +  F +   +  +  WG+ A      L  G +VF+EGRL T K      D   +  ++ +V+ +++
  S:     4 LNKVMLIGNLGKDPEVRYTPGGTAVASFSLATSEKFKNRNGEFEEKTEWHNVVLWGRQAEIAGEYLAKGRTVFIEGRLQTRKWQ----DKEGRDRWSTEVVGERM 104
>gi|134296973|ref|YP_001120708.1| single-strand DNA-binding protein [Burkholderia vietnamiensis G4] >gi|134140130|gb|ABO55873.1| single-strand binding protein [Burkholderia vietnamiensis G4] (183 aa)
Score = 108, Expect = 7.0e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|94309260|ref|YP_582470.1| single-strand DNA-binding protein [Ralstonia metallidurans CH34] >gi|93353112|gb|ABF07201.1| single-strand binding protein [Ralstonia metallidurans CH34] (181 aa)
Score = 108, Expect = 7.2e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +   +  LA  D      S  F ++  + RI  +GK+A      L+ G SV++EGR+ T K  ++S     +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPETRYMPSGDAVTNIRLATTDRYKDKQSGEFKEATEWHRIAFFGKLAEIAGQYLRKGSSVYIEGRIRTRKWQDQS----GQDKYSTEIVADQM 105
>gi|172061736|ref|YP_001809388.1| single-strand binding protein [Burkholderia ambifaria MC40-6] >gi|171994253|gb|ACB65172.1| single-strand binding protein [Burkholderia ambifaria MC40-6] (186 aa)
Score = 108, Expect = 7.4e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|115352888|ref|YP_774727.1| single-strand DNA-binding protein [Burkholderia ambifaria AMMD] >gi|115282876|gb|ABI88393.1| single-strand binding protein [Burkholderia ambifaria AMMD] (187 aa)
Score = 108, Expect = 7.4e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|118726031|ref|ZP_01574664.1| single-strand binding protein [Clostridium cellulolyticum H10] >gi|118664587|gb|EAV71216.1| single-strand binding protein [Clostridium cellulolyticum H10] (142 aa)
Score = 108, Expect = 7.7e-04, Identities = 38/109 (34%), Positives = 52/109 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           MN+V L G+L+ DP+   T  NN   ASF+LA        G      +I I AW + A F       G  V V GR+ T       DD   K  Y  +V+A++ Y  D + + E
  S:     1 MNKVLLMGRLTKDPDLRYTSGNNTAVASFTLAVNRRFAREG-QPQADFINIVAWDRSAEFCGKYFTKGMQVAVVGRIQTRTW----DDNEGKRHYVTEVVAEETYFADSKRNSE 109
>gi|188591474|ref|YP_001796073.1| Single-stranded DNA-binding protein [Cupriavidus taiwanensis] >gi|170938869|emb|CAP63870.1| Single-stranded DNA-binding protein [Cupriavidus taiwanensis] (169 aa)
Score = 108, Expect = 8.0e-04, Identities = 30/99 (30%), Positives = 54/99 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  +A  D      S    ++  + RI+ +GK+A      LK G SV++EGR+ T K  ++S     +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYMPSGDAVANIRIATTDRYKDKQSGEMKEATEWHRISFFGKLAEIAGQYLKKGSSVYIEGRIRTRKWQDQS----GQDKYSTEIVADQM 105
>gi|194562389|ref|YP_002097412.1| Single-stranded DNA-binding protein [Burkholderia dolosa AUO158] >gi|124894013|gb|EAY67893.1| Single-stranded DNA-binding protein [Burkholderia dolosa AUO158] (181 aa)
Score = 108, Expect = 8.1e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|78067576|ref|YP_370345.1| single-strand DNA-binding protein [Burkholderia sp. 383] >gi|77968321|gb|ABB09701.1| Single-strand binding protein [Burkholderia sp. 383] (184 aa)
Score = 108, Expect = 8.5e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|85544428|pdb|2CWA|A Chain A, Crystal Structure Of The Single-Stranded Dna Binding Protein From Thermus Thermophilus Hb8 (263 aa)
Score = 108, Expect = 8.7e-04, Identities = 29/102 (28%), Positives = 49/102 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRP 102
           +N+VFL G L+ DP    T      A   LA  +   G  +   ++ + AW  +A +   L+ GD +FV GRL    +N+     + +  +  +V A ++ RP
  S:   128 LNQVFLXGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRL----VNDSWTSSSGERRFQTRVEALRLERP 226
>gi|194316868|ref|YP_002012878.1| single-stranded DNA-binding protein [Burkholderia mallei ATCC 10399] >gi|160696023|gb|EDP85993.1| single-stranded DNA-binding protein [Burkholderia mallei ATCC 10399] (209 aa)
Score = 108, Expect = 8.8e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:    17 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 118
>gi|149918458|ref|ZP_01906948.1| single-strand binding protein [Plesiocystis pacifica SIR-1] >gi|149820758|gb|EDM80168.1| single-strand binding protein [Plesiocystis pacifica SIR-1] (198 aa)
Score = 108, Expect = 8.8e-04, Identities = 35/99 (35%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACI------DSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRS-DDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T+     A  S+A         S+   +   + R+T WG+ A      L  G  V+VEGRL T     RS DD      Y+ ++IAD V
  S:     4 INKVILVGNLGRDPELRYTQGGTAVARLSVATTRRWRNKQSNEMVEETEWHRVTVWGQTAEHCNNYLSKGRQVYVEGRLQT-----RSYDDKEGIKRYSTEIIADTV 105
>gi|194528531|ref|YP_002064053.1| single-stranded DNA-binding protein [Burkholderia mallei JHU] >gi|147752541|gb|EDK59607.1| single-stranded DNA-binding protein [Burkholderia mallei JHU] (212 aa)
Score = 108, Expect = 8.8e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:    17 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 118
>gi|161523718|ref|YP_001578730.1| single-strand DNA-binding protein [Burkholderia multivorans ATCC 17616] >gi|189351518|ref|YP_001947146.1| single-strand DNA-binding protein [Burkholderia multivorans ATCC 17616] >gi|160341147|gb|ABX14233.1| single-strand binding protein [Burkholderia multivorans ATCC 17616] >gi|189335540|dbj|BAG44610.1| single-strand DNA-binding protein [Burkholderia multivorans ATCC 17616] (182 aa)
Score = 108, Expect = 8.9e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|121601305|ref|YP_991413.1| single-strand DNA-binding protein [Burkholderia mallei SAVP1] >gi|167001018|ref|ZP_02266819.1| single-strand DNA-binding protein [Burkholderia mallei PRL-20] >gi|121230115|gb|ABM52633.1| single-strand binding protein [Burkholderia mallei SAVP1] (196 aa)
Score = 107, Expect = 9.1e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|124384026|ref|YP_001027511.1| single-strand DNA-binding protein [Burkholderia mallei NCTC 10229] >gi|126451223|ref|YP_001082477.1| single-strand DNA-binding protein [Burkholderia mallei NCTC 10247] >gi|194576221|ref|YP_002111104.1| single-stranded DNA-binding protein [Burkholderia mallei 2002721280] >gi|124292046|gb|ABN01315.1| single-strand binding protein [Burkholderia mallei NCTC 10229] >gi|126244093|gb|ABO07186.1| single-stranded DNA-binding protein [Burkholderia mallei NCTC 10247] >gi|148026542|gb|EDK84627.1| single-stranded DNA-binding protein [Burkholderia mallei 2002721280] (192 aa)
Score = 107, Expect = 9.1e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|53724062|ref|YP_104581.1| single-strand DNA-binding protein [Burkholderia mallei ATCC 23344] >gi|67643413|ref|ZP_00442159.1| COG0629: Single-stranded DNA-binding protein [Burkholderia mallei GB8 horse 4] >gi|52427485|gb|AAU48078.1| single-strand binding protein [Burkholderia mallei ATCC 23344] (199 aa)
Score = 107, Expect = 9.1e-04, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|160902035|ref|YP_001567616.1| single-strand binding protein [Petrotoga mobilis SJ95] >gi|160359679|gb|ABX31293.1| single-strand binding protein [Petrotoga mobilis SJ95] (171 aa)
Score = 107, Expect = 9.4e-04, Identities = 30/79 (37%), Positives = 41/79 (51%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFN-DSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNR 80
           N+V L G+L+ DP    T   N  A+F LA    +  N D   +I+I A+GK A F    LK G  + VEG L   +  +R
  S:     6 NKVILVGRLTRDPEIRSTMNGNNVANFHLAVDGGTSNNQDGTDFIKIVAFGKQADFASNYLKKGKLILVEGSLHINQWTDR 86
>gi|42523087|ref|NP_968467.1| single-strand binding protein [Bdellovibrio bacteriovorus HD100] >gi|39575292|emb|CAE79460.1| single-strand binding protein [Bdellovibrio bacteriovorus HD100] (143 aa)
Score = 107, Expect = 9.4e-04, Identities = 30/99 (30%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G+L  DP      + +  A  +LA  +S        +   + RIT WGK+A      L  G  V+VEG+L T +     +D   +  Y  +++A  V
  S:     4 VNKVILVGRLGADPEVKAIGSGSTVARLNLATSESWVKDGQRQERTEWHRITVWGKLAEICGKHLSKGRQVYVEGKLQTRQW----EDQQGQKRYTTEIVASTV 103
>gi|186475110|ref|YP_001856580.1| single-strand binding protein [Burkholderia phymatum STM815] >gi|184191569|gb|ACC69534.1| single-strand binding protein [Burkholderia phymatum STM815] (172 aa)
Score = 107, Expect = 1.1e-03, Identities = 31/99 (31%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + RI+ +G++A  V   LK G SV++EGR+ T K   +    +    Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKQSGEFKEMTEWHRISFFGRLAEIVSEYLKKGSSVYIEGRIRTRKYQAQ----DGTDRYSTEIVADQM 105
>gi|172059039|ref|YP_001815499.1| single-strand binding protein [Exiguobacterium sibiricum 255-15] >gi|171991560|gb|ACB62482.1| single-strand binding protein [Exiguobacterium sibiricum 255-15] (175 aa)
Score = 107, Expect = 1.1e-03, Identities = 37/99 (37%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS---YIRITAWGKVASFVLT-LKPGDSVFVEGRL--STYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T++      F+LAC       D K    +I    W K A  V   LK G    VEGRL  S+Y      DD + +  Y  +V+AD V
  S:     2 INRVVLVGRLTRDPEMRYTQSGIAVTRFTLACDRPFTGQDGKREADFIDCVVWRKQAENVAQYLKKGSLAGVEGRLQISSY------DDKDGQRRYRAEVVADSV 100
>gi|188591137|ref|YP_001795737.1| ssDNA-binding protein, controls activity of RecBCD nuclease [Cupriavidus taiwanensis] >gi|170938031|emb|CAP63015.1| ssDNA-binding protein, controls activity of RecBCD nuclease [Cupriavidus taiwanensis] (178 aa)
Score = 107, Expect = 1.1e-03, Identities = 28/99 (28%), Positives = 52/99 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +   +  LA  D      S    ++  + R+  +GK+A      L+ G SV++EGR+ T K  ++S     +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPETRYMPSGDAVTNLRLATTDRYKDKQSGEMKEATEWHRVAMFGKLAEIAAQYLRKGSSVYIEGRIRTRKWQDQS----GQDKYSTEIVADQM 105
>gi|118045781|ref|ZP_01514438.1| single-strand binding protein [Chloroflexus aggregans DSM 9485] >gi|117997793|gb|EAV11977.1| single-strand binding protein [Chloroflexus aggregans DSM 9485] (175 aa)
Score = 107, Expect = 1.2e-03, Identities = 37/114 (32%), Positives = 58/114 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSGFNDSKS-YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA----------DKVYRPDEENSLEQPVDK 114
           +N+V L G L  DP    T   +   +F +A      D  G +  ++ + RI AW K+       L  G  V++EGRL T K  +R    + +  Y  +VIA          ++   PD E   ++PVD+
  S:     5 LNKVQLTGHLGADPEMRYTAQGSPVTTFRVASNRTWRDKDGHSHEETEWFRIVAWDKLGEICNQYLTKGTRVYIEGRLQTRKWVDR----DGQERYTTEVIAQDMIILSSKGERGPVPDAEPVYDEPVDE 130
>gi|134279806|ref|ZP_01766518.1| single-stranded DNA-binding protein [Burkholderia pseudomallei 305] >gi|134249006|gb|EBA49088.1| single-stranded DNA-binding protein [Burkholderia pseudomallei 305] (181 aa)
Score = 106, Expect = 1.2e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|126441518|ref|YP_001057648.1| single-strand DNA-binding protein [Burkholderia pseudomallei 668] >gi|126221011|gb|ABN84517.1| single-stranded DNA-binding protein [Burkholderia pseudomallei 668] (179 aa)
Score = 106, Expect = 1.2e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|76808910|ref|YP_332194.1| single-strand DNA-binding protein [Burkholderia pseudomallei 1710b] >gi|194511167|ref|YP_002023696.1| single-stranded DNA-binding protein [Burkholderia pseudomallei Pasteur 52237] >gi|194572533|ref|YP_002107529.1| single-stranded DNA-binding protein [Burkholderia pseudomallei 406e] >gi|76578363|gb|ABA47838.1| single-strand binding protein [Burkholderia pseudomallei 1710b] >gi|157806095|gb|EDO83265.1| single-stranded DNA-binding protein [Burkholderia pseudomallei 406e] >gi|157935452|gb|EDO91122.1| single-stranded DNA-binding protein [Burkholderia pseudomallei Pasteur 52237] (185 aa)
Score = 106, Expect = 1.2e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|53718186|ref|YP_107172.1| single-strand DNA-binding protein [Burkholderia pseudomallei K96243] >gi|126453998|ref|YP_001064893.1| single-strand DNA-binding protein [Burkholderia pseudomallei 1106a] >gi|161360170|ref|ZP_02106035.1| single-strand DNA-binding protein [Burkholderia pseudomallei 1106b] >gi|194516390|ref|YP_002051773.1| single-stranded DNA-binding protein [Burkholderia pseudomallei S13] >gi|52208600|emb|CAH34536.1| single-strand binding protein [Burkholderia pseudomallei K96243] >gi|126227640|gb|ABN91180.1| single-stranded DNA-binding protein [Burkholderia pseudomallei 1106a] >gi|169653623|gb|EDS86316.1| single-stranded DNA-binding protein [Burkholderia pseudomallei S13] (184 aa)
Score = 106, Expect = 1.2e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|83718627|ref|YP_441057.1| single-strand DNA-binding protein [Burkholderia thailandensis E264] >gi|83652452|gb|ABC36515.1| single-strand binding protein [Burkholderia thailandensis E264] (186 aa)
Score = 106, Expect = 1.3e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|161369955|ref|ZP_02109523.1| single-strand DNA-binding protein [Burkholderia pseudomallei 1710a] (185 aa)
Score = 106, Expect = 1.3e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|38640325|ref|NP_944246.1| Bcep22gp17 [Burkholderia phage Bcep22] >gi|33860392|gb|AAQ54952.1| Bcep22gp17 [Burkholderia phage Bcep22] (169 aa)
Score = 106, Expect = 1.3e-03, Identities = 29/99 (29%), Positives = 54/99 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S    ++  + R++ +G++A  V   L+ G SV++EGR+ T K  ++S     +  Y  +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDIKEATEWHRVSFFGRLAEIVDEHLRKGASVYIEGRIKTRKWQDQS----GQDRYTTEIVADRM 105
>gi|38637996|ref|NP_942970.1| single-strand DNA-binding protein [Ralstonia eutropha H16] >gi|37999359|sp|P59927|SSB_RALEH Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|32527334|gb|AAP86084.1| putative single-strand binding protein [Ralstonia eutropha] (188 aa)
Score = 106, Expect = 1.5e-03, Identities = 28/99 (28%), Positives = 54/99 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  +A  D      S    ++  + R++ +GK+A      L+ G SV++EGR+ T K  ++S     +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYMPSGDAVANLRIATTDRYKDKQSGEMKEATEWHRVSMFGKLAEIAGQYLRKGSSVYIEGRIRTRKWQDQS----GQDKYSTEIVADQM 105
>gi|163846448|ref|YP_001634492.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] >gi|187603188|ref|ZP_02989408.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] >gi|163667737|gb|ABY34103.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] >gi|187484843|gb|EDU22824.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] (176 aa)
Score = 106, Expect = 1.5e-03, Identities = 36/114 (31%), Positives = 58/114 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSG-FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA----------DKVYRPDEENSLEQPVDK 114
           +N+V L G L  DP    T   +   +F +A      D  G  ++   + R+ AW K+       L  G  V+VEGRL T K  +R    + +  Y  +VIA          ++   PD E + ++P+D+
  S:     5 LNKVQLTGHLGADPEMRYTAQGSAVTTFRVASNRTWRDKDGNTHEETEWFRVVAWDKLGEICNQYLTKGTRVYVEGRLQTRKWTDR----DGQDRYTTEVIAQDMIILSPKGERGPIPDAEPAYDEPMDE 130
>gi|148654987|ref|YP_001275192.1| single-strand binding protein [Roseiflexus sp. RS-1] >gi|148567097|gb|ABQ89242.1| single-strand binding protein [Roseiflexus sp. RS-1] (176 aa)
Score = 105, Expect = 1.6e-03, Identities = 33/96 (34%), Positives = 49/96 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS--SG---FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP    T   +   +F +A   S  SG    +D   + RI AW K+A      LK G  V++EGRL T   ++R+     +  Y  +V+A
  S:     5 LNKVMLTGHLGADPEMRFTPQGSAVTTFRVASNRSWKSGDGVQHDDTEWFRIVAWDKLAEICNEYLKKGTRVYIEGRLQTRSWDDRN---TGEKRYITEVVA 103
>gi|77918257|ref|YP_356072.1| ssDNA-binding protein [Pelobacter carbinolicus DSM 2380] >gi|77544340|gb|ABA87902.1| ssDNA-binding protein [Pelobacter carbinolicus DSM 2380] (157 aa)
Score = 105, Expect = 1.6e-03, Identities = 35/107 (32%), Positives = 56/107 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY---RPDEENS 107
           +N+V L G L  DP    T +    A+FSLA  +     D  S     +  I AW ++A      L  G  V++EG++ T    +R  D N +  Y  +++AD++    RP ++NS
  S:     3 VNKVILVGNLGKDPELRYTASGTAVANFSLATTERYKDRDGNSQEKTEWHNIVAWRQLAEICGKYLSKGRQVYIEGKIQTRSYEDR--DGNRR--YITEIVADQMQMLGRPGDDNS 114
>gi|125973865|ref|YP_001037775.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] >gi|125714090|gb|ABN52582.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] (134 aa)
Score = 105, Expect = 1.6e-03, Identities = 33/103 (32%), Positives = 45/103 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPD 103
           MN+V L G+L+ DP    T T      F LA        G  +   +  I AW K   F     + G  V + GRL     N   D+  +K T   ++IAD+ Y  D
  S:     1 MNKVILMGRLTQDPELRHTTTGKAVCHFRLAVNRRFSRQGEQEQADFFPIVAWEKTGEFCNNYFRKGQQVAIIGRLQNRSWN---DEQGNKRTIT-EIIADEAYFAD 103
>gi|158319095|ref|YP_001511602.1| single-strand binding protein [Alkaliphilus oremlandii OhILAs] >gi|158139294|gb|ABW17606.1| single-strand binding protein [Alkaliphilus oremlandii OhILAs] (137 aa)
Score = 105, Expect = 1.9e-03, Identities = 32/99 (32%), Positives = 45/99 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP    T +    A+FS+A            +  I  WGK A      L  G  V +EGRL +     ++ +      Y  +VIAD+V
  S:     1 MNRVILIGRLARDPELRFTASGKAVATFSIAVNRPFSKEKEADFFNIVVWGKSAENCANYLSKGRLVGLEGRLQSRSYETQTGEKR----YITEVIADQV 96
>gi|196249488|ref|ZP_03148185.1| single-strand binding protein [Geobacillus sp. G11MC16] >gi|196210782|gb|EDY05544.1| single-strand binding protein [Geobacillus sp. G11MC16] (165 aa)
Score = 105, Expect = 1.9e-03, Identities = 34/97 (35%), Positives = 51/97 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACI----DSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +NRV L G+L+ DP    T +     +F+LA      + +G  ++  +IR  AW K A  +   LK G  V ++GRL T      S + N + TY  QV+ D
  S:     2 INRVILTGRLTDDPQFRYTPSGMAVVTFTLAVTRPFANQNGVREA-DFIRCVAWRKQAENIANYLKKGSMVGIDGRLETG-----SYERNGRRTYYTQVVVD 97
>gi|167917517|ref|ZP_02504608.1| single-strand DNA-binding protein [Burkholderia pseudomallei BCC215] (140 aa)
Score = 105, Expect = 1.9e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167568742|ref|ZP_02361616.1| single-strand DNA-binding protein [Burkholderia oklahomensis C6786] (155 aa)
Score = 105, Expect = 2.0e-03, Identities = 30/99 (30%), Positives = 54/99 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K  ++    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQSQ----DGQDRYSTEIVADQM 105
>gi|167585450|ref|ZP_02377838.1| single-strand DNA-binding protein [Burkholderia ubonensis Bu] (159 aa)
Score = 104, Expect = 2.1e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167773045|ref|ZP_02445098.1| hypothetical protein ANACOL_04434 [Anaerotruncus colihominis DSM 17241] >gi|167664978|gb|EDS09108.1| hypothetical protein ANACOL_04434 [Anaerotruncus colihominis DSM 17241] (152 aa)
Score = 104, Expect = 2.3e-03, Identities = 32/105 (30%), Positives = 48/105 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEE 105
           +NR  L G+L  DP   QT       SF +A     +S G      ++ I AW + A FV      G  + +EG + T       +D N     A++++AD VY  D +
  S:     2 LNRAILMGRLVADPELRQTPNGVSVTSFRIAVDRNFNSKGGERQADFLDIVAWRQTAEFVTRYFTKGRMIALEGSIQTRNY----EDKNGNKRTAVEIVADNVYFADSK 106
>gi|113866431|ref|YP_724920.1| single-strand DNA-binding protein [Ralstonia eutropha H16] >gi|113525207|emb|CAJ91552.1| Single-strand binding protein [Ralstonia eutropha H16] (179 aa)
Score = 104, Expect = 2.3e-03, Identities = 28/99 (28%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +   +  LA  D      S    ++  + R++ +GK+A      L+ G SV++EGR+ T K  ++S     +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPETRYLPSGDAVTNIRLATTDRYKDKQSGEMKEATEWHRVSFFGKIAEIAGQYLRKGSSVYIEGRIRTRKWQDQS----GQDKYSTEIVADQM 105
>gi|118578644|ref|YP_899894.1| single-strand binding protein [Pelobacter propionicus DSM 2379] >gi|118501354|gb|ABK97836.1| single-strand binding protein [Pelobacter propionicus DSM 2379] (139 aa)
Score = 104, Expect = 2.3e-03, Identities = 33/99 (33%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP    T      ASFSLA  +       +  IR T W  +  +          L  G SV+++G+L T K  +R    + K  Y  ++I DK+
  S:     4 LNRVELIGNLGRDPEIRYTPGGTAVASFSLATSEKVKTKSGEWEIR-TEWHNIVLYARLAEVAGEYLTKGKSVYLDGKLKTRKWQDR----DGKDRYTTEIIGDKL 104
>gi|167835402|ref|ZP_02462285.1| single-strand DNA-binding protein [Burkholderia thailandensis MSMB43] (138 aa)
Score = 104, Expect = 2.4e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|156741509|ref|YP_001431638.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] >gi|156232837|gb|ABU57620.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] (152 aa)
Score = 104, Expect = 2.5e-03, Identities = 28/96 (29%), Positives = 46/96 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSG-FNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V + G+L  DP    T   +   +FS+A      D SG  ++   +  +  W K+A      L+    V++EGRL T       +D N    Y  +V+A
  S:     5 LNKVMIIGRLGKDPEMRHTPGGSPVTTFSVATGRQWKDGSGELHEETEWFNVVTWNKLAEICYEHLRKSSRVYIEGRLQT----RHWEDQNGVTHYRTEVVA 102
>gi|156740055|ref|YP_001430184.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] >gi|156231383|gb|ABU56166.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] (175 aa)
Score = 104, Expect = 2.5e-03, Identities = 33/96 (34%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS--SG---FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP    T   +   +F +A   S  SG    +D   + RI AW K+A      LK G  V++EGRL T    +R+     +  Y  +V+A
  S:     5 LNKVMLTGHLGADPEMRFTPQGSAVTTFRVASNRSWKSGDGIQHDDTEWFRIVAWDKLAEICNEYLKKGTRVYIEGRLQTRSWEDRN---TGEKRYMTEVVA 103
>gi|167561513|ref|ZP_02354429.1| single-strand DNA-binding protein [Burkholderia oklahomensis EO147] (140 aa)
Score = 104, Expect = 2.5e-03, Identities = 32/99 (32%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K    S D   +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQ--SQDGQDR--YSTEIVADQM 105
>gi|134288159|ref|YP_001110322.1| single-strand binding protein [Burkholderia vietnamiensis G4] >gi|134132809|gb|ABO59519.1| single-strand binding protein [Burkholderia vietnamiensis G4] (175 aa)
Score = 104, Expect = 2.5e-03, Identities = 31/99 (31%), Positives = 55/99 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLST--YKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S    D+  + R++ +G++A  V   LK G SV++EGR+ T  Y+  + SD       Y+ +++A+++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKQSGEMRDATEWHRVSFFGRLAEIVSEYLKKGSSVYIEGRIRTRKYQAQDGSD------RYSTEIVAEQM 105
>gi|160944121|ref|ZP_02091351.1| hypothetical protein FAEPRAM212_01623 [Faecalibacterium prausnitzii M21/2] >gi|158444797|gb|EDP21801.1| hypothetical protein FAEPRAM212_01623 [Faecalibacterium prausnitzii M21/2] (159 aa)
Score = 104, Expect = 2.6e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N V + G+L+ DP   QT T    ASF +AC    G  D+       +I + AW + A FV    + G  + V+GRL + +  +++    +    A++V+A+ +
  S:     2 LNVVAIMGRLARDPEMRQTTTGKNVASFRIAC--DRGRRDANGQSVADWIDVVAWDRQAEFVCRYFQKGSLIVVDGRLQSRQYQDKTGANRT----AVEVVANNI 100
>gi|94969250|ref|YP_591298.1| single-strand binding protein [Acidobacteria bacterium Ellin345] >gi|94551300|gb|ABF41224.1| single-strand binding protein [Acidobacteria bacterium Ellin345] (164 aa)
Score = 103, Expect = 2.7e-03, Identities = 31/99 (31%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G +  DP    T      A FS+A      D  G + D   +  ITAW K+A  V   +K G+ +++EGRL T   ++  D    +  Y  +++A+ +
  S:     5 VNKVILVGNVGKDPEVKYTPQGTAIARFSVATSERFKDKQGEWQDRTEWHSITAWQKLAEIVGEYVKKGNKIYIEGRLRT---DSWDDQKTGEKKYRTEIVANDI 106
>gi|167814169|ref|ZP_02445849.1| single-strand DNA-binding protein [Burkholderia pseudomallei 91] >gi|167901271|ref|ZP_02488476.1| single-strand DNA-binding protein [Burkholderia pseudomallei NCTC 13177] (144 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167617864|ref|ZP_02386495.1| single-strand DNA-binding protein [Burkholderia thailandensis Bt4] (159 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167579789|ref|ZP_02372663.1| single-strand DNA-binding protein [Burkholderia thailandensis TXDOH] (132 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167844266|ref|ZP_02469774.1| single-strand DNA-binding protein [Burkholderia pseudomallei B7210] (136 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167822691|ref|ZP_02454162.1| single-strand DNA-binding protein [Burkholderia pseudomallei 9] (125 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167718044|ref|ZP_02401280.1| single-strand DNA-binding protein [Burkholderia pseudomallei DM98] >gi|167737060|ref|ZP_02409834.1| single-strand DNA-binding protein [Burkholderia pseudomallei 14] (130 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/99 (30%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|167771964|ref|ZP_02444017.1| hypothetical protein ANACOL_03337 [Anaerotruncus colihominis DSM 17241] >gi|167665762|gb|EDS09892.1| hypothetical protein ANACOL_03337 [Anaerotruncus colihominis DSM 17241] (138 aa)
Score = 103, Expect = 2.9e-03, Identities = 33/106 (31%), Positives = 52/106 (49%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS---YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N V + G+L+ DP   QT +     SFSLAC       + +S   +  + AW   A      L  G  V VEGRL T K    +DD  ++  + ++++A  ++  D + S
  S:     3 NHVGIMGRLTADPELRQTVSGLAVTSFSLACQRGRKGPNGESAADFFTVVAWRGTAELAAKYLTKGRLVVVEGRLQTRKWV--ADDGTNR--HVVEIVASAIHFADSKKS 108
>gi|114332412|ref|YP_748634.1| single-strand binding protein [Nitrosomonas eutropha C91] >gi|114309426|gb|ABI60669.1| single-strand binding protein [Nitrosomonas eutropha C91] (155 aa)
Score = 103, Expect = 2.9e-03, Identities = 29/99 (29%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+ ++A  D+     G    ++ + RI  +GK+A      LK G  +++EGRL T K  ++S+       Y  +++AD++
  S:     4 LNKVMLIGNLGRDPEIRYMPSGDAMANLNIATTDTWKDKGGEKQERTEWHRIVMFGKLAEITGEYLKKGSQIYIEGRLQTRKWTDKSN----VERYTTEIVADRM 104
>gi|167757398|ref|ZP_02429525.1| hypothetical protein CLORAM_02948 [Clostridium ramosum DSM 1402] >gi|167703573|gb|EDS18152.1| hypothetical protein CLORAM_02948 [Clostridium ramosum DSM 1402] (153 aa)
Score = 103, Expect = 3.0e-03, Identities = 35/117 (29%), Positives = 52/117 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATV 117
           +NRV L G+++ +P   +T+  +   SF+LA      S        +I    W K A  V      G  V VEG++ T       DD + K  + ++V  D V   D  N  E P+D   V
  S:     2 INRVVLVGRMTRNPELRRTQQGDAVTSFTLAVNRNFTSGDGQRQADFINCVVWRKPAENVERYCSKGSLVGVEGKIQTRTY----DDKDGKTVFVVEVRCDSVQFLDTRNQNEAPMDTQKV 118
>gi|189423327|ref|YP_001950504.1| single-strand binding protein [Geobacter lovleyi SZ] >gi|189419586|gb|ACD93984.1| single-strand binding protein [Geobacter lovleyi SZ] (139 aa)
Score = 103, Expect = 3.1e-03, Identities = 32/99 (32%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP    T      ASFSLA  +       +  +R T W  +  +          L  G SV+++G+L T K  +R    + K  Y  ++I DK+
  S:     4 LNRVELIGNLGRDPEIRYTPGGTAVASFSLATSEKVKTKSGEWEVR-TEWHNIVLYARLAEVAGEYLSKGKSVYLDGKLKTRKWQDR----DGKDRYTTEIIGDKL 104
>gi|157363692|ref|YP_001470459.1| single-strand binding protein [Thermotoga lettingae TMO] >gi|157314296|gb|ABV33395.1| single-strand binding protein [Thermotoga lettingae TMO] (144 aa)
Score = 103, Expect = 3.3e-03, Identities = 30/80 (37%), Positives = 43/80 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC-----IDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNR 80
            N+V L G+++ DP    T +    ASFSLA       ++S    +  +IRI A+ K+A F  L LK G  + VEG L   +   R
  S:     4 FNKVILVGRITRDPEIRFTTSGKGVASFSLAVDRPTRANASSDQQTTDFIRIVAFNKLADFAKLYLKKGLLILVEGELRLQRWQAR 89
>gi|56550592|ref|YP_161658.1| single-strand DNA-binding protein [Ralstonia metallidurans CH34] >gi|94152685|ref|YP_582087.1| single-strand DNA-binding protein [Ralstonia metallidurans CH34] >gi|56410298|emb|CAI30180.1| putative single-strand binding protein SSB [Ralstonia metallidurans CH34] >gi|93359051|gb|ABF13137.1| single-strand binding protein [Ralstonia metallidurans CH34] (190 aa)
Score = 103, Expect = 3.3e-03, Identities = 29/99 (29%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +   +  +A  D      S+ F ++  + RI  +GK+A      L+ G SV++EGR+ T K      D + +  Y+ +++AD++
  S:     4 VNKVILVGNLGADPETRYLPSGDAVTNIRIATTDRYKDKQSNEFKEATEWHRIAFFGKLAEIAGQYLRKGSSVYIEGRIRTRKWQ----DQSGQDKYSTEIVADQM 105
>gi|71906123|ref|YP_283710.1| single-strand binding protein [Dechloromonas aromatica RCB] >gi|71845744|gb|AAZ45240.1| Single-strand binding protein [Dechloromonas aromatica RCB] (156 aa)
Score = 103, Expect = 3.4e-03, Identities = 31/97 (31%), Positives = 50/97 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+    G L  DP    T +     +FS+AC +S  + D ++        ++RI+A+GK+A      LK G  V+VEG L T K      D + +  Y  ++  D
  S:     4 VNKWIGIGNLGRDPETRFTASGEAICNFSIACTES--WKDKQTGERKEMTEWVRISAFGKLAEICSQYLKKGSQVYVEGSLRTRKWT----DKDGQERYTTEIRCD 103
>gi|196229511|ref|ZP_03128376.1| single-strand binding protein [Chthoniobacter flavus Ellin428] >gi|196226743|gb|EDY21248.1| single-strand binding protein [Chthoniobacter flavus Ellin428] (181 aa)
Score = 103, Expect = 3.4e-03, Identities = 30/99 (30%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC-----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L+ DP    T      A   LA       ++    +  ++I +T WG+VA  V    K G  +FVEGRL   +++   D    +    L+V+ D +
  S:     4 LNKVMLIGNLTRDPEIKYTPKGTAIADIGLAVNRNYTTETGEKREEVTFIDVTLWGRVAEIVGEYCKKGRPLFVEGRL---QLDTWDDKQTGQKRSKLKVVGDNI 105
>gi|39997249|ref|NP_953200.1| single-strand binding protein [Geobacter sulfurreducens PCA] >gi|39984139|gb|AAR35527.1| single-strand binding protein [Geobacter sulfurreducens PCA] (139 aa)
Score = 103, Expect = 3.4e-03, Identities = 33/99 (33%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP    T      ASFSLA  +    N S  +   T W  +  +          L  G SV+++G+L T K  +R    + K  Y  ++I DK+
  S:     4 LNRVELIGNLGRDPEIRYTPGGTAVASFSLATSEKV-KNKSGEWETRTEWHNIVLYARLAEVAGEYLSKGKSVYLDGKLKTRKWQDR----DGKDRYTTEIIGDKL 104
>gi|170734122|ref|YP_001766069.1| single-strand binding protein [Burkholderia cenocepacia MC0-3] >gi|169817364|gb|ACA91947.1| single-strand binding protein [Burkholderia cenocepacia MC0-3] (183 aa)
Score = 102, Expect = 3.5e-03, Identities = 29/99 (29%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++A+++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVAEQM 105
>gi|107023710|ref|YP_622037.1| single-strand DNA-binding protein [Burkholderia cenocepacia AU 1054] >gi|116690797|ref|YP_836420.1| single-strand DNA-binding protein [Burkholderia cenocepacia HI2424] >gi|194558184|ref|YP_002093210.1| Single-strand binding protein [Burkholderia cenocepacia PC184] >gi|105893899|gb|ABF77064.1| single-strand binding protein [Burkholderia cenocepacia AU 1054] >gi|116648886|gb|ABK09527.1| single-strand binding protein [Burkholderia cenocepacia HI2424] >gi|124871975|gb|EAY63691.1| Single-strand binding protein [Burkholderia cenocepacia PC184] (184 aa)
Score = 102, Expect = 3.5e-03, Identities = 29/99 (29%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +    + +  Y+ +++A+++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQ----DGQDRYSTEIVAEQM 105
>gi|73540075|ref|YP_294595.1| single-strand DNA-binding protein [Ralstonia eutropha JMP134] >gi|72117488|gb|AAZ59751.1| Single-strand binding protein [Ralstonia eutropha JMP134] (181 aa)
Score = 102, Expect = 3.7e-03, Identities = 27/99 (27%), Positives = 52/99 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +   +  LA  D      S    ++  + R+  +GK+A      L+ G SV++EG++ T K  ++S     +  Y+ +++AD++
  S:     4 INKVILVGNLGADPETRYMPSGDAVTNLRLATTDRYKDKQSGEMKEATEWHRVAMFGKLAEIAAQYLRKGSSVYIEGKIRTRKWQDQS----GQDKYSTEIVADQM 105
>gi|167759136|ref|ZP_02431263.1| hypothetical protein CLOSCI_01483 [Clostridium scindens ATCC 35704] >gi|167663254|gb|EDS07384.1| hypothetical protein CLOSCI_01483 [Clostridium scindens ATCC 35704] (143 aa)
Score = 102, Expect = 3.9e-03, Identities = 32/98 (32%), Positives = 48/98 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSGFNDSKS---YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           MN+V L G+L+ DPN   +  NN     ++A     +D  G  D +    +I   A+G+   F    LK G  V V GR+ T    NR    + +  Y   VI ++
  S:     1 MNKVILMGRLTRDPNVRYSPRNNSQEEMAIARYTLAVDRRGAKDGQQSADFISCVAFGRDGEFAEKYLKQGTKVVVTGRIQTGSYTNR----DGQKVYTTDVIVEE 102
>gi|124265304|ref|YP_001019308.1| single-strand binding protein [Methylibium petroleiphilum PM1] >gi|124258079|gb|ABM93073.1| single-strand binding protein [Methylibium petroleiphilum PM1] (173 aa)
Score = 102, Expect = 4.4e-03, Identities = 31/99 (31%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF-------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T + +   + SLA   +    DS   +  T W +V  +          LK G  V+VEGRL T K      D +    Y  ++IA+++
  S:     4 INKVILIGNLGRDPEVRYTPSGSAVCNISLATTRNWKSKDSGDKVEETEWHRVVFYDRLAEIAGEYLKKGRPVYVEGRLKTRKWQ----DKDGAEKYTTEIIAEQM 105
>gi|121998963|ref|YP_001003750.1| single-strand binding protein [Halorhodospira halophila SL1] >gi|121590368|gb|ABM62948.1| single-strand binding protein [Halorhodospira halophila SL1] (160 aa)
Score = 101, Expect = 4.8e-03, Identities = 29/99 (29%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T + +  A+ +LA  D+     +      T W +V  F          L+ G  V++EGRL T K      D N +  Y  +++A+++
  S:     6 VNKVILIGNLGRDPEVRYTASGSAVANVALATSDTWRDRQTGEQQERTEWHRVVMFNRLGEIAGEYLRKGSKVYIEGRLQTRKWQ----DQNGQDRYTTEIVANEM 107
>gi|196251062|ref|ZP_03149743.1| single-strand binding protein [Geobacillus sp. G11MC16] >gi|196209434|gb|EDY04212.1| single-strand binding protein [Geobacillus sp. G11MC16] (164 aa)
Score = 101, Expect = 5.2e-03, Identities = 34/97 (35%), Positives = 50/97 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACI----DSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +NRV L G+L+ DP    T +     +F LA      + +G  ++  +IR  AW K A  +   LK G  V ++GRL T      S + N + TY  QV+ D
  S:     2 INRVILTGRLTDDPQFRYTPSGVAVVTFILAVTRPFANQNGVREA-DFIRCVAWRKQAENIANYLKKGSMVGIDGRLETG-----SYERNGRRTYYTQVVVD 97
>gi|114568044|ref|YP_755198.1| single-strand binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338979|gb|ABI69827.1| single-strand binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (150 aa)
Score = 101, Expect = 5.5e-03, Identities = 29/99 (29%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T+     A+F+LA +D     +   +I I  W K A      L  G  V +EGR+     +N+      +  +  +V+A+ V
  S:     2 LNRVILIGRLTKDPELRYTQNGTAVATFTLA-VDRKYKREETDFIPIVVWAKQAENCANYLNKGSLVAIEGRIQVRTYDNQE----GQRRWVTEVVAEDV 96
>gi|169832352|ref|YP_001718334.1| single-strand binding protein [Candidatus Desulforudis audaxviator MP104C] >gi|169639196|gb|ACA60702.1| single-strand binding protein [Candidatus Desulforudis audaxviator MP104C] (142 aa)
Score = 101, Expect = 5.6e-03, Identities = 37/120 (30%), Positives = 58/120 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDS 120
           +N++ L G+L+ DP    T +    A F++A     +D  G N    +I + AW K+  +    L  G  V VEGRL   ++ +  D+   +   A +VIAD V   D    L  P D+   + S
  S:     2 LNKIILIGRLARDPELRYTPSGTPVAGFTVAVDRPFVDKQG-NRGTDFIDVVAWRKLGETCARHLGKGRLVCVEGRL---ELRSYEDNQGIRRKVA-EVIADNVRFLDGPRGLGTPHDQNEQVKS 121
>gi|118594328|ref|ZP_01551675.1| Single-strand binding protein family [Methylophilales bacterium HTCC2181] >gi|118440106|gb|EAV46733.1| Single-strand binding protein family [Methylophilales bacterium HTCC2181] (148 aa)
Score = 101, Expect = 5.8e-03, Identities = 32/99 (32%), Positives = 52/99 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKS-YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G+L  DP    T       SF++A      D  G N  ++ +  I+ +GK+A      LK G  V++EGRL T K      + + +  Y  Q++AD++
  S:     3 VNKVILVGRLGRDPEARYTANQQPICSFAVATSRRYKDKEGNNQEQTEWHNISMFGKLAEIGNQYLKKGSQVYLEGRLQTNK-----SEKDGQTRYFTQIVADQM 102
>gi|15895648|ref|NP_348997.1| single-strand DNA-binding protein [Clostridium acetobutylicum ATCC 824] >gi|15025394|gb|AAK80337.1|AE007738_5 Single-strand DNA-binding protein, ssb [Clostridium acetobutylicum ATCC 824] (229 aa)
Score = 100, Expect = 6.0e-03, Identities = 37/111 (33%), Positives = 58/111 (52%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS--LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYR-PDEENSLEQPV 112
           N++FL G   F   K   RT   G   S  L  ++ S +N S  YI   AWG+ + F  TLK GD++ + GRL + +   + ++ ++    A +V   K+ R  DEEN+ E  +
  S:   107 NQIFLDG---FICKKPVYRTTPFGREISDMLLAVNRS-YNKS-DYIPTIAWGRNSRFCETLKVGDNIRIWGRLQSREYQKKVNEKDTVKKTAYEVSISKMERVGDEENAEEANI 215
>gi|169351669|ref|ZP_02868607.1| hypothetical protein CLOSPI_02450 [Clostridium spiroforme DSM 1552] >gi|169291891|gb|EDS74024.1| hypothetical protein CLOSPI_02450 [Clostridium spiroforme DSM 1552] (153 aa)
Score = 100, Expect = 6.0e-03, Identities = 45/149 (30%), Positives = 66/149 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS---YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY----RPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDI 149
           +NRV L G+++ DP   +T   +   SF+LA   +    D +    +I    W K A  V      G  V VEGR+ T       D+   +  Y ++VI D V     R   E +  QP  +    +  F   KT   E E   +F  + D  +DDI
  S:     2 INRVVLVGRMTRDPELRRTPQGDAVTSFTLAVNRNYTSRDGQQQADFINCVVWRKPAENVERYCSKGSLVGVEGRIQTRSY----DNSQGQKVYVVEVICDSVQFLETRAARERAQSQPQMQQN--NDNFYDMKTVELEKEFDNSFN-TYDIMEDDI 151
>gi|26553569|ref|NP_757503.1| single-strand DNA binding protein [Mycoplasma penetrans HF-2] >gi|37999433|sp|Q8EWT6|SSB_MYCPE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|26453575|dbj|BAC43907.1| single-strand DNA binding protein [Mycoplasma penetrans HF-2] (189 aa)
Score = 100, Expect = 6.3e-03, Identities = 37/149 (24%), Positives = 71/149 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDI 149
           MN+VF+ G+L+ DP +  T+     +  S+A  D+   N++  +    AW   A+F+ + L  GD V ++G+L      ++      K  Y ++++ + +     +NS     + A+ ID  +    TN   N  +Q   +S+ +  DD 
  S:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETY-FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE----GKTVYVIEIVIESIKPLSSKNS----NNAASSIDKNY--NPTNTKNNNYSQQSNMSVSEAMDDF 139
>gi|118577324|ref|YP_899564.1| single-strand binding protein [Pelobacter propionicus DSM 2379] >gi|118504829|gb|ABL01311.1| single-strand binding protein [Pelobacter propionicus DSM 2379] (143 aa)
Score = 100, Expect = 6.9e-03, Identities = 30/99 (30%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID----SSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L   L  DP    T +    AS S+A  +    SSG + D   + R+  W + A      L  G SV++EGRL T     R  + +    Y  +++ +K+
  S:     4 LNKVMLIAALGKDPEVRYTSSGTAVASLSVATTEKTKNSSGEWEDRTEWHRVVFWARQAEIAGEYLSKGKSVYIEGRLQT-----REYEKDGIKRYTTEIVGEKL 103
>gi|160915231|ref|ZP_02077444.1| hypothetical protein EUBDOL_01239 [Eubacterium dolichum DSM 3991] >gi|158433030|gb|EDP11319.1| hypothetical protein EUBDOL_01239 [Eubacterium dolichum DSM 3991] (158 aa)
Score = 100, Expect = 7.7e-03, Identities = 33/99 (33%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+++ DP   +T +     +F+LA    I   G  D+  +I   AW  VA  +    K G  + VEGR+ T   ++RS     K  Y  +V+ D V
  S:     2 INRVVLVGRITKDPVLRKTTSGISVVAFTLAVNRRIKKEGQPDA-DFINCQAWQGVADVLHKYTKKGSLIGVEGRIQTRSYDDRS----GKRVYVTEVVVDSV 99
>gi|121535340|ref|ZP_01667152.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] >gi|121306032|gb|EAX46962.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] (134 aa)
Score = 99, Expect = 7.8e-03, Identities = 29/72 (40%), Positives = 38/72 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC--IDSSGFNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRL 72
           MN+V L G+L+ DP    T+T    ASF+LA     S G      +I I AW ++A      L  G  + VEGRL
  S:     1 MNKVILVGRLAQDPEVRYTQTGKAVASFNLAVNRYVSQG-QQQTDFIPIVAWERLAETCGNNLTKGQRILVEGRL 74
>gi|148657504|ref|YP_001277709.1| single-strand binding protein [Roseiflexus sp. RS-1] >gi|148569614|gb|ABQ91759.1| single-strand binding protein [Roseiflexus sp. RS-1] (151 aa)
Score = 99, Expect = 8.0e-03, Identities = 28/96 (29%), Positives = 46/96 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSG-FNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V + G+L  DP    T   +   +FS+A      D SG  ++   +  +  W K+A      L+    V++EGRL T       +D N    Y  +V+A
  S:     5 LNKVMIIGRLGKDPEMRYTPGGSPVTTFSVATGRQWKDGSGELHEETEWFNVVTWNKLAEICHEHLRKSSRVYIEGRLQT----RHWEDQNGVTHYRTEVVA 102
>gi|110598256|ref|ZP_01386532.1| single-strand binding protein [Chlorobium ferrooxidans DSM 13031] >gi|110340171|gb|EAT58670.1| single-strand binding protein [Chlorobium ferrooxidans DSM 13031] (185 aa)
Score = 99, Expect = 8.3e-03, Identities = 30/96 (31%), Positives = 50/96 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNS-KATYALQVIA 96
           +N+V L G+L  DP   Q  +N +  +F++A  ++  F D++        +  I  WG++       L  G  V++EG+L T       DDP S +  YA  +I 
  S:    21 LNKVMLIGRLGKDPVSRQAGSNTV-CNFTIATSET--FKDAQGSKQERTEWHNIAVWGRLGEICQQYLTKGREVYIEGKLQTRSW----DDPKSGEKKYATDIIC 118
>gi|37912973|gb|AAR05305.1| predicted single-stranded DNA-binding protein [uncultured marine gamma proteobacterium EB000-45B06] >gi|40063204|gb|AAR38041.1| single-strand binding protein [uncultured marine bacterium 562] (146 aa)
Score = 99, Expect = 8.5e-03, Identities = 29/81 (35%), Positives = 45/81 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRS 81
           +N+V L G L   P    T T +  A+ S+A  +S     SG   D   + ++  +GK+A  V   L  G SV++EG+L T K  ++S
  S:     5 VNKVILVGNLGQKPEMRYTATQSAVANISIATTESWKDKESGEMRDKTEWHKVVYFGKLAEIVEKYLDKGSSVYIEGKLQTRKWQDKS 92
>gi|138896484|ref|YP_001126937.1| single-strand DNA binding protein [Geobacillus thermodenitrificans NG80-2] >gi|134267997|gb|ABO68192.1| Single-strand DNA binding protein [Geobacillus thermodenitrificans NG80-2] (165 aa)
Score = 99, Expect = 8.6e-03, Identities = 33/97 (34%), Positives = 50/97 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACI----DSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +NRV L G+L+ DP    T +     +F+LA      + +G  ++  +IR  AW K A  +   LK G  V ++GRL T      S + N +  Y  QV+ D
  S:     2 INRVILTGRLTDDPQFRYTPSGVAVVTFTLAVTRPFANQNGVREA-DFIRCVAWRKQAENIANYLKKGSMVGIDGRLETG-----SYERNGRRVYYTQVVVD 97
>gi|160931687|ref|ZP_02079081.1| hypothetical protein CLOLEP_00518 [Clostridium leptum DSM 753] >gi|156869332|gb|EDO62704.1| hypothetical protein CLOLEP_00518 [Clostridium leptum DSM 753] (150 aa)
Score = 99, Expect = 9.0e-03, Identities = 34/110 (30%), Positives = 52/110 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS---SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY--RPDEENSLEQ 110
           +N   L G+L+ DP    T ++    SF+LA   S   SG +    +I I AW   A FV      G  V V+G + T    ++  +       A +V+AD V+   P  ++S  Q
  S:     2 LNTAILMGRLTADPELRHTPSDVAVTSFTLAVDRSYVKSGADRQVDFIDIVAWRSTAEFVCRYFHKGQLVAVQGSIQTRSYTDKEGNKRK----AFEVVADNVHFAEPKRDSSYSQ 113
>gi|149926622|ref|ZP_01914882.1| single-strand binding protein [Limnobacter sp. MED105] >gi|149824551|gb|EDM83767.1| single-strand binding protein [Limnobacter sp. MED105] (169 aa)
Score = 99, Expect = 9.2e-03, Identities = 32/99 (32%), Positives = 52/99 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP+       + GA  +LA   SS + D  +        + R+  +G++A       K G SV++EGRL T K  ++S        Y  ++IAD++
  S:     4 VNKVILVGNLGKDPD--VRYLPDGGAVVNLALATSSSWKDKNTGEKREETEWHRVVIYGRLAEIAGEYCKKGRSVYIEGRLKTRKWQDQS----GVDKYTTEIIADQM 105
>gi|68248857|ref|YP_247969.1| single-strand DNA-binding protein [Haemophilus influenzae 86-028NP] >gi|68057056|gb|AAX87309.1| Single-strand binding protein [Haemophilus influenzae 86-028NP] (168 aa)
Score = 99, Expect = 9.4e-03, Identities = 45/149 (30%), Positives = 71/149 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN----------ATENELAQAFPISLDDEDDDI 149
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  YA ++  D  ++     +N+     D      S + A +TN          A +    QA P  +D  DDDI
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYATEIQGDVMQMLGGRNQNASGSGNDMGGTPQSSYQARQTNNGNSYQSSRPAPQQSAPQAEP-PMDGFDDDI 166
>gi|30250374|ref|NP_842444.1| single-strand binding protein family [Nitrosomonas europaea ATCC 19718] >gi|37999371|sp|Q82S98|SSB_NITEU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|30181169|emb|CAD86365.1| Single-strand binding protein family [Nitrosomonas europaea ATCC 19718] (149 aa)
Score = 99, Expect = 9.6e-03, Identities = 28/99 (28%), Positives = 52/99 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+ ++A  D+     G    ++ + R+  +GK A      LK G  +++EGRL T K  ++S+       Y  +++AD++
  S:     4 LNKVMLIGNLGRDPEIRYMPSGDAMANLNIATTDTWKDKGGEKQERTEWHRVVMFGKQAEIAGEYLKKGSQIYIEGRLQTRKWTDKSN----VERYTTEIVADRM 104
>gi|163867787|ref|YP_001608991.1| single-strand binding protein (ssb) [Bartonella tribocorum CIP 105476] >gi|161017438|emb|CAK00996.1| single-strand binding protein (ssb) [Bartonella tribocorum CIP 105476] (152 aa)
Score = 98, Expect = 1.0e-02, Identities = 29/83 (34%), Positives = 45/83 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGA---SFSLACIDSSGFNDSKSYIRITAWGKVASF--------VLTLKPGDSVFVEGRLSTYKMNNRSDD 83
           +N+V L G L  DP   +++T N GA   +F LA  +S    ++   +  T W  V  F        +  L  G  V+VEG+L T K  +++D 
  S:     7 LNKVILIGYLGADP---ESKTMNSGAEIVNFRLATSESYTDKNTHQKVEKTEWHSVVVFNPYLAKIALQYLSKGSKVYVEGKLQTRKWQDKNDH 97
>gi|77361620|ref|YP_341195.1| single-strand binding protein (SSB) (helix-destabilizing protein) [Pseudoalteromonas haloplanktis TAC125] >gi|76876531|emb|CAI87753.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Pseudoalteromonas haloplanktis TAC125] (244 aa)
Score = 98, Expect = 1.0e-02, Identities = 30/97 (30%), Positives = 46/97 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP        N  A+ +LA  DS          D   + R+  +GK+A  V    + G  ++VEG+L T K      DP  +  Y  +++ D
  S:     5 VNKVILVGNLGQDPEVRYMPNGNGVANITLATSDSYKDKNTGQMVDKTEWHRVVFFGKLAEIVGEYCRKGSQIYVEGKLQTRKWT----DPQGQEKYTTEIVVD 104
>gi|148747771|ref|YP_001285850.1| putative ssDNA binding protein [Geobacillus virus E2] >gi|113715713|gb|ABI36862.1| putative ssDNA binding protein [Geobacillus virus E2] >gi|156530369|gb|ABU75286.1| single-stranded DNA binding protein [Geobacillus virus E2] (161 aa)
Score = 98, Expect = 1.1e-02, Identities = 35/99 (35%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLTLKP-GDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ D     T      ASF+LA   +  F + +      +I + AW K A  V      G  V V+GRL T     RS + + +  Y  +V+AD V
  S:     1 MNRVVLVGRLTKDAELRYTPNGTAVASFTLAV--NRPFTNQQGEREVDFISVIAWRKTAENVANYTAKGSLVAVDGRLQT-----RSYEKDGRRVYVTEVVADSV 98
>gi|163846601|ref|YP_001634645.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] >gi|163667890|gb|ABY34256.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] (138 aa)
Score = 98, Expect = 1.2e-02, Identities = 24/74 (32%), Positives = 40/74 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLST 74
           +N+V + G+L  DP    T ++   A+F +A      D +G  +D   +  + AW ++A      L  G  V++EGRL T
  S:     5 LNKVMIIGRLGVDPELRYTASDAPVATFRVAASRQWRDQNGDLHDETEWFNVVAWNRLAEICHQYLSRGARVYIEGRLQT 84
>gi|134287578|ref|YP_001109744.1| single-strand binding protein [Burkholderia vietnamiensis G4] >gi|134132228|gb|ABO59963.1| single-strand binding protein [Burkholderia vietnamiensis G4] (206 aa)
Score = 98, Expect = 1.2e-02, Identities = 28/99 (28%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +  A+  +A  D      S  F +   + RI+ +G++A      LK G S++VEGR+ T K   +    + +  Y+ +++AD++
  S:    14 VNKVIIVGNLGADPEVRYLPSGDAVANVRVATTDRYKDKASGDFKEMTEWHRISFFGRLAEIASEYLKKGSSIYVEGRIRTRKWQGQ----DGQDRYSTEIVADQM 115
>gi|138897055|ref|YP_001127508.1| single-strand DNA-binding protein, phage-related protein [Geobacillus thermodenitrificans NG80-2] >gi|134268568|gb|ABO68763.1| Single-strand DNA-binding protein, phage-related protein [Geobacillus thermodenitrificans NG80-2] (164 aa)
Score = 98, Expect = 1.3e-02, Identities = 35/110 (31%), Positives = 54/110 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQ 110
           +NRV L G+L+ DP    T +    A+F+LA      +  G  ++  +I+   W + A  V   LK G    V+GRL T    N+      +  Y  +V+AD V   + + S EQ
  S:     2 INRVILVGRLTRDPELRYTPSGVAVATFTLAVNRPFTNQQGEREA-DFIQCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYENQE----GRRVYVTEVVADNVQFLEPKGSNEQ 111
>gi|152979537|ref|YP_001345166.1| single-strand binding protein [Actinobacillus succinogenes 130Z] >gi|150841260|gb|ABR75231.1| single-strand binding protein [Actinobacillus succinogenes 130Z] (159 aa)
Score = 97, Expect = 1.3e-02, Identities = 41/149 (27%), Positives = 69/149 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENEL-----AQAFPISLDDEDDDI 149
           +N+V + G+L  DP           A+ S+A  +S    ++     +T W ++  +          L+ G  ++VEGRL T K      D N +  Y  ++  D +   D  NS  Q  D A    +P   ++++A   +      AQ  P  +D+ DDDI
  S:     4 VNKVIIVGRLGNDPEIRTMPNGEAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEIVGEYLRKGSQIYVEGRLRTRKWQ----DQNGQDRYTTEIQGDVMQMLDSRNS--QGGDFAPQNTAPQQYSRSSAPRQQTAPKPAAQPEP-PMDNFDDDI 157
>gi|120553681|ref|YP_958032.1| single-strand binding protein [Marinobacter aquaeolei VT8] >gi|120323530|gb|ABM17845.1| single-strand binding protein [Marinobacter aquaeolei VT8] (174 aa)
Score = 97, Expect = 1.4e-02, Identities = 30/97 (30%), Positives = 50/97 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP+   T   N   + +LA  +S  + D ++        + R+  +GKVA      L+ G  V++EG+L T K  N+      +  Y  +V+ D
  S:     5 VNKVILIGNLGQDPDTRYTPNGNAVVNLNLATDES--YKDRQTGQLVPKTEWHRVVLFGKVAEVAGQYLRKGSKVYIEGKLQTRKWQNKE----GQDVYTTEVVVD 104
>gi|167770482|ref|ZP_02442535.1| hypothetical protein ANACOL_01827 [Anaerotruncus colihominis DSM 17241] >gi|167667077|gb|EDS11207.1| hypothetical protein ANACOL_01827 [Anaerotruncus colihominis DSM 17241] (137 aa)
Score = 97, Expect = 1.5e-02, Identities = 29/100 (28%), Positives = 47/100 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           +N+V L G+ + DP   QT       SF +A     +S        +I I AW + A F++     G  + +EG + T       +D N     A++VIA+ V+
  S:     2 LNKVILMGRFTADPELRQTPNGVSVTSFRIAVDRNFNSKDGERQADFINIVAWRQTAEFIVRYFVKGQMIALEGSIQTRSY----EDKNGNKRMAVEVIAEHVW 101
>gi|196033825|ref|ZP_03101236.1| single-stranded DNA-binding protein [Bacillus cereus W] >gi|195993505|gb|EDX57462.1| single-stranded DNA-binding protein [Bacillus cereus W] (111 aa)
Score = 97, Expect = 1.6e-02, Identities = 32/99 (32%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-SSGFNDSKS-----YIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ +P    T+    GA+++  CI  + GF +S       +I    W K A  V    K G  V + GR+ T    +  DD   K  Y  +V+ + +
  S:     2 MNRVVLIGRLTKEPELYYTKQ---GAAYARICIAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQT----SNYDDEQGKRIYRTEVVIESI 100
>gi|91216094|ref|ZP_01253062.1| Single-strand binding protein [Psychroflexus torquis ATCC 700755] >gi|91185611|gb|EAS71986.1| Single-strand binding protein [Psychroflexus torquis ATCC 700755] (112 aa)
Score = 97, Expect = 1.7e-02, Identities = 28/72 (38%), Positives = 40/72 (55%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIR-ITAWGKVASFVLT-LKPGDSVFVEGRLS 73
           N V L G L  DP  +   +      FS+A      D+SG   + +Y   I AWGK ASF+ T +K G  V ++G+L+
  S:     6 NSVQLMGHLGQDPEVVNLDSGKKLVKFSIATNEYYHDTSGEKVTNTYWHNIIAWGKTASFIETYVKKGQEVLIKGKLA 83
>gi|187602514|ref|ZP_02988738.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] >gi|187485334|gb|EDU23311.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] (138 aa)
Score = 96, Expect = 1.7e-02, Identities = 24/74 (32%), Positives = 39/74 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLST 74
           +N+V + G+L  DP    T +    A+F +A      D +G  +D   +  + AW ++A      L  G  V++EGRL T
  S:     5 LNKVMIIGRLGVDPELRYTASGAPVATFRVAASRQWRDQNGDLHDETEWFNVVAWNRLAEICHQYLSRGARVYIEGRLQT 84
>gi|56422016|ref|YP_149334.1| single-strand DNA-binding protein [Geobacillus kaustophilus HTA426] >gi|56381858|dbj|BAD77766.1| single-strand DNA-binding protein [Geobacillus kaustophilus HTA426] (164 aa)
Score = 96, Expect = 1.8e-02, Identities = 34/110 (30%), Positives = 54/110 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQ 110
           +NRV L G+L+ DP    T +    A+F+LA      +  G  ++  +I+   W + A  V   LK G    V+GRL T    N+      +  Y  +V+AD V   + + + EQ
  S:     2 INRVILVGRLTRDPELRYTPSGVAVATFTLAVNRPFTNQQGERET-DFIQCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYENQE----GRRVYVTEVVADSVQFLEPKGTSEQ 111
>gi|166980836|ref|ZP_02252308.1| single-strand DNA-binding protein [Bacillus cereus AH187] (111 aa)
Score = 96, Expect = 1.8e-02, Identities = 31/99 (31%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-SSGFNDSKS-----YIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ +P    T+    G +++ AC+  + GF +S       +I    W K A  V    K G  V + GR+ T    +  DD   K  Y  +V+ + +
  S:     2 MNRVVLIGRLTKEPELYYTKQ---GVAYARACVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQT----SNYDDEQGKRIYRTEVVIESI 100
>gi|167768834|ref|ZP_02440887.1| hypothetical protein ANACOL_00151 [Anaerotruncus colihominis DSM 17241] >gi|167669006|gb|EDS13136.1| hypothetical protein ANACOL_00151 [Anaerotruncus colihominis DSM 17241] (155 aa)
Score = 96, Expect = 1.9e-02, Identities = 33/100 (33%), Positives = 47/100 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           +NR+ + G+L+ DP    T      ASF+LA      F + ++      +I + AW   A FV      G    VEGRL      +R  +    A    +VIAD VY
  S:     2 LNRIIIMGRLTRDPELRSTPNGTSVASFTLAV--DRDFKNKQTGEKETDFIDMIAWRSTAEFVARYFTKGRMAVVEGRLQIRLWEDRDGNKRKSA----EVIADSVY 102
>gi|187927384|ref|YP_001897871.1| single-strand binding protein [Ralstonia pickettii 12J] >gi|187724274|gb|ACD25439.1| single-strand binding protein [Ralstonia pickettii 12J] (185 aa)
Score = 96, Expect = 2.0e-02, Identities = 27/99 (27%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G SV++EGRL T     R  + + +  Y+ +++AD++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASGEMKEATEWHRIAFFGRLAEIAGEYLKKGSSVYIEGRLKT-----RQWEKDGQKQYSTEIVADQM 104
>gi|153886167|ref|ZP_02007322.1| single-strand binding protein [Ralstonia pickettii 12D] >gi|151577132|gb|EDN41533.1| single-strand binding protein [Ralstonia pickettii 12D] (185 aa)
Score = 96, Expect = 2.1e-02, Identities = 27/99 (27%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G SV++EGRL T     R  + + +  Y+ +++AD++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASGEMKEATEWHRIAFFGRLAEIAGEYLKKGSSVYIEGRLKT-----RQWEKDGQKQYSTEIVADQM 104
>gi|150387886|ref|YP_001317935.1| single-strand binding protein [Alkaliphilus metalliredigens QYMF] >gi|149947748|gb|ABR46276.1| single-strand binding protein [Alkaliphilus metalliredigens QYMF] (146 aa)
Score = 96, Expect = 2.1e-02, Identities = 27/99 (27%), Positives = 45/99 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV + G+L+ DP    T +    A+FS+A   +        +  +  W K A      L  G  V ++GRL +     ++ D      Y  +++AD+V
  S:     1 MNRVVMIGRLARDPELRFTASGKAVATFSIAVNKTFSKEKQADFFNVVVWNKTAENCANYLAKGRLVGLDGRLQSRSYETKNGDKR----YVTEIVADQV 96
>gi|126666784|ref|ZP_01737761.1| Single-stranded DNA-binding protein [Marinobacter sp. ELB17] >gi|126628829|gb|EAZ99449.1| Single-stranded DNA-binding protein [Marinobacter sp. ELB17] (224 aa)
Score = 96, Expect = 2.1e-02, Identities = 25/76 (32%), Positives = 37/76 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYK 76
           +N+V L G L  DP+   T   N   + SLA  +S     +   +  T W K+  F          L+ G  ++VEG+L T K
  S:    33 INKVILIGNLGQDPDTRYTPNGNAVVNLSLATDESYKDRQTGQMVPKTEWHKIVMFGKVAEVAGQYLRKGSKIYVEGKLQTRK 115
>gi|75763191|ref|ZP_00742956.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489323|gb|EAO52774.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (176 aa)
Score = 96, Expect = 2.2e-02, Identities = 40/137 (29%), Positives = 60/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       D  + K  Y  +V+A+ V   +  N   +   + +    P  A   N + N   Q+
  S:     5 MNRVILVGRLTXDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----DGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQSSNPFGQS 139
>gi|88798949|ref|ZP_01114531.1| single-strand DNA-binding protein [Reinekea sp. MED297] >gi|88778429|gb|EAR09622.1| single-strand DNA-binding protein [Reinekea sp. MED297] (181 aa)
Score = 96, Expect = 2.2e-02, Identities = 27/99 (27%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G+L  DP+   T +     + ++A  +    +D  +   IT W +V  F  T       L  G  V++EGRL T K      D N +  Y+ +++ +++
  S:     6 VNKVIILGRLGQDPDVRTTASGTQVVNLNVATNELGRADDQGNRQDITEWHRVVLFGRTAEVAAQYLSKGSQVYIEGRLQTRKW----QDQNGQDRYSTEIVGNEM 107
>gi|37520002|ref|NP_923379.1| hypothetical protein gvip045 [Gloeobacter violaceus PCC 7421] >gi|35210994|dbj|BAC88374.1| ycf41 [Gloeobacter violaceus PCC 7421] (150 aa)
Score = 95, Expect = 2.4e-02, Identities = 33/100 (33%), Positives = 48/100 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           MN + L G L  +P +L+   + +    +L    +    +    IR+ A+G +A  V  TL  GD V VEGRL   +   R D    K T   ++IA KVY
  S:     1 MNAIALMGTLQSEP-ELRFTQDGLARLSTLLGFSAGRPEEPDFQIRMVAFGNLAEEVARTLHHGDGVLVEGRLQA-ETRGRPDGTKEKVT---ELIARKVY 96
>gi|170691476|ref|ZP_02882641.1| single-strand binding protein [Burkholderia graminis C4D1M] >gi|170143681|gb|EDT11844.1| single-strand binding protein [Burkholderia graminis C4D1M] (184 aa)
Score = 95, Expect = 2.5e-02, Identities = 28/99 (28%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S    ++  + R++ +G++A  V   LK G SV++EGR+ T K   +    +    Y+ +++A+++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEMKEATEWHRVSFFGRLAEIVSEYLKKGSSVYLEGRIRTRKWQAQ----DGTDRYSTEIVAEQM 105
>gi|115345811|gb|ABI95364.1| single-stranded DNA binding protein [Deinococcus proteolyticus] (291 aa)
Score = 95, Expect = 2.5e-02, Identities = 33/99 (33%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSK-SYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MN V + G L+ +P    T   +   S  LA      D SG    K  +I +T W ++A  +  LK GD V V+GRL    MN    D +     + +V A +V
  S:   129 MNEVLVVGNLTREPELRYTPGGDAVLSLGLAVNENWTDRSGEKQEKVHWIDVTLWRELAEAMQNLKKGDPVLVKGRL----MNESWTDKDGNKRSSTKVEATRV 228
>gi|187922618|ref|YP_001894260.1| single-strand binding protein [Burkholderia phytofirmans PsJN] >gi|187713812|gb|ACD15036.1| single-strand binding protein [Burkholderia phytofirmans PsJN] (179 aa)
Score = 95, Expect = 2.5e-02, Identities = 28/99 (28%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S    ++  + R++ +G++A  V   LK G SV++EGR+ T K   +    +    Y+ +++A+++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEMKEATEWHRVSFFGRLAEIVSEYLKKGSSVYLEGRIRTRKWQAQ----DGTDRYSTEIVAEQM 105
>gi|91781739|ref|YP_556945.1| single-strand DNA-binding protein [Burkholderia xenovorans LB400] >gi|91685693|gb|ABE28893.1| Single-strand binding protein [Burkholderia xenovorans LB400] (177 aa)
Score = 95, Expect = 2.5e-02, Identities = 28/99 (28%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      + +  A+  LA  D      S    ++  + R++ +G++A  V   LK G SV++EGR+ T K   +    +    Y+ +++A+++
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEMKEATEWHRVSFFGRLAEIVSEYLKKGSSVYLEGRIRTRKWQAQ----DGTDRYSTEIVAEQM 105
>gi|148360372|ref|YP_001251579.1| single strand DNA binding protein [Legionella pneumophila str. Corby] >gi|148282145|gb|ABQ56233.1| single strand DNA binding protein [Legionella pneumophila str. Corby] (140 aa)
Score = 95, Expect = 2.6e-02, Identities = 29/99 (29%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS----YIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP  +  +      + +LA  +S   ND       + ++  +GK+      LK G  V++EG+L +    N+  D   KA  AL +I + +
  S:     5 LNRVQLIGNLGADPKIVTGKDGQSFVTATLATNESFKQNDEWQTRVEWHQLVLFGKLTKVAEYLKKGSHVYLEGKLRS----NQWTDNEGKARQALSIIVNHI 103
>gi|150016663|ref|YP_001308917.1| single-strand DNA-binding protein [Clostridium beijerinckii NCIMB 8052] >gi|149903128|gb|ABR33961.1| single-strand binding protein/Primosomal replication protein n [Clostridium beijerinckii NCIMB 8052] (216 aa)
Score = 95, Expect = 2.7e-02, Identities = 29/106 (27%), Positives = 47/106 (44%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   +   +  +   +   YI   AWG+ + F  TL  GD++ V GRL + +   +  D       A +V   K+ R ++E S
  S:   107 NEIFLDGYICKEP---IYRTTPFGREIADVLLAVNRAYNKSDYIPTIAWGRNSRFCQTLNVGDNIKVWGRLQSREYQKKVSDSEVVKKIAYEVSISKMERANKEES 209
>gi|160872092|ref|ZP_02062224.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Rickettsiella grylli] >gi|159120891|gb|EDP46229.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Rickettsiella grylli] (152 aa)
Score = 95, Expect = 2.7e-02, Identities = 30/107 (28%), Positives = 50/107 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +N+V L G L  DP           A  +LA  +S          +   + RI  + ++A  V   LK G  V++EGRL T K  +++   +    Y  ++IA+++   D   S
  S:     5 INKVILIGNLGADPEIRHMPNGTAVAHINLATSESWKDKNTGELQERTEWHRIVLFQRLAEIVAEYLKKGAKVYIEGRLQTRKWQDKTTGHDR---YTTEIIANEMQMLDSRGS 115
>gi|171325305|ref|ZP_02913811.1| single-strand binding protein [Geobacillus sp. WCH70] >gi|171088729|gb|EDT35074.1| single-strand binding protein [Geobacillus sp. WCH70] (164 aa)
Score = 95, Expect = 2.8e-02, Identities = 34/110 (30%), Positives = 54/110 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQ 110
           +NRV L G+L+ DP    T +    A+F+LA   +  F + +      +I    W + A  V   LK G    V+GRL T     +    + +  Y  +V+AD V   + ++S EQ
  S:     2 INRVILVGRLTRDPELRYTPSGVAVATFTLAV--NRPFTNQQGEREADFINCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYEGQ----DGRRVYVTEVVADSVQFLEPKSSAEQ 111
>gi|54293953|ref|YP_126368.1| hypothetical protein lpl1010 [Legionella pneumophila str. Lens] >gi|54297004|ref|YP_123373.1| hypothetical protein lpp1045 [Legionella pneumophila str. Paris] >gi|53750789|emb|CAH12196.1| hypothetical protein [Legionella pneumophila str. Paris] >gi|53753785|emb|CAH15245.1| hypothetical protein [Legionella pneumophila str. Lens] (140 aa)
Score = 95, Expect = 2.8e-02, Identities = 28/99 (28%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS----YIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP  +  +      + +LA  +S   ND       + ++  +GK+      LK G  V++EG+L +    N+  D   KA  AL ++   +
  S:     5 LNRVQLIGNLGADPKSIAGKDGQSFVTTTLATNESFKQNDEWQTRVEWHQLVLFGKLTKVTEYLKKGSQVYLEGKLRS----NQWTDNEGKARQALSIVVSHI 103
>gi|89902532|ref|YP_525003.1| single-strand binding protein [Rhodoferax ferrireducens T118] >gi|89347269|gb|ABD71472.1| single-strand binding protein [Rhodoferax ferrireducens T118] (167 aa)
Score = 95, Expect = 2.9e-02, Identities = 35/113 (30%), Positives = 56/113 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFN-------DSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVD 113
           +N+V L G L  DP      + +  A+ ++A   SS +        +   + R+T +GK+A  V   LK G SV+VEGR+ T K      D +    YA  +IA+++        +  P D
  S:     4 VNKVILVGNLGRDPEIRYLPSGDPVANITIAT--SSKYKSKTGEMVEETEWHRVTFFGKLAEIVGQYLKKGRSVYVEGRIKTRKYT----DKDGIEKYATDIIANEMQMLGGREGMGGPSD 118
>gi|148825471|ref|YP_001290224.1| single-strand DNA-binding protein [Haemophilus influenzae PittEE] >gi|148715631|gb|ABQ97841.1| single-strand DNA-binding protein [Haemophilus influenzae PittEE] (168 aa)
Score = 95, Expect = 2.9e-02, Identities = 44/149 (29%), Positives = 71/149 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN----------ATENELAQAFPISLDDEDDDI 149
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D  ++     +N+     D  +   S + A +TN          A +    QA P  +D  DDDI
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYSNDMGSTPQSSYQARQTNNGGSYQSSRPAPQQSAPQAEP-PMDGFDDDI 166
>gi|192809477|ref|ZP_03038152.1| single-strand binding protein [Geobacillus sp. Y412MC10] >gi|192802148|gb|EDV78653.1| single-strand binding protein [Geobacillus sp. Y412MC10] (164 aa)
Score = 95, Expect = 2.9e-02, Identities = 30/99 (30%), Positives = 42/99 (42%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T +      F+LA        G      +I +  W ++A      L+ G    VEGR+      N       K  Y  +VIAD V
  S:     2 LNRVILIGRLTKDPELRYTPSGVAVTQFTLAVDRPFTGQGGEREADFIPVVTWRQLAETCANYLRKGRLTAVEGRIQVRNYENNE----GKRVYVTEVIADNV 100
>gi|116626683|ref|YP_828839.1| single-strand binding protein [Solibacter usitatus Ellin6076] >gi|116229845|gb|ABJ88554.1| single-strand binding protein [Solibacter usitatus Ellin6076] (129 aa)
Score = 94, Expect = 3.0e-02, Identities = 27/76 (35%), Positives = 39/76 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACI-----DSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYK 76
           +NR+ L G +  D  +    T  I A FSLA       D+  +     + R  A+GK+A F  TL  G  V VEG L +++
  S:     3 LNRITLIGFIGSDAERKAANTTKI-AIFSLATKTSWKNDAGSWESRTEWHRCVAFGKLADFAGTLSKGAHVAVEGELRSHE 82
>gi|168143824|ref|ZP_02587053.1| single-strand binding protein [Bacillus cereus G9842] (172 aa)
Score = 94, Expect = 3.1e-02, Identities = 40/137 (29%), Positives = 60/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       D  + K  Y  +V+A+ V   +  N   +   + +    P  A   N + N   Q+
  S:     1 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----DGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQSSNPFGQS 135
>gi|153168328|ref|ZP_01928250.1| single strand binding protein [Listeria monocytogenes FSL N1-017] >gi|133726359|gb|EBA28057.1| single strand binding protein [Listeria monocytogenes FSL N1-017] (160 aa)
Score = 94, Expect = 3.2e-02, Identities = 32/99 (32%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T       +D + K  Y  +++A+ V
  S:     2 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDKDGKRVYVTEIVAESV 100
>gi|42629699|ref|ZP_00155244.1| COG0629: Single-stranded DNA-binding protein [Haemophilus influenzae R2846] (168 aa)
Score = 94, Expect = 3.2e-02, Identities = 44/149 (29%), Positives = 70/149 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN----------ATENELAQAFPISLDDEDDDI 149
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D  ++     +N+     D      S + A +TN          A +    QA P  +D  DDDI
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVMQMLGGRNQNAGGSGNDMGGAPQSSYQARQTNNGNSYQSSRPAPQQSAPQAEP-PMDGFDDDI 166
>gi|153006764|ref|YP_001381089.1| single-strand binding protein [Anaeromyxobacter sp. Fw109-5] >gi|152030337|gb|ABS28105.1| single-strand binding protein [Anaeromyxobacter sp. Fw109-5] (156 aa)
Score = 94, Expect = 3.3e-02, Identities = 33/99 (33%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP    T      A+  +A   S  + D +S        +  +  WGK A      L  G  V+VEGRL T K     D  + +  Y ++V+A+ V
  S:     2 VNRVILVGNLGKDPEVRYTSGGQAVANLRIAT--SRSWTDKQSGQKKEETEWHDVEVWGKQAEQCGEYLAKGRQVYVEGRLKTDKWQ---DKQSGQERYKVKVVAETV 104
>gi|163943153|ref|YP_001648037.1| single-strand DNA-binding protein [Bacillus weihenstephanensis KBAB4] >gi|163865350|gb|ABY46409.1| single-strand binding protein [Bacillus weihenstephanensis KBAB4] (173 aa)
Score = 94, Expect = 3.4e-02, Identities = 40/137 (29%), Positives = 60/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       D  + K  Y  +V+A+ V   +  N   +   + +    P  A   N + N   Q+
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----DGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQSSNPFGQS 136
>gi|167909488|ref|ZP_02496579.1| single-strand DNA-binding protein [Burkholderia pseudomallei 112] (99 aa)
Score = 94, Expect = 3.4e-02, Identities = 27/80 (33%), Positives = 42/80 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNR 80
           +N+V L G L  DP      + +  A+  LA  D      S  F +   + R+  +G++A  V   LK G SV++EGR+ T K   +
  S:     4 VNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGEFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQ 90
>gi|146329809|ref|YP_001209056.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] >gi|146233279|gb|ABQ14257.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] (169 aa)
Score = 94, Expect = 3.4e-02, Identities = 33/113 (29%), Positives = 61/113 (53%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVD 113
           +N+V L G +  +P+ ++ T    + A+FSLA   S  +ND ++        + R  A+ ++A  +   ++ G  +++EGRL T K      D N    Y  ++I +++   D  NS  +P D
  S:     4 VNKVILVGNVGQNPDVRVMTNGEQV-ANFSLAT--SMNWNDRQTGEKREKTEWHRCVAYRRLAEIIGQYVRKGSKLYIEGRLETRKWQ----DQNGIDRYTTEIIVNEMQMLDSRNSSSEPYD 119
>gi|83589002|ref|YP_429011.1| single-strand binding protein [Moorella thermoacetica ATCC 39073] >gi|83571916|gb|ABC18468.1| single-strand binding protein [Moorella thermoacetica ATCC 39073] (154 aa)
Score = 94, Expect = 3.6e-02, Identities = 33/99 (33%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS----YIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T +     +F+LA +D +  N        +IRIT W K+A      L  G  V V+GRL T       + P+ +      V+A+ V
  S:     2 LNRVILIGRLTRDPELRYTASGVAMTTFTLA-VDRNFVNQQGERGTDFIRITVWRKLAETCANHLGKGRLVAVDGRLQTRTY----ETPDGQKRSVTDVVAEDV 100
>gi|167755263|ref|ZP_02427390.1| hypothetical protein CLORAM_00768 [Clostridium ramosum DSM 1402] >gi|167705313|gb|EDS19892.1| hypothetical protein CLORAM_00768 [Clostridium ramosum DSM 1402] (160 aa)
Score = 94, Expect = 3.7e-02, Identities = 31/99 (31%), Positives = 44/99 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+++ DP   +T   +   SF+LA      S        +I    W K A  V      G  V VEGR+ T       D+   +  Y ++VI D V
  S:     2 INRVVLVGRMTRDPELRRTPQGDAVTSFTLAVNRNFTSRDGQQQADFINCVVWRKPAENVERYCSKGSLVGVEGRIQTRSY----DNTQGQKVYVVEVICDSV 100
>gi|189218766|ref|YP_001939407.1| Single-stranded DNA-binding protein [Methylokorus infernorum V4] >gi|189185624|gb|ACD82809.1| Single-stranded DNA-binding protein [Methylacidiphilum infernorum V4] (145 aa)
Score = 93, Expect = 3.8e-02, Identities = 30/99 (30%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSS------GFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+VFL G L+ DP    T         SLA I+SS         D   ++ +  WG+ A      L+ G  +FVEGRL   +   +  +  ++    ++V AD++
  S:     4 LNKVFLIGNLTRDPECRYTPKGTPVGDISLA-INSSFRSQDGQIKDEVCFVDVVIWGRQAETCKEYLQKGSLIFVEGRLQMEQWETKEGEKRTR----MKVRADRI 104
>gi|134301136|ref|YP_001114632.1| single-strand binding protein [Desulfotomaculum reducens MI-1] >gi|134053836|gb|ABO51807.1| single-strand binding protein [Desulfotomaculum reducens MI-1] (140 aa)
Score = 93, Expect = 3.9e-02, Identities = 29/99 (29%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS----YIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N++ L G+L+ DP +L+  TN +  +     +D   FN  +     +I I  W K+A      L  G  + V+GRL         DD       A +V+AD +
  S:     2 LNKIILIGRLTRDP-ELRYTTNGVAVARLTIAVDRPQFNREREKETDFIDIVVWQKLAETCANNLGKGRLIAVDGRLQIRSY----DDSQGIRRKAAEVVADSI 100
>gi|33519511|ref|NP_878343.1| single-strand DNA-binding protein [Candidatus Blochmannia floridanus] >gi|33517174|emb|CAD83556.1| single-strand DNA-binding protein [Candidatus Blochmannia floridanus] (158 aa)
Score = 93, Expect = 3.9e-02, Identities = 26/80 (32%), Positives = 42/80 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNR 80
           +N+V L G L  DP        N  A+ S+A  D      ++ F +   + R+  +GK+A    + L+ G  V++EG L T K  N+
  S:     6 INKVILVGYLGQDPEIRYMSNGNPVANISIATTDTWKDKQTNEFKEKTEWHRVVLFGKLAEITSSYLRKGSQVYIEGSLRTRKWQNQ 92
>gi|196155058|ref|YP_002124547.1| single-strand binding protein [Alteromonas macleodii 'Deep ecotype'] >gi|88775919|gb|EAR07166.1| single-strand binding protein [Alteromonas macleodii 'Deep ecotype'] >gi|196110837|gb|ACG64553.1| single-strand binding protein [Alteromonas macleodii 'Deep ecotype'] (196 aa)
Score = 93, Expect = 4.1e-02, Identities = 29/99 (29%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP        N  A+ SLA  +S         +   + R+T + ++A      LK G  ++VEG+L T K      D   +  Y  ++I D++
  S:     6 VNKVILVGNLGNDPEVRYMPNGNAVANLSLATSESWKDQQGQVQERTEWHRLTMYRRLAEIAGEYLKKGSQIYVEGKLQTRKW----QDQQGQDKYTTEIIVDQM 106
>gi|187476594|ref|YP_784618.1| single-strand binding protein [Bordetella avium 197N] >gi|115421180|emb|CAJ47674.1| single-strand binding protein [Bordetella avium 197N] (166 aa)
Score = 93, Expect = 4.3e-02, Identities = 32/99 (32%), Positives = 53/99 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRI--TAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP   + R +  GA+   L+   +S + D  S  R   T W +V  +          LK G SV++EGRL T K  ++    +    Y+ +++AD++
  S:     4 VNKVILVGNLGRDP---EVRYSPDGAAICNLSLATTSQWKDKASGERREETEWHRVVMYNRLAEIAGEYLKKGRSVYIEGRLKTRKWQDKDTGADR---YSTEIVADQM 106
>gi|71066238|ref|YP_264965.1| putative single-strand binding protein [Psychrobacter arcticus 273-4] >gi|71039223|gb|AAZ19531.1| putative single-strand binding protein [Psychrobacter arcticus 273-4] (213 aa)
Score = 93, Expect = 4.4e-02, Identities = 29/99 (29%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASF-------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP   Q   NN G+  +++   S  + D +S  +   T W +++ F          L+ G  V++EG L T K      DPN +  Y  ++ A+++
  S:     4 VNKVIIIGNLGADPEARQ--FNNGGSVTNISVATSEQWTDKQSGEKREATEWHRISLFNRLGEIAAQYLRKGSKVYIEGSLRTRKY----QDPNGQDRYITEIRAEQM 105
>gi|91776774|ref|YP_546530.1| single-strand binding protein [Methylobacillus flagellatus KT] >gi|91710761|gb|ABE50689.1| single-strand binding protein [Methylobacillus flagellatus KT] (167 aa)
Score = 93, Expect = 4.4e-02, Identities = 30/99 (30%), Positives = 46/99 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP           A+FS+A  DS    + +   R T W  +  +          LK G  V++EGRL T K   +      +  Y  ++IAD++
  S:     4 VNKVILVGNLGRDPEVRYMPNGEAVANFSIATTDSWKDKNGQRQER-TEWHNIVMYRRLAEIAGEYLKKGRPVYIEGRLQTRKWQTKE----GQDRYTTEIIADQM 104
>gi|153889266|ref|ZP_02010388.1| single-strand binding protein [Ralstonia pickettii 12D] >gi|151574263|gb|EDN38697.1| single-strand binding protein [Ralstonia pickettii 12D] (130 aa)
Score = 93, Expect = 4.8e-02, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G  V++EGRL T     R  + + +  Y+ +++AD++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASGEMKETTEWHRIAFFGRLAEIAGEYLKKGSQVYIEGRLKT-----RQWEKDGQKQYSTEIVADQL 104
>gi|187930893|ref|YP_001901379.1| single-strand binding protein [Ralstonia pickettii 12J] >gi|187728937|gb|ACD30100.1| single-strand binding protein [Ralstonia pickettii 12J] (130 aa)
Score = 93, Expect = 4.9e-02, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G  V++EGRL T     R  + + +  Y+ +++AD++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASGEMKETTEWHRIAFFGRLAEIAGEYLKKGSQVYIEGRLKT-----RQWEKDGQKQYSTEIVADQM 104
>gi|149376655|ref|ZP_01894414.1| Single-stranded DNA-binding protein [Marinobacter algicola DG893] >gi|149359028|gb|EDM47493.1| Single-stranded DNA-binding protein [Marinobacter algicola DG893] (175 aa)
Score = 92, Expect = 5.1e-02, Identities = 29/97 (29%), Positives = 49/97 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP    T   N   + +LA  +S  + D ++        + RI  +GK+A      L+ G  V++EG+L T K   +    + +  Y  +V+ D
  S:     5 VNKVILIGNLGQDPETRYTPNGNAVVNLNLATDES--YKDRQTGQLVPKTEWHRIVMFGKIAEVAGQYLRKGSKVYIEGKLQTRKWQGQ----DGQDRYTTEVVVD 104
>gi|153186937|ref|ZP_01936981.1| single-strand binding protein subfamily [Listeria monocytogenes J0161] >gi|153191855|ref|ZP_01939009.1| hypothetical protein LMPG_02253 [Listeria monocytogenes J2818] >gi|126940877|gb|EBA18789.1| single-strand binding protein subfamily [Listeria monocytogenes J0161] >gi|127764726|gb|EBA25251.1| hypothetical protein LMPG_02253 [Listeria monocytogenes J2818] (160 aa)
Score = 92, Expect = 5.1e-02, Identities = 32/99 (32%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTRNY----EDNDGKRVFVTEVVAETV 100
>gi|75764878|ref|ZP_00744239.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487633|gb|EAO51488.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (111 aa)
Score = 92, Expect = 5.1e-02, Identities = 31/99 (31%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-SSGFNDSKS-----YIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ +P    T+    G +++  CI  + GF +S       +I    W K A  V    K G  V + GR+ T    +  DD   K  Y  +V+ + +
  S:     2 MNRVVLIGRLTKEPELYYTKQ---GVAYARICIAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQT----SNYDDEQGKRIYRTEVVIESI 100
>gi|59714401|ref|YP_207175.1| single-strand DNA binding protein [Vibrio fischeri ES114] >gi|59482678|gb|AAW88287.1| single-strand DNA binding protein [Vibrio fischeri ES114] (116 aa)
Score = 92, Expect = 5.4e-02, Identities = 32/96 (33%), Positives = 48/96 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP     R   I A F+LA  +S          ++  Y R+   G++A  + +  K G  V++EG+  T K   R DD N K  Y  +V+ 
  S:     7 VNKVILLGHLRQDPEISYNRFGKIIAHFTLATEESWQDKATGQQRENTEYHRVVVLGRLAKVIKSKTKKGTQVYLEGKNKTIK---RQDD-NGKDYYLTEVMV 105
>gi|167212944|ref|ZP_02283251.1| hypothetical protein LmonL_20722 [Listeria monocytogenes LO28] (160 aa)
Score = 92, Expect = 5.5e-02, Identities = 32/99 (32%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA      +        +I+   W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVILVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|16799175|ref|NP_469443.1| hypothetical protein lin0097 [Listeria innocua Clip11262] >gi|37999746|sp|Q92FK7|SSB2_LISIN Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|16412517|emb|CAC95330.1| lin0097 [Listeria innocua] (159 aa)
Score = 92, Expect = 5.6e-02, Identities = 33/109 (30%), Positives = 52/109 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I+   W K A      LK G    V+GR+ T       +D + K  +  +V+A+ V   +  N  E
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAV--NRTFTNQQGEREADFIQCVVWRKPAENAANFLKKGSMAGVDGRIQTRNY----EDSDGKRVFVTEVVAESVQFLEPRNHAE 110
>gi|93006782|ref|YP_581219.1| single-strand binding protein [Psychrobacter cryohalolentis K5] >gi|92394460|gb|ABE75735.1| single-strand binding protein [Psychrobacter cryohalolentis K5] (219 aa)
Score = 92, Expect = 5.8e-02, Identities = 29/99 (29%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASF-------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP   Q   NN G+  +++   S  + D +S  +   T W +++ F          L+ G  V++EG L T K      DPN +  Y  ++ A+++
  S:     4 VNKVIIIGNLGADPEARQ--FNNGGSVTNISVATSEQWTDKQSGEKREATEWHRISLFNRLGEIAAQYLRKGSKVYIEGSLRTRKY----QDPNGQDRYITEIRAEQM 105
>gi|95928586|ref|ZP_01311333.1| single-strand binding protein [Desulfuromonas acetoxidans DSM 684] >gi|95135376|gb|EAT17028.1| single-strand binding protein [Desulfuromonas acetoxidans DSM 684] (181 aa)
Score = 92, Expect = 5.9e-02, Identities = 31/99 (31%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKS-YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T +     +FSLA      D  G   +K+ +  I AW ++A      L  G  +++EG L T K  +R  D N +  Y  +++A+++
  S:     3 VNKVILVGNLGKDPELRYTPSGAAVVNFSLATSETYKDRDGNRQTKTEWHNIVAWRQLAEICGKYLHKGKQIYIEGALQTRKWQDR--DGNDR--YTTEIVANQM 103
>gi|150384308|ref|ZP_01923008.1| single-strand binding protein [Victivallis vadensis ATCC BAA-548] >gi|150259289|gb|EDM96529.1| single-strand binding protein [Victivallis vadensis ATCC BAA-548] (218 aa)
Score = 92, Expect = 5.9e-02, Identities = 32/99 (32%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+VFL G L+ DP+ L+   N  G   F LA     + +    D   ++ I  WGK A      L+ G    +EGRL   +  +R+          L+V+AD+V
  S:     5 LNKVFLLGNLTRDPD-LRYLPNGSGVCEFGLAVNRRFVSNGKEIDETCFVDIVVWGKAAENCKQFLEKGSQALIEGRLQFDQWEDRN---GGGKRSRLRVVADQV 105
>gi|152977672|ref|YP_001377189.1| single-strand DNA-binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026424|gb|ABS24194.1| single-strand binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (164 aa)
Score = 92, Expect = 5.9e-02, Identities = 41/147 (27%), Positives = 62/147 (42%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDD 147
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T     +    + +  Y  +V+A+ V   +  NS  +   + +    P  A   N   N   Q+        DD
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFTNQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQ----DGRRVYVTEVLAESVQFLEPRNSGGE--QRGSFNQQPSGAGFGNQGSNPFGQSGNSGFTKNDD 146
>gi|153893258|ref|ZP_02014023.1| single-strand binding protein [Opitutaceae bacterium TAV2] >gi|151580675|gb|EDN44463.1| single-strand binding protein [Opitutaceae bacterium TAV2] (170 aa)
Score = 92, Expect = 6.0e-02, Identities = 31/97 (31%), Positives = 52/97 (53%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNI---GASFSLACIDSSG-FNDSKSYIRITAWGK----VASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+VFL G L+ DP  ++  R   I   G + S    D SG   +  +++ + AWGK    ++ +V   +P   +FVEGRL   K +   D    +    L+V+ +
  S:     4 LNKVFLIGNLTRDPELRVTPRGTPICQFGLAISRQFKDESGQTREEATFVDVEAWGKQGETISKYVTKGRP---LFVEGRL---KFDQWEDKTTQQKRSKLKVVLE 103
>gi|114321893|ref|YP_743576.1| single-strand binding protein [Alkalilimnicola ehrlichei MLHE-1] >gi|114228287|gb|ABI58086.1| single-strand binding protein [Alkalilimnicola ehrlichei MLHE-1] (154 aa)
Score = 92, Expect = 6.0e-02, Identities = 29/97 (29%), Positives = 49/97 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP    T   +   +  LA  D+     SG    ++ + RI  +GK+A      L+ G  V++EGRL T K   +    + +  Y  +++A+
  S:     5 VNKVILIGNLGVDPEVRYTANGSAVTNVRLATTDTWRDKQSGEQQERTEWHRIVFFGKLAEIAGEYLRKGSKVYIEGRLQTRKWQGQ----DGQDRYTTEIVAN 104
>gi|146281200|ref|YP_001171353.1| single-strand DNA-binding protein [Pseudomonas stutzeri A1501] >gi|145569405|gb|ABP78511.1| single-stranded DNA-binding protein [Pseudomonas stutzeri A1501] (159 aa)
Score = 92, Expect = 6.2e-02, Identities = 27/97 (27%), Positives = 43/97 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           MN+V L G +  DP        N   + +LA  DS          +   + R+  +GKVA      L+ G   ++EGRL T     R  + +    Y  +++ D
  S:     1 MNKVILIGNVGGDPETRYMPNGNAVTNITLATTDSWKDKQTGQLQERTEWHRVVLFGKVAEIAGEYLRKGSQCYIEGRLQT-----REWEKDGVKRYTTEIVVD 99
>gi|42630549|ref|ZP_00156088.1| COG0629: Single-stranded DNA-binding protein [Haemophilus influenzae R2866] >gi|145639839|ref|ZP_01795440.1| dihydrodipicolinate synthase [Haemophilus influenzae PittII] >gi|145271057|gb|EDK10973.1| dihydrodipicolinate synthase [Haemophilus influenzae PittII] (168 aa)
Score = 92, Expect = 6.3e-02, Identities = 36/128 (28%), Positives = 60/128 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN 128
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D  ++     +N+     D   V  S + A +TN
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVMQMLGGRNQNASGYGNDMGGVPQSSYQARQTN 136
>gi|169335535|ref|ZP_02862728.1| hypothetical protein ANASTE_01949 [Anaerofustis stercorihominis DSM 17244] >gi|169258273|gb|EDS72239.1| hypothetical protein ANASTE_01949 [Anaerofustis stercorihominis DSM 17244] (140 aa)
Score = 92, Expect = 6.3e-02, Identities = 36/99 (36%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGAS---FSLACIDSSGFNDSKS---YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPN-SKATYALQVIADKV 99
           +N+V L G+L+ DP   +TR    G+S   F+LA   +    D +    +I I AWGK A      L  G    V GR+ T     RS D N     Y  +V+A++V
  S:     2 LNKVVLIGRLTRDP---ETRVLTSGSSVSTFTLAVDRTFKSRDGERGTDFIPIVAWGKTAELCGQYLSKGRQTAVAGRIQT-----RSYDANDGSKRYVTEVVAEEV 100
>gi|171319972|ref|ZP_02909046.1| single-strand binding protein [Burkholderia ambifaria MEX-5] >gi|171094767|gb|EDT39807.1| single-strand binding protein [Burkholderia ambifaria MEX-5] (196 aa)
Score = 92, Expect = 6.4e-02, Identities = 29/99 (29%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP        +  A+  +A  D      S  Y  +T W +V SF   L        K G S++VEGR+ T K   +    + +  Y+ +++AD++
  S:     4 VNKVIIVGNLGADPEVRYLPCGDAVANVRVATTDRYKDKASGDYKEMTEWHRV-SFFGRLAEVASEYPKKGSSIYVEGRIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|16798847|ref|NP_463525.1| putative SSB protein [Listeria phage A118] >gi|157325471|ref|YP_001468893.1| gp53 [Listeria phage A006] >gi|5823662|emb|CAB53850.1| putative SSB protein [Listeria phage A118] >gi|66733476|gb|AAY53290.1| gp53 [Listeria phage A006] (160 aa)
Score = 92, Expect = 6.5e-02, Identities = 32/99 (32%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA      + +G  ++  +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRMFTNQNGEREA-DFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDNDGKRVFVTEVVAESV 100
>gi|47097485|ref|ZP_00235027.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|153186866|ref|ZP_01936957.1| hypothetical protein LMOG_02935 [Listeria monocytogenes J0161] >gi|153192296|ref|ZP_01939316.1| hypothetical protein LMPG_02580 [Listeria monocytogenes J2818] >gi|47014126|gb|EAL05117.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|126940907|gb|EBA18816.1| hypothetical protein LMOG_02935 [Listeria monocytogenes J0161] >gi|127764356|gb|EBA24895.1| hypothetical protein LMPG_02580 [Listeria monocytogenes J2818] (160 aa)
Score = 92, Expect = 6.5e-02, Identities = 34/107 (31%), Positives = 52/107 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           MNRV L G+L+ DP    T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V   D +N+
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDSDGKRVFVTEVVAESVQFLDPKNN 108
>gi|167736316|dbj|BAG07415.1| AHL synthase [Gluconacetobacter intermedius] (209 aa)
Score = 91, Expect = 6.8e-02, Identities = 30/89 (33%), Positives = 41/89 (46%)
  Q:    22 NNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV-------YRPDEENSLEQ 110
             I A   LACI+ S  ND  +Y+ +TAWG +   V    PG    VE ++ + K      D  S      Q + DK        Y   + NS+EQ
  S:   116 KQISAELILACIEFSVLNDIHTYLFLTAWGVLKRIV----PGAG--VEAQIHSRKTLPSGHDVASAVVPVSQAVLDKARAKLNIHYAVLDNNSIEQ 205
>gi|56692915|ref|YP_164279.1| single-stranded DNA-binding protein [Pseudomonas phage F116] >gi|48527501|gb|AAT45876.1| single-stranded DNA-binding protein [Pseudomonas aeruginosa phage F116] (167 aa)
Score = 91, Expect = 6.8e-02, Identities = 28/97 (28%), Positives = 49/97 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP+   T       S SLA  +S     +G    ++ + R+  +G++A      L+ G  V++EG L T K   +    + +  Y+ +V+ D
  S:     5 VNKVILVGHLGQDPDARSTPGGKAVTSLSLATSESWKDKQTGQQQERTEWHRVVLFGRLAEIAAQYLRKGSQVYIEGSLRTRKWQGQ----DGQDHYSTEVVVD 104
>gi|167957111|ref|ZP_02544185.1| single-strand binding protein [candidate division TM7 single-cell isolate TM7c] (127 aa)
Score = 91, Expect = 6.9e-02, Identities = 27/96 (28%), Positives = 43/96 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G+L+ DP    T +     SF LA +D  G      +  + AW K    V   L  G    ++GRL   + ++  D    K    ++V+A
  S:     5 INQVILMGRLTRDPEMRTTASGKNVCSFGLA-VDRQGQEGQADFFDVIAWEKTGELVNQYLSKGRRCLIQGRL---RQDSWEDKDTGKKRNRVEVVA 97
>gi|153203713|ref|ZP_01944709.1| hypothetical protein LMSG_02931 [Listeria monocytogenes HPB2262] >gi|133734597|gb|EBA36295.1| hypothetical protein LMSG_02931 [Listeria monocytogenes HPB2262] (159 aa)
Score = 91, Expect = 6.9e-02, Identities = 34/109 (31%), Positives = 53/109 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           MNRV L G+L+ DP    T      A+F+LA      + +G  ++  +I+   W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V   +  N  E
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQNGEREA-DFIQCVVWRKPAENVANFLKKGSLAGVDGRIQTRNY----EDNDGKRVFVTEVVAESVQFLEPRNHAE 110
>gi|77166470|ref|YP_344995.1| single-strand binding protein [Nitrosococcus oceani ATCC 19707] >gi|76884784|gb|ABA59465.1| Single-strand binding protein [Nitrosococcus oceani ATCC 19707] (163 aa)
Score = 91, Expect = 7.1e-02, Identities = 32/122 (26%), Positives = 55/122 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPF 122
           +N+V L G L  DP    T +    A+ +LA  ++     +      T W +V  F          LK G  ++VEGRL T K   +    + +  Y  +++A ++          Q +D+AT   +P+
  S:     6 VNKVILVGNLGRDPEVRYTASGGAIANITLATSETWKDKTTGEQQERTEWHRVVFFGRLGEIAGEYLKKGAKIYVEGRLQTRKWQGQ----DGQDRYTTEIVASEM----------QMLDRATGGSAPY 120
>gi|145296445|ref|YP_001139266.1| hypothetical protein cgR_2358 [Corynebacterium glutamicum R] >gi|140846365|dbj|BAF55364.1| hypothetical protein [Corynebacterium glutamicum R] (205 aa)
Score = 91, Expect = 7.2e-02, Identities = 24/58 (41%), Positives = 32/58 (55%)
  Q:    38 FNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
            N  K +I + AWGK+  +  ++LKPG SV V+G L T +    S DPN K     Q I
  S:    46 HNVDKVFINVEAWGKLGINSHISLKPGVSVIVQGFLYTNEWEVESADPNVKKLEKRQEI 104
>gi|187603425|ref|ZP_02989637.1| single-strand binding protein [Exiguobacterium sp. AT1b] >gi|187484200|gb|EDU22192.1| single-strand binding protein [Exiguobacterium sp. AT1b] (169 aa)
Score = 91, Expect = 7.5e-02, Identities = 33/99 (33%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS---YIRITAWGKVASFVLT-LKPGDSVFVEGRL--STYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T++       +LAC       D K    +I    W K A  V   LK G    V+GRL  S+Y+        + +  Y  +V+AD V
  S:     2 INRVVLVGRLTRDPEMRYTQSGIAVTRLTLACDRPFAGQDGKRETDFIDCVVWRKQAENVAQYLKKGSMAGVDGRLQISSYEGQ------DGQRRYRAEVVADSV 100
>gi|82703345|ref|YP_412911.1| single-strand binding protein [Nitrosospira multiformis ATCC 25196] >gi|82411410|gb|ABB75519.1| single-strand binding protein [Nitrosospira multiformis ATCC 25196] (152 aa)
Score = 91, Expect = 7.9e-02, Identities = 31/81 (38%), Positives = 45/81 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTR-------TNNIGASFSLACIDSSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRS 81
           +N+V L G L  DP   +TR         NI  + +    D +G    K+ + R+T + K+A      LK G SV+VEGRL T K  ++S
  S:     4 VNKVILIGNLGKDP---ETRYMPNGDAVTNITVATTETWKDKNGEKQEKTEWHRVTFYRKLAEIAGEYLKKGRSVYVEGRLETRKWTDKS 90
>gi|177665239|ref|ZP_02941039.1| single-strand binding protein [Cyanothece sp. PCC 8801] >gi|196244063|ref|ZP_03142791.1| single-strand binding protein [Cyanothece sp. PCC 8802] >gi|172075661|gb|EDT61075.1| single-strand binding protein [Cyanothece sp. PCC 8801] >gi|196208195|gb|EDY02986.1| single-strand binding protein [Cyanothece sp. PCC 8802] (160 aa)
Score = 91, Expect = 8.4e-02, Identities = 25/100 (25%), Positives = 43/100 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           MN   L  K+   P    T+ N    +  L   +     ++ + +++  WG +A+ +    K GD V +EGRLS     N  D P        +++A  +Y
  S:     1 MNSCVLMAKVIRSPELRYTQENQTAVAQMLVEFEGRRPEEATATLKVVGWGNLATQMQENYKEGDRVIIEGRLSI----NSFDRPEGFKEKRAELVASHIY 97
>gi|187736346|ref|YP_001878458.1| single-strand binding protein [Akkermansia muciniphila ATCC BAA-835] >gi|187426398|gb|ACD05677.1| single-strand binding protein [Akkermansia muciniphila ATCC BAA-835] (166 aa)
Score = 91, Expect = 8.5e-02, Identities = 29/99 (29%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA-----CIDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+VFL G L+ DP    T          LA       D+S   +  +++ +T W + A      L  G  VFVEGRL   ++++  D  + +    L+VI + +
  S:     4 LNKVFLMGNLTADPELRYTPKGTAVTDIRLAINRYYAGDNSERQEETTFVDVTLWNRQAEVAGNYLSKGRGVFVEGRL---QLDSWEDKASGQKRTKLRVIGENI 105
>gi|145632493|ref|ZP_01788227.1| single-strand DNA-binding protein [Haemophilus influenzae 3655] >gi|144986688|gb|EDJ93240.1| single-strand DNA-binding protein [Haemophilus influenzae 3655] (173 aa)
Score = 90, Expect = 8.6e-02, Identities = 36/128 (28%), Positives = 60/128 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN 128
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D  ++     +N+     D   V  S + A +TN
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYGNDMGGVPQSSYQARQTN 136
>gi|42520614|ref|NP_966529.1| single-strand binding protein [Wolbachia endosymbiont of Drosophila melanogaster] >gi|99034516|ref|ZP_01314498.1| hypothetical protein Wendoof_01000693 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|42410353|gb|AAS14463.1| single-strand binding protein [Wolbachia endosymbiont of Drosophila melanogaster] (160 aa)
Score = 90, Expect = 8.8e-02, Identities = 33/95 (34%), Positives = 45/95 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP    T+     ASFS+A  +S  + D  S +R   T W  +  F   L        + G  V+VEG L T K      D N    Y  +V+
  S:     6 INKVILVGNLGKDPEIRTTQNGKEMASFSIATSES--WTDKLSGMRSEKTEWHNIVIFSEGLVKIVKDFARKGSKVYVEGSLRTRKWT----DQNGGERYTTEVV 104
>gi|19553651|ref|NP_601653.1| single-stranded DNA-binding protein [Corynebacterium glutamicum ATCC 13032] >gi|62391295|ref|YP_226697.1| single-strand DNA binding protein [Corynebacterium glutamicum ATCC 13032] >gi|21325226|dbj|BAB99848.1| Single-stranded DNA-binding protein [Corynebacterium glutamicum ATCC 13032] >gi|41326635|emb|CAF21117.1| SINGLE-STRAND DNA BINDING PROTEIN [Corynebacterium glutamicum ATCC 13032] (205 aa)
Score = 90, Expect = 8.8e-02, Identities = 24/58 (41%), Positives = 32/58 (55%)
  Q:    38 FNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
            N  K +I + AWGK+  +  ++LKPG SV V+G L T +    S DPN K     Q I
  S:    46 HNVDKVFINVEAWGKLGVNSHISLKPGVSVIVQGFLYTNEWEVESADPNVKKLEKRQEI 104
>gi|161522605|ref|YP_001585534.1| single-strand binding protein [Burkholderia multivorans ATCC 17616] >gi|189348526|ref|YP_001941722.1| single-strand DNA-binding protein [Burkholderia multivorans ATCC 17616] >gi|160346158|gb|ABX19242.1| single-strand binding protein [Burkholderia multivorans ATCC 17616] >gi|189338664|dbj|BAG47732.1| single-strand DNA-binding protein [Burkholderia multivorans ATCC 17616] (184 aa)
Score = 90, Expect = 9.0e-02, Identities = 24/99 (24%), Positives = 55/99 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +  A+  +A  D      +  + ++  + R++ +G++A  V   L+ G S++VEG++ T K   +    + +  Y+ +++AD++
  S:     4 VNKVIIVGNLGADPEVRYLPSGDAVANARVATTDRYKDKATGEYKETTEWHRVSFFGRLAEIVSEYLRKGSSIYVEGKIRTRKWQGQ----DGQDRYSTEIVADQM 105
>gi|114570434|ref|YP_757114.1| single-strand binding protein [Maricaulis maris MCS10] >gi|114340896|gb|ABI66176.1| single-strand binding protein [Maricaulis maris MCS10] (164 aa)
Score = 90, Expect = 9.1e-02, Identities = 33/98 (33%), Positives = 46/98 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRI--TAWGKVASF--------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP     R NN     +L+   S  + D  S  R   T W +V  F           LK G  V+VEG+L T K      D N +  Y+ +V+  +
  S:     5 VNKVILVGNLGRDPEI--RRMNNGDPVVNLSVATSESWRDKSSGERREKTEWHRVVIFNDNLAKVAENYLKKGSKVYVEGQLQTRKWT----DQNGQEKYSTEVVLQR 106
>gi|16804347|ref|NP_465832.1| hypothetical protein lmo2308 [Listeria monocytogenes EGD-e] >gi|47096011|ref|ZP_00233613.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|167405138|ref|ZP_02309902.1| hypothetical protein LmonocytFSL_19113 [Listeria monocytogenes FSL J2-003] >gi|37999734|sp|Q8Y4X1|SSB2_LISMO Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|16411778|emb|CAD00386.1| lmo2308 [Listeria monocytogenes] >gi|47015608|gb|EAL06539.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] (160 aa)
Score = 90, Expect = 9.1e-02, Identities = 32/99 (32%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA      + +G  ++  +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V
  S:     2 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREA-DFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDNDGKRVFVTEVVAESV 100
>gi|153168365|ref|ZP_01928273.1| hypothetical protein LMHG_02807 [Listeria monocytogenes FSL N1-017] >gi|133726352|gb|EBA28050.1| hypothetical protein LMHG_02807 [Listeria monocytogenes FSL N1-017] (159 aa)
Score = 90, Expect = 9.3e-02, Identities = 32/99 (32%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V
  S:     1 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDNDGKRVFVTEVVAESV 99
>gi|83746579|ref|ZP_00943629.1| Single-strand DNA binding protein [Ralstonia solanacearum UW551] >gi|83726713|gb|EAP73841.1| Single-strand DNA binding protein [Ralstonia solanacearum UW551] (178 aa)
Score = 90, Expect = 9.3e-02, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G  V+VEGRL T     R  + + +  Y+ +++A+++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASGEMKEATEWHRIAFFGRLAEIAGEYLKKGSQVYVEGRLKT-----RQWEKDGQKQYSTEIVAEQM 104
>gi|65317454|ref|ZP_00390413.1| COG0629: Single-stranded DNA-binding protein [Bacillus anthracis str. A2012] >gi|118480501|ref|YP_897652.1| single-strand DNA-binding protein [Bacillus thuringiensis str. Al Hakam] >gi|167641755|ref|ZP_02399998.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0193] >gi|170689467|ref|ZP_02880657.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0465] >gi|170707600|ref|ZP_02898053.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0389] >gi|118419726|gb|ABK88145.1| single-stranded DNA-binding protein [Bacillus thuringiensis str. Al Hakam] >gi|167510309|gb|EDR85712.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0193] >gi|170127596|gb|EDS96470.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0389] >gi|170666569|gb|EDT17342.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0465] (176 aa)
Score = 90, Expect = 9.4e-02, Identities = 39/137 (28%), Positives = 60/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       +  + K  Y  +V+A+ V   +  N   +   + +    P  A   N + N   Q+
  S:     5 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----EGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQSSNPFGQS 139
>gi|148284682|ref|YP_001248772.1| single-stranded DNA-binding protein [Orientia tsutsugamushi str. Boryong] >gi|146740121|emb|CAM80303.1| single-stranded DNA-binding protein [Orientia tsutsugamushi Boryong] (155 aa)
Score = 90, Expect = 9.5e-02, Identities = 29/95 (30%), Positives = 44/95 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF---VLTL-----KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +NRV L G L  DP   +T      A+FSLA  ++     S      T W ++  F   ++ +     K G  V +EG L T K      D + +  Y  ++I
  S:     5 LNRVTLIGNLGHDPEIRKTNDGKEIAAFSLATTETWRDKHSNEKKEKTEWHRIVVFNDGIVNIIKNYVKKGSKVLIEGSLQTRKW----QDSSGQEKYTTEII 103
>gi|153180328|ref|ZP_01933448.1| single-strand binding protein subfamily [Listeria monocytogenes F6900] >gi|133732095|gb|EBA33793.1| single-strand binding protein subfamily [Listeria monocytogenes F6900] (151 aa)
Score = 90, Expect = 9.5e-02, Identities = 34/107 (31%), Positives = 52/107 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           MNRV L G+L+ DP    T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V   D +N+
  S:    13 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDSDGKRVFVTEVVAESVQFLDPKNN 119
>gi|87162071|ref|YP_494609.1| single-strand binding protein [Staphylococcus aureus subsp. aureus USA300] >gi|161510208|ref|YP_001575867.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727615|ref|ZP_02759892.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87128045|gb|ABD22559.1| Single-strand binding protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|160369017|gb|ABX29988.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] (156 aa)
Score = 90, Expect = 9.7e-02, Identities = 36/107 (33%), Positives = 56/107 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +NR  L G+L+ DP +L+T  N +  ASF+LA   +  F +++      +I I  + K A  V   L  G    V+GRL T    N+      +  Y  +VIAD +   + +NS
  S:     2 LNRTILVGRLTRDP-ELRTTQNGVNVASFTLAV--NRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKE----GQRVYVTEVIADSIQFLEPKNS 108
>gi|94986935|ref|YP_594868.1| single-stranded DNA-binding protein [Lawsonia intracellularis PHE/MN1-00] >gi|94731184|emb|CAJ54546.1| Single-stranded DNA-binding protein [Lawsonia intracellularis PHE/MN1-00] (151 aa)
Score = 90, Expect = 9.8e-02, Identities = 31/99 (31%), Positives = 46/99 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G+L  DP    T+T +   S ++A  +S    D     R T W +V+ F          L  G  VFVEG L T K      D   +  Y  ++ A +V
  S:     2 LNKVMIIGRLGRDPEIRYTQTGSPVCSLNIATDESYTDRDGNKVER-TEWHRVSVFQRAAENCGQYLSKGSLVFVEGNLQTRKWQ----DQQGQDRYTTEIKAQRV 102
>gi|30265491|ref|NP_847868.1| single-strand DNA-binding protein [Bacillus anthracis str. Ames] >gi|47531059|ref|YP_022408.1| single-strand DNA-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47568672|ref|ZP_00239369.1| single-strand DNA binding protein [Bacillus cereus G9241] >gi|52145281|ref|YP_086738.1| single-strand DNA-binding protein [Bacillus cereus E33L] >gi|165873020|ref|ZP_02217641.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0488] >gi|166982573|ref|ZP_02254005.1| single-strand DNA-binding protein [Bacillus cereus AH187] >gi|166997086|ref|ZP_02263545.1| single-strand DNA-binding protein [Bacillus cereus AH820] >gi|168160950|ref|ZP_02596183.1| single-strand DNA-binding protein [Bacillus cereus H3081.97] >gi|190569296|ref|ZP_03022190.1| single-stranded DNA-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|196036124|ref|ZP_03103524.1| single-stranded DNA-binding protein [Bacillus cereus W] >gi|196041929|ref|ZP_03109216.1| single-stranded DNA-binding protein [Bacillus cereus NVH0597-99] >gi|196045533|ref|ZP_03112764.1| single-stranded DNA-binding protein [Bacillus cereus 03BB108] >gi|37999368|sp|Q81JI3|SSB_BACAN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|30260169|gb|AAP29354.1| single-stranded DNA-binding protein [Bacillus anthracis str. Ames] >gi|47506207|gb|AAT34883.1| single-stranded DNA-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47554660|gb|EAL13014.1| single-strand DNA binding protein [Bacillus cereus G9241] >gi|51978750|gb|AAU20300.1| single-stranded DNA-binding protein [Bacillus cereus E33L] >gi|164711232|gb|EDR16788.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0488] >gi|190559603|gb|EDV13594.1| single-stranded DNA-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|195991291|gb|EDX55259.1| single-stranded DNA-binding protein [Bacillus cereus W] >gi|196023740|gb|EDX62416.1| single-stranded DNA-binding protein [Bacillus cereus 03BB108] >gi|196027184|gb|EDX65804.1| single-stranded DNA-binding protein [Bacillus cereus NVH0597-99] (172 aa)
Score = 90, Expect = 9.8e-02, Identities = 39/137 (28%), Positives = 60/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       +  + K  Y  +V+A+ V   +  N   +   + +    P  A   N + N   Q+
  S:     1 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----EGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQSSNPFGQS 135
>gi|153093065|gb|EDN74081.1| single-stranded DNA-binding protein [Mannheimia haemolytica PHL213] (147 aa)
Score = 90, Expect = 9.9e-02, Identities = 31/107 (28%), Positives = 50/107 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +N+V + G L  DP           A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V++EGRL T K      D N +  Y  ++  D +   D  NS
  S:     4 INKVIIVGNLGNDPEMRTMPNGEAVANISVATSES--WNDKNTGERRELTEWHRIVFYRRQAEVCGQYLRKGSKVYIEGRLRTRKW----QDQNGQDRYTTEIQGDVLQMLDSRNS 113
>gi|162456895|ref|YP_001619262.1| single-stranded DNA binding protein [Sorangium cellulosum 'So ce 56'] >gi|161167477|emb|CAN98782.1| single-stranded DNA binding protein [Sorangium cellulosum 'So ce 56'] (203 aa)
Score = 90, Expect = 1.0e-01, Identities = 34/99 (34%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR-----ITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP    T+      +  LA  +S    D     R     +  WGK A +    L  G S+F+EG L T   ++R  D N +  Y  +VIA+ V
  S:     5 LNRVMLLGNLGADPELRFTQGGQAVLNLRLATTESYLDRDKVRKERTDWHNVVIWGKRAEALGKILSKGSSIFIEGSLRTSSYDDR--DGNKR--YKTEVIANNV 105
>gi|49188310|ref|YP_031563.1| single-strand DNA-binding protein [Bacillus anthracis str. Sterne] >gi|49480470|ref|YP_039463.1| single-strand DNA-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|167635123|ref|ZP_02393440.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0442] >gi|177655279|ref|ZP_02936833.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0174] >gi|49182237|gb|AAT57613.1| single-stranded DNA-binding protein [Bacillus anthracis str. Sterne] >gi|49332026|gb|AAT62672.1| single-stranded DNA-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|167529597|gb|EDR92347.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0442] >gi|172080206|gb|EDT65298.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0174] (173 aa)
Score = 90, Expect = 1.0e-01, Identities = 39/137 (28%), Positives = 60/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       +  + K  Y  +V+A+ V   +  N   +   + +    P  A   N + N   Q+
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----EGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQSSNPFGQS 136
>gi|46446738|ref|YP_008103.1| single-strand DNA-binding protein [Candidatus Protochlamydia amoebophila UWE25] >gi|46400379|emb|CAF23828.1| putative Single-strand binding protein [Candidatus Protochlamydia amoebophila UWE25] (158 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/96 (30%), Positives = 46/96 (47%)
  Q:     4 VFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWG-KVASFVLTLKPGDSVFVEGRLSTYKMNNRSD--DPNSKATYALQVIADKV 99
           V + G+L  DP    T +     +F++A     G  D   ++R+T WG ++   +  LK G +V V G     KMN  S   D   +   +L+V AD +
  S:     4 VNIAGRLGKDPEARFTPSGQKVTAFTIATNHRKGKEDITIWVRVTVWGDRLDKIISYLKKGSAVIVVG-----KMNPPSSYTDKEGRTQISLEVTADMI 97
>gi|169187394|ref|ZP_02847553.1| single-strand binding protein [Paenibacillus sp. JDR-2] >gi|169005403|gb|EDS52255.1| single-strand binding protein [Paenibacillus sp. JDR-2] (176 aa)
Score = 90, Expect = 1.0e-01, Identities = 31/99 (31%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID---SSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T        F++A +D   +SG  + ++ +I +  W ++A      L+ G    VEGR+      N       K  Y  +VIAD V
  S:     2 LNRVILIGRLTRDPELRYTPAGVAVTQFTIA-VDRPFTSGQGEREADFIPVVTWRQLAETCANYLRKGRLTAVEGRIQVRNYENNE----GKRVYVTEVIADNV 100
>gi|110640051|ref|YP_680261.1| single-stranded DNA binding protein [Cytophaga hutchinsonii ATCC 33406] >gi|110282732|gb|ABG60918.1| single-stranded DNA binding protein [Cytophaga hutchinsonii ATCC 33406] (152 aa)
Score = 90, Expect = 1.0e-01, Identities = 34/97 (35%), Positives = 49/97 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAW------GKVASFV-LTLKPGDSVFVEGRLSTYKMNNRS-DDPNSKATYALQVIAD 97
           +N+V L G L  DP      T+   A+FSLA  +S   N S   +  T W      G VA  +   L+ G  ++VEG++ T     RS DD +    Y  ++I D
  S:     4 INKVILVGNLGKDPEVRAIGTDRKVANFSLATTESY-KNKSGERVDQTEWHNVVFYGPVADVIERYLRKGSQIYVEGKIRT-----RSYDDKDGVKKYITEIIGD 102
>gi|189183638|ref|YP_001937423.1| single-strand binding protein [Orientia tsutsugamushi str. Ikeda] >gi|189180409|dbj|BAG40189.1| single-strand binding protein [Orientia tsutsugamushi str. Ikeda] (155 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/93 (31%), Positives = 41/93 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF---VLTL-----KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQ 93
           +NRV L G L  DP   +T      A+FSLA  ++     S      T W ++  F   ++ +     K G  V +EG L T K  + S          LQ
  S:     5 LNRVTLIGNLGHDPEIRKTNDGKEIAAFSLATTETWRDKHSNEKKEKTEWHRIVVFNDGIVNIIKSYVKKGSKVLIEGSLQTRKWQDSSGQEKYTTEIVLQ 105
>gi|167462796|ref|ZP_02327885.1| single-strand DNA-binding protein [Paenibacillus larvae subsp. larvae BRL-230010] (155 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/99 (29%), Positives = 44/99 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T +      F+LA +D    N         +I I  W ++A      L+ G    VEGR+      N       +  Y  +++AD V
  S:     2 LNRVILIGRLTRDPELRYTPSGVAVTQFTLA-VDRPYMNQQTRERETDFINIVTWRQLAETCANYLRKGRLTAVEGRIQVRNYENNE----GRKVYVTEIVADNV 101
>gi|146329431|ref|YP_001209671.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] >gi|146232901|gb|ABQ13879.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] (151 aa)
Score = 90, Expect = 1.0e-01, Identities = 27/81 (33%), Positives = 49/81 (60%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRS 81
           +N+V L G +  DP+ ++ T    + A+FSLA   S  +ND +S        + R  A+ ++A  +   ++ G  +++EGRL T K  ++S
  S:     4 INKVILIGNVGKDPDMRVMTNGEQV-ANFSLAT--SMSWNDRQSGEKREKTEWHRCVAYRRIAEIIGQYVRKGSKLYIEGRLETRKWQDQS 91
>gi|153887925|ref|ZP_02009072.1| single-strand binding protein [Ralstonia pickettii 12D] >gi|187928634|ref|YP_001899121.1| single-strand binding protein [Ralstonia pickettii 12J] >gi|151575524|gb|EDN39933.1| single-strand binding protein [Ralstonia pickettii 12D] >gi|187725524|gb|ACD26689.1| single-strand binding protein [Ralstonia pickettii 12J] (177 aa)
Score = 90, Expect = 1.0e-01, Identities = 26/99 (26%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G SV++EGRL T     R  + + +  Y+ +++A+++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRFKDKGSGEMREATEWHRIAFFGRLAEIAGEYLKKGSSVYIEGRLKT-----RQWEKDGQKQYSTEIVAEQM 104
>gi|15603815|ref|NP_246889.1| single-strand DNA-binding protein [Pasteurella multocida subsp. multocida str. Pm70] >gi|37999461|sp|Q9CJP4|SSB_PASMU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|12722386|gb|AAK04034.1| Ssb [Pasteurella multocida subsp. multocida str. Pm70] (166 aa)
Score = 90, Expect = 1.1e-01, Identities = 35/129 (27%), Positives = 59/129 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNA 129
           +N+V + G L  DP +++T  N    A+ S+A  +S    ++     +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D +   D  N  +Q    A    +P   A T +
  S:     4 VNKVIIVGNLGNDP-EIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGS 135
>gi|90408951|ref|ZP_01217085.1| ssDNA-binding protein controls activity of RecBCD nuclease [Psychromonas sp. CNPT3] >gi|90309952|gb|EAS38103.1| ssDNA-binding protein controls activity of RecBCD nuclease [Psychromonas sp. CNPT3] (205 aa)
Score = 90, Expect = 1.1e-01, Identities = 31/106 (29%), Positives = 52/106 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEEN 106
           +N+V L G L  DP        N  A+ +LA  +S  + D +S        +  +T +G++       LK G  ++VEGRL T    ++  D + +A Y  +V   ++   D  N
  S:     6 INKVILVGNLGKDPEMRYMPNGNAVANLTLATTES--WKDKQSGERKEHTEWHNLTVFGRLGEMCGEYLKKGAKIYVEGRLKT----DKWQDQSGQARYTTKVNVSEIQMMDSRN 114
>gi|119470445|ref|ZP_01613173.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Alteromonadales bacterium TW-7] >gi|119446370|gb|EAW27646.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Alteromonadales bacterium TW-7] (233 aa)
Score = 90, Expect = 1.1e-01, Identities = 29/97 (29%), Positives = 45/97 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP        N  A+ +LA  DS          D   + R+  +GK+A  V    + G  ++VEG+L T K      D   +  Y  +++ D
  S:     5 VNKVILVGNLGQDPEVRYMPNGNGVANITLATSDSYKDKNTGQMVDKTEWHRVVFFGKLAEIVGEYCRKGSQIYVEGKLQTRKWT----DQQGQEKYTTEIVVD 104
>gi|23100933|ref|NP_694400.1| single-strand DNA-binding protein [Oceanobacillus iheyensis HTE831] >gi|37999427|sp|Q8CX55|SSB_OCEIH Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|22779168|dbj|BAC15434.1| single-strand DNA-binding protein (phage-related protein) [Oceanobacillus iheyensis HTE831] (161 aa)
Score = 90, Expect = 1.1e-01, Identities = 29/99 (29%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP+   T      A+F++A      +   N    +I    W + A +    +K G  V V+GR+ T     +    + K  Y  +V+AD V
  S:     2 LNRVVLVGRLTRDPDLRYTPNGVAVANFNIAVNRPFSNQQGNREADFINCVIWRRPAENLANYMKKGSMVGVDGRIQTRNFEGQ----DGKTVYVTEVVADSV 100
>gi|167215002|ref|ZP_02285309.1| single-strand binding protein [Listeria monocytogenes FSL R2-503] (128 aa)
Score = 90, Expect = 1.1e-01, Identities = 33/99 (33%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVILVGRLTKDPDLRYTPAGAAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|134096251|ref|YP_001101326.1| ssDNA-binding protein controls activity of RecBCD nuclease [Herminiimonas arsenicoxydans] >gi|133740154|emb|CAL63205.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Herminiimonas arsenicoxydans] (161 aa)
Score = 90, Expect = 1.1e-01, Identities = 33/99 (33%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKS--------YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP   +TR    G + + +A   +  + D  S        + RIT + K+A      LK G SV++EGRL T K      D +    Y  ++IAD +
  S:     4 VNKVIIVGNLGRDP---ETRYMPNGEAVTNVAVATTESWKDKTSGDKKEVTEWHRITFYRKLAEIAGQYLKKGSSVYIEGRLQTRKWT----DKDGVERYTTEIIADTM 105
>gi|161831024|ref|YP_001596218.1| single-stranded DNA-binding protein [Coxiella burnetii RSA 331] >gi|161762891|gb|ABX78533.1| single-stranded DNA-binding protein [Coxiella burnetii RSA 331] (158 aa)
Score = 90, Expect = 1.1e-01, Identities = 31/103 (30%), Positives = 53/103 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPD 103
           +N+V L G L  DP    T   N  A+ +LA   S+ + D ++        + RI  + ++A  V   L+ G  +++EG L T K      D N    Y  ++IA++++  D
  S:     5 VNKVILIGNLGQDPEVRYTPNGNAVANVTLAT--STTWRDKQTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQ----DKNGVDRYTTEIIANEMHMLD 110
>gi|17545141|ref|NP_518543.1| single-strand DNA-binding protein [Ralstonia solanacearum GMI1000] >gi|37999450|sp|Q8Y2B4|SSB_RALSO Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|17427432|emb|CAD13950.1| probable single-strand binding protein (ssb) (helix-destabilizing protein). [Ralstonia solanacearum] (178 aa)
Score = 90, Expect = 1.1e-01, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +   +  +A  D      S    ++  + RI  +G++A      LK G  V+VEGRL T     R  + + +  Y+ +++A+++
  S:     4 VNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASGEMREATEWHRIAFFGRLAEIAGEYLKKGSQVYVEGRLKT-----RQWEKDGQKQYSTEIVAEQM 104
>gi|157325015|ref|YP_001468441.1| gp56 [Listeria phage A500] >gi|66733023|gb|AAY52842.1| gp56 [Listeria phage A500] (160 aa)
Score = 89, Expect = 1.1e-01, Identities = 30/99 (30%), Positives = 46/99 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA      ++       +I    W K A      LK G    V+GR+ T       +D + K  +  +V+A+ V
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNTQGEQEADFINCVVWRKPAENAANFLKKGSMAGVDGRVQTRNY----EDSDGKRVFVTEVVAETV 100
>gi|124520273|ref|ZP_01695456.1| single-strand binding protein [Bacillus coagulans 36D1] >gi|124497763|gb|EAY45316.1| single-strand binding protein [Bacillus coagulans 36D1] (164 aa)
Score = 89, Expect = 1.1e-01, Identities = 33/99 (33%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP+   T +    A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N  + D   +  Y  +V+AD V
  S:     2 LNRVVLVGRLTKDPDLRYTPSGVTVATFTLAV--NRTFTNQQGEREADFINCVVWRKQAENVANYLKKGSLAGVDGRIQT--RNYEAQD--GRRVYVTEVVADSV 100
>gi|182414104|ref|YP_001819170.1| single-strand binding protein [Opitutus terrae PB90-1] >gi|177841318|gb|ACB75570.1| single-strand binding protein [Opitutus terrae PB90-1] (159 aa)
Score = 89, Expect = 1.1e-01, Identities = 30/95 (31%), Positives = 44/95 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
            N+V+L G L+ DP    T        F +A      D SG   D  +++ I AWGK    +      G  +FVEGRL   K +   D  + +    L+V+
  S:     4 FNKVYLIGNLTRDPELRVTPKGTAICQFGMAVNRQFKDESGALRDDTTFVDIEAWGKQGETISKYCTKGRPLFVEGRL---KFDQWEDKTSGQKRSKLKVV 101
>gi|114707073|ref|ZP_01439972.1| single-strand DNA binding protein [Fulvimarina pelagi HTCC2506] >gi|114537623|gb|EAU40748.1| single-strand DNA binding protein [Fulvimarina pelagi HTCC2506] (169 aa)
Score = 89, Expect = 1.1e-01, Identities = 29/93 (31%), Positives = 42/93 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQ 93
           +N+V L G L  DP   +T+     A+FS+A  +S    +S      T W +V  F   L        K G  V++EG+L T K   +           LQ
  S:     5 VNKVILVGNLGADPEMRRTQDGKPIANFSVATSESWRDRNSGERREKTEWHRVVCFNEGLNKVIEQYVKKGSKVYIEGQLQTRKWQGQDGQDRYSTEVVLQ 105
>gi|167213509|ref|ZP_02283816.1| hypothetical protein LmonoFSL_00040 [Listeria monocytogenes FSL R2-503] (160 aa)
Score = 89, Expect = 1.2e-01, Identities = 35/109 (32%), Positives = 56/109 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV-YRPDEENSLE 109
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V +   ++N++E
  S:     2 MNRVMLVGRLTKDPDLRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQT--RNYEGND--GKRVYVTEIVAESVQFLEPKQNAVE 111
>gi|163868148|ref|YP_001609352.1| single-strand binding protein (ssb) [Bartonella tribocorum CIP 105476] >gi|161017799|emb|CAK01357.1| single-strand binding protein (ssb) [Bartonella tribocorum CIP 105476] (153 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/95 (31%), Positives = 50/95 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGA---SFSLACIDSSGFNDSKSYIRI--TAWGKVASF--------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP   +++T N GA   +F +A  +S  + D  ++ ++  T W  V  F        +  L  G  V++EG+L T K      D N    Y  +++
  S:     7 LNKVILIGYLGADP---ESKTMNSGAEIVNFRMATSES--YTDKNTHQKVDKTEWHSVVVFNPHLAKIALQYLHKGSKVYIEGKLQTRKW----QDKNGHDRYTTEIV 105
>gi|126700855|ref|YP_001089752.1| single-strand DNA-binding protein [Clostridium difficile 630] >gi|145953747|ref|ZP_01802755.1| hypothetical protein CdifQ_04003756 [Clostridium difficile QCD-32g58] >gi|168694529|ref|ZP_02726806.1| single-strand DNA-binding protein [Clostridium difficile QCD-37x79] >gi|168713730|ref|ZP_02746007.1| single-strand DNA-binding protein [Clostridium difficile QCD-63q42] >gi|168724194|ref|ZP_02756471.1| single-strand DNA-binding protein [Clostridium difficile QCD-76w55] >gi|168731534|ref|ZP_02763811.1| single-strand DNA-binding protein [Clostridium difficile QCD-97b34] >gi|196126957|ref|ZP_03118706.1| single-strand DNA-binding protein [Clostridium difficile ATCC 43255] >gi|196160426|ref|ZP_03120987.1| single-strand DNA-binding protein [Clostridium difficile CIP 107932] >gi|196165085|ref|ZP_03125616.1| single-strand DNA-binding protein [Clostridium difficile QCD-23m63] >gi|115252292|emb|CAJ70133.1| single-stranded DNA binding protein [Clostridium difficile 630] (211 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/106 (28%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     R   +G   + L    +  +N S  YI    WG+ A F   LK GD + + GR+ + +   + D+ N     A +V   K+ + DE N+
  S:   108 NSIFLDGYVCKEP---VYRKTPLGREITDLLVAINRPYNKS-DYIPSIVWGRNAKFAKNLKVGDRIQLWGRVQSREYEKKIDENNVVKKMAYEVSISKIKKLDENNN 210
>gi|29653623|ref|NP_819315.1| single-stranded DNA-binding protein [Coxiella burnetii RSA 493] >gi|154707576|ref|YP_001425151.1| single-stranded DNA-binding protein [Coxiella burnetii Dugway 5J108-111] >gi|164686023|ref|ZP_01947649.2| single-stranded DNA-binding protein [Coxiella burnetii 'MSU Goat Q177'] >gi|37999375|sp|Q83EP4|SSB_COXBU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|29540885|gb|AAO89829.1| single-strand binding protein [Coxiella burnetii RSA 493] >gi|154356862|gb|ABS78324.1| single-stranded DNA-binding protein [Coxiella burnetii Dugway 5J108-111] >gi|164601569|gb|EAX31729.2| single-stranded DNA-binding protein [Coxiella burnetii 'MSU Goat Q177'] (158 aa)
Score = 89, Expect = 1.2e-01, Identities = 31/103 (30%), Positives = 53/103 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPD 103
           +N+V L G L  DP    T   N  A+ +LA   S+ + D ++        + RI  + ++A  V   L+ G  +++EG L T K      D N    Y  ++IA++++  D
  S:     5 VNKVILIGNLGQDPEVRYTPNGNAVANVTLAT--STTWRDKQTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQ----DKNGVDRYTTEIIANEMHMLD 110
>gi|69245565|ref|ZP_00603503.1| Single-strand binding protein [Enterococcus faecium DO] >gi|68195692|gb|EAN10130.1| Single-strand binding protein [Enterococcus faecium DO] (161 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/97 (30%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N V L G+L+ DP+   T +    A+F+LA      +   N    +I    W K A  + TL K G  + V GR+ T   +N+      +  Y  +V+AD
  S:     2 INNVTLVGRLTKDPDLRYTASGTAVATFTLAVNRNFANQNGNREADFINCVIWRKPAETMATLAKKGGLIGVVGRIQTRTYDNQQ----GQRVYVTEVVAD 98
>gi|158520061|ref|YP_001527931.1| single-strand binding protein [Desulfococcus oleovorans Hxd3] >gi|158508887|gb|ABW65854.1| single-strand binding protein [Desulfococcus oleovorans Hxd3] (137 aa)
Score = 89, Expect = 1.2e-01, Identities = 29/96 (30%), Positives = 45/96 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+  + G+L  DP    T+     ASFS+A  +     DS      T W +V +F          L  G  V+V+GRL T     RS + +    Y  +++A
  S:     4 VNKAIIVGRLGRDPELRYTQDGRAVASFSVATSEEWKDKDSGDKKERTEWHRVVAFGRLGEICGEYLAKGRLVYVDGRLQT-----RSWEKDGVTRYTTEIVA 101
>gi|148378396|ref|YP_001252937.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] >gi|148287880|emb|CAL81946.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] (112 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/99 (27%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLACIDSSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ D    Q    ++    F +A        +SK+ YI I  WG+ A  +   +K G  + V GR+         +D N    Y ++++++++
  S:     1 MNRVMLIGRLTKDAELKQIEDRDVSLLRFVIAVNRYYNKENSKTDYIPIVVWGRHAEAIHKYMKKGKLISVVGRIQA----RNYEDKNGNKKYGIEIVSNEI 98
>gi|162447064|ref|YP_001620196.1| single-strand DNA-binding protein [Acholeplasma laidlawii PG-8A] >gi|161985171|gb|ABX80820.1| single-strand DNA-binding protein [Acholeplasma laidlawii PG-8A] (148 aa)
Score = 89, Expect = 1.3e-01, Identities = 36/146 (24%), Positives = 70/146 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDED 146
           +NRV L G+++ D +   T +     SF+LA      S+       +I    W   A F+   +K G+ + V+GR+ T       +D + +  Y  +V+AD V   +  +S +   D +    + + A ++N  ++EL ++    + D+D
  S:     2 INRVVLVGRITKDVDHRVTTSGASVVSFTLAVNRNFTSASGEREADFINCVTWRASADFMKNYVKKGNLLAVDGRMQTRNY----EDNDGRTVYITEVVADSVQLLESRSSNQS--DNSGQYRNKYEANQSNDAQDELYESTKNLIADDD 145
>gi|167463807|ref|ZP_02328896.1| Single-strand DNA-binding protein, phage-related protein [Paenibacillus larvae subsp. larvae BRL-230010] (134 aa)
Score = 89, Expect = 1.3e-01, Identities = 30/99 (30%), Positives = 43/99 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T +      F+LA +D    N         +I I  W + A      L+ G    VEGR+      N       +  Y  +V+AD V
  S:     2 LNRVVLIGRLTRDPELRYTPSGVAVTKFTLA-VDRPYMNQQTRERETDFINIVTWRQTAEACANHLRKGRLTAVEGRIQVRNYENNE----GRRIYVTEVVADNV 101
>gi|109896479|ref|YP_659734.1| single-strand binding protein [Pseudoalteromonas atlantica T6c] >gi|109698760|gb|ABG38680.1| single-strand binding protein [Pseudoalteromonas atlantica T6c] (200 aa)
Score = 89, Expect = 1.3e-01, Identities = 28/99 (28%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP        N  A+ S+A  +S         +   + R+T + ++A      L+ G  ++VEG+L T K      D   +  Y  +VI D++
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANLSIATSESWKDQQGQMQERTEWHRLTMYRRLAEVAGEYLRKGSQIYVEGKLQTRKW----QDQQGQDKYTTEVIVDQM 106
>gi|153180345|ref|ZP_01933456.1| hypothetical protein LMMG_02941 [Listeria monocytogenes F6900] >gi|133732087|gb|EBA33785.1| hypothetical protein LMMG_02941 [Listeria monocytogenes F6900] (140 aa)
Score = 89, Expect = 1.3e-01, Identities = 32/99 (32%), Positives = 50/99 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP+   T      A+F+LA      + +G  ++  +I    W K A  V   LK G    V+GR+ T       +D + K  +  +V+A+ V
  S:     2 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREA-DFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNY----EDNDGKRVFVTEVVAESV 100
>gi|124262891|ref|YP_001023361.1| single-stranded DNA-binding protein [Methylibium petroleiphilum PM1] >gi|124262137|gb|ABM97126.1| Single-stranded DNA-binding protein [Methylibium petroleiphilum PM1] (169 aa)
Score = 89, Expect = 1.4e-01, Identities = 28/99 (28%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF-------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP    T + +   + S+A   +    DS      T W +V  +          LK G  V++EGRL T K      D + K  Y  +++A+++
  S:     4 VNKVHILGNLGRDPEVRYTPSGSAVCNISVATTRNWKNKDSGEKQEETEWHRVVLYDRLAEIAGEYLKKGRPVYIEGRLKTRKWQ----DKDGKDQYTTEIVANEM 105
>gi|117926939|ref|YP_867556.1| single-strand binding protein [Magnetococcus sp. MC-1] >gi|117610695|gb|ABK46150.1| single-strand binding protein [Magnetococcus sp. MC-1] (180 aa)
Score = 89, Expect = 1.4e-01, Identities = 25/81 (30%), Positives = 44/81 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRS 81
           +N+V L G L  DP    T+     A+ ++A  +S  +ND +        + R+  +GK A      ++ G  V++EG+L T K  ++S
  S:     5 LNKVQLIGNLGADPEVRYTQAGKAMANLNIATSES--WNDQQGQRQERTEWHRVVIFGKAAEIAQQYMRKGSKVYIEGQLQTRKWQDQS 91
>gi|134298844|ref|YP_001112340.1| single-strand binding protein [Desulfotomaculum reducens MI-1] >gi|134051544|gb|ABO49515.1| single-strand binding protein [Desulfotomaculum reducens MI-1] (136 aa)
Score = 89, Expect = 1.4e-01, Identities = 33/107 (30%), Positives = 53/107 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS----YIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY-------RPDEENS 107
           +N+V L G+L+ DP +L+  TN I  +     ++   FN  +     +I I  W ++A      L  G  V V+GRL         DD       A +V+A+ V        RP+ ++S
  S:     2 LNKVILIGRLTRDP-ELRYTTNGIAVAKLNLAVERPQFNREREKETDFIDIVVWQRLAEICANNLGKGRLVAVDGRLQVRSY----DDNQGIRRKAAEVVAENVKFLDWPKDRPNHQDS 115
>gi|33337378|gb|AAQ13360.1|U66100_2 ssb homolog [Streptococcus pyogenes] (119 aa)
Score = 88, Expect = 1.5e-01, Identities = 28/96 (29%), Positives = 48/96 (50%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           N+V   G+L   P  ++T T+   A  SLA      ++SG  ++  +I +  WGK+A + V     G  +F++G L T     R  D + +  Y  +V+  
  S:     3 NKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREA-DFISVVVWGKLAETLVSYASKGSLIFIDGELRT-----RKYDKDGQVHYVTEVLCQ 97
>gi|52841211|ref|YP_095010.1| single strand DNA binding protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628322|gb|AAU27063.1| single strand DNA binding protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (140 aa)
Score = 88, Expect = 1.5e-01, Identities = 30/99 (30%), Positives = 45/99 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSS-GFNDSKSYIRITAW------GKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G L  DP  +   T   G SF  A + ++  F  S  +     W      GK+      LK G  V++EG+L +    N+  D   K    L V+ + +
  S:     5 LNRVQLIGNLGADPKSI---TGKDGQSFVTATLATNESFKKSDEWQTRVEWHQLVLFGKLIKVAEYLKKGSQVYLEGKLRS----NQWTDNEGKTHQTLSVVVNHI 103
>gi|190571216|ref|YP_001975574.1| single-strand binding protein [Wolbachia pipientis] >gi|190357488|emb|CAQ54923.1| single-strand binding protein [Wolbachia pipientis] (160 aa)
Score = 88, Expect = 1.6e-01, Identities = 31/95 (32%), Positives = 42/95 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP    T+     ASFS+A  +S     S +    T W  +  F   L        + G  V+VEG L T K      D N    Y  +V+
  S:     6 INKVILVGNLGKDPEIRTTQNGKEMASFSIATSESWTDKFSGTRSEKTEWHNIVIFSEGLVKIVKDFARKGSKVYVEGSLRTRKWT----DQNGSERYTTEVV 104
>gi|83648823|ref|YP_437258.1| single-stranded DNA-binding protein [Hahella chejuensis KCTC 2396] >gi|83636866|gb|ABC32833.1| Single-stranded DNA-binding protein [Hahella chejuensis KCTC 2396] (210 aa)
Score = 88, Expect = 1.6e-01, Identities = 28/97 (28%), Positives = 52/97 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP    T + +  ++  LA  +S  + D ++        + R+  +GK+A      L+ G  V++EGRL T K  ++S     +  Y+ +++ D
  S:     5 VNKVILIGNLGSDPETRYTPSGSAISNLRLATDES--YKDKQTGQLVPRTEWHRVVLFGKLAEIAAQYLRKGSKVYIEGRLQTRKWQDQS----GQDRYSTEIVVD 104
>gi|167015407|ref|ZP_02277940.1| hypothetical protein LmonFS_14436 [Listeria monocytogenes FSL J1-194] (159 aa)
Score = 88, Expect = 1.6e-01, Identities = 33/109 (30%), Positives = 52/109 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           MNRV L G+L+ DP    T      A+F+LA      + +G  ++  +I+   W K A      LK G    V+GR+ T       +D + K  +  +V+A+ V   +  N  E
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRAFTNQNGEREA-DFIQCVVWRKPAENAANFLKKGSMAGVDGRIQTRNY----EDNDGKRVFVTEVVAESVQFLEPRNHAE 110
>gi|119946996|ref|YP_944676.1| single-strand binding protein [Psychromonas ingrahamii 37] >gi|119865600|gb|ABM05077.1| single-strand binding protein [Psychromonas ingrahamii 37] (222 aa)
Score = 88, Expect = 1.6e-01, Identities = 29/109 (26%), Positives = 53/109 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           +N+V L G L  DP        N  A+ +LA  +S     SG    K+ + R+T + ++       LK G  ++VEG+L T K   +    + +  Y  +++  +++  D  N  +
  S:     6 VNKVVLVGNLGKDPEMRYMPNGNAVANLTLATTESWKDKQSGERKEKTEWHRLTVFNRLGEMCGEYLKKGVKIYVEGKLQTRKWQGQ----DGQDKYTTEIVVSEIHMMDARNPTQ 117
>gi|20808452|ref|NP_623623.1| single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] >gi|20517069|gb|AAM25227.1| Single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] (153 aa)
Score = 88, Expect = 1.7e-01, Identities = 31/99 (31%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLTLK-PGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G+ + D  KL T + +    FSLA      +  G N    +I + AW ++A  +      G  V V GRL T     R  D + K    L+V+A+++
  S:     3 LNKVMLVGRTTKDLKKLITPSGHPVVHFSLAVDRNYTNKEG-NRETDFIPVVAWNRLAEILEQYAVKGTLVAVVGRLQT----RRYTDGSGKNVRILEVVAEEI 101
>gi|30023497|ref|NP_835128.1| single-strand DNA-binding protein [Bacillus cereus ATCC 14579] >gi|168137548|ref|ZP_02580777.1| single-strand DNA-binding protein [Bacillus cereus B4264] >gi|37999367|sp|Q814G6|SSB_BACCR Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|29899058|gb|AAP12329.1| Single-strand DNA binding protein [Bacillus cereus ATCC 14579] (170 aa)
Score = 88, Expect = 1.7e-01, Identities = 39/137 (28%), Positives = 59/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       +  + K  Y  +V+A+ V   +  N   +   + +    P  A   N   N   Q+
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----EGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQGSNPFGQS 136
>gi|28209879|ref|NP_780823.1| single-strand binding protein [Clostridium tetani E88] >gi|37999423|sp|Q899R2|SSB_CLOTE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|28202314|gb|AAO34760.1| single-strand binding protein [Clostridium tetani E88] (145 aa)
Score = 88, Expect = 1.7e-01, Identities = 32/99 (32%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNIGASFSLACIDSSGFNDSKS---YIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP  K    T     +F LA +D     D K+   +I +  WGK A S    +  G  + + GR+ T     +    +    Y  +V+AD+V
  S:     1 MNRVVLIGRLTKDPELKFTPGTGTAVTTFVLA-VDRRFSKDGKNEADFIPVVVWGKQAESTANYMSKGKLIGISGRIQTRSYEAK----DGTRRYVTEVVADEV 99
>gi|15829081|ref|NP_326441.1| single-strand binding protein (SSB) (helix-destabilizing protein) [Mycoplasma pulmonis UAB CTIP] >gi|37999456|sp|Q98PV9|SSB_MYCPU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|14090025|emb|CAC13783.1| SINGLE-STRAND BINDING PROTEIN (SSB) (HELIX-DESTABILIZING PROTEIN) [Mycoplasma pulmonis] (181 aa)
Score = 88, Expect = 1.7e-01, Identities = 28/86 (32%), Positives = 48/86 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNS 86
           MNR+ + G+++ DP    T +    + F++A +D   F+  +S     YI + AW  ++ F+   +  G  V VEG L +Y    RS+D N+
  S:     1 MNRICIVGRITRDPYNNITNSGISYSRFTIA-VDRRNFSSQRSENITDYIPVVAWRGLSEFIKKNVFKGTLVSVEGSLQSYI---RSEDKNT 88
>gi|171057246|ref|YP_001789595.1| single-strand binding protein [Leptothrix cholodnii SP-6] >gi|170774691|gb|ACB32830.1| single-strand binding protein [Leptothrix cholodnii SP-6] (183 aa)
Score = 88, Expect = 1.7e-01, Identities = 28/99 (28%), Positives = 44/99 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF-------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP    T +     + S+A   +    D       T W +V  +          L+ G  V+VEGRL T K      D   +  Y  +++AD++
  S:     4 VNKVILIGNLGRDPEVRYTPSGAAVCNVSVATTRNWKSKDGGERQEETEWHRVVFYDRLAEIAGEYLRKGRPVYVEGRLKTRKWQ----DKEGRDQYTTEIVADQM 105
>gi|42784669|ref|NP_981916.1| single-strand DNA-binding protein [Bacillus cereus ATCC 10987] >gi|167937973|ref|ZP_02525048.1| single-strand DNA-binding protein [Bacillus cereus AH1134] >gi|42740601|gb|AAS44524.1| single-stranded DNA-binding protein [Bacillus cereus ATCC 10987] (169 aa)
Score = 88, Expect = 1.7e-01, Identities = 39/137 (28%), Positives = 59/137 (43%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQA 137
           MNRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GRL T       +  + K  Y  +V+A+ V   +  N   +   + +    P  A   N   N   Q+
  S:     1 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY----EGQDGKRVYVTEVLAESVQFLEPRNGGGE--QRGSFNQQPSGAGFGNQGSNPFGQS 135
>gi|114771958|ref|ZP_01449347.1| single-strand binding protein [alpha proteobacterium HTCC2255] (175 aa)
Score = 88, Expect = 1.7e-01, Identities = 29/99 (29%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP         + A+ S+A  +S  + D +        + RIT + ++A      LK G  V++EG+L T K      D      Y  ++IAD++
  S:     6 VNKVIIVGNLGNDPEVKNLPNGGVVANLSVATSES--WKDQQGQPQERTEWHRITMYRRLAEIAGEYLKKGSKVYLEGKLQTRKW----QDQQGNDRYTTEIIADQM 106
>gi|167856566|ref|ZP_02479272.1| single-stranded DNA-binding protein [Haemophilus parasuis 29755] >gi|167852308|gb|EDS23616.1| single-stranded DNA-binding protein [Haemophilus parasuis 29755] (179 aa)
Score = 88, Expect = 1.8e-01, Identities = 29/97 (29%), Positives = 48/97 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP+       +  A+ S+A  +S  +ND  +  R  +T W ++  F          L+ G  V+VEG+L T K      D N +  Y  ++  D
  S:     4 VNKVIIVGNLGNDPDMRTMPNGDAVATLSVATSES--WNDKMTGERREVTEWHRIVFFRRQAEVAGQYLRKGSKVYVEGKLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|152980525|ref|YP_001355029.1| single-strand DNA-binding protein [Janthinobacterium sp. Marseille] >gi|151280602|gb|ABR89012.1| single-strand DNA-binding protein [Janthinobacterium sp. Marseille] (162 aa)
Score = 88, Expect = 1.8e-01, Identities = 33/99 (33%), Positives = 51/99 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKS--------YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP   +TR    G + + +A   +  + D  S        + RIT + K+A      LK G +V+VEGRL T K      D +    Y  ++IAD +
  S:     4 VNKVIIVGNLGRDP---ETRYMPNGEAVTNVAVATTESWKDKNSGDKKEITEWHRITFYRKLAEIAGQYLKKGSAVYVEGRLQTRKWT----DKDGVERYTTEIIADTM 105
>gi|158321042|ref|YP_001513549.1| single-strand DNA-binding protein [Alkaliphilus oremlandii OhILAs] >gi|158141241|gb|ABW19553.1| single-strand binding protein/Primosomal replication protein n [Alkaliphilus oremlandii OhILAs] (222 aa)
Score = 88, Expect = 1.9e-01, Identities = 28/112 (25%), Positives = 48/112 (42%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPN--SKATYALQVIADKVYRPDEENSLEQPVD 113
           N +FL G +   P     R    G   +   +  +   +   YI   AWG+ A F   L  GD + + GR+ + K   + +D N  +K  Y + +   +    ++EN  E+  D
  S:   111 NEIFLEGYICKSP---VYRETPFGREITDILVAVNRLYNKSDYIPAIAWGRNARFSSNLNIGDKIRIWGRIQSRKYQKKFNDGNVVNKVAYEVSISKMEKVNSEDENKTEEHTD 221
>gi|152972922|ref|YP_001338068.1| single-strand DNA-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957771|gb|ABR79801.1| single-strand DNA-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (174 aa)
Score = 88, Expect = 1.9e-01, Identities = 25/81 (30%), Positives = 42/81 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRS 81
           +N+V L G L  DP      +    A+F+LA  +S          +   + R+  +GK+A      L+ G  V++EG+L T K  ++S
  S:     6 VNKVILVGNLGQDPEVRYMPSGGAVANFTLATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQS 93
>gi|16272208|ref|NP_438419.1| single-strand DNA-binding protein [Haemophilus influenzae Rd KW20] >gi|1174443|sp|P44409|SSB_HAEIN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|1573216|gb|AAC21916.1| single-stranded DNA binding protein (ssb) [Haemophilus influenzae Rd KW20] (168 aa)
Score = 88, Expect = 1.9e-01, Identities = 35/128 (27%), Positives = 59/128 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN 128
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D  ++     +N+     D      S + A +TN
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYGNDMGGAPQSSYQARQTN 136
>gi|160881891|ref|YP_001560859.1| single-strand binding protein [Clostridium phytofermentans ISDg] >gi|160430557|gb|ABX44120.1| single-strand binding protein [Clostridium phytofermentans ISDg] (146 aa)
Score = 87, Expect = 1.9e-01, Identities = 31/98 (31%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNIG-ASFSLAC---IDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           MN+V L G+L+ DP  +     N++  A +SLA        G  D+  +   TA+G+ A F    LK G  + + GR+      N+    + +  Y++QVI D+
  S:     1 MNKVILMGRLTRDPEIRYSQGANSLAIARYSLAVNRSFKREGEPDA-DFFNCTAFGRNAEFAEKYLKQGTRILISGRIQQDNYTNK----DGQKVYSVQVIVDE 99
>gi|124514469|gb|EAY55982.1| Single-stranded DNA-binding protein [Leptospirillum sp. Group II UBA] (140 aa)
Score = 87, Expect = 1.9e-01, Identities = 30/75 (40%), Positives = 41/75 (54%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-SGFNDSK---SYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYK 76
           N+V L G L+ DP    TR     ASF+LA  +     N+++   SYI +  +GK A  V   L+ G  V VEGRL   +
  S:     5 NKVILMGNLTRDPEVRFTRDGAPVASFTLAINNRYRQENETREDVSYIDVVTFGKQADLVKNYLEKGSPVLVEGRLQQRR 84
>gi|16801465|ref|NP_471733.1| hypothetical protein lin2402 [Listeria innocua Clip11262] >gi|37999745|sp|Q928X8|SSB3_LISIN Single-stranded DNA-binding protein 3 (SSB 3) (Helix-destabilizing protein 3) >gi|16414925|emb|CAC97629.1| lin2402 [Listeria innocua] (160 aa)
Score = 87, Expect = 1.9e-01, Identities = 32/99 (32%), Positives = 46/99 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP    T      A+F+LA      +        +I+   W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|116626929|ref|YP_829085.1| single-strand binding protein [Solibacter usitatus Ellin6076] >gi|116230091|gb|ABJ88800.1| single-strand binding protein [Solibacter usitatus Ellin6076] (162 aa)
Score = 87, Expect = 1.9e-01, Identities = 31/97 (31%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWG--------KVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+VFL G+L  D     T +    + F+LA   S+    S  +  +T W          VA+F+L    G  V+VEGRL T       +D   +  Y  +VI +
  S:     6 VNKVFLLGRLGKDAETKFTPSGLSISKFTLATNRSTKDQQSGEWKELTDWHNIVVWRTEHVANFLLK---GKQVYVEGRLETRSY----EDKEGQKKYFTEVICE 103
>gi|188590672|ref|YP_001921647.1| single-strand binding domain protein [Clostridium botulinum E3 str. Alaska E43] >gi|188500953|gb|ACD54089.1| single-strand binding domain protein [Clostridium botulinum E3 str. Alaska E43] (216 aa)
Score = 87, Expect = 2.0e-01, Identities = 27/106 (25%), Positives = 48/106 (45%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   +   +  +   +   YI   AWG+ + F  +L  GD++ V GR+ + +   +  D  S    A +V   K+ + + +NS
  S:   107 NEIFLDGYICKEP---VYRTTPFGREIADVLLAVNRAYNKSDYIPTIAWGRNSRFCQSLSVGDNIRVWGRVQSREYQKKVSDTESIKKIAYEVSISKMEKVEGDNS 209
>gi|145635157|ref|ZP_01790862.1| single-strand DNA-binding protein [Haemophilus influenzae PittAA] >gi|145267578|gb|EDK07577.1| single-strand DNA-binding protein [Haemophilus influenzae PittAA] (168 aa)
Score = 87, Expect = 2.1e-01, Identities = 29/97 (29%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|189485364|ref|YP_001956305.1| single-stranded DNA-binding protein [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287323|dbj|BAG13844.1| single-stranded DNA-binding protein [uncultured Termite group 1 bacterium phylotype Rs-D17] (155 aa)
Score = 87, Expect = 2.1e-01, Identities = 31/98 (31%), Positives = 49/98 (50%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSK-SYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           N V + G+L+ DP   +T T     SF +A         +  + D++ +++ I  W   A      LK G  V+VEGRL T K   +     S+    L+V+A +V
  S:    14 NSVIIVGRLTRDPELRRTVTGKAICSFDIAISGRMKDPVTGDWKDAEPTFVPIIVWNNQAERCGERLKKGLPVYVEGRLKTNKWEGKDGIKRSR----LEVVASRV 115
>gi|145640173|ref|ZP_01795757.1| single-strand DNA-binding protein [Haemophilus influenzae R3021] >gi|145274759|gb|EDK14621.1| single-strand DNA-binding protein [Haemophilus influenzae 22.4-21] (168 aa)
Score = 87, Expect = 2.1e-01, Identities = 29/97 (29%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|88812721|ref|ZP_01127967.1| Single-strand binding protein [Nitrococcus mobilis Nb-231] >gi|88789959|gb|EAR21080.1| Single-strand binding protein [Nitrococcus mobilis Nb-231] (147 aa)
Score = 87, Expect = 2.1e-01, Identities = 32/111 (28%), Positives = 58/111 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS-----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPD---EENSLEQP 111
           +N+V L G L  DP    + + +   +  LA  D+     SG    ++ + RI  +G++A      L+ G  V++EGRL T K   +    + +  Y  +++A ++   D   E +S E+P
  S:     5 INKVILIGNLGADPEVRYSPSGSAVTNARLATTDAWRDRQSGEQQERTEWHRIVFFGRLAEIAGEYLRKGAKVYIEGRLQTRKWQGQ----DGQDRYTTEIVASEMQMLDSRTEASSSERP 121
>gi|145590082|ref|YP_001156679.1| single-strand binding protein [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048488|gb|ABP35115.1| single-strand binding protein [Polynucleobacter sp. QLW-P1DMWA-1] (151 aa)
Score = 87, Expect = 2.2e-01, Identities = 26/97 (26%), Positives = 49/97 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G +  DP      + +   + S+A  D      +    ++  + R+  +GK+A      LK G  V+VEGRL T K      D + +  Y+ +++A+
  S:     4 VNKVIIVGNVGRDPETRYMPSGDAVTNISVATSDRYKDKQTGEMKETTEWHRVAFFGKLAEIAGQYLKKGSQVYVEGRLRTRKWT----DASGQEKYSTEIVAE 103
>gi|118443634|ref|YP_877816.1| single-strand DNA-binding protein [Clostridium novyi NT] >gi|118134090|gb|ABK61134.1| single-strand DNA binding protein [Clostridium novyi NT] (220 aa)
Score = 87, Expect = 2.2e-01, Identities = 29/115 (25%), Positives = 52/115 (45%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKAT 116
           N++FL G +  +P     RT   G   +   +  +   +   YI   +WG+ + F  TL  GD++ V GRL + K   +  +       A +V   K+   DE   +++ +DK+ 
  S:   107 NQIFLDGYICKEP---IYRTTPFGREIADILLAVNRPYNKSDYIPTISWGRNSRFCKTLNVGDNIRVWGRLQSRKYQKKVGEDEVVTKTAYEVSISKLEYADE---IDEEIDKSV 215
>gi|145628571|ref|ZP_01784371.1| single-strand DNA-binding protein [Haemophilus influenzae 22.1-21] >gi|507347|gb|AAA60461.1| SSB >gi|144979041|gb|EDJ88727.1| single-strand DNA-binding protein [Haemophilus influenzae 22.1-21] (168 aa)
Score = 87, Expect = 2.2e-01, Identities = 29/97 (29%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|145637152|ref|ZP_01792814.1| dihydrodipicolinate synthase [Haemophilus influenzae PittHH] >gi|145269597|gb|EDK09538.1| dihydrodipicolinate synthase [Haemophilus influenzae PittHH] (173 aa)
Score = 87, Expect = 2.2e-01, Identities = 35/128 (27%), Positives = 59/128 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD--KVYRPDEENSLEQPVDKATVIDSPFLAAKTN 128
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D  ++     +N+     D      S + A +TN
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGDVMQMLGGRNQNAGSYGNDMGGAPQSSYQARQTN 136
>gi|168467974|ref|ZP_02701811.1| single-stranded DNA-binding protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195628932|gb|EDX48334.1| single-stranded DNA-binding protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] (178 aa)
Score = 87, Expect = 2.3e-01, Identities = 27/81 (33%), Positives = 40/81 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRS 81
           +N+V L G L  DP       N   AS  LA  +S          D   + R+  +GK+A      L+ G  V++EG+L T K  ++S
  S:     6 INKVILVGALGRDPEVRYLPDNKAVASLQLATNESWRDKQTGEMKDKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQS 93
>gi|171464183|ref|YP_001798296.1| single-strand binding protein [Polynucleobacter necessarius STIR1] >gi|171193721|gb|ACB44682.1| single-strand binding protein [Polynucleobacter necessarius STIR1] (151 aa)
Score = 87, Expect = 2.3e-01, Identities = 26/97 (26%), Positives = 49/97 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G +  DP      + +   + S+A  D      +    ++  + R+  +GK+A      LK G  V+VEGRL T K      D + +  Y+ +++A+
  S:     4 VNKVIIVGNVGRDPETRYMPSGDAVTNISVATSDRYKDKQTGEMKETTEWHRVAFFGKLAEIAGQYLKKGSQVYVEGRLRTRKWT----DASGQEKYSTEIVAE 103
>gi|15927558|ref|NP_375091.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus N315] >gi|30043970|ref|NP_835537.1| single-strand DNA-binding protein [Staphylococcus phage phiN315] >gi|148266761|ref|YP_001245704.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|148268456|ref|YP_001247399.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|150392805|ref|YP_001315480.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|150394518|ref|YP_001317193.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|37999457|sp|Q99SQ9|SSB_STAAN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|13701777|dbj|BAB43070.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus N315] >gi|147739830|gb|ABQ48128.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|147741525|gb|ABQ49823.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|149945257|gb|ABR51193.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|149946970|gb|ABR52906.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] (156 aa)
Score = 87, Expect = 2.3e-01, Identities = 34/107 (31%), Positives = 53/107 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +NR  L G+L+ DP    T++    ASF+LA   +  F +++      +I I  + K A  V   L  G    V+GRL T    N+      +  Y  +VIAD +   + +NS
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAV--NRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKE----GQRVYVTEVIADSIQFLEPKNS 108
>gi|15924973|ref|NP_372507.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|156980300|ref|YP_001442559.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu3] >gi|37999749|sp|Q931K4|SSB_STAAM Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|14247756|dbj|BAB58145.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|156722435|dbj|BAF78852.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu3] (156 aa)
Score = 87, Expect = 2.4e-01, Identities = 34/107 (31%), Positives = 53/107 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +NR  L G+L+ DP    T++    ASF+LA   +  F +++      +I I  + K A  V   L  G    V+GRL T    N+      +  Y  +VIAD +   + +NS
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAV--NRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKE----GQRVYVTEVIADSIQFLEPKNS 108
>gi|157960400|ref|YP_001500434.1| single-strand binding protein [Shewanella pealeana ATCC 700345] >gi|157845400|gb|ABV85899.1| single-strand binding protein [Shewanella pealeana ATCC 700345] (222 aa)
Score = 87, Expect = 2.4e-01, Identities = 28/98 (28%), Positives = 50/98 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A      D  G    ++ + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVMFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVVDQ 105
>gi|116871458|ref|YP_848239.1| single-strand binding protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740336|emb|CAK19454.1| ssb [Listeria welshimeri serovar 6b str. SLCC5334] (177 aa)
Score = 86, Expect = 2.5e-01, Identities = 33/99 (33%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP    T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|124007396|ref|ZP_01692103.1| Ssb protein [Microscilla marina ATCC 23134] >gi|123987229|gb|EAY26969.1| Ssb protein [Microscilla marina ATCC 23134] (152 aa)
Score = 86, Expect = 2.5e-01, Identities = 26/73 (35%), Positives = 37/73 (50%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLA--CIDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLST 74
           N++ L G L  DP         + A+FS+A       G      + R++ WG  A  V   L+ G+ V+VEGRLST
  S:     5 NKIILIGHLGDDPAVRDFEGRKV-ANFSIAVNAYTKPGEEPKTDWFRVSFWGNNAEVVEKYLRKGNQVYVEGRLST 79
>gi|177675975|ref|ZP_02946390.1| single-strand binding protein [Methylocella silvestris BL2] >gi|172069308|gb|EDT55417.1| single-strand binding protein [Methylocella silvestris BL2] (168 aa)
Score = 86, Expect = 2.7e-01, Identities = 30/93 (32%), Positives = 44/93 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQ 93
           +N+V L G L  DP   +  + +   SFSLA  DS  + D  +  R   T W  +  F   L        K G  V+VEG+L T +  ++  +        LQ
  S:     5 VNKVILIGNLGRDPETRRMNSGDAVVSFSLATTDS--WRDKATGERKDRTEWHNIVIFNENLGKIADQYCKKGSKVYVEGQLQTREYTDKDGNQRKVTEIVLQ 105
>gi|170759438|ref|YP_001788475.1| single-strand nucleic acid-binding domain-containing protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406427|gb|ACA54838.1| single-strand binding domain protein [Clostridium botulinum A3 str. Loch Maree] (233 aa)
Score = 86, Expect = 2.7e-01, Identities = 31/106 (29%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   + L    +  +N S  YI   +WG+ A F  TL+ GD++ V GRL +     R  +  +    A +V   K+ R  +E +
  S:   108 NEIFLDGYICKEP---IYRTTPFGREIADLLLAVNRPYNKS-DYIPNISWGRNARFCKTLQVGDNIRVWGRLQSRYYQKRISEDKTITKVAYEVSISKMERVGDEQA 210
>gi|145641709|ref|ZP_01797285.1| single-strand DNA-binding protein [Haemophilus influenzae R3021] >gi|145273523|gb|EDK13393.1| single-strand DNA-binding protein [Haemophilus influenzae 22.4-21] (146 aa)
Score = 86, Expect = 2.7e-01, Identities = 35/134 (26%), Positives = 59/134 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY----RPDEENSLEQPVDKATVIDSPFLAAKTNATENEL 134
           +N+V + G L  DP           A+ S+A  +S    +S      T W ++  +          L+ G  V++EGRL T K      D N +  Y  ++  D +     R DE+ S  +   K    D    AA+ +  +N++
  S:     4 INKVIIVGHLGNDPEMRTMPNGEQVANISVATSESWTDKNSGEKKTQTEWHRIVFYRRQAEICGQYLQKGSQVYIEGRLKTRKWQ----DQNGQDRYTTEIQGDVLQMLGGRQDEQKSQSKSQPKPKKTDPLSAAAEQDGFDNDI 144
>gi|168183475|ref|ZP_02618139.1| single-strand binding domain protein [Clostridium botulinum Bf] >gi|182673357|gb|EDT85318.1| single-strand binding domain protein [Clostridium botulinum Bf] (232 aa)
Score = 86, Expect = 2.8e-01, Identities = 31/106 (29%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   + L    +  +N S  YI   +WG+ A F  TL+ GD++ V GRL +     R  +  +    A +V   K+ R  +E +
  S:   107 NEIFLDGYICKEP---IYRTTPFGREIADLLLAVNRPYNKS-DYIPNISWGRNARFCKTLQVGDNIRVWGRLQSRYYQKRISEDKTITKVAYEVSISKMERVGDEQA 209
>gi|148827387|ref|YP_001292140.1| single-strand DNA-binding protein [Haemophilus influenzae PittGG] >gi|148718629|gb|ABQ99756.1| single-strand DNA-binding protein [Haemophilus influenzae PittGG] (168 aa)
Score = 86, Expect = 2.8e-01, Identities = 29/97 (29%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|119773656|ref|YP_926396.1| single-strand binding protein [Shewanella amazonensis SB2B] >gi|119766156|gb|ABL98726.1| single-strand binding protein [Shewanella amazonensis SB2B] (234 aa)
Score = 86, Expect = 2.8e-01, Identities = 27/98 (27%), Positives = 49/98 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S   N  +      + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y  +++ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDNQGQQQERTEWHRVVMFGKLAEIAGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYTTEIVVDQ 105
>gi|47092406|ref|ZP_00230196.1| single-strand binding protein subfamily [Listeria monocytogenes str. 4b H7858] >gi|47019183|gb|EAL09926.1| single-strand binding protein subfamily [Listeria monocytogenes str. 4b H7858] (159 aa)
Score = 86, Expect = 2.8e-01, Identities = 33/109 (30%), Positives = 51/109 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLE 109
           MNRV L G+L+ DP    T      A+F+LA      + +G  ++  +I    W K A      LK G    V+GR+ T       +D + K  +  +V+A+ V   +  N  E
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQNGEREA-DFINCVVWRKPAENAANFLKKGSMAGVDGRIQTRNY----EDNDGKRVFVTEVVAESVQFLEPRNHAE 110
>gi|168187294|ref|ZP_02621929.1| single-stranded DNA-binding protein [Clostridium botulinum C str. Eklund] >gi|169294799|gb|EDS76932.1| single-stranded DNA-binding protein [Clostridium botulinum C str. Eklund] (148 aa)
Score = 86, Expect = 2.9e-01, Identities = 40/156 (25%), Positives = 72/156 (46%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNND 156
           MNRV L G+L+ DP  +         A+F+LA      S G  D+  ++ I  WGK A      +  G  V V G + T     +    +    Y  +++AD+V   D  N++ +   ++T ++       ++  +N+  Q++       D++I PI + D
  S:     1 MNRVVLVGRLTKDPELRFTPGAGKAVATFTLAVNRRFKSQGQPDA-DFLPIVVWGKQAENTANYVGKGSQVGVSGAIHTRSYEAK----DGTRRYVTEIVADEVQFLDSRNAVSRTEPRSTGMNE----FDSSNNDNDFNQSY-------DEEITPIDDGD 145
>gi|170757162|ref|YP_001782791.1| single-strand nucleic acid-binding domain-containing protein [Clostridium botulinum B1 str. Okra] >gi|169122374|gb|ACA46210.1| single-strand binding domain protein [Clostridium botulinum B1 str. Okra] (233 aa)
Score = 86, Expect = 2.9e-01, Identities = 31/106 (29%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   + L    +  +N S  YI   +WG+ A F  TL+ GD++ V GRL +     R  +  +    A +V   K+ R  +E +
  S:   108 NEIFLDGYICKEP---IYRTTPFGREIADLLLAVNRPYNKS-DYIPNISWGRNARFCKTLQVGDNIRVWGRLQSRYYQKRISEDKTITKVAYEVSISKMERVGDEQA 210
>gi|75758396|ref|ZP_00738519.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494122|gb|EAO57215.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (178 aa)
Score = 86, Expect = 3.0e-01, Identities = 22/77 (28%), Positives = 38/77 (49%)
  Q:     3 RVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNN 79
           +  + G+L+ DP       N +   F++A  D  G   +  +  ++AWGK+ + V    K G  V VEG++ + K  N
  S:     4 KQLIVGRLTRDPESTPYGENTV-CRFAVAVDDGYGDKKTTDFFNVSAWGKLGANVQQYTKKGSVVLVEGKMKSSKKEN 80
>gi|114150006|gb|ABI51621.1| single-stranded DNA-binding protein [Deinococcus grandis] (296 aa)
Score = 86, Expect = 3.0e-01, Identities = 24/72 (33%), Positives = 37/72 (51%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLTLKPGDSVFVEGRL 72
           MN V L G ++ DP    T   +      LA  ++  +ND +        +I +T W  +A  +  L+ GD V V+GRL
  S:   129 MNEVILIGNVTRDPELRYTPAGDAVLGLGLAVNET--WNDRQGQRQEKTHWIDVTLWRDLAERMKDLRKGDPVLVQGRL 205
>gi|15896954|ref|NP_350303.1| single strand DNA binding protein, SSB [Clostridium acetobutylicum ATCC 824] >gi|37999760|sp|Q97CX3|SSB3_CLOAB Single-stranded DNA-binding protein 3 (SSB 3) (Helix-destabilizing protein 3) >gi|15026829|gb|AAK81643.1|AE007867_10 Single strand DNA binding protein, SSB [Clostridium acetobutylicum ATCC 824] (144 aa)
Score = 86, Expect = 3.0e-01, Identities = 32/99 (32%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPN-KLQTRTNNIGASFSLAC---IDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MN+V L G+L+ DP  K    T    ASF+LA        G  ++  +I I  WGK A S    +  G  + V GR+ T       D  +    Y  +++A++V
  S:     1 MNKVVLIGRLTKDPELKFTPGTGTAVASFTLAVDRRFKKEGQQEA-DFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSY----DAKDGTRRYVTEIVAEEV 99
>gi|74316456|ref|YP_314196.1| single-strand binding protein [Thiobacillus denitrificans ATCC 25259] >gi|74055951|gb|AAZ96391.1| Single-strand binding protein [Thiobacillus denitrificans ATCC 25259] (157 aa)
Score = 86, Expect = 3.0e-01, Identities = 30/99 (30%), Positives = 46/99 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFND-SKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V L G L  DP      +    A+ ++A  D   + D S   +  T W +V+ F  T       LK G  V+VEG + T K      D      YA ++  D++
  S:     4 VNKVILVGNLGRDPEMRYLPSGEAVANLAIATTDK--YKDKSGQMVEQTEWHRVSFFGRTAEVCGQYLKKGSQVYVEGSIRTRKYT----DKEGVEKYATEIRGDRM 104
>gi|187776922|ref|ZP_02993395.1| hypothetical protein CLOSPO_00461 [Clostridium sporogenes ATCC 15579] >gi|187775581|gb|EDU39383.1| hypothetical protein CLOSPO_00461 [Clostridium sporogenes ATCC 15579] (248 aa)
Score = 86, Expect = 3.1e-01, Identities = 31/106 (29%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   + L    +  +N S  YI   +WG+ A F  TL+ GD++ V GRL +     R  +  +    A +V   K+ R  +E +
  S:   119 NEIFLDGYICKEP---VYRTTPFGREIADLLLAVNRPYNKS-DYIPNISWGRNARFCKTLQVGDNIRVWGRLQSRYYQKRISEDKTITKVAYEVSISKMERVGDEQA 221
>gi|153938778|ref|YP_001392433.1| single-strand DNA-binding protein [Clostridium botulinum F str. Langeland] >gi|182701656|ref|ZP_02613858.2| single-strand binding domain protein [Clostridium botulinum NCTC 2916] >gi|152934674|gb|ABS40172.1| single-strand binding domain protein [Clostridium botulinum F str. Langeland] >gi|182670170|gb|EDT82146.1| single-strand binding domain protein [Clostridium botulinum NCTC 2916] (233 aa)
Score = 86, Expect = 3.1e-01, Identities = 31/106 (29%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   + L    +  +N S  YI   +WG+ A F  TL+ GD++ V GRL +     R  +  +    A +V   K+ R  +E +
  S:   108 NEIFLDGYICKEP---IYRTTPFGREIADLLLAVNRPYNKS-DYIPNISWGRNARFCKTLQVGDNIRVWGRLQSRYYQKRISEDKTITKVAYEVSISKMERVGDEQA 210
>gi|153176213|ref|ZP_01931472.1| single-strand binding protein [Listeria monocytogenes FSL N3-165] >gi|133728926|gb|EBA30624.1| single-strand binding protein [Listeria monocytogenes FSL N3-165] (178 aa)
Score = 86, Expect = 3.1e-01, Identities = 33/99 (33%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP    T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|16799117|ref|NP_469385.1| hypothetical protein lin0038 [Listeria innocua Clip11262] >gi|37999747|sp|Q92FR5|SSB1_LISIN Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|16412459|emb|CAC95271.1| ssb [Listeria innocua] (179 aa)
Score = 86, Expect = 3.1e-01, Identities = 33/99 (33%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP    T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|16802093|ref|NP_463578.1| hypothetical protein lmo0045 [Listeria monocytogenes EGD-e] >gi|46906276|ref|YP_012665.1| single-strand binding protein [Listeria monocytogenes str. 4b F2365] >gi|47092170|ref|ZP_00229962.1| single-strand binding protein [Listeria monocytogenes str. 4b H7858] >gi|47095113|ref|ZP_00232725.1| single-strand binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|153164870|ref|ZP_01926045.1| single-strand binding protein [Listeria monocytogenes FSL N1-017] >gi|153181077|ref|ZP_01934044.1| single-strand binding protein [Listeria monocytogenes F6900] >gi|153184404|ref|ZP_01935163.1| single-strand binding protein [Listeria monocytogenes J0161] >gi|153192688|ref|ZP_01939648.1| single-strand binding protein [Listeria monocytogenes J2818] >gi|153198011|ref|ZP_01942181.1| single-strand binding protein [Listeria monocytogenes 10403S] >gi|153200433|ref|ZP_01942595.1| single-strand binding protein [Listeria monocytogenes HPB2262] >gi|167015970|ref|ZP_02278503.1| single-strand binding protein [Listeria monocytogenes FSL J1-194] >gi|167211120|ref|ZP_02281427.1| single-strand binding protein [Listeria monocytogenes LO28] >gi|167215496|ref|ZP_02285803.1| single-strand binding protein [Listeria monocytogenes FSL R2-503] >gi|167216356|ref|ZP_02285992.1| single-strand binding protein [Listeria monocytogenes FSL J1-175] >gi|167342421|ref|ZP_02288351.1| single-strand binding protein [Listeria monocytogenes FSL J1-208] >gi|167403225|ref|ZP_02308060.1| single-strand binding protein [Listeria monocytogenes FSL J2-003] >gi|167452781|ref|ZP_02319004.1| single-strand binding protein [Listeria monocytogenes FSL J2-064] >gi|168267080|ref|ZP_02689045.1| single-strand binding protein [Listeria monocytogenes FSL J2-071] >gi|37999735|sp|Q8YAR8|SSB1_LISMO Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|16409404|emb|CAC98260.1| ssb [Listeria monocytogenes] >gi|46879540|gb|AAT02842.1| single-strand binding protein [Listeria monocytogenes str. 4b F2365] >gi|47016458|gb|EAL07379.1| single-strand binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|47019372|gb|EAL10113.1| single-strand binding protein [Listeria monocytogenes str. 4b H7858] >gi|126942907|gb|EBA20641.1| single-strand binding protein [Listeria monocytogenes J0161] >gi|127632347|gb|EBA22029.1| single-strand binding protein [Listeria monocytogenes 10403S] >gi|127763725|gb|EBA24559.1| single-strand binding protein [Listeria monocytogenes J2818] >gi|133728570|gb|EBA30268.1| single-strand binding protein [Listeria monocytogenes FSL N1-017] >gi|133731595|gb|EBA33293.1| single-strand binding protein [Listeria monocytogenes F6900] >gi|133736711|gb|EBA38409.1| single-strand binding protein [Listeria monocytogenes HPB2262] (178 aa)
Score = 86, Expect = 3.1e-01, Identities = 33/99 (33%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNRV L G+L+ DP    T      A+F+LA   +  F + +      +I    W K A  V   LK G    V+GR+ T   N   +D   K  Y  +++A+ V
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAV--NRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQT--RNYEGND--GKRVYVTEIVAESV 100
>gi|148381105|ref|YP_001255646.1| single-strand binding domain protein [Clostridium botulinum A str. ATCC 3502] >gi|153933644|ref|YP_001385479.1| single-strand DNA-binding protein [Clostridium botulinum A str. ATCC 19397] >gi|153935192|ref|YP_001388885.1| single-strand DNA-binding protein [Clostridium botulinum A str. Hall] >gi|148290589|emb|CAL84718.1| single-stranded DNA binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152929688|gb|ABS35188.1| single-strand binding domain protein [Clostridium botulinum A str. ATCC 19397] >gi|152931106|gb|ABS36605.1| single-strand binding domain protein [Clostridium botulinum A str. Hall] (233 aa)
Score = 86, Expect = 3.2e-01, Identities = 31/106 (29%), Positives = 49/106 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFS-LACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   + L    +  +N S  YI   +WG+ A F  TL+ GD++ V GRL +     R  +  +    A +V   K+ R  +E +
  S:   108 NEIFLDGYICKEP---IYRTTPFGREIADLLLAVNRPYNKS-DYIPNISWGRNARFCKTLQVGDNIRVWGRLQSRYYQKRISEDKTITKVAYEVSISKMERVGDEQA 210
>gi|33152365|ref|NP_873718.1| single-strand DNA-binding protein [Haemophilus ducreyi 35000HP] >gi|37999362|sp|P59930|SSB_HAEDU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|33148588|gb|AAP96107.1| single stranded DNA binding protein [Haemophilus ducreyi 35000HP] (176 aa)
Score = 86, Expect = 3.2e-01, Identities = 26/97 (26%), Positives = 43/97 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP           A+ S+A  +S    ++     +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 INKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGQYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|169794714|ref|YP_001712507.1| putative single-strand binding protein (helix-destabilizing protein) [Acinetobacter baumannii AYE] >gi|169147641|emb|CAM85504.1| putative Single-strand binding protein (Helix-destabilizing protein) [Acinetobacter baumannii] (117 aa)
Score = 85, Expect = 3.3e-01, Identities = 30/96 (31%), Positives = 47/96 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS--YIRITAWGKVASF-------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  +P   Q +     A FS+A   S  + D ++  +I  T W ++ +           LK G  V++EG L T K      D N++  Y  +V A
  S:     4 INKVILVGMLGANPIPKQFQNGGSYAQFSIAT--SEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEGSLHTRKWT----DQNNQERYVTEVRA 102
>gi|145631076|ref|ZP_01786851.1| dihydrodipicolinate synthase [Haemophilus influenzae 22.4-21] >gi|144983361|gb|EDJ90843.1| dihydrodipicolinate synthase [Haemophilus influenzae R3021] (167 aa)
Score = 85, Expect = 3.4e-01, Identities = 29/97 (29%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP        +  A+ S+A  +S  +ND  +  R  +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 VNKVIIVGHLGNDPEIRTMPNGDAVANISVATSES--WNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|169825431|ref|YP_001695606.1| single-stranded DNA-binding protein (SSB) (helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] >gi|168994708|gb|ACA42247.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] (199 aa)
Score = 85, Expect = 3.5e-01, Identities = 31/99 (31%), Positives = 54/99 (54%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGAS-FSLACIDSSGFNDSKS-----YIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP +L+   N I ++ F++A   +  F++ +      +I   AW K A +    ++ G+ + VEGR+ T     +    + K  Y   V+AD V
  S:     2 INRVVLVGRLTKDP-ELRYTPNGIASTRFTIAVNRT--FSNQQGEREADFISCVAWRKQAENLANYMRKGNLIGVEGRIQTGSYEGQ----DGKRVYTTDVVADSV 100
>gi|168335182|ref|ZP_02693287.1| single-strand binding protein [Epulopiscium sp. 'N.t. morphotype B'] (162 aa)
Score = 85, Expect = 3.5e-01, Identities = 44/164 (26%), Positives = 73/164 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR----------ITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEESD 164
           MN+V L G L+ DP   + R +      ++A     G    ++Y R          I A+GK A F     K G  V + GR+     NN  +D N    Y+ ++I D     + ++S +    + T   + +   ++N  EN+     P   D++     P L     +EEE+D
  S:     1 MNKVILMGNLTKDP---EVRYSQSATPLAIA---RYGIAVKRTYTREGEPDTDFFNIVAFGKTAEFAEKFFKKGLKVCIAGRIQ----NNNWEDQNKVKHYSTEIIVDDQEFAESKSSFQA---RVTNRGTSYNDGQSNYGENKAYNPTPPLNDNDMGGFTPKL---PPMEEEND 159
>gi|108885499|gb|ABG23243.1| single-stranded DNA-binding protein [Deinococcus murrayi] (276 aa)
Score = 85, Expect = 3.5e-01, Identities = 29/96 (30%), Positives = 46/96 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTN----NIGASFSLACIDSSGFNDSKS-YIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDP-NSKATYALQVIA 96
           MN V L G ++ DP    T        +G + + +  D  G    K+ +I +T W  +A  +  L+ GD + V+GRL      +R  +  NS    A +V A
  S:   129 MNEVVLIGNVTRDPELRYTPAGDAVLGLGLAVNESWQDRQGQRQEKTHWIDVTLWRDLAESMKDLRKGDPILVQGRLVNEAWTDREGNKRNSTKVEATRVEA 230
>gi|163793153|ref|ZP_02187129.1| single-strand DNA binding protein [alpha proteobacterium BAL199] >gi|159181799|gb|EDP66311.1| single-strand DNA binding protein [alpha proteobacterium BAL199] (206 aa)
Score = 85, Expect = 3.6e-01, Identities = 32/98 (32%), Positives = 46/98 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASF--------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP    T+      +F+LA   S  + D  S  R   T W +V  F           L+ G SV+VEG L T K      D + +  Y  +V+  +
  S:    28 VNKVILVGNLGRDPEVRTTQDGTKIVNFTLAT--SENWRDKSSGERRERTEWHRVVIFNENLARIAEQYLRKGSSVYVEGALQTRKWT----DKDGQERYTTEVVLQR 129
>gi|49484225|ref|YP_041449.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|118725075|ref|YP_908811.1| putative single-strand DNA-binding protein [Staphylococcus aureus phage phiNM3] >gi|151222121|ref|YP_001332943.1| phage single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|81827983|sp|Q6GF73|SSB_STAAR Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|49242354|emb|CAG41066.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|104641840|gb|ABF73182.1| putative single-strand DNA-binding protein [Staphylococcus aureus phage phiNM3] >gi|150374921|dbj|BAF68181.1| phage single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus str. Newman] (156 aa)
Score = 85, Expect = 3.7e-01, Identities = 33/107 (30%), Positives = 53/107 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +NR  L G+L+ DP    T++    ASF+LA   +  F +++      +I I  + K A  V   L  G    V+GRL T    N+      +  Y  +V+AD +   + +NS
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAV--NRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKE----GQRVYVTEVVADSIQFLEPKNS 108
>gi|167622573|ref|YP_001672867.1| single-strand binding protein [Shewanella halifaxensis HAW-EB4] >gi|167352595|gb|ABZ75208.1| single-strand binding protein [Shewanella halifaxensis HAW-EB4] (223 aa)
Score = 85, Expect = 3.7e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S     G    ++ + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVMFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVVDQ 105
>gi|163868582|ref|YP_001609791.1| single-strand DNA binding protein [Bartonella tribocorum CIP 105476] >gi|161018238|emb|CAK01796.1| single-strand DNA binding protein [Bartonella tribocorum CIP 105476] (168 aa)
Score = 85, Expect = 3.8e-01, Identities = 37/145 (25%), Positives = 66/145 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF--------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEE-------NSLEQPVDKATVIDSPFLAAKTN------ATENELAQAFPISLDDE 145
           +N+V L G L  DP   +  + +  A+  +A  +S    ++      T W  +  F           LK G  +++EG+L T K      D N    Y  +++  K YR + +        S EQ V +       F  + +N         +++ ++F   LDD+
  S:     5 LNKVILIGNLGSDPEIRRLNSGDQVANLRIATSESWRDRNTNERKERTEWHNIVIFNENLVKVVEQYLKKGSKIYIEGQLQTRKW----QDQNGNDRYTTEIVLQK-YRGELQMLDGRGGASGEQGVGQGGSYSGGFADSSSNQRNTFGQNNSQVGESFSHKLDDD 165
>gi|20809109|ref|NP_624280.1| single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] >gi|37999446|sp|Q8R6M2|SSB_THETN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|20517787|gb|AAM25884.1| Single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] (150 aa)
Score = 85, Expect = 3.9e-01, Identities = 37/114 (32%), Positives = 54/114 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVL-TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY------------RPDEENSLEQPVDK 114
           +N+V L G+L+ DP    T       +F+LA     +  SG      +I I  W K+A      LK G  V V G + T       DD +    +  +V+AD V              P+EE  L++  DK
  S:     2 LNKVILIGRLTKDPVMRYTSDMVPVTTFTLAVNRNYVSQSG-ERPTDFIPIVTWRKLAEICANNLKKGRLVAVTGSIQTRTW----DDSSGNRHWVTEVVADDVRFLEPKSGFGSGSAPEEEKELDEDFDK 127
>gi|9635210|ref|NP_058484.1| ssDNA binding protein [Staphylococcus phage PVL] >gi|156603906|ref|YP_001429853.1| ss-DNA-binding protein [Staphylococcus phage tp310-1] >gi|3341953|dbj|BAA31919.1| ssDNA binding protein [Staphylococcus phage PVL] >gi|154817992|gb|ABS87420.1| ss-DNA-binding protein [Staphylococcus phage tp310-1] (156 aa)
Score = 85, Expect = 3.9e-01, Identities = 33/107 (30%), Positives = 53/107 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           +NR  L G+L+ DP    T++    ASF+LA   +  F +++      +I +  + K A  V   L  G    V+GRL T    N+      +  Y  +VIAD +   + +NS
  S:     2 INRTILVGRLTRDPELRTTQSGVNVASFTLAV--NRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTRNYENKE----GQRVYVTEVIADSIQFLEPKNS 108
>gi|182679033|ref|YP_001833179.1| single-strand binding protein [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634916|gb|ACB95690.1| single-strand binding protein [Beijerinckia indica subsp. indica ATCC 9039] (180 aa)
Score = 85, Expect = 4.0e-01, Identities = 31/93 (33%), Positives = 43/93 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIR--ITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQ 93
           +N+V L G L  DP   +  +     SFSLA  +S  + D  S  R   T W  V  F   L        K G  V++EG+L T +  +R  +        LQ
  S:     5 VNKVILIGNLGRDPEVRRMNSGEAVVSFSLATTES--WRDKMSGERRDRTEWHNVVIFNENLGKIAEQYCKKGSKVYLEGQLQTREYQDRDGNQRRTTEVVLQ 105
>gi|21283650|ref|NP_646738.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MW2] >gi|49486796|ref|YP_044017.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|37999443|sp|Q8NVN2|SSB_STAAW Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|81827821|sp|Q6G7V6|SSB1_STAAS Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|21205091|dbj|BAB95786.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MW2] >gi|49245239|emb|CAG43711.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MSSA476] (156 aa)
Score = 85, Expect = 4.0e-01, Identities = 31/99 (31%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NR  L G+L+ DP    T++    ASF+LA   +  F +++      +I I  + K A  V   L  G    V+GRL T    N+      +  Y  +V+AD +
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAV--NRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKE----GQRVYVTEVVADSI 100
>gi|146297012|ref|YP_001180783.1| single-strand DNA-binding protein [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410588|gb|ABP67592.1| single-strand binding protein/Primosomal replication protein n [Caldicellulosiruptor saccharolyticus DSM 8903] (214 aa)
Score = 85, Expect = 4.0e-01, Identities = 22/94 (23%), Positives = 44/94 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLST--YKMNNRSDDPNSKATYALQV 94
           +N +FL G +   P   Q RT  +G   +   +  +       YI   AWG+ A +  T + GD++ + GR+ +  Y+    + +  ++  Y + +
  S:   109 INEIFLNGYVCKKP---QYRTTPLGREITDILLAVNRLYGKSDYIPCIAWGRNARYASTFQIGDNIKIWGRVQSRDYQKRLETGEVETRTAYEVSI 201
>gi|159901474|ref|YP_001547721.1| single-strand binding protein [Herpetosiphon aurantiacus ATCC 23779] >gi|159894513|gb|ABX07593.1| single-strand binding protein [Herpetosiphon aurantiacus ATCC 23779] (166 aa)
Score = 85, Expect = 4.0e-01, Identities = 27/96 (28%), Positives = 45/96 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSG-FNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V + G+L  DP    T       +F++A      D +G   D   +  +  W K+A      L  G  V++EGRL T       DD + +  +  +V+A
  S:     5 LNKVMIIGRLGKDPEMRFTPQGTPVTNFTVAAGRQWKDPNGETRDETEWFSVVVWNKLAEICNQYLTKGSRVYIEGRLQTRSW----DDDSGQKRFRTEVVA 102
>gi|113476722|ref|YP_722783.1| single-strand binding protein/primosomal replication protein n [Trichodesmium erythraeum IMS101] >gi|110167770|gb|ABG52310.1| single-strand binding protein/Primosomal replication protein n [Trichodesmium erythraeum IMS101] (168 aa)
Score = 85, Expect = 4.1e-01, Identities = 26/100 (26%), Positives = 44/100 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY 100
           MN   L  +++ DP    T  + +  +  +    + G N+  + +++ AWG +A  V       D V VEGRLS     N  + P        ++ A K+Y
  S:     1 MNSCILMVQITKDPELRYTADSQLPVAEMIVEFPNLGVNNKPALLKVVAWGDLAEQVNEKYHQEDYVIVEGRLSI----NTIERPEGFKEKRAELTASKIY 97
>gi|88858653|ref|ZP_01133294.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Pseudoalteromonas tunicata D2] >gi|88818879|gb|EAR28693.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Pseudoalteromonas tunicata D2] (238 aa)
Score = 85, Expect = 4.1e-01, Identities = 28/97 (28%), Positives = 47/97 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS------SGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP        +  A+ SLA  +S          D   + R+  +GK+A  V   ++ G  ++VEG+L T K      D + +  Y  +++ D
  S:     5 VNKVILVGNLGQDPEVRYMPNGSAVANVSLATAESYKDKNTGQMVDKTEWHRVVFFGKLAEIVGEYVRKGSQIYVEGKLQTRKWT----DKDGQEKYTTEIVVD 104
>gi|32034137|ref|ZP_00134369.1| COG0629: Single-stranded DNA-binding protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208261|ref|YP_001053486.1| single-strand DNA-binding protein [Actinobacillus pleuropneumoniae L20] >gi|165976201|ref|YP_001651794.1| single-strand DNA-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150114|ref|YP_001968639.1| single-stranded DNA-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126097053|gb|ABN73881.1| single-stranded DNA-binding protein [Actinobacillus pleuropneumoniae L20] >gi|165876302|gb|ABY69350.1| single stranded DNA binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915245|gb|ACE61497.1| single-stranded DNA-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (174 aa)
Score = 84, Expect = 4.2e-01, Identities = 26/97 (26%), Positives = 43/97 (44%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V + G L  DP           A+ S+A  +S    ++     +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D
  S:     4 INKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGQYLRKGSQVYVEGRLKTRKW----QDQNGQDRYTTEIQGD 103
>gi|163760270|ref|ZP_02167353.1| single-strand DNA-binding protein [Hoeflea phototrophica DFL-43] >gi|162282669|gb|EDQ32957.1| single-strand DNA-binding protein [Hoeflea phototrophica DFL-43] (172 aa)
Score = 84, Expect = 4.4e-01, Identities = 29/93 (31%), Positives = 43/93 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF--------VLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQ 93
           +N+V L G L  DP+  +T+     A+ S+A  +S    +S      T W +V  F           LK G  V++EG L T K  ++S          LQ
  S:     5 VNKVILIGNLGADPDIKRTQDGRPIANLSIATSESWRDKNSGERREKTEWHRVVIFNEGLCKIAESYLKKGSKVYIEGALQTRKWTDQSGQDKYSTEVVLQ 105
>gi|52082635|ref|YP_081426.1| single-strand DNA-binding protein [Bacillus licheniformis ATCC 14580] >gi|52788034|ref|YP_093863.1| hypothetical protein BLi04362 [Bacillus licheniformis ATCC 14580] >gi|52005846|gb|AAU25788.1| single-strand DNA-binding protein [Bacillus licheniformis ATCC 14580] >gi|52350536|gb|AAU43170.1| Ssb [Bacillus licheniformis DSM 13] (170 aa)
Score = 84, Expect = 4.5e-01, Identities = 31/99 (31%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T +    A+F+LA   +  F + +      +I    W + A  V   LK G    V+GRL T    N+      +  Y  +V A+ V
  S:     2 LNRVVLVGRLTKDPELRYTPSGAAVATFTLAV--NRTFTNQQGEREADFINCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYENQQ----GQRVYVTEVQAESV 100
>gi|52424640|ref|YP_087777.1| single-strand DNA-binding protein [Mannheimia succiniciproducens MBEL55E] >gi|52306692|gb|AAU37192.1| Ssb protein [Mannheimia succiniciproducens MBEL55E] (161 aa)
Score = 84, Expect = 4.6e-01, Identities = 39/149 (26%), Positives = 62/149 (41%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATY-------ALQVIADKVYRPDEENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDI 149
           +N+V + G L  DP           A+ S+A  +S    ++     +T W ++  +          L+ G  V+VEGRL T K      D N +  Y        LQ++  +    D   +  QP         P  +A         A A   ++D+ DDDI
  S:     4 INKVIIVGHLGNDPEIRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGEYLRKGSQVYVEGRLRTRKWQ----DQNGQDRYTTEIQGDVLQMLGGRGQTADAGFAAPQPNQS---FSRPQASAARQQPATRPAPAAEPAMDNFDDDI 159
>gi|42518092|ref|NP_964022.1| single-strand binding protein [Lactobacillus johnsonii NCC 533] >gi|41582376|gb|AAS07988.1| single-strand binding protein [Lactobacillus johnsonii NCC 533] (172 aa)
Score = 84, Expect = 4.7e-01, Identities = 35/106 (33%), Positives = 50/106 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV----YRPDEEN 106
           +N V L G+L+ DP+   T +    A+F+LA      +S G      +I    W K A +F      G  V ++GR+ T       DD + K  Y  +VI D       R D EN
  S:     2 INNVVLVGRLTRDPDLRTTGSGISVATFTLAVDRQYTNSQG-ERGADFISCVIWRKAAENFANFTSKGSLVGIQGRIQTRTY----DDKDGKRVYVTEVIVDNFSLLESRRDREN 111
>gi|149177251|ref|ZP_01855857.1| single-strand binding protein [Planctomyces maris DSM 8797] >gi|148843965|gb|EDL58322.1| single-strand binding protein [Planctomyces maris DSM 8797] (163 aa)
Score = 84, Expect = 4.8e-01, Identities = 28/98 (28%), Positives = 50/98 (51%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFN-------DSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           N+V L G L+ DP    T   +  A   LA ++ S F+       +  +++ +T WG+ A      L  G SV +EGRL   +++   D  + +    L+V+ + +
  S:     5 NKVILVGNLTRDPQVRYTPGGSAVAEIGLA-VNRSWFDKNSNSRKEETTFVDVTLWGRTAEVASEYLTKGRSVLIEGRL---QLDQWDDKESGQKRSKLKVVGENM 106
>gi|37999428|sp|Q8D254|SSB_WIGBR Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) (163 aa)
Score = 84, Expect = 5.0e-01, Identities = 29/96 (30%), Positives = 47/96 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP        N   + SLA  +     ++G +  K+ + R+  +GK+A      LK G  V++EG L T K      D N +  Y  +++ 
  S:     6 INKVILIGNLGQDPEVRYIPNGNAITNLSLATSENWRDKNTGESKEKTEWHRVILFGKLAEVAGEYLKKGSQVYIEGNLQTRKW----QDQNGQDRYITEIVV 104
>gi|32491249|ref|NP_871503.1| hypothetical protein WGLp500 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166456|dbj|BAC24646.1| ssb [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (167 aa)
Score = 84, Expect = 5.1e-01, Identities = 29/96 (30%), Positives = 47/96 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID-----SSGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP        N   + SLA  +     ++G +  K+ + R+  +GK+A      LK G  V++EG L T K      D N +  Y  +++ 
  S:    10 INKVILIGNLGQDPEVRYIPNGNAITNLSLATSENWRDKNTGESKEKTEWHRVILFGKLAEVAGEYLKKGSQVYIEGNLQTRKW----QDQNGQDRYITEIVV 108
>gi|126651976|ref|ZP_01724168.1| single-strand DNA-binding protein [Bacillus sp. B14905] >gi|169830184|ref|YP_001700342.1| single-stranded DNA-binding protein (SSB) (helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] >gi|126591245|gb|EAZ85354.1| single-strand DNA-binding protein [Bacillus sp. B14905] >gi|168994672|gb|ACA42212.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] (189 aa)
Score = 84, Expect = 5.1e-01, Identities = 31/99 (31%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP +L+   N I AS       +  F++ +      +I   AW K A  +   ++ G  + VEGR+ T     +    + K  Y   V+AD V
  S:     2 INRVVLVGRLTKDP-ELRYTPNGI-ASTRFTVAVNRAFSNQQGEREADFINCVAWRKQAENLANFMRKGSLIGVEGRIQTGSYEGQ----DGKRVYTTDVVADSV 100
>gi|167939397|ref|ZP_02526472.1| single-strand DNA-binding protein [Bacillus cereus AH1134] (169 aa)
Score = 84, Expect = 5.4e-01, Identities = 37/112 (33%), Positives = 57/112 (50%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-----YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVY--------RPDEEN-SLEQPV 112
           +NRV L G+L+ DP+   T      A+F+LA   +  F + +      +I    W K A  V   L+ G    V+GRL T       +  + K  Y  +V+A+ V         R ++ N S +QPV
  S:     3 LNRVILVGRLTKDPDLRYTPNGVAVATFTLAV--NRAFANQQGEREADFINCVIWRKQAENVANYLRKGSLAGVDGRLQTRNY----EGQDGKRVYVTEVLAESVQFLEPRNSGRGEQRNTSNQQPV 123
>gi|28211893|ref|NP_782837.1| single-strand DNA-binding protein [Clostridium tetani E88] >gi|28204336|gb|AAO36774.1| single-strand DNA binding protein [Clostridium tetani E88] (214 aa)
Score = 83, Expect = 5.6e-01, Identities = 26/93 (27%), Positives = 43/93 (46%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNR--SDDPNSKATYALQV 94
           N++FL G +  +P     RT   G   +   +  +   +   YI   AWG+ + F   LK GD++ V GRL + +   R   D+   K  Y + +
  S:   107 NQIFLNGFICKEP---IYRTTPFGREIADVLLAVNRAYNKSDYIPTIAWGRNSRFCKGLKVGDNIRVWGRLQSREYQKRISEDEVIKKIAYEVSI 198
>gi|24375515|ref|NP_719558.1| single-strand binding protein [Shewanella oneidensis MR-1] >gi|37999432|sp|Q8EA81|SSB_SHEON Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|24350384|gb|AAN57002.1|AE015834_5 single-strand binding protein [Shewanella oneidensis MR-1] (238 aa)
Score = 83, Expect = 5.7e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S  + D +        + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSES--WKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|117922026|ref|YP_871218.1| single-strand binding protein [Shewanella sp. ANA-3] >gi|117614358|gb|ABK49812.1| single-strand binding protein [Shewanella sp. ANA-3] (235 aa)
Score = 83, Expect = 5.8e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S     G    ++ + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|58336362|ref|YP_192947.1| single-stranded DNA-binding protein [Lactobacillus acidophilus NCFM] >gi|58253679|gb|AAV41916.1| single-stranded DNA-binding protein [Lactobacillus acidophilus NCFM] (172 aa)
Score = 83, Expect = 5.9e-01, Identities = 32/97 (32%), Positives = 54/97 (55%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLACIDSSGFNDSKS-----YIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +NRV L G+L+ DP +L+T  + I  A+F+LA +D   F +S+      +I    W K A +F      G  V ++GR+ T   +N+    + +  Y  +V+ D
  S:     2 INRVVLVGRLTRDP-ELRTTGSGISVATFTLA-VDRQ-FTNSQGERGADFISCVIWRKAAENFCNFTSKGSLVGIDGRIQTRSYDNK----DGQRVYVTEVVVD 98
>gi|153870489|ref|ZP_01999881.1| Single-strand binding protein/Primosomal replication protein n [Beggiatoa sp. PS] >gi|152073041|gb|EDN70115.1| Single-strand binding protein/Primosomal replication protein n [Beggiatoa sp. PS] (225 aa)
Score = 83, Expect = 6.1e-01, Identities = 28/106 (26%), Positives = 50/106 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC------IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEEN 106
           +N+V L G L  DP    T++    A+  LA         +  + D   + R+  + ++A  V   L+ G  ++VEGR+   K N   D    +  Y  +++A ++   D  N
  S:     5 VNKVILVGHLGIDPEIRTTQSGMTIATVKLATNFSTKDKQTGEWRDETEWHRVVFFERLAEIVKQYLRKGSQIYVEGRI---KTNKWQDQNTGQDRYMTEIVAREMQMLDSRN 114
>gi|114046043|ref|YP_736593.1| single-strand binding protein [Shewanella sp. MR-7] >gi|113887485|gb|ABI41536.1| single-strand binding protein [Shewanella sp. MR-7] (236 aa)
Score = 83, Expect = 6.2e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S     G    ++ + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|75675758|ref|YP_318179.1| single-strand DNA-binding protein [Nitrobacter winogradskyi Nb-255] >gi|74420628|gb|ABA04827.1| Single-strand DNA-binding protein [Nitrobacter winogradskyi Nb-255] (163 aa)
Score = 83, Expect = 6.3e-01, Identities = 31/95 (32%), Positives = 45/95 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASF------VLT--LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP   +T+     A+  +A  +S     S      T W +V  F      V+   LK G  V+VEG+L T K      D N    Y+ +V+
  S:     5 VNKVILIGNLGADPEIKRTQDGRPIANLRIATSESWRDRTSGERKERTEWHRVVIFNEGLCKVVEQYLKKGSKVYVEGQLQTRKWT----DQNGVEKYSTEVV 103
>gi|154688194|ref|YP_001423355.1| hypothetical protein RBAM_037990 [Bacillus amyloliquefaciens FZB42] >gi|154354045|gb|ABS76124.1| Ssb [Bacillus amyloliquefaciens FZB42] (172 aa)
Score = 83, Expect = 6.3e-01, Identities = 31/99 (31%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T +    A+F+LA      + SG  ++  +I    W + A  V   LK G    V+GRL T    N+      +  +  +V A+ V
  S:     2 LNRVVLVGRLTKDPELRYTPSGAAVATFTLAVNRTFTNQSGEREA-DFINCVTWRRQAENVANFLKKGSLAGVDGRLQTRNYENQQ----GQRVFVTEVQAESV 100
>gi|157694461|ref|YP_001488923.1| single-strand DNA-binding protein [Bacillus pumilus SAFR-032] >gi|194016522|ref|ZP_03055136.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Bacillus pumilus ATCC 7061] >gi|157683219|gb|ABV64363.1| single-strand DNA-binding protein [Bacillus pumilus SAFR-032] >gi|194011995|gb|EDW21563.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Bacillus pumilus ATCC 7061] (181 aa)
Score = 83, Expect = 6.5e-01, Identities = 31/99 (31%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T      A+F+LA      + SG  ++  +I    W + A  V   LK G    V+GRL T    N+      +  +  +V A+ V
  S:     2 LNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREA-DFINCVTWRRQAENVANFLKKGSLAGVDGRLQTRNYENQQ----GQRVFVTEVQAESV 100
>gi|113971749|ref|YP_735542.1| single-strand binding protein [Shewanella sp. MR-4] >gi|113886433|gb|ABI40485.1| single-strand binding protein [Shewanella sp. MR-4] (236 aa)
Score = 83, Expect = 6.5e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S     G    ++ + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|84704589|ref|ZP_01018089.1| single-strand binding protein [Parvularcula bermudensis HTCC2503] >gi|84689425|gb|EAQ15267.1| single-strand binding protein [Parvularcula bermudensis HTCC2503] (154 aa)
Score = 83, Expect = 6.6e-01, Identities = 34/95 (35%), Positives = 47/95 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRI--TAWGKVASFVL--------TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP   Q   NN G   +L    S  + D  S  R   T W  VA F           LK G  V++EG+L T K  ++  D N +  Y+ +V+
  S:     5 VNKVILIGNLGQDPEVRQF--NNGGQVCNLRIATSENWKDKNSGERREKTEWHSVAIFSEPLVRVAQNYLKKGSKVYIEGQLETRKWQDK--DGNDR--YSTEVV 103
>gi|113461865|ref|YP_719934.1| single-stranded DNA binding protein [Haemophilus somnus 129PT] >gi|112823908|gb|ABI25997.1| single-stranded DNA binding protein [Haemophilus somnus 129PT] (149 aa)
Score = 83, Expect = 6.8e-01, Identities = 30/106 (28%), Positives = 49/106 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGAS-FSLACIDSSGFNDSKSYIRITAWGKVASFVLT-------LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEEN 106
           +N+V + G L  DP +++T  N    S  S+A  +S     +     +T W ++  +          L+ G  V+VEGRL T K      D N +  Y  ++  D +   D  N
  S:     4 INKVIIVGNLGADP-EVRTMPNGEAVSNISVATSESWTDKTTGEKRELTEWHRIVFYRRQAEIVGEYLRKGSKVYVEGRLKTRKWQ----DQNGQDRYTTEIQGDVLQMLDSRN 112
>gi|163815608|ref|ZP_02206981.1| hypothetical protein COPEUT_01783 [Coprococcus eutactus ATCC 27759] >gi|158449245|gb|EDP26240.1| hypothetical protein COPEUT_01783 [Coprococcus eutactus ATCC 27759] (150 aa)
Score = 83, Expect = 7.0e-01, Identities = 27/80 (33%), Positives = 43/80 (53%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLA----CIDSSGFN----DSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNR 80
           MN+V L G+L+ DP    +++N+     ++A     +D   FN     +  +I   A+GK A F    LK G  + V GR+ T    N+
  S:     1 MNKVILMGRLTRDPEVRYSQSNSSDGQMAIARYTLAVDRR-FNRNGDQNADFIGCVAFGKSAEFAEKYLKQGTKIAVTGRIQTGSYTNK 88
>gi|56416658|ref|YP_153732.1| single-strand binding protein [Anaplasma marginale str. St. Maries] >gi|56387890|gb|AAV86477.1| single-strand binding protein [Anaplasma marginale str. St. Maries] (179 aa)
Score = 82, Expect = 7.2e-01, Identities = 30/95 (31%), Positives = 43/95 (45%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVI 95
           +N+V L G L  DP+    +     ASFSLA  +S     S +    T W  +  F   L        + G  V++EG L T K +    D N    Y  +V+
  S:    17 VNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWLDKASGARTEKTEWHSIVVFSEGLVRVVKTCARKGSKVYIEGSLRTRKWS----DQNGNDRYTTEVV 115
>gi|94984273|ref|YP_603637.1| single-strand binding protein [Deinococcus geothermalis DSM 11300] >gi|94554554|gb|ABF44468.1| single-strand binding protein [Deinococcus geothermalis DSM 11300] (301 aa)
Score = 82, Expect = 7.4e-01, Identities = 28/96 (29%), Positives = 46/96 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTN----NIGASFSLACIDSSGFNDSKS-YIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNR-SDDPNSKATYALQVIA 96
           +N V L G ++ DP    T        +G + + +  D  G    K+ ++ +T W  +A  +  L+ GD V V+GRL      +R  +  NS    A +V A
  S:   129 LNEVILIGNVTRDPELRYTPAGDAVLGLGLAVNESWQDRQGQRQEKTHWVDVTLWRDLAEAMKDLRKGDPVLVQGRLVNEAWTDRDGNKRNSTKVEATRVEA 230
>gi|83815578|ref|YP_444854.1| single-strand binding protein [Salinibacter ruber DSM 13855] >gi|83756972|gb|ABC45085.1| single-strand binding protein [Salinibacter ruber DSM 13855] (170 aa)
Score = 82, Expect = 7.5e-01, Identities = 27/96 (28%), Positives = 47/96 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSK-----SYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIA 96
           +N+V L G L  DP    T +     + SLA  +S   +D +      +  + AWG++       L+ G  V+ EG++ T    N+ +D +    Y+ +V A
  S:     5 VNKVVLIGNLGDDPELRYTGSGTAVCNMSLATNESYTNSDGEEVQQTEWHDVVAWGRLGEVCNEYLERGSQVYFEGKIET----NQWEDQDGNTRYSTEVKA 102
>gi|146291745|ref|YP_001182169.1| single-strand binding protein [Shewanella putrefaciens CN-32] >gi|145563435|gb|ABP74370.1| single-strand binding protein [Shewanella putrefaciens CN-32] (236 aa)
Score = 82, Expect = 7.5e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDS----SGFNDSKS-YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S     G    ++ + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|126175947|ref|YP_001052096.1| single-strand binding protein [Shewanella baltica OS155] >gi|152999106|ref|YP_001364787.1| single-strand binding protein [Shewanella baltica OS185] >gi|160873703|ref|YP_001553019.1| single-strand binding protein [Shewanella baltica OS195] >gi|125999152|gb|ABN63227.1| single-strand binding protein [Shewanella baltica OS155] >gi|151363724|gb|ABS06724.1| single-strand binding protein [Shewanella baltica OS185] >gi|160859225|gb|ABX47759.1| single-strand binding protein [Shewanella baltica OS195] (234 aa)
Score = 82, Expect = 7.5e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S  + D +        + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSES--WKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|148245121|ref|YP_001219814.1| single-strand DNA-binding protein [Clostridium kluyveri DSM 555] >gi|146337001|gb|ABQ23612.1| single-strand DNA-binding protein [Clostridium kluyveri DSM 555] (103 aa)
Score = 82, Expect = 7.5e-01, Identities = 33/99 (33%), Positives = 48/99 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGA-SFSLACIDSSGFNDSKS---YIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MNR  L G+L+ DP    T +N     +F+LA I+     D +    +I I  WGK+A S    L  G    V GR+ T     +    +    Y  +V+AD+V
  S:     1 MNRTVLIGRLTKDPELKFTPSNGTAVTTFTLA-INRRFSKDGQQEADFIPIVVWGKIAESSANYLTKGKLAGVAGRIQTRSYEAK----DGTMRYVTEVVADEV 99
>gi|116628691|ref|YP_813863.1| single-stranded DNA-binding protein [Lactobacillus gasseri ATCC 33323] >gi|116094273|gb|ABJ59425.1| Single-stranded DNA-binding protein [Lactobacillus gasseri ATCC 33323] (172 aa)
Score = 82, Expect = 7.7e-01, Identities = 34/106 (32%), Positives = 50/106 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV----YRPDEEN 106
           +N V L G+L+ DP+   T +    A+F+LA      +S G      ++    W K A +F      G  V ++GR+ T       DD + K  Y  +VI D       R D EN
  S:     2 INNVVLVGRLTRDPDLRTTGSGISVATFTLAVDRQYTNSQG-ERGADFVSCVIWRKAAENFANFTSKGSLVGIQGRIQTRTY----DDKDGKRVYVTEVIVDNFSLLESRRDREN 111
>gi|91790395|ref|YP_551347.1| single-strand binding protein [Polaromonas sp. JS666] >gi|91699620|gb|ABE46449.1| single-strand binding protein [Polaromonas sp. JS666] (162 aa)
Score = 82, Expect = 8.4e-01, Identities = 27/99 (27%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACID------SSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +N+V + G L  DP      + +  A+ ++A  D      S    ++  + R+   G++A  V   L+ G  V+VEG L T K      D + +  Y  ++ AD++
  S:     4 VNKVIIVGNLGRDPEMRSFPSGDQVANVTIATTDKWKDKQSGEMKEATEWHRVVFNGRLAEIVGQYLRKGSQVYVEGSLRTRKWT----DKDGQEKYTTEIRADQM 105
>gi|149114921|ref|ZP_01841670.1| single-strand binding protein [Shewanella baltica OS223] >gi|146865370|gb|EDK50697.1| single-strand binding protein [Shewanella baltica OS223] (236 aa)
Score = 82, Expect = 8.6e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S  + D +        + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSES--WKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105
>gi|168183705|ref|ZP_02618369.1| single-strand binding protein [Clostridium botulinum Bf] >gi|182673193|gb|EDT85154.1| single-strand binding protein [Clostridium botulinum Bf] (148 aa)
Score = 82, Expect = 8.7e-01, Identities = 33/99 (33%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLACIDSSGFNDSKS---YIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MN+V L G+L+ DP    T  N    A+F+LA +D     D +    +I I  WGK A S    +  G  + V GR+ T     +    +    Y  +VIA++V
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVATFTLA-VDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAK----DGTRRYVTEVIAEEV 99
>gi|163722610|ref|ZP_02130148.1| single-strand binding protein [Desulfatibacillum alkenivorans AK-01] >gi|161404364|gb|EDQ28594.1| single-strand binding protein [Desulfatibacillum alkenivorans AK-01] (146 aa)
Score = 82, Expect = 8.9e-01, Identities = 27/97 (27%), Positives = 45/97 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFV-LTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIAD 97
           +N+V L G L  DP      +    A+ +LA  +     D   + RI  + K+A      LK G   + EGRL T +  ++  D N +  Y  +++A+
  S:     4 LNKVMLIGHLGRDPEMKYAASGLAIANINLATTEKFKGEDRTEWHRIVVFDKLAEICGQYLKKGSQAYFEGRLKTKEWTDK--DGNKR--YTTEIVAN 97
>gi|193214371|ref|YP_001995570.1| single-strand binding protein [Chloroherpeton thalassium ATCC 35110] >gi|193087848|gb|ACF13123.1| single-strand binding protein [Chloroherpeton thalassium ATCC 35110] (162 aa)
Score = 82, Expect = 9.1e-01, Identities = 27/74 (36%), Positives = 39/74 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSK-------SYIRITAWGKVA-SFVLTLKPGDSVFVEGRLST 74
           +N V + G L+ DP   QT T     +FS+AC  +  F DS         Y+ + AW K+A S    L    +V V+G L +
  S:     9 INSVVIAGNLTKDPIFRQTTTGTPVVNFSIAC--NRRFRDSNNQWQEDVCYVGVVAWNKLAESCRDNLHKSSAVLVDGELQS 88
>gi|16081142|ref|NP_391970.1| single-strand DNA-binding protein [Bacillus subtilis subsp. subtilis str. 168] >gi|586039|sp|P37455|SSB_BACSU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|467374|dbj|BAA05220.1| single strand DNA binding protein [Bacillus subtilis] >gi|2636637|emb|CAB16127.1| single-strand DNA-binding protein [Bacillus subtilis subsp. subtilis str. 168] (172 aa)
Score = 82, Expect = 9.1e-01, Identities = 31/99 (31%), Positives = 47/99 (47%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLAC----IDSSGFNDSKSYIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           +NRV L G+L+ DP    T      A+F+LA      + SG  ++  +I    W + A  V   LK G    V+GRL T    N+      +  +  +V A+ V
  S:     2 LNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREA-DFINCVTWRRQAENVANFLKKGSLAGVDGRLQTRNYENQQ----GQRVFVTEVQAESV 100
>gi|73666895|ref|YP_302911.1| single-strand binding protein [Ehrlichia canis str. Jake] >gi|72394036|gb|AAZ68313.1| Single-strand binding protein [Ehrlichia canis str. Jake] (157 aa)
Score = 82, Expect = 9.1e-01, Identities = 32/106 (30%), Positives = 49/106 (46%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRI--TAWGKVASFVLTL--------KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEEN 106
           +N+V L G L  DP+    +     ASFS+A   S  + D  S IR   T W  +  F   L        + G  +++EG L T K  ++++         LQ     +Y  D +N
  S:     6 VNKVILIGNLGKDPDIRVMQNGKEMASFSIAT--SESWVDKTSGIRTEKTEWHNIVVFNEGLVKIIKNCVRKGSKIYIEGSLRTRKWTDQNNVDRYTTEVILQGFNSALYMLDAKN 119
>gi|187935425|ref|YP_001886686.1| single-strand binding domain protein [Clostridium botulinum B str. Eklund 17B] >gi|187723578|gb|ACD24799.1| single-strand binding domain protein [Clostridium botulinum B str. Eklund 17B] (216 aa)
Score = 82, Expect = 9.3e-01, Identities = 26/106 (24%), Positives = 47/106 (44%)
  Q:     2 NRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEENS 107
           N +FL G +  +P     RT   G   +   +  +   +   YI   AWG+ + F  +L  GD++ V GR+ + +   +  D  S    A +V   K+ + + + S
  S:   107 NEIFLDGYICKEP---VYRTTPFGREIADVLLAVNRAYNKSDYIPTIAWGRNSRFCQSLSVGDNIRVWGRVQSREYQKKVSDTESIKKIAYEVSISKMEKVEGDTS 209
>gi|148381564|ref|YP_001256105.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] >gi|153930842|ref|YP_001385941.1| single-strand binding protein [Clostridium botulinum A str. ATCC 19397] >gi|153939968|ref|YP_001392983.1| single-strand binding protein [Clostridium botulinum F str. Langeland] >gi|168181094|ref|ZP_02615758.1| single-strand binding protein [Clostridium botulinum NCTC 2916] >gi|170755652|ref|YP_001783262.1| single-strand binding protein [Clostridium botulinum B1 str. Okra] >gi|170759014|ref|YP_001788969.1| single-strand binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|187777389|ref|ZP_02993862.1| hypothetical protein CLOSPO_00945 [Clostridium sporogenes ATCC 15579] >gi|148291048|emb|CAL85185.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152926886|gb|ABS32386.1| single-strand binding protein [Clostridium botulinum A str. ATCC 19397] >gi|152935864|gb|ABS41362.1| single-strand binding protein [Clostridium botulinum F str. Langeland] >gi|169120864|gb|ACA44700.1| single-strand binding protein [Clostridium botulinum B1 str. Okra] >gi|169406003|gb|ACA54414.1| single-strand binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|182668070|gb|EDT80049.1| single-strand binding protein [Clostridium botulinum NCTC 2916] >gi|187774317|gb|EDU38119.1| hypothetical protein CLOSPO_00945 [Clostridium sporogenes ATCC 15579] (148 aa)
Score = 81, Expect = 9.5e-01, Identities = 33/99 (33%), Positives = 49/99 (49%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIG-ASFSLACIDSSGFNDSKS---YIRITAWGKVA-SFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
           MN+V L G+L+ DP    T  N    A+F+LA +D     D +    +I I  WGK A S    +  G  + V GR+ T     +    +    Y  +VIA++V
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVATFTLA-VDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAK----DGTRRYVTEVIAEEV 99
>gi|68171130|ref|ZP_00544539.1| Single-strand binding protein [Ehrlichia chaffeensis str. Sapulpa] >gi|67999455|gb|EAM86095.1| Single-strand binding protein [Ehrlichia chaffeensis str. Sapulpa] (170 aa)
Score = 81, Expect = 9.7e-01, Identities = 31/106 (29%), Positives = 51/106 (48%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRI--TAWGKVASF------VL--TLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDEEN 106
           +N+V L G L  DP+    +     ASFS+A   S  + D  S +R   T W  V  F      ++   ++ G  +++EG L T K  ++++         LQ     +Y  D +N
  S:    19 VNKVILIGNLGKDPDIRVMQNGKEMASFSIAT--SESWVDKASGMRTEKTEWHNVVVFNEGLVKIIKNCIRKGSKIYIEGSLRTRKWTDQNNVDRYTTEVILQGFNSALYMLDAKN 132
>gi|108802901|ref|YP_642838.1| single-strand binding protein [Rubrobacter xylanophilus DSM 9941] >gi|108764144|gb|ABG03026.1| single-strand binding protein [Rubrobacter xylanophilus DSM 9941] (141 aa)
Score = 81, Expect = 9.7e-01, Identities = 27/99 (27%), Positives = 42/99 (42%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYIRITAWGKVASFVLTL-KPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKV 99
            NRV L G L+ DP    T       SF +A       N+   +  ++AW ++   +    K GD + +EGRL       +     SK    + ++AD V
  S:     4 FNRVILAGNLTRDPELRFTSDGVPVCSFGIAVNRVRSRNEEVDFFDVSAWRELGETIANYKKKGDPILIEGRLQYRTWEAQDGTRRSK----VDIVADNV 99
>gi|120600326|ref|YP_964900.1| single-strand binding protein [Shewanella sp. W3-18-1] >gi|124545570|ref|ZP_01704763.1| single-strand binding protein [Shewanella putrefaciens 200] >gi|120560419|gb|ABM26346.1| single-strand binding protein [Shewanella sp. W3-18-1] >gi|124510913|gb|EAY54980.1| single-strand binding protein [Shewanella putrefaciens 200] (236 aa)
Score = 81, Expect = 9.9e-01, Identities = 28/98 (28%), Positives = 51/98 (52%)
  Q:     1 MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKS-------YIRITAWGKVASFVLT-LKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADK 98
           +N+V L G L  DP        N  A+ ++A  +S  + D +        + R+  +GK+A      L+ G  V++EG+L T K  ++S     +  Y+ +V+ D+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSES--WKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQS----GQDRYSTEVVIDQ 105