>gi|13508037|ref|NP_109986.1| 4'-phosphopantetheinyl transferase [Mycoplasma pneumoniae M129] >gi|6225002|sp|P75480|ACPS_MYCPN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|1674234|gb|AAB96186.1| holo-acyl-carrier protein synthase-like protein [Mycoplasma pneumoniae M129] (119 aa)
Score = 630, Expect = 2.3e-64, Identities = 119/119 (100%), Positives = 119/119 (100%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQTPWKN 119
           MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQTPWKN
  S:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQTPWKN 119
>gi|12045065|ref|NP_072876.1| 4'-phosphopantetheinyl transferase [Mycoplasma genitalium G37] >gi|6225001|sp|Q9ZB79|ACPS_MYCGE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|3844819|gb|AAC71438.1| holo-(acyl-carrier-protein) synthase [Mycoplasma genitalium G37] >gi|166078942|gb|ABY79560.1| holo-(acyl-carrier-protein) synthase [synthetic Mycoplasma genitalium JCVI-1.0] (114 aa)
Score = 341, Expect = 6.6e-31, Identities = 67/114 (58%), Positives = 91/114 (79%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           M++GIGID+V++KRF  L  +T +CFAKRLLTS E   Y KL  ++++++FLAVHW+LKEAIYKA +HIKPLF++LEI K N +Y C+    I LLLSVSY++ +++AICLAQQ
  S:     1 MVVGIGIDVVQLKRFLTLV-ETSDCFAKRLLTSNELNSYWKL-NNNQRANFLAVHWTLKEAIYKATSHIKPLFTKLEIYKLNNQYRCEFIQNINLLLSVSYTNCHVSAICLAQQ 112
>gi|31541454|gb|AAP56755.1| AcpS [Mycoplasma gallisepticum R] (116 aa)
Score = 214, Expect = 3.9e-16, Identities = 48/114 (42%), Positives = 75/114 (65%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G+GID+V I RF+  A+++D  F K+LLT  E   Y  +  +S ++ FLA+ WSLKEAI+KA+      F+QLEI K +  Y C ++ KI+L LS+S+    + A+ +A++
  S:     6 MIIGVGIDVVSIDRFQ--AKKSDE-FIKKLLTEHEQNKYKTVIGESNQNIFLAIRWSLKEAIFKALKTWDE-FTQLEIRKIHGAYECSLNEKIKLHLSISHEGQRLVAMAVAER 115
>gi|161511506|ref|NP_853187.2| 4'-phosphopantetheinyl transferase [Mycoplasma gallisepticum R] >gi|61211598|sp|Q7NB74.2|ACPS_MYCGA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) (111 aa)
Score = 214, Expect = 3.9e-16, Identities = 48/114 (42%), Positives = 75/114 (65%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G+GID+V I RF+  A+++D  F K+LLT  E   Y  +  +S ++ FLA+ WSLKEAI+KA+      F+QLEI K +  Y C ++ KI+L LS+S+    + A+ +A++
  S:     1 MIIGVGIDVVSIDRFQ--AKKSDE-FIKKLLTEHEQNKYKTVIGESNQNIFLAIRWSLKEAIFKALKTWDE-FTQLEIRKIHGAYECSLNEKIKLHLSISHEGQRLVAMAVAER 110
>gi|148377985|ref|YP_001256861.1| Holo-[acyl-carrier protein]synthase [Mycoplasma agalactiae PG2] >gi|148292031|emb|CAL59423.1| Holo-[acyl-carrier protein]synthase [Mycoplasma agalactiae PG2] (104 aa)
Score = 150, Expect = 9.3e-09, Identities = 32/82 (39%), Positives = 50/82 (60%)
  Q:     4 GIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRY 85
            IG+D+ +I RF++L + T      R+L++ E+  + +L+ D EK  FLA  W +KEA++KA N I P F ++ I KK   Y
  S:     5 NIGLDMTKISRFQELKKST----IIRILSAEEFIEFDELKSDYEKQKFLATRWCIKEAMFKADNAI-PAFDKITIIKKQGVY 81
>gi|26553487|ref|NP_757421.1| holo-acyl carrier protein synthase [Mycoplasma penetrans HF-2] >gi|26453493|dbj|BAC43825.1| holo-acyl carrier protein synthase [Mycoplasma penetrans HF-2] (120 aa)
Score = 145, Expect = 3.9e-08, Identities = 40/109 (36%), Positives = 57/109 (52%)
  Q:     3 LGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHI-KPLFSQLEITKK-NQRYNCQIDPKIELLLSVSYSSNNITAICL 111
             IGID+ +I  F   + +    F KRLLT  EY  Y K+  ++ K  FLA  W+LKEA +KA+N   K  F  +E  K  N  Y C     ++  +S+SY  N + A  +
  S:    14 FNIGIDVTKIDYFVNKSDK----FIKRLLTDNEYNQYLKI-DNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVK--VSISYDGNQVFATAI 117
>gi|90961337|ref|YP_535253.1| Holo-[acyl-carrier protein] synthase [Lactobacillus salivarius UCC118] >gi|122993089|sp|Q1WV15.1|ACPS_LACS1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90820531|gb|ABD99170.1| Holo-[acyl-carrier protein] synthase [Lactobacillus salivarius UCC118] (135 aa)
Score = 136, Expect = 4.5e-07, Identities = 43/118 (36%), Positives = 64/118 (54%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN---HIKPLFSQLEITKKNQRYNCQI-----DPKIELLLSVSYSSNNITAICLAQQTPWK 118
           MI G GID+ EI++  Q A++    FAKR+LT  E A + K  K + K  FLA  +S KEA  KA       K  F  +EI   NQ    +I     D K++  +S+S+S   +    + ++  W+
  S:     1 MIYGNGIDIQEIRKI-QKAQEKRESFAKRILTVNELAIFEKY-KGNRKYEFLAGRFSAKEAFSKAYGTGIGKKVGFQDIEILNDNQTGRPEIVKFPGDNKLQAKISISHSGEYVVTEVILEKLTWQ 124
>gi|144574962|gb|AAZ43519.2| holo-acyl-carrier protein synthase [Mycoplasma synoviae 53] (101 aa)
Score = 128, Expect = 3.2e-06, Identities = 33/111 (29%), Positives = 60/111 (54%)
  Q:     3 LGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQ 113
           + +G+DLV I RF+   ++    F +RLL+  E   + KL  +  K  FLA  W++KEAI+KA N     F+++ + K N  +N +        +S+S+ ++ + A  + +
  S:     1 MNLGVDLVTISRFKNKNKE----FIERLLSEEELVEFNKLDNEESKELFLARSWAIKEAIFKADNSYFK-FNKINLIKINNEWNFK-----NFKISISHENDLLIAFVIKE 101
>gi|170091748|ref|XP_001877096.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164648589|gb|EDR12832.1| predicted protein [Laccaria bicolor S238N-H82] (157 aa)
Score = 128, Expect = 3.3e-06, Identities = 32/75 (42%), Positives = 46/75 (61%)
  Q:     2 ILGIGIDLVEIKRFEQL-ARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHI-KPLFSQL 76
           ILGIG+DLV I R   L +R+    FA R+L+S E A +  +  +  +  FLAV W +KEA YKA+  + +P +  L
  S:    28 ILGIGVDLVNIPRITALLSRRDPQRFASRILSSDELALWQSMPLN-RRVQFLAVRWGVKEAAYKAMFPVARPTWKDL 103
>gi|78485083|ref|YP_391008.1| holo-(acyl-carrier-protein) synthase [Thiomicrospira crunogena XCL-2] >gi|123555740|sp|Q31HN9.1|ACPS_THICR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|78363369|gb|ABB41334.1| holo-(acyl-carrier-protein) synthase [Thiomicrospira crunogena XCL-2] (127 aa)
Score = 127, Expect = 4.2e-06, Identities = 28/67 (41%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG DLVEI R   L  + +  FAKR+L   E   +   ++  +   FLA  W+ KEAI KA+ 
  S:     1 MIVGIGTDLVEIARIAALMTKRNEVFAKRILAQQELERF---KQHGQPEKFLAKRWAAKEAISKALG 64
>gi|47459314|ref|YP_016176.1| holo-acyl carrier protein synthase [Mycoplasma mobile 163K] >gi|61211502|sp|Q6KHG5|ACPS_MYCMO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|47458644|gb|AAT27965.1| holo-acyl carrier protein synthase [Mycoplasma mobile 163K] (107 aa)
Score = 127, Expect = 4.3e-06, Identities = 39/110 (35%), Positives = 63/110 (57%)
  Q:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           IG+DL +I RF+  + +    FAKR+L+  E+  + ++ KD    SFLA  W++KEAIYKA N+    FS++ + KK+  Y  Q        +SVS+  + I A  + ++
  S:     7 IGVDLTKISRFKNKSEK----FAKRILSHEEFEKW-EINKDH---SFLATRWAIKEAIYKADNNFFE-FSKINV-KKDNYYWFQ-----NFYISVSHEGDLIIAFVIKKE 101
>gi|91205807|ref|YP_538162.1| 4'-phosphopantetheinyl transferase [Rickettsia bellii RML369-C] >gi|157827065|ref|YP_001496129.1| 4'-phosphopantetheinyl transferase [Rickettsia bellii OSU 85-389] >gi|166198222|sp|A8GW65.1|ACPS_RICB8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|123084557|sp|Q1RHU1|ACPS_RICBR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|91069351|gb|ABE05073.1| Holo-[acyl carrier protein] synthase [Rickettsia bellii RML369-C] >gi|157802369|gb|ABV79092.1| 4'-phosphopantetheinyl transferase [Rickettsia bellii OSU 85-389] (127 aa)
Score = 127, Expect = 4.7e-06, Identities = 27/65 (41%), Positives = 42/65 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI+G+G D+V+I R E++ +     F KR+L + E   +A L+K+S   +FLA  ++ KEAI KA
  S:     1 MIIGVGTDIVQIPRIEKIIKLYPEIFPKRILNTEELKKFALLKKESH-VTFLAKRFAAKEAISKA 64
>gi|42518358|ref|NP_964288.1| acyl carrier protein synthase [Lactobacillus johnsonii NCC 533] >gi|61211576|sp|Q74LB3|ACPS_LACJO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|41582643|gb|AAS08254.1| acyl carrier protein synthase [Lactobacillus johnsonii NCC 533] (119 aa)
Score = 126, Expect = 6.8e-06, Identities = 28/67 (41%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+GID VE++R +++  + D  FAKR+LT  E+  Y +L K   K  +L   +SLKE+  KA+ 
  S:     1 MIRGVGIDSVEVERMKKIVEKGDK-FAKRVLTPKEFEQYQQL-KGKRKVEYLGGRFSLKESFSKAMG 65
>gi|169860957|ref|XP_001837113.1| predicted protein [Coprinopsis cinerea okayama7#130] >gi|116501835|gb|EAU84730.1| predicted protein [Coprinopsis cinerea okayama7#130] (153 aa)
Score = 125, Expect = 7.0e-06, Identities = 29/82 (35%), Positives = 46/82 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQT-DNCFAKRLLTSTEYAHYAKLRKDSEKSS---FLAVHWSLKEAIYKAV-NHIKPLFSQLEITKKNQ 83
           ILGIG+D++   R   L ++     F K++L+  EY+ +  L           +LAV WS+KEA YKA+   ++P + +L  T  N 
  S:     3 ILGIGVDIIHTPRISALLKKRYAGRFVKKILSPAEYSGWVNLSTSGTSGDLVRYLAVRWSVKEAAYKALYPTVRPTWKELTYTSLNS 89
>gi|116628940|ref|YP_814112.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus gasseri ATCC 33323] >gi|116094522|gb|ABJ59674.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus gasseri ATCC 33323] (125 aa)
Score = 125, Expect = 8.8e-06, Identities = 28/67 (41%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G GID VE++R +++  + D  FAKR+LT  E+A Y +L K   +  +L   +SLKE+  KA+ 
  S:     7 MIRGFGIDSVEVERMKKIVEKGDK-FAKRVLTPKEFAQYQQL-KGKRRVEYLGGRFSLKESFSKALG 71
>gi|157803577|ref|YP_001492126.1| 4'-phosphopantetheinyl transferase [Rickettsia canadensis str. McKiel] >gi|166198223|sp|A8EYA8.1|ACPS_RICCK Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157784840|gb|ABV73341.1| 4'-phosphopantetheinyl transferase [Rickettsia canadensis str. McKiel] (131 aa)
Score = 125, Expect = 8.8e-06, Identities = 26/65 (40%), Positives = 43/65 (66%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++GIG D+V+I R E++       FAK++LT  E   +A L K + +++F+A H++ KEA+ KA
  S:     1 MLVGIGTDIVQIPRIEKILHLYPQLFAKKILTLKELKQFALLDK-TNRATFVAKHFAAKEAVSKA 64
>gi|126132280|ref|XP_001382665.1| holo-(acyl-carrier protein) synthase [Pichia stipitis CBS 6054] >gi|126094490|gb|ABN64636.1| holo-(acyl-carrier protein) synthase [Pichia stipitis CBS 6054] (136 aa)
Score = 124, Expect = 9.5e-06, Identities = 41/113 (36%), Positives = 64/113 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAK---RLL-TSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKN--QRYNCQIDPKI-----------ELLLSVSYSSNNITAICLAQQ 114
           +LGIG+D+V   RF +L  +     AK   R+L    E   + ++     K  FLA  W+ KEA++K ++    + SQ +   K+  ++Y+ Q  P I           E LLS+S+ SN + A  L QQ
  S:    10 VLGIGVDVVNTDRFRRLVSRDPRFLAKLTARILHPQHELPEFFRISDAENKVKFLAGSWASKEAVFKTLD----ISSQKQFQFKHWFRKYSEQGKPHICNDNYPQSEQEEFLLSISHDSNVLVASALRQQ 135
>gi|81429226|ref|YP_396227.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) (4'-phosphopantetheine transferase AcpS) [Lactobacillus sakei subsp. sakei 23K] >gi|90111940|sp|Q38V63|ACPS_LACSS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|78610869|emb|CAI55921.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) (4'-phosphopantetheine transferase AcpS) [Lactobacillus sakei subsp. sakei 23K] (117 aa)
Score = 124, Expect = 1.0e-05, Identities = 30/65 (46%), Positives = 46/65 (70%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTE---YAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI+G+GIDL EI RFE+ A++ ++ FA+++LT+TE   ++HY   R       FLA  +++KEA  KA
  S:     1 MIVGLGIDLAEIDRFEK-AQEKNSRFAEKVLTATEFELFSHYTGRR----ALEFLAGRFAVKEAFSKA 63
>gi|154684965|ref|YP_001420126.1| 4'-phosphopantetheinyl transferase [Bacillus amyloliquefaciens FZB42] >gi|166198173|sp|A7Z1L9.1|ACPS_BACA2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|154350816|gb|ABS72895.1| AcpS [Bacillus amyloliquefaciens FZB42] (121 aa)
Score = 124, Expect = 1.1e-05, Identities = 32/65 (49%), Positives = 40/65 (61%)
  Q:     1 MILGIGIDLVEIKRFE-QLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIGID+VE+ R E  L+RQ    F +R+LT  EYA +  L  D  K  FLA  ++ KEA  KA
  S:     1 MIFGIGIDIVELHRIENMLSRQAR--FPQRILTEAEYARFT-LLSDKRKIEFLAGRFAAKEAFSKA 63
>gi|171779288|ref|ZP_02920259.1| hypothetical protein STRINF_01136 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282344|gb|EDT47771.1| hypothetical protein STRINF_01136 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (119 aa)
Score = 122, Expect = 1.5e-05, Identities = 27/67 (40%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G GIDL EI   ++ A + +N FAKR+LT  E+  ++  + +  +  FLA  W+ KEA  KA+ 
  S:     1 MIIGHGIDLQEIDAIKR-AYEKNNRFAKRVLTEKEFQVFSGFKAEKRQMEFLAGRWAAKEAFAKAMG 66
>gi|58336607|ref|YP_193192.1| holo-acyl-carrier protein [Lactobacillus acidophilus NCFM] >gi|75433045|sp|Q5FMB3|ACPS_LACAC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|58253924|gb|AAV42161.1| holo-acyl-carrier protein [Lactobacillus acidophilus NCFM] (118 aa)
Score = 122, Expect = 1.9e-05, Identities = 27/67 (40%), Positives = 43/67 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+GID +E++R +++  + D  FAK++LT  E+A Y KL +   K  +L   +SLKE+  KA+ 
  S:     1 MIKGVGIDSIEVERVKKIIDKGD-LFAKKVLTPNEFAQYQKL-EGKRKVEYLGGRFSLKESFSKAMG 65
>gi|15828584|ref|NP_325944.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Mycoplasma pulmonis UAB CTIP] >gi|20137428|sp|Q98R97|ACPS_MYCPU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|14089526|emb|CAC13286.1| HOLO-[ACYL-CARRIER PROTEIN] SYNTHASE (HOLO-ACP SYNTHASE) [Mycoplasma pulmonis] (108 aa)
Score = 122, Expect = 1.9e-05, Identities = 38/113 (33%), Positives = 63/113 (55%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           ++ IG+DLV+I+R E    ++D+ F +++L+  EY  Y K +    K+ FLA  W++KEA++KA N     F ++ ITKK+  Y  + D       ++S SS     I   Q+
  S:     3 LIMIGVDLVKIERLEN---KSDH-FVRKILSLDEYELYQKTK---AKAIFLATRWAIKEALFKADNQ-HFCFKKINITKKDNVY--KFDG-----FAISVSSEKEYVIAFVQK 100
>gi|161506850|ref|YP_001576804.1| Holo-acyl-carrier protein [Lactobacillus helveticus DPC 4571] >gi|172048358|sp|A8YXI2.1|ACPS_LACH4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|160347839|gb|ABX26513.1| Holo-acyl-carrier protein [Lactobacillus helveticus DPC 4571] (118 aa)
Score = 121, Expect = 2.4e-05, Identities = 26/67 (38%), Positives = 44/67 (65%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+GID +E++R +++  + D+ FA+++LT  E+A Y K+ K   K  +L   +SLKE+  KA+ 
  S:     1 MIKGVGIDSIEVERVKKIVAKGDS-FAEKVLTPKEFAQYQKM-KGKRKVEYLGGRFSLKESFSKAMG 65
>gi|87118653|ref|ZP_01074552.1| holo-(acyl-carrier protein) synthase [Marinomonas sp. MED121] >gi|86166287|gb|EAQ67553.1| holo-(acyl-carrier protein) synthase [Marinomonas sp. MED121] (142 aa)
Score = 121, Expect = 2.4e-05, Identities = 25/67 (37%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG D+VEI R +   ++  + F KRLLT  E   Y +++ +    +++A  ++ KEA+ KA+ 
  S:    15 MILGIGTDIVEIPRIKDSVKRLGDRFLKRLLTQKELDRYYEIKHEDVAMAYVAKRFAAKEAVAKALG 81
>gi|59712690|ref|YP_205466.1| 4'-phosphopantetheinyl transferase [Vibrio fischeri ES114] >gi|75431524|sp|Q5E318|ACPS_VIBF1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59480791|gb|AAW86578.1| holo-(acyl-carrier-protein) synthase [Vibrio fischeri ES114] (126 aa)
Score = 120, Expect = 3.0e-05, Identities = 24/66 (36%), Positives = 43/66 (65%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ EI+R E+   ++ + FA+R+L+ +E+  Y +L+   +K  FLA  ++ KEA  KA+ 
  S:     3 IVGLGTDIAEIERVEKALSRSGDAFAERILSQSEFEKYQELK---QKGRFLAKRFAAKEAASKALG 65
>gi|157825957|ref|YP_001493677.1| 4'-phosphopantetheinyl transferase [Rickettsia akari str. Hartford] >gi|166198221|sp|A8GP44.1|ACPS_RICAH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157799915|gb|ABV75169.1| 4'-phosphopantetheinyl transferase [Rickettsia akari str. Hartford] (126 aa)
Score = 120, Expect = 3.0e-05, Identities = 27/67 (40%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           M++G+G D+V+I R E++       FAKR+L S E   +A L K S  ++FLA  ++ KEA+ KA  
  S:     1 MLIGVGTDIVQILRIEKILHLYPELFAKRILASKELRQFALLNKTSH-ATFLAKRFAAKEAVSKAFG 66
>gi|82702883|ref|YP_412449.1| phosphopantethiene-protein transferase domain-contain protein [Nitrosospira multiformis ATCC 25196] >gi|123544320|sp|Q2Y864.1|ACPS_NITMU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|82410948|gb|ABB75057.1| phosphopantethiene/protein transferase domain [Nitrosospira multiformis ATCC 25196] (125 aa)
Score = 119, Expect = 3.4e-05, Identities = 29/67 (43%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG DLVE  R  +L  +    FA+RLLT  E+  YA   K  + + FLA  ++ KEA+ KA  
  S:     1 MIYGIGTDLVETSRITRLLEKYGERFARRLLTDEEWPEYA---KSMQPAMFLAKRFAAKEALAKAFG 64
>gi|67459335|ref|YP_246959.1| 4'-phosphopantetheinyl transferase [Rickettsia felis URRWXCal2] >gi|75536239|sp|Q4UKX9|ACPS_RICFE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|67004868|gb|AAY61794.1| Holo-[acyl carrier protein] synthase [Rickettsia felis URRWXCal2] (131 aa)
Score = 119, Expect = 3.4e-05, Identities = 26/65 (40%), Positives = 40/65 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M +G+G D+V+I R E++       FAK++LTS E A ++ L K    + FLA  ++ KEA+ KA
  S:     1 MFIGVGTDIVQIPRIEKILHLYPELFAKKILTSKELAQFSLLDKTGH-AVFLAKRFAAKEAVSKA 64
>gi|15892804|ref|NP_360518.1| 4'-phosphopantetheinyl transferase [Rickettsia conorii str. Malish 7] >gi|34581486|ref|ZP_00142966.1| holo-[acyl carrier protein] synthase [Rickettsia sibirica 246] >gi|20137397|sp|Q92H90|ACPS_RICCN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|15619986|gb|AAL03419.1| holo-[acyl carrier protein] synthase [EC:2.7.8.7] [Rickettsia conorii str. Malish 7] >gi|28262871|gb|EAA26375.1| holo-[acyl carrier protein] synthase [Rickettsia sibirica 246] (131 aa)
Score = 119, Expect = 3.7e-05, Identities = 26/65 (40%), Positives = 42/65 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++LTS E   +A L K +  ++FLA  ++ KEA+ KA
  S:     1 MLIGVGTDIVQIPRIEKILHLYPELFAKKILTSKELKQFALLGKINH-AAFLAKRFAAKEAVSKA 64
>gi|163802962|ref|ZP_02196849.1| 4'-phosphopantetheinyl transferase [Vibrio campbellii AND4] >gi|159173252|gb|EDP58080.1| 4'-phosphopantetheinyl transferase [Vibrio campbellii AND4] (126 aa)
Score = 119, Expect = 3.8e-05, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+ EI+R E+   +T   FAKR+L+  E   + +L+   +K  +LA  +++KEA  KA+ 
  S:     3 ILGLGTDIAEIERIEKALSRTGEPFAKRILSGDEMTRFTELK---QKGRYLAKRFAVKEAASKALG 65
>gi|156975788|ref|YP_001446695.1| 4'-phosphopantetheinyl transferase [Vibrio harveyi ATCC BAA-1116] >gi|166198244|sp|A7MZA4.1|ACPS_VIBHB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|156527382|gb|ABU72468.1| hypothetical protein VIBHAR_03532 [Vibrio harveyi ATCC BAA-1116] (126 aa)
Score = 119, Expect = 3.9e-05, Identities = 26/66 (39%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+ EI+R E+   +T   FAKR+L+  E   +A+L+   +K  +LA  +++KEA  KA+ 
  S:     3 ILGLGTDIAEIERIEKALGRTGEPFAKRILSEDEVIKFAELK---QKGRYLAKRFAVKEAASKALG 65
>gi|153835468|ref|ZP_01988135.1| holo-(acyl-carrier-protein) synthase [Vibrio harveyi HY01] >gi|148867979|gb|EDL67176.1| holo-(acyl-carrier-protein) synthase [Vibrio harveyi HY01] (126 aa)
Score = 119, Expect = 3.9e-05, Identities = 26/66 (39%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+ EI+R E+   +T   FAKR+L+  E   +A+L+   +K  +LA  +++KEA  KA+ 
  S:     3 ILGLGTDIAEIERIEKALGRTGEPFAKRILSQDEMIKFAELK---QKGRYLAKRFAVKEAASKALG 65
>gi|81097174|ref|ZP_00875480.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Streptococcus suis 89/1591] >gi|80976778|gb|EAP40355.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Streptococcus suis 89/1591] (119 aa)
Score = 119, Expect = 3.9e-05, Identities = 40/114 (35%), Positives = 59/114 (51%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNH--IKPLFSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GIDL E++  E  AR     F K++LT  E+  Y  L     +  +LA  WS KEA+ KA+     K  F  +EI  T K   Y  +      + LS+S+S N + A  + ++
  S:     1 MIVGHGIDLQEMEAIES-ARIKPQGFPKKILTEKEFERYQSL-SGRRQLEYLAGRWSAKEALTKALGTGIGKIGFHDIEILNTSKGVPYVTKSPFDGNIWLSISHSGNFVQASVILEE 116
>gi|165933467|ref|YP_001650256.1| 4'-phosphopantetheinyl transferase [Rickettsia rickettsii str. Iowa] >gi|189027340|sp|B0BYC4.1|ACPS_RICRO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|165908554|gb|ABY72850.1| holo-[acyl-carrier protein] synthase [Rickettsia rickettsii str. Iowa] (131 aa)
Score = 119, Expect = 4.0e-05, Identities = 26/65 (40%), Positives = 42/65 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++LTS E   +A L K +  ++FLA  ++ KEA+ KA
  S:     1 MLIGVGTDIVQIPRIEKILHLYPELFAKKILTSKELKQFALLGKINH-AAFLAKRFAAKEAVSKA 64
>gi|157828739|ref|YP_001494981.1| 4'-phosphopantetheinyl transferase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|166198224|sp|A8GSU8.1|ACPS_RICRS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157801220|gb|ABV76473.1| 4'-phosphopantetheinyl transferase [Rickettsia rickettsii str. 'Sheila Smith'] (131 aa)
Score = 119, Expect = 4.2e-05, Identities = 26/65 (40%), Positives = 42/65 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++LTS E   +A L K +  ++FLA  ++ KEA+ KA
  S:     1 MLIGVGTDIVQISRIEKILHLYPELFAKKILTSKELKQFALLGKINH-AAFLAKRFAAKEAVSKA 64
>gi|146319467|ref|YP_001199179.1| 4'-phosphopantetheinyl transferase [Streptococcus suis 05ZYH33] >gi|146321664|ref|YP_001201375.1| 4'-phosphopantetheinyl transferase [Streptococcus suis 98HAH33] >gi|166198239|sp|A4W3N6.1|ACPS_STRS2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198241|sp|A4VXE0.1|ACPS_STRSY Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|145690273|gb|ABP90779.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus suis 05ZYH33] >gi|145692470|gb|ABP92975.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus suis 98HAH33] (119 aa)
Score = 118, Expect = 4.5e-05, Identities = 40/114 (35%), Positives = 59/114 (51%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNH--IKPLFSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GIDL E++  E  AR     F K++LT  E+  Y  L     +  +LA  WS KEA+ KA+     K  F  +EI  T K   Y  +      + LS+S+S N + A  + ++
  S:     1 MIVGHGIDLQEMEAIES-ARIKHQGFPKKILTEKEFERYQSL-SGRRQLEYLAGRWSAKEALTKALGTGIGKIGFHDIEILNTSKGVPYVTKSPFDGNIWLSISHSGNFVQASVILEE 116
>gi|89075084|ref|ZP_01161525.1| 4'-phosphopantetheinyl transferase [Photobacterium sp. SKA34] >gi|89049171|gb|EAR54736.1| 4'-phosphopantetheinyl transferase [Photobacterium sp. SKA34] (126 aa)
Score = 118, Expect = 5.7e-05, Identities = 34/106 (32%), Positives = 61/106 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNIT 107
           I+G+G D+ EI+R E++  ++ + FA+++L+S E   + +L+   +K  FLA  +++KEA  KA+   I    S  + T KN       D + + LLS+S  +N + 
  S:     3 IVGLGTDIAEIERVEKVFARSGDAFAQKILSSFELEQFQQLK---QKGRFLAKRFAVKEAASKALGTGIACGVSFHDFTVKN-------DERGKPLLSLSGKANELA 99
>gi|50122196|ref|YP_051363.1| 4'-phosphopantetheinyl transferase [Pectobacterium atrosepticum SCRI1043] >gi|59797731|sp|Q6D222|ACPS_ERWCT Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|49612722|emb|CAG76172.1| holo-[acyl-carrier protein] synthase [Erwinia carotovora subsp. atroseptica SCRI1043] (126 aa)
Score = 117, Expect = 6.4e-05, Identities = 26/66 (39%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+LT  E+AHY   ++  +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEVVIERSGERLARRILTDAEWAHY---QQHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|51473758|ref|YP_067515.1| 4'-phosphopantetheinyl transferase [Rickettsia typhi str. Wilmington] >gi|59797723|sp|Q68WF9|ACPS_RICTY Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|51460070|gb|AAU04033.1| holo-[acyl-carrier protein] synthase; Holo-ACP synthase. [Rickettsia typhi str. Wilmington] (128 aa)
Score = 117, Expect = 6.8e-05, Identities = 25/65 (38%), Positives = 41/65 (63%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++LTS E   +  L K +  ++FLA  ++ KEA+ KA
  S:     1 MLIGVGTDIVQIPRIEKILNLYQELFAKKILTSQELKQFTLLDKPNH-ATFLAKRFAAKEAVSKA 64
>gi|51597202|ref|YP_071393.1| 4'-phosphopantetheinyl transferase [Yersinia pseudotuberculosis IP 32953] >gi|153947663|ref|YP_001400121.1| 4'-phosphopantetheinyl transferase [Yersinia pseudotuberculosis IP 31758] >gi|170023439|ref|YP_001719944.1| holo-acyl-carrier-protein synthase [Yersinia pseudotuberculosis YPIII] >gi|186896299|ref|YP_001873411.1| holo-acyl-carrier-protein synthase [Yersinia pseudotuberculosis PB1/+] >gi|166918340|sp|A7FFU3.1|ACPS_YERP3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797703|sp|Q667V4|ACPS_YERPS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|51590484|emb|CAH22124.1| holo-[acyl-carrier protein] synthase [Yersinia pseudotuberculosis IP 32953] >gi|152959158|gb|ABS46619.1| holo-(acyl-carrier-protein) synthase [Yersinia pseudotuberculosis IP 31758] >gi|169749973|gb|ACA67491.1| holo-acyl-carrier-protein synthase [Yersinia pseudotuberculosis YPIII] >gi|186699325|gb|ACC89954.1| holo-acyl-carrier-protein synthase [Yersinia pseudotuberculosis PB1/+] (126 aa)
Score = 117, Expect = 7.0e-05, Identities = 25/66 (37%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  +T    A+R+L+ +E+ HY   ++  +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEISRIEAVVERTGERLARRILSPSEWQHY---QQHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|183603780|ref|ZP_02721074.2| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae MLV-016] >gi|183578878|gb|EDT99406.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae MLV-016] (122 aa)
Score = 117, Expect = 7.1e-05, Identities = 38/114 (33%), Positives = 61/114 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GID+ E+   E    + +  FAKR+LT+ E   +  L K   +  +LA  WS KEA  KA+   I  L F  LE+   ++   Y  Q     ++ LS+S++   +TA  + ++
  S:     3 MIVGHGIDIEELASIESAVTRHEG-FAKRVLTAQEMERFTSL-KGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEE 118
>gi|182684641|ref|YP_001836388.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae CGSP14] >gi|182629975|gb|ACB90923.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae CGSP14] (123 aa)
Score = 117, Expect = 7.2e-05, Identities = 38/114 (33%), Positives = 61/114 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GID+ E+   E    + +  FAKR+LT+ E   +  L K   +  +LA  WS KEA  KA+   I  L F  LE+   ++   Y  Q     ++ LS+S++   +TA  + ++
  S:     4 MIVGHGIDIEELASIESAVTRHEG-FAKRVLTAQEMERFTSL-KGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEE 119
>gi|168487533|ref|ZP_02712041.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1087-00] >gi|183569643|gb|EDT90171.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1087-00] (120 aa)
Score = 117, Expect = 7.3e-05, Identities = 38/114 (33%), Positives = 61/114 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GID+ E+   E    + +  FAKR+LT+ E   +  L K   +  +LA  WS KEA  KA+   I  L F  LE+   ++   Y  Q     ++ LS+S++   +TA  + ++
  S:     1 MIVGHGIDIEELASIESAVTRHEG-FAKRVLTTQEMERFTSL-KGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEE 116
>gi|163728751|ref|ZP_02136234.1| 4'-phosphopantetheinyl transferase [Vibrio fischeri MJ11] >gi|161398230|gb|EDQ22516.1| 4'-phosphopantetheinyl transferase [Vibrio fischeri MJ11] (126 aa)
Score = 117, Expect = 7.4e-05, Identities = 24/66 (36%), Positives = 43/66 (65%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ EI+R E+   ++ + FA+R+L+ +E+  Y +L+   +K  FLA  ++ KEA  KA+ 
  S:     3 IVGLGTDIAEIERVEKALSRSGDAFAERILSQSEFEIYQELK---QKGRFLAKRFAAKEAASKALG 65
>gi|73541935|ref|YP_296455.1| 4'-phosphopantetheinyl transferase [Ralstonia eutropha JMP134] >gi|90111946|sp|Q46Z22|ACPS_RALEJ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|72119348|gb|AAZ61611.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Ralstonia eutropha JMP134] (140 aa)
Score = 117, Expect = 7.5e-05, Identities = 25/67 (37%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           MI G+G D++EI R + +  +T   FA+++L + E A Y   +  SE+   +FLA  ++ KEA  KA+ 
  S:     1 MIYGVGTDIIEIARVQGVMERTRGRFAEKVLGADELAKYHARKARSERRGLAFLATRFAAKEAFSKAIG 69
>gi|90580329|ref|ZP_01236136.1| 4'-phosphopantetheinyl transferase [Vibrio angustum S14] >gi|90438631|gb|EAS63815.1| 4'-phosphopantetheinyl transferase [Vibrio angustum S14] (126 aa)
Score = 117, Expect = 7.5e-05, Identities = 34/106 (32%), Positives = 61/106 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNIT 107
           I+G+G D+ EI+R E++  ++ + FA+++L+S+E   + +L+    K  FLA  +++KEA  KA+   I    S  + T KN       D + + LLS+S  +N + 
  S:     3 IVGLGTDIAEIERVEKVFARSGDAFAQKILSSSELEQFQQLKL---KGRFLAKRFAVKEAASKALGTGIACGVSFHDFTVKN-------DERGKPLLSLSGKANELA 99
>gi|15901533|ref|NP_346137.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae TIGR4] >gi|15903584|ref|NP_359134.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae R6] >gi|111657515|ref|ZP_01408258.1| hypothetical protein SpneT_02001281 [Streptococcus pneumoniae TIGR4] >gi|116515875|ref|YP_816965.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae D39] >gi|148984141|ref|ZP_01817436.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP3-BS71] >gi|148989350|ref|ZP_01820718.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP6-BS73] >gi|148994016|ref|ZP_01823372.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP9-BS68] >gi|148997752|ref|ZP_01825316.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP11-BS70] >gi|149001991|ref|ZP_01826945.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP14-BS69] >gi|149006638|ref|ZP_01830337.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP18-BS74] >gi|149011436|ref|ZP_01832683.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP19-BS75] >gi|168484890|ref|ZP_02709835.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1873-00] >gi|168488584|ref|ZP_02712783.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae SP195] >gi|168491419|ref|ZP_02715562.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC0288-04] >gi|168493603|ref|ZP_02717746.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC3059-06] >gi|169833456|ref|YP_001695075.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae Hungary19A-6] >gi|194398007|ref|YP_002038310.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae G54] >gi|122278189|sp|Q04J73.1|ACPS_STRP2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61217886|sp|P0A2W6|ACPS_STRPN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61217889|sp|P0A2W7|ACPS_STRR6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|10764422|gb|AAG22706.1| acyl carrier protein synthase; AcpS [Streptococcus pneumoniae] >gi|14973193|gb|AAK75777.1| holo-(acyl-carrier protein) synthase [Streptococcus pneumoniae TIGR4] >gi|15459205|gb|AAL00345.1| Acyl Carrier protein synthase [Streptococcus pneumoniae R6] >gi|116076451|gb|ABJ54171.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae D39] >gi|147756251|gb|EDK63293.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP11-BS70] >gi|147759800|gb|EDK66790.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP14-BS69] >gi|147761936|gb|EDK68899.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP18-BS74] >gi|147764426|gb|EDK71357.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP19-BS75] >gi|147923430|gb|EDK74543.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP3-BS71] >gi|147925100|gb|EDK76180.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP6-BS73] >gi|147927483|gb|EDK78511.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP9-BS68] >gi|168995958|gb|ACA36570.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae Hungary19A-6] >gi|172041955|gb|EDT50001.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1873-00] >gi|183572725|gb|EDT93253.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae SP195] >gi|183574238|gb|EDT94766.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC0288-04] >gi|183576263|gb|EDT96791.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC3059-06] >gi|194357674|gb|ACF56122.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae G54] (120 aa)
Score = 116, Expect = 8.1e-05, Identities = 38/114 (33%), Positives = 61/114 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GID+ E+   E    + +  FAKR+LT+ E   +  L K   +  +LA  WS KEA  KA+   I  L F  LE+   ++   Y  Q     ++ LS+S++   +TA  + ++
  S:     1 MIVGHGIDIEELASIESAVTRHEG-FAKRVLTAQEMERFTSL-KGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEE 116
>gi|15988400|pdb|1FTE|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) >gi|15988401|pdb|1FTE|B Chain B, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) >gi|15988402|pdb|1FTE|C Chain C, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) >gi|15988403|pdb|1FTF|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 2) >gi|15988404|pdb|1FTF|B Chain B, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 2) >gi|15988405|pdb|1FTF|C Chain C, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 2) >gi|15988406|pdb|1FTH|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (3'5'-Adp Complex) >gi|15988407|pdb|1FTH|B Chain B, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (3'5'-Adp Complex) >gi|15988408|pdb|1FTH|C Chain C, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (3'5'-Adp Complex) (122 aa)
Score = 116, Expect = 8.3e-05, Identities = 38/114 (33%), Positives = 61/114 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GID+ E+   E    + +  FAKR+LT+ E   +  L K   +  +LA  WS KEA  KA+   I  L F  LE+   ++   Y  Q     ++ LS+S++   +TA  + ++
  S:     3 MIVGHGIDIEELASIESAVTRHEG-FAKRVLTALEMERFTSL-KGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEE 118
>gi|194290148|ref|YP_002006055.1| holo-[acyl-carrier-protein] synthase; Holo-ACP synthase 4'-phosphopantetheinyl transferase acpS [Cupriavidus taiwanensis] >gi|193223983|emb|CAQ69992.1| holo-[acyl-carrier-protein] synthase; Holo-ACP synthase 4'-phosphopantetheinyl transferase acpS [Cupriavidus taiwanensis] (140 aa)
Score = 116, Expect = 8.6e-05, Identities = 26/67 (38%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           MI GIG D+++I R + +  +T+  FA+++L   E A Y   +  SEK   +FLA  ++ KEA  KA+ 
  S:     1 MIYGIGTDIIQIARVQGVMTRTNGRFAEKVLGPDELAKYHARKARSEKRGLAFLATRFAAKEAFSKAIG 69
>gi|77974719|ref|ZP_00830258.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Yersinia frederiksenii ATCC 33641] (126 aa)
Score = 116, Expect = 8.8e-05, Identities = 25/66 (37%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  +T    A+R+L+ +E+ HY   ++  +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEISRIEAVVERTGEKLARRILSPSEWQHY---QQHQQPIRFLAKRFAVKEAAAKAFG 65
>gi|152974080|ref|YP_001373597.1| holo-acyl-carrier-protein synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189027318|sp|A7GKE4.1|ACPS_BACCN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|152022832|gb|ABS20602.1| holo-acyl-carrier-protein synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] (119 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/84 (42%), Positives = 48/84 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQR 84
           MILGIGID++E+ R E++     N F +R+LT TE    AKL K      F+A  ++ KEA  KAV   I    S L+I  KN +
  S:     1 MILGIGIDIIELNRIEKMINGKLN-FIERILTETERDVAAKL-KGKRLVEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEIKNDQ 83
>gi|116515097|ref|YP_802726.1| hypothetical protein BCc_161 [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|122285507|sp|Q057R6.1|ACPS_BUCCC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116256951|gb|ABJ90633.1| holo-(acyl-carrier protein) synthase [Buchnera aphidicola str. Cc (Cinara cedri)] (126 aa)
Score = 115, Expect = 1.1e-04, Identities = 32/88 (36%), Positives = 47/88 (53%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQI 89
           I+GIGID++ I RF++L         K++L+  E   Y+   K   K  FLA+ +S+KEAI KA+         + I K N   NC+I
  S:     3 IIGIGIDVINIFRFKKLIINYGIKIPKKILSKKELIEYSYTHK---KEKFLAIRFSIKEAIAKAIG--------ISIFKNNFLNNCEI 79
>gi|33593097|ref|NP_880741.1| 4'-phosphopantetheinyl transferase [Bordetella pertussis Tohama I] >gi|81578526|sp|Q7VWV9|ACPS_BORPE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|33563472|emb|CAE42357.1| putative holo-[acyl-carrier protein] synthase [Bordetella pertussis Tohama I] (153 aa)
Score = 114, Expect = 1.4e-04, Identities = 29/66 (43%), Positives = 43/66 (65%)
  Q:     2 ILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHY-AKLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           I GIG+DL+ I+R E+ LAR  D  FA+++L   E A + A+ R+D  +   FLA  ++ KEA  KA+ 
  S:    18 IAGIGMDLLRIERIERALARHGDR-FAQKILGPKELAKFQARRRRDPARGVRFLATRFAAKEAFSKAIG 85
>gi|157964716|ref|YP_001499540.1| 4'-phosphopantetheinyl transferase [Rickettsia massiliae MTU5] >gi|166918338|sp|A8F257.1|ACPS_RICM5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157844492|gb|ABV84993.1| Holo-[acyl carrier protein] synthase [Rickettsia massiliae MTU5] (131 aa)
Score = 114, Expect = 1.4e-04, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++LTS E   +  L K    ++FLA  ++ KEA+ KA
  S:     1 MLIGVGTDIVQIPRIEKILHLYPELFAKKILTSQELKQFVLLGK-IHHAAFLAKRFAAKEAVSKA 64
>gi|77958585|ref|ZP_00822616.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Yersinia bercovieri ATCC 43970] (126 aa)
Score = 114, Expect = 1.4e-04, Identities = 24/64 (37%), Positives = 41/64 (64%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILG+G D+VEI R E +  ++ +  A+R+L+ +E+ HY   ++  +   FLA  +++KEA  KA
  S:     3 ILGLGTDIVEISRIEAVVERSGDRLARRILSPSEWQHY---QQHQQPIRFLAKRFAVKEAAAKA 63
>gi|77963378|ref|ZP_00827188.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Yersinia mollaretii ATCC 43969] (126 aa)
Score = 114, Expect = 1.5e-04, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++ +  A+R+L+ +E+ HY   ++  +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEISRIEAVVERSGDRLARRILSPSEWQHY---QQHQQPIRFLAKRFAVKEAAAKAFG 65
>gi|167472011|ref|ZP_02336715.1| 4'-phosphopantetheinyl transferase [Rickettsia africae ESF-5] (131 aa)
Score = 114, Expect = 1.5e-04, Identities = 25/65 (38%), Positives = 41/65 (63%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++L S E   +A L K +  ++FLA  ++ KEA+ KA
  S:     1 MLIGVGTDIVQIPRIEKILHLYPELFAKKILASKELKQFALLGKINH-AAFLAKRFAAKEAVSKA 64
>gi|33602320|ref|NP_889880.1| 4'-phosphopantetheinyl transferase [Bordetella bronchiseptica RB50] >gi|81579901|sp|Q7WH64|ACPS_BORBR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|33576759|emb|CAE33837.1| putative holo-[acyl-carrier protein] synthase [Bordetella bronchiseptica RB50] (153 aa)
Score = 114, Expect = 1.5e-04, Identities = 29/66 (43%), Positives = 43/66 (65%)
  Q:     2 ILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHY-AKLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           I GIG+DL+ I+R E+ LAR  D  FA+++L   E A + A+ R+D  +   FLA  ++ KEA  KA+ 
  S:    18 IAGIGMDLLRIERIERALARHGDR-FAQKILGPEELAKFHARRRRDPARGVRFLATRFAAKEAFSKAIG 85
>gi|33596391|ref|NP_884034.1| 4'-phosphopantetheinyl transferase [Bordetella parapertussis 12822] >gi|81579329|sp|Q7W9J6|ACPS_BORPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|33566160|emb|CAE37064.1| putative holo-[acyl-carrier protein] synthase [Bordetella parapertussis] (153 aa)
Score = 113, Expect = 1.7e-04, Identities = 29/66 (43%), Positives = 43/66 (65%)
  Q:     2 ILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHY-AKLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           I GIG+DL+ I+R E+ LAR  D  FA+++L   E A + A+ R+D  +   FLA  ++ KEA  KA+ 
  S:    18 IAGIGMDLLRIERIERALARHGDR-FAQKILGPEELAKFHARRRRDPARGVRFLATRFAAKEAFSKAIG 85
>gi|16123116|ref|NP_406429.1| 4'-phosphopantetheinyl transferase [Yersinia pestis CO92] >gi|22125201|ref|NP_668624.1| 4'-phosphopantetheinyl transferase [Yersinia pestis KIM] >gi|45442308|ref|NP_993847.1| 4'-phosphopantetheinyl transferase [Yersinia pestis biovar Microtus str. 91001] >gi|108808362|ref|YP_652278.1| 4'-phosphopantetheinyl transferase [Yersinia pestis Antiqua] >gi|108811373|ref|YP_647140.1| 4'-phosphopantetheinyl transferase [Yersinia pestis Nepal516] >gi|145598833|ref|YP_001162909.1| 4'-phosphopantetheinyl transferase [Yersinia pestis Pestoides F] >gi|149365384|ref|ZP_01887419.1| holo-[acyl-carrier protein] synthase [Yersinia pestis CA88-4125] >gi|162418600|ref|YP_001607939.1| 4'-phosphopantetheinyl transferase [Yersinia pestis Angola] >gi|165928229|ref|ZP_02224061.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939198|ref|ZP_02227748.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Orientalis str. IP275] >gi|166008172|ref|ZP_02229070.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212439|ref|ZP_02238474.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398453|ref|ZP_02303977.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421444|ref|ZP_02313197.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423546|ref|ZP_02315299.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167467710|ref|ZP_02332414.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis FV-1] >gi|122979496|sp|Q1C5D9.1|ACPS_YERPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|122980239|sp|Q1CKE0.1|ACPS_YERPN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198246|sp|A4TKX4.1|ACPS_YERPP Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|20137373|sp|Q8ZCP5|ACPS_YERPE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|21958066|gb|AAM84875.1|AE013732_7 CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Yersinia pestis KIM] >gi|45437172|gb|AAS62724.1| holo-[acyl-carrier protein] synthase [Yersinia pestis biovar Microtus str. 91001] >gi|108775021|gb|ABG17540.1| holo-(acyl-carrier protein) synthase [Yersinia pestis Nepal516] >gi|108780275|gb|ABG14333.1| holo-(acyl-carrier protein) synthase [Yersinia pestis Antiqua] >gi|115348595|emb|CAL21537.1| holo-[acyl-carrier protein] synthase [Yersinia pestis CO92] >gi|145210529|gb|ABP39936.1| holo-(acyl-carrier protein) synthase [Yersinia pestis Pestoides F] >gi|149291797|gb|EDM41871.1| holo-[acyl-carrier protein] synthase [Yersinia pestis CA88-4125] >gi|162351415|gb|ABX85363.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis Angola] >gi|165912798|gb|EDR31425.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Orientalis str. IP275] >gi|165919736|gb|EDR37069.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992554|gb|EDR44855.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206370|gb|EDR50850.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960933|gb|EDR56954.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050957|gb|EDR62365.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057716|gb|EDR67462.1| holo-(acyl-carrier-protein) synthase [Yersinia pestis biovar Mediaevalis str. K1973002] (126 aa)
Score = 113, Expect = 1.8e-04, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R + +  +T    A+R+L+ +E+ HY   ++  +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEISRIQAVVERTGERLARRILSPSEWQHY---QQHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|152995278|ref|YP_001340113.1| holo-acyl-carrier-protein synthase [Marinomonas sp. MWYL1] >gi|189027333|sp|A6VUP9.1|ACPS_MARMS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|150836202|gb|ABR70178.1| holo-acyl-carrier-protein synthase [Marinomonas sp. MWYL1] (127 aa)
Score = 113, Expect = 1.9e-04, Identities = 31/102 (30%), Positives = 52/102 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYS 102
           MI+G+G DLVEI R  Q   +    F  R+LT+ E   ++++    + +SF+A  ++ KEA  KA      L + + +    Q +N    P  + +L+V  S
  S:     1 MIIGVGTDLVEIARIAQSIERLGERFIDRILTAAEKERWSEISNLEKANSFVAKRFAAKEAAVKA------LGTGIGLGVSFQHFNVSNLPSGQPVLTVDES 96
>gi|56418763|ref|YP_146081.1| 4'-phosphopantetheinyl transferase [Geobacillus kaustophilus HTA426] >gi|61211382|sp|Q5L3G7|ACPS_GEOKA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56378605|dbj|BAD74513.1| holo-[acyl-carrier protein] synthase [Geobacillus kaustophilus HTA426] (129 aa)
Score = 113, Expect = 2.0e-04, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIGID+VE++R   L  ++   F +R+LT  E A + +L   + ++ FLA  ++ KEA  KA+ 
  S:     1 MIVGIGIDIVELERIRSLLERSRK-FPERILTPREKAQFGEL-PPARQAEFLAGRFAAKEAYAKALG 65
>gi|84390108|ref|ZP_00991370.1| 4'-phosphopantetheinyl transferase [Vibrio splendidus 12B01] >gi|84376762|gb|EAP93637.1| 4'-phosphopantetheinyl transferase [Vibrio splendidus 12B01] (126 aa)
Score = 113, Expect = 2.0e-04, Identities = 27/85 (31%), Positives = 50/85 (58%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN---HIKPLFSQLEITKKNQRYN 86
           ++G+G D+ EI+R E+   ++ + FA+R+LT +E+  + +L+   +K  +LA  ++ KEA  KA+     +   F   EI+  N  Y 
  S:     3 VVGLGTDIAEIERVEKALSRSGDAFAQRILTDSEFEVFQQLK---QKGRYLAKRFAAKEAASKALGTGIALGVTFHDFEIS--NDEYG 85
>gi|113868513|ref|YP_727002.1| 4'-phosphopantetheinyl transferase [Ralstonia eutropha H16] >gi|123329061|sp|Q0K8N7.1|ACPS_RALEH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|113527289|emb|CAJ93634.1| phosphopantetheinyl transferase [Ralstonia eutropha H16] (140 aa)
Score = 113, Expect = 2.2e-04, Identities = 24/67 (35%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           MI G+G D+++I R + +  +T+  FA+++L   E A Y   +  SEK   +FL+  ++ KEA  KA+ 
  S:     1 MIYGVGTDIIQIARVQGVMERTNGRFAEKVLGPDELAKYHARKARSEKRGLAFLSTRFAAKEAFSKAIG 69
>gi|146414682|ref|XP_001483311.1| hypothetical protein PGUG_04040 [Pichia guilliermondii ATCC 6260] >gi|146391784|gb|EDK39942.1| hypothetical protein PGUG_04040 [Pichia guilliermondii ATCC 6260] (135 aa)
Score = 113, Expect = 2.2e-04, Identities = 36/112 (32%), Positives = 63/112 (56%)
  Q:     2 ILGIGIDLVEIKRFEQL-ARQTDNCFAKRLLTST-----EYAHYAKLRKDS--EKSS-FLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKI---------ELLLSVSYSSNNITAICLAQ 113
           +LG G+D+V I+RF++L  +   + + KRL         E  H+  LR     EKS  +LA  W++KEAIYK+++       + +  +  + Y  +  P +         + L+SVS+    + A  + Q
  S:     3 VLGHGVDIVRIERFQRLVGKNPSDAYVKRLTRRIMHEVHEAPHFEALRAAGRFEKSVVYLAGTWAIKEAIYKSIDDADQ--KKFQFNRWYRVYGSRGQPIVGSDVFDKNQQFLVSVSHDGGTLIASVIRQ 130
>gi|153886574|ref|ZP_02007728.1| holo-acyl-carrier-protein synthase [Ralstonia pickettii 12D] >gi|151576748|gb|EDN41150.1| holo-acyl-carrier-protein synthase [Ralstonia pickettii 12D] (147 aa)
Score = 112, Expect = 2.3e-04, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+++I+R E + ++T+  FA+++L   E    H  K R +    +FLA  ++ KEA+ KA+ 
  S:    14 IYGIGTDIIQIERVEGVMQRTNGRFAEKVLGPDELRVYHARKARSERRGLAFLATRFAAKEAVSKAIG 81
>gi|77978404|ref|ZP_00833833.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Yersinia intermedia ATCC 29909] (126 aa)
Score = 112, Expect = 2.3e-04, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+ +E+ HY   ++  +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEISRIEAVVERSGEKLARRILSPSEWQHY---QQHQQPIRFLAKRFAVKEAAAKAFG 65
>gi|171920899|ref|ZP_02696188.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178926|ref|ZP_02555054.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188023992|ref|ZP_02569492.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039578|ref|ZP_02528722.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 8] >gi|188518238|ref|ZP_02555910.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524401|ref|ZP_02558180.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530960|ref|ZP_02546877.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188569196|ref|ZP_02829662.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 2] >gi|188592835|ref|ZP_02694998.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 10] >gi|195867883|ref|ZP_03079882.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903115|gb|EDT49404.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209189|gb|EDU06232.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019017|gb|EDU57057.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998168|gb|EDU67265.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659847|gb|EDX53227.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660460|gb|EDX53718.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (118 aa)
Score = 112, Expect = 2.4e-04, Identities = 41/103 (39%), Positives = 63/103 (61%)
  Q:     6 GIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITK-KNQR--YNCQIDPKIELLLSVSYSSNNITA 108
           GID++E  R E+L    +  FAKR+L   E  +Y +L    EK+ +LA  ++ KEA+ KA   +K  ++ + I K KN+R  Y  +I  K EL+LS+SY+ N + A
  S:     6 GIDIIEWNR-EEL---NNPSFAKRILVDDELKYYLQLNSLKEKNRYLASIFASKEAVMKAF-KLKYGYNDILILKTKNERQVYLNKILIK-ELVLSISYTENYVVA 105
>gi|187928027|ref|YP_001898514.1| holo-acyl-carrier-protein synthase [Ralstonia pickettii 12J] >gi|187724917|gb|ACD26082.1| holo-acyl-carrier-protein synthase [Ralstonia pickettii 12J] (147 aa)
Score = 112, Expect = 2.5e-04, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+++I+R E + ++T+  FA+++L   E    H  K R +    +FLA  ++ KEA+ KA+ 
  S:    14 IYGIGTDIIQIERVEGVMQRTNGRFAEKVLGPEELRVYHARKARSERRGLAFLATRFAAKEAVSKAIG 81
>gi|83748439|ref|ZP_00945461.1| Holo-[acyl-carrier protein] synthase [Ralstonia solanacearum UW551] >gi|83724850|gb|EAP72006.1| Holo-[acyl-carrier protein] synthase [Ralstonia solanacearum UW551] (147 aa)
Score = 112, Expect = 2.7e-04, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+++I+R E + ++T   FA+++L   E    H  K R +    +FLA  ++ KEA+ KA+ 
  S:    14 IYGIGTDIIQIERVEGVMQRTQGRFAEKVLGPDELRIYHARKARSERRGLAFLATRFAAKEAVSKAIG 81
>gi|149926464|ref|ZP_01914725.1| 4'-phosphopantetheinyl transferase [Limnobacter sp. MED105] >gi|149824827|gb|EDM84041.1| 4'-phosphopantetheinyl transferase [Limnobacter sp. MED105] (134 aa)
Score = 112, Expect = 2.7e-04, Identities = 27/66 (40%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSS-----FLAVHWSLKEAIYKAVN 67
           ILG+G D++E+ R E L R+  + F KR+LT+ E   Y    + S+KS+     F+A  +  KEA  KA+ 
  S:     5 ILGLGCDILEVDRLEGLLRKGRDVFIKRVLTTAEIDEY---ERRSDKSAIRGTLFVATRYCAKEAFSKAMG 72
>gi|27468593|ref|NP_765230.1| holo-ACP synthase [Staphylococcus epidermidis ATCC 12228] >gi|57867601|ref|YP_189249.1| holo-(acyl-carrier-protein) synthase [Staphylococcus epidermidis RP62A] >gi|29427694|sp|Q8CNK6|ACPS_STAES Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71152224|sp|Q5HME4|ACPS_STAEQ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|27316140|gb|AAO05274.1|AE016749_220 holo-ACP synthase [Staphylococcus epidermidis ATCC 12228] >gi|57638259|gb|AAW55047.1| holo-(acyl-carrier-protein) synthase [Staphylococcus epidermidis RP62A] (117 aa)
Score = 111, Expect = 3.1e-04, Identities = 27/67 (40%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIGIDL+EI+R + L  QT   F +R+LT  E     +   +  +  FLA  +++KEA  KA+ 
  S:     1 MIYGIGIDLIEIERIKNLQNQTK--FIERILTIEERDKLNQYTHEQRRLEFLAGRFTVKEAFSKALG 65
>gi|16077529|ref|NP_388343.1| 4'-phosphopantetheinyl transferase [Bacillus subtilis subsp. subtilis str. 168] >gi|6225000|sp|P96618|ACPS_BACSU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|1881272|dbj|BAA19299.1| ydcB [Bacillus subtilis] >gi|2632762|emb|CAB12269.1| holo-acyl carrier protein synthase [Bacillus subtilis subsp. subtilis str. 168] (121 aa)
Score = 111, Expect = 3.1e-04, Identities = 27/67 (40%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+D+ E+KR   +A +    FA+R+LT +E   Y +L  +  K+ FLA  ++ KEA  KA  
  S:     1 MIYGIGLDITELKRIASMAGRQKR-FAERILTRSELDQYYEL-SEKRKNEFLAGRFAAKEAFSKAFG 65
>gi|121728975|ref|ZP_01681979.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae V52] >gi|147675265|ref|YP_001217959.1| 4'-phosphopantetheinyl transferase [Vibrio cholerae O395] >gi|172047580|sp|A5F5H4.1|ACPS_VIBC3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|121628741|gb|EAX61208.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae V52] >gi|146317148|gb|ABQ21687.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae O395] (126 aa)
Score = 111, Expect = 3.2e-04, Identities = 27/67 (40%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G D+ EI+R E+ LAR  +N FA+R+LT +E   +       ++  FLA  ++ KEA  KA+ 
  S:     1 MIVGLGTDIAEIERVEKALARSGEN-FARRILTDSELEQF---HASKQQGRFLAKRFAAKEAASKALG 64
>gi|153803084|ref|ZP_01957670.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-3] >gi|124121366|gb|EAY40109.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-3] >gi|150422429|gb|EDN14388.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae AM-19226] (126 aa)
Score = 111, Expect = 3.4e-04, Identities = 27/67 (40%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G D+ EI+R E+ LAR  +N FA+R+LT +E   +       ++  FLA  ++ KEA  KA+ 
  S:     1 MIVGLGTDIAEIERVEKALARSGEN-FARRILTDSELEQF---HASKQQGRFLAKRFAAKEAASKALG 64
>gi|15642453|ref|NP_232086.1| 4'-phosphopantetheinyl transferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121590990|ref|ZP_01678309.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 2740-80] >gi|153214508|ref|ZP_01949417.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 1587] >gi|153222469|ref|ZP_01953203.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MAK 757] >gi|153819823|ref|ZP_01972490.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae NCTC 8457] >gi|153826900|ref|ZP_01979567.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-2] >gi|153830870|ref|ZP_01983537.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 623-39] >gi|194531115|ref|YP_002066630.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MO10] >gi|20137515|sp|Q9KPB6|ACPS_VIBCH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|9657035|gb|AAF95599.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547167|gb|EAX57296.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 2740-80] >gi|124115310|gb|EAY34130.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 1587] >gi|124118906|gb|EAY37649.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MAK 757] >gi|125617475|gb|EAZ46039.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MO10] >gi|125621214|gb|EAZ49555.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae V51] >gi|126509642|gb|EAZ72236.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae NCTC 8457] >gi|148873639|gb|EDL71774.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 623-39] >gi|149739263|gb|EDM53525.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-2] (126 aa)
Score = 111, Expect = 3.4e-04, Identities = 27/67 (40%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G D+ EI+R E+ LAR  +N FA+R+LT +E   +       ++  FLA  ++ KEA  KA+ 
  S:     1 MIVGLGTDIAEIERVEKALARSGEN-FARRILTDSELEQF---HASKQQGRFLAKRFAAKEAASKALG 64
>gi|70725961|ref|YP_252875.1| holo-ACP synthase [Staphylococcus haemolyticus JCSC1435] >gi|90111952|sp|Q4L7V6|ACPS_STAHJ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|68446685|dbj|BAE04269.1| holo-ACP synthase [Staphylococcus haemolyticus JCSC1435] (119 aa)
Score = 111, Expect = 3.6e-04, Identities = 24/67 (35%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIGIDL+EI R ++   +  +   KR+LT  E   +   + +  K  FL+  ++ KEA  KA+ 
  S:     1 MIHGIGIDLIEIDRIKKAFEKQKDKLVKRILTQEEEQQFHSFKSEKRKLEFLSGRFATKEAFSKALG 67
>gi|167563522|ref|ZP_02356438.1| 4'-phosphopantetheinyl transferase [Burkholderia oklahomensis EO147] >gi|167570683|ref|ZP_02363557.1| 4'-phosphopantetheinyl transferase [Burkholderia oklahomensis C6786] (143 aa)
Score = 111, Expect = 3.6e-04, Identities = 25/66 (37%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DLV++ R   +  +TD  FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLVQVSRVAAVLERTDGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|116493288|ref|YP_805023.1| phosphopantetheinyl transferase (holo-ACP synthase) [Pediococcus pentosaceus ATCC 25745] >gi|122265248|sp|Q03DZ1.1|ACPS_PEDPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116103438|gb|ABJ68581.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Pediococcus pentosaceus ATCC 25745] (118 aa)
Score = 110, Expect = 3.9e-04, Identities = 35/106 (33%), Positives = 56/106 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKI-------ELLLSVSYSSNNI 106
           MI GIGID+  I RF+ L       F +++LT TE+  + + +K      FLA H+S+KE+  KA      L  +L        Y+    PKI        + +S+S+S +++
  S:     1 MIYGIGIDITNIDRFKTLHNPA--TFIQKVLTPTEFDEF-EAKKGQRAYEFLAGHFSVKESYSKAYG--TGLGKKLNFQDIEINYDGVGKPKIVKHPFSGTVHVSISHSDHHV 108
>gi|149021205|ref|ZP_01835451.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP23-BS72] >gi|147930306|gb|EDK81290.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP23-BS72] (120 aa)
Score = 110, Expect = 4.0e-04, Identities = 37/114 (32%), Positives = 60/114 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEI--TKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI+G GID+ E+   E    + +  FAKR+LT+ E   +  L K   +  +LA  WS KEA  KA+   I  L F  LE+   ++   Y  Q     ++ LS+S++   + A  + ++
  S:     1 MIVGHGIDIEELASIESAVTRHEG-FAKRVLTAQEMERFTSL-KGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVIASVILEE 116
>gi|86146355|ref|ZP_01064679.1| 4'-phosphopantetheinyl transferase [Vibrio sp. MED222] >gi|85835834|gb|EAQ53968.1| 4'-phosphopantetheinyl transferase [Vibrio sp. MED222] (126 aa)
Score = 110, Expect = 4.1e-04, Identities = 22/66 (33%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ++G+G D+ EI+R E+   ++   FA+R+LT +E+  + +L+   +K  +LA  ++ KEA  KA+ 
  S:     3 VVGLGTDIAEIERVEKALSRSGEAFAQRILTDSEFEVFQQLK---QKGRYLAKRFAAKEAASKALG 65
>gi|149192071|ref|ZP_01870296.1| 4'-phosphopantetheinyl transferase [Vibrio shilonii AK1] >gi|148834096|gb|EDL51108.1| 4'-phosphopantetheinyl transferase [Vibrio shilonii AK1] (126 aa)
Score = 110, Expect = 4.2e-04, Identities = 23/66 (34%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I G+G D+ EI+R E+   ++   FA+R+LT  E   + +L+   ++  FLA  +++KEA  KA+ 
  S:     3 IQGLGTDIAEIERVEKALARSGEAFAQRILTDNELVQFQQLK---QQGRFLAKRFAVKEAASKALG 65
>gi|187735702|ref|YP_001877814.1| holo-acyl-carrier-protein synthase [Akkermansia muciniphila ATCC BAA-835] >gi|187425754|gb|ACD05033.1| holo-acyl-carrier-protein synthase [Akkermansia muciniphila ATCC BAA-835] (128 aa)
Score = 110, Expect = 4.2e-04, Identities = 26/81 (32%), Positives = 46/81 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN---HIKPLFSQLEITKKN 82
           I G+G+DL +++R  Q  R+    FA R+ T  E+A+    RK ++    LA  ++ KEA+ KA+      K  F+ +E+ + +
  S:     4 IAGLGMDLADMERVRQALRKNGEAFALRICTPDEWAY---CRKHADPVPHLAARFAAKEAVAKALGTGIGAKCAFTDVEVVRGD 84
>gi|171324879|ref|ZP_02913390.1| holo-acyl-carrier-protein synthase [Geobacillus sp. WCH70] >gi|171089154|gb|EDT35488.1| holo-acyl-carrier-protein synthase [Geobacillus sp. WCH70] (119 aa)
Score = 110, Expect = 4.3e-04, Identities = 28/67 (41%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIGID+VE++R EQL  + +  F  R+LT  E   + +L     K  FLA  ++ KEA  KA+ 
  S:     1 MIIGIGIDIVELERIEQLMMKNEK-FIDRILTEEEKRIFFQL-SPKRKVEFLAGRFAAKEAYAKAIG 65
>gi|28899342|ref|NP_798947.1| 4'-phosphopantetheinyl transferase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839831|ref|ZP_01992498.1| holo-(acyl-carrier-protein) synthase [Vibrio parahaemolyticus AQ3810] >gi|31076608|sp|Q87LP3|ACPS_VIBPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|28807578|dbj|BAC60831.1| holo-(acyl-carrier-protein) synthase [Vibrio parahaemolyticus RIMD 2210633] >gi|149746648|gb|EDM57636.1| holo-(acyl-carrier-protein) synthase [Vibrio parahaemolyticus AQ3810] (126 aa)
Score = 110, Expect = 4.4e-04, Identities = 23/66 (34%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+ EI+R E+   ++   FA+R+L+  E A +++L+   ++  +LA  ++ KEA  KA+ 
  S:     3 ILGLGTDIAEIERIEKALGRSGEPFAQRILSEDEMAKFSQLK---QQGRYLAKRFAAKEAASKALG 65
>gi|156932894|ref|YP_001436810.1| 4'-phosphopantetheinyl transferase [Enterobacter sakazakii ATCC BAA-894] >gi|166198199|sp|A7MH03.1|ACPS_ENTS8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|156531148|gb|ABU75974.1| hypothetical protein ESA_00696 [Enterobacter sakazakii ATCC BAA-894] (126 aa)
Score = 109, Expect = 5.0e-04, Identities = 25/66 (37%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++ +  AKR+L++ E+A Y   +   +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIDRIEAVISRSGDRLAKRVLSANEWAQY---QAHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|94502131|ref|ZP_01308632.1| 4'-phosphopantetheinyl transferase [Oceanobacter sp. RED65] >gi|94425733|gb|EAT10740.1| 4'-phosphopantetheinyl transferase [Oceanobacter sp. RED65] (127 aa)
Score = 109, Expect = 5.2e-04, Identities = 27/79 (34%), Positives = 44/79 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNH--IKPL-FSQLEIT 79
           M + IG D+VEI+R  Q+ ++       R+LT +E   +  +  D  + ++LA  W  KEA+ KA+     K L F  +E+T
  S:     1 MTIAIGTDIVEIERIYQVYQRQGEKLVNRVLTPSEQERFYSMINDDVRMAYLAKRWCAKEAVSKAMGTGIAKGLGFQDIEVT 82
>gi|169829736|ref|YP_001699894.1| Holo-[acyl-carrier-protein] synthase [Lysinibacillus sphaericus C3-41] >gi|168994224|gb|ACA41764.1| Holo-[acyl-carrier-protein] synthase [Lysinibacillus sphaericus C3-41] (139 aa)
Score = 109, Expect = 5.6e-04, Identities = 29/67 (43%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTE---YAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+D+VEI R E+  ++TD  F  R+LT+ E   +  Y++ R    K  FLA  ++ KEA  KA+ 
  S:    23 MIKGIGLDIVEIDRIEKAMKRTDK-FKDRILTTREKILFDSYSETR----KVEFLAGRFAAKEAFSKAMG 87
>gi|163789885|ref|ZP_02184321.1| 4'-phosphopantetheinyl transferase [Carnobacterium sp. AT7] >gi|159874825|gb|EDP68893.1| 4'-phosphopantetheinyl transferase [Carnobacterium sp. AT7] (116 aa)
Score = 109, Expect = 5.8e-04, Identities = 33/82 (40%), Positives = 50/82 (60%)
  Q:     1 MILGIGIDLVEIKRFEQ--LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKN 82
           MI+GIG+D+ EI R ++  L R+T   F+ R+LT  E   +++L K + +  FLA  ++ KEA  KA+   I  L F  +EI   N
  S:     1 MIVGIGLDIAEITRIKEAYLKRET---FSSRVLTPAEMEIFSRL-KGNRQMEFLAGRYAAKEAFSKAMGTGIGKLGFQDIEIIPDN 82
>gi|15604430|ref|NP_220948.1| 4'-phosphopantetheinyl transferase [Rickettsia prowazekii str. Madrid E] >gi|6225003|sp|Q9ZCX5|ACPS_RICPR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|3861124|emb|CAA15024.1| HOLO-[ACYL-CARRIER PROTEIN] SYNTHASE (acpS) [Rickettsia prowazekii] (126 aa)
Score = 108, Expect = 6.4e-04, Identities = 24/65 (36%), Positives = 39/65 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M++G+G D+V+I R E++       FAK++L   E   +  L K +  ++FLA  +S KEA+ KA
  S:     1 MLIGVGTDIVQIPRIEKILNIYQELFAKKILALKELKQFTLLNK-TNHATFLAKRFSAKEAVSKA 64
>gi|123441367|ref|YP_001005354.1| 4'-phosphopantetheinyl transferase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166198245|sp|A1JKK7.1|ACPS_YERE8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|122088328|emb|CAL11119.1| holo-[acyl-carrier protein] synthase [Yersinia enterocolitica subsp. enterocolitica 8081] (126 aa)
Score = 108, Expect = 6.5e-04, Identities = 23/66 (34%), Positives = 39/66 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+VEI R E +  ++    A+R+L+  E+ HY   ++  +   FLA  +++KEA  KA  
  S:     3 IIGLGTDIVEISRIEAVVERSGEKLARRILSPAEWQHY---QQHQQPIRFLAKRFAVKEAAAKAFG 65
>gi|189425584|ref|YP_001952761.1| holo-acyl-carrier-protein synthase [Geobacter lovleyi SZ] >gi|189421843|gb|ACD96241.1| holo-acyl-carrier-protein synthase [Geobacter lovleyi SZ] (126 aa)
Score = 108, Expect = 6.9e-04, Identities = 27/67 (40%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIGID VEI RF++   + +     RL    E   Y + RK  + +S LA  ++ KEA  KA+ 
  S:     1 MILGIGIDTVEISRFQRFLDEDNQALLNRLFAPAEQ-EYCRPRK--QAASCLAARFAAKEAFVKALG 64
>gi|89099492|ref|ZP_01172368.1| 4'-phosphopantetheinyl transferase [Bacillus sp. NRRL B-14911] >gi|89085878|gb|EAR65003.1| 4'-phosphopantetheinyl transferase [Bacillus sp. NRRL B-14911] (125 aa)
Score = 108, Expect = 7.2e-04, Identities = 44/117 (37%), Positives = 62/117 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKA-VNHIKPLFSQLEITKKNQRYNCQIDPKIE---LLLSVSYS-SNNITAICLAQQTPW 117
           +I GIGID+VEI+R  ++A +    F++R+LT  E A Y  L   SEK    F+A  ++ KEA  KA    I    S  +I   N R       K E   L LS+S+S S  +  + +A   P 
  S:     4 VIEGIGIDIVEIERISRMANRAK--FSERILTEGELAKYITL---SEKRQLEFIAGRFAAKEAFSKANGTGIGSELSFQDIEISNDRKGKPFFSKPEREGLHLSISHSESYAVAQVVIATPLPG 122
>gi|148244710|ref|YP_001219404.1| holo-[acyl-carrier protein] synthase [Candidatus Vesicomyosocius okutanii HA] >gi|189027355|sp|A5CWJ8.1|ACPS_VESOH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|146326537|dbj|BAF61680.1| holo-[acyl-carrier protein] synthase [Candidatus Vesicomyosocius okutanii HA] (127 aa)
Score = 108, Expect = 7.2e-04, Identities = 26/67 (38%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+G+D+V I+R E++  +    F KR+L+  E   +AK + DS  S++ A  +S KEA  KA+ 
  S:     1 MIYGVGVDIVNIERVERILSKNKEGFVKRVLSEYEQVLFAK-KGDS--STYCAKRFSAKEAFAKALG 64
>gi|17545786|ref|NP_519188.1| 4'-phosphopantetheinyl transferase [Ralstonia solanacearum GMI1000] >gi|20137360|sp|Q8Y0H7|ACPS_RALSO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|17428080|emb|CAD14769.1| probable holo-[acyl-carrier-protein] synthase (holo-acp synthase)(4'-phosphopantetheinyl transferase acps). [Ralstonia solanacearum] (138 aa)
Score = 108, Expect = 7.4e-04, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           I GIG D+++I+R E + ++T   FA+++L   E   Y   +  SE+   +FLA  ++ KEA+ KA+ 
  S:     5 IYGIGTDIIQIERVEGVMQRTHGRFAEKVLGPDELRIYQARKARSERRGLAFLATRFAAKEAVSKAIG 72
>gi|118400976|ref|XP_001032809.1| phosphopantethiene--protein transferase domain containing protein [Tetrahymena thermophila SB210] >gi|89287154|gb|EAR85146.1| phosphopantethiene--protein transferase domain containing protein [Tetrahymena thermophila SB210] (130 aa)
Score = 107, Expect = 8.4e-04, Identities = 26/79 (32%), Positives = 43/79 (54%)
  Q:     2 ILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITK 80
           I GIG D+V  +R  + L   T + F  ++L   E   + +   + ++S +LA  W+ KEAI KA    + +F Q+ +TK
  S:     4 IFGIGTDIVSNQRMMKILQGTTRDRFLNKVLNKIEIEEFNQKSTEEQQSQYLASRWAFKEAIVKASGRRELIFPQMYLTK 83
>gi|15616867|ref|NP_240080.1| holo-[acyl-carrier protein] synthase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131242|sp|P57344|ACPS_BUCAI Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|25304172|pir||F84959 holo-[acyl-carrier-protein] synthase (EC 2.7.8.7) [imported] - Buchnera sp. (strain APS) >gi|10038931|dbj|BAB12966.1| holo-[acyl-carrier protein] synthase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (126 aa)
Score = 107, Expect = 8.4e-04, Identities = 38/95 (40%), Positives = 54/95 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA----VNHIKPLFSQLEITKKNQRYNCQIDPKIELL 96
           I+GIGID VEI R + +  +  + FA+++L++ E+  Y  L  DS   SFLA  +  KEA  KA    +NH +  F+QLE  K     N    PK+  L
  S:     3 IIGIGIDFVEILRIKNIFLKYGDKFARKILSTEEWKKYI-LIDDS--ISFLAKKFVAKEAASKALGTGINH-QITFNQLEFYK-----NKSGKPKLRFL 92
>gi|194563826|ref|YP_002098849.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Burkholderia dolosa AUO158] >gi|124895450|gb|EAY69330.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Burkholderia dolosa AUO158] (142 aa)
Score = 107, Expect = 8.8e-04, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T   FA+++L   E    H  + R D+   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDVVQVSRVAAVLERTGGRFAEKVLGPDELRVFHARRARSDARGIAFLATRFSAKEAFSKAIG 70
>gi|55821699|ref|YP_140141.1| 4'-phosphopantetheinyl transferase [Streptococcus thermophilus LMG 18311] >gi|55823620|ref|YP_142061.1| 4'-phosphopantetheinyl transferase [Streptococcus thermophilus CNRZ1066] >gi|81558969|sp|Q5LY70|ACPS_STRT1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|81560158|sp|Q5M2S6|ACPS_STRT2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|55737684|gb|AAV61326.1| holo-(acyl carrier protein) synthase [Streptococcus thermophilus LMG 18311] >gi|55739605|gb|AAV63246.1| holo-(acyl carrier protein) synthase [Streptococcus thermophilus CNRZ1066] (119 aa)
Score = 107, Expect = 9.8e-04, Identities = 37/115 (32%), Positives = 60/115 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIE--LLLSVSYSSNNITAICLAQQT 115
           MI G GIDL EI   ++ A   +  FAK++LT  E+  +  L  + + S FLA  W+ KEA  KA    I  + F  +EI   ++          E  + +S+S+S + + A  + ++T
  S:     1 MIFGHGIDLQEISAVKK-AYDRNPRFAKKVLTPKEWERFESLSGERQMS-FLAGRWAGKEAFSKAWGTGIGAVGFKDIEILNNDKGAPVVTQSPFEGNVFISISHSGDFVQASVILEKT 117
>gi|13357954|ref|NP_078228.1| holo-acyl carrier protein synthase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762431|ref|YP_001752476.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920477|ref|ZP_02690346.2| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508629|ref|ZP_02689191.2| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701738|ref|ZP_02553919.2| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189027354|sp|B1AJ32.1|ACPS_UREP2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|20137541|sp|Q9PQ97|ACPS_UREPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|11356865|pir||G82895 holo-acyl carrier protein synthase UU393 [imported] - Ureaplasma urealyticum >gi|6899379|gb|AAF30803.1|AE002137_2 holo-acyl carrier protein synthase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828008|gb|ACA33270.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902935|gb|EDT49224.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676088|gb|EDT87993.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701008|gb|EDU19290.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 6 str. ATCC 27818] (115 aa)
Score = 107, Expect = 9.8e-04, Identities = 41/103 (39%), Positives = 60/103 (58%)
  Q:     6 GIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITK-KNQR--YNCQIDPKIELLLSVSYSSNNITA 108
           GID++E  R E+L    +  FAKR+L   E  +Y +L    EK  +LA  ++ KEA+ KA+  +K  +  + I K +NQR  Y  +I  K EL LS+SY+   I A
  S:     6 GIDIIEWNR-EEL---NNPLFAKRILIDNELEYYFQLNSSREKKRYLASVFACKEAVMKAL-KLKYGYGDILILKTENQRQVYLNKILIK-ELELSISYTETYIVA 105
>gi|150019684|ref|YP_001311938.1| holo-acyl-carrier-protein synthase [Clostridium beijerinckii NCIMB 8052] >gi|189027324|sp|A6M302.1|ACPS_CLOB8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|149906149|gb|ABR36982.1| holo-acyl-carrier-protein synthase [Clostridium beijerinckii NCIMB 8052] (123 aa)
Score = 107, Expect = 1.1e-03, Identities = 28/67 (41%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG D++EI R E+ A Q  N F +R  T  E A++ KL+    K + +A +++ KEAI KA+ 
  S:     1 MIIGIGTDIIEISRIER-AIQRTNTFIERSFTCNEIAYF-KLK--GFKGNVVAGNFAAKEAISKAIG 63
>gi|194683226|emb|CAR43907.1| holo-[acyl-carrier protein] synthase [Proteus mirabilis HI4320] (126 aa)
Score = 106, Expect = 1.1e-03, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+GIG+D+VEI R E++  ++    A+R+LT  E+  Y   +   +   FLA  +++KEA  KA+ 
  S:     3 IVGIGMDIVEISRIEEIIGRSGERLARRILTDNEWIIY---QSHKQPVRFLAKRFAVKEAAAKALG 65
>gi|15672825|ref|NP_266999.1| acyl carrier protein synthase [Lactococcus lactis subsp. lactis Il1403] >gi|13878322|sp|Q9CH95|ACPS_LACLA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|12723769|gb|AAK04941.1|AE006318_4 acyl carrier protein synthase [Lactococcus lactis subsp. lactis Il1403] (119 aa)
Score = 106, Expect = 1.1e-03, Identities = 22/65 (33%), Positives = 38/65 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M+ G G+D VE+ R ++   +++  F +++LT+ E   Y   +  + K+ FLA  W+ KEA  KA
  S:     1 MVFGTGVDNVELSRIQKALTRSER-FVEQVLTAVELEKYNSFQSTARKTEFLAGRWAAKEAFSKA 64
>gi|116511663|ref|YP_808879.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactococcus lactis subsp. cremoris SK11] >gi|125624500|ref|YP_001032983.1| holo-[acyl-carrier protein] synthase [Lactococcus lactis subsp. cremoris MG1363] >gi|123125696|sp|Q030B5.1|ACPS_LACLS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198203|sp|A2RLV5.1|ACPS_LACLM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116107317|gb|ABJ72457.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactococcus lactis subsp. cremoris SK11] >gi|124493308|emb|CAL98278.1| holo-[acyl-carrier protein] synthase [Lactococcus lactis subsp. cremoris MG1363] (119 aa)
Score = 106, Expect = 1.2e-03, Identities = 22/65 (33%), Positives = 38/65 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           M+ G G+D VE+ R ++   +++  F +++LT+ E   Y   +  + K+ FLA  W+ KEA  KA
  S:     1 MVFGTGVDNVELSRIQKALTRSER-FVEQVLTTMELEKYNNFQSTARKTEFLAGRWAAKEAFSKA 64
>gi|20137474|sp|Q9FCV3|ACPS_LACRE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) (117 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/65 (43%), Positives = 36/65 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIGID+  I RF+ L   T   F K++LT  E A  A  +       FLA H+S+KE+  KA
  S:     1 MIYGIGIDITNIDRFKALHNPT--SFIKKVLTDKEQAELAG-KSGQRAYEFLAGHFSVKESYSKA 62
>gi|9798536|emb|CAC03496.1| hypothetical protein [Lactobacillus reuteri] (137 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/65 (43%), Positives = 36/65 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIGID+  I RF+ L   T   F K++LT  E A  A  +       FLA H+S+KE+  KA
  S:    21 MIYGIGIDITNIDRFKALHNPT--SFIKKVLTDKEQAELAG-KSGQRAYEFLAGHFSVKESYSKA 82
>gi|88604337|ref|YP_504515.1| phosphopantethiene-protein transferase domain-contain protein [Methanospirillum hungatei JF-1] >gi|88189799|gb|ABD42796.1| phosphopantethiene--protein transferase domain [Methanospirillum hungatei JF-1] (127 aa)
Score = 106, Expect = 1.3e-03, Identities = 37/112 (33%), Positives = 60/112 (53%)
  Q:     3 LGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA-----VNHIKPLFSQLEITKK-----NQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           +GIG D+ EI+RFE    +    F ++  T  E  +   + KD+  +  LA  ++ KEA+ KA     V HI   +  +EI        N R N   +  + + LS+S+SS+   A C+ Q+
  S:     9 IGIGTDIEEIRRFENFQERQFRVFLEKNYTKPELEYC--MSKDA-PAPHLAARYAGKEAVIKALYSLNVTHI--FYPAIEIINNESGVPNVRINSNENENLRIKLSLSHSSSMALAFCIIQK 125
>gi|149178951|ref|ZP_01857528.1| acyl-carrier protein synthase [Planctomyces maris DSM 8797] >gi|148842225|gb|EDL56611.1| acyl-carrier protein synthase [Planctomyces maris DSM 8797] (128 aa)
Score = 106, Expect = 1.3e-03, Identities = 37/113 (32%), Positives = 63/113 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYK--AVNHIKPL-FSQLE------------ITKKNQRYNCQIDPKIELLLSVSYSSN--NITAICLAQ 113
           MI+G+G D+VEI R  Q+  +  + F  R+ T  E   Y   +K+ E+    A  W+ KEA+ K      IK + + ++E            I+   +R+  ++    E+L+++S+S      TAI L Q
  S:     1 MIVGLGTDIVEISRIGQMIERHGDTFLNRVFTENENT-YCGSKKNKEQ--HYAGRWAAKEAVMKTLGTGFIKGIGWKEIEVINLQSGKPTIVISGGVERHAGEMGIS-EILITISHSREFATATAIALGQ 126
>gi|148981903|ref|ZP_01816561.1| 4'-phosphopantetheinyl transferase [Vibrionales bacterium SWAT-3] >gi|145960704|gb|EDK26046.1| 4'-phosphopantetheinyl transferase [Vibrionales bacterium SWAT-3] (126 aa)
Score = 106, Expect = 1.4e-03, Identities = 22/66 (33%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ++G+G D+ EI+R E+   ++   FA R+LT +E+  + +L+   +K  +LA  ++ KEA  KA+ 
  S:     3 VVGLGTDIAEIERVEKALSRSGEAFALRILTESEFEVFQQLK---QKGRYLAKRFAAKEAASKALG 65
>gi|94989167|ref|YP_597268.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS9429] >gi|94993057|ref|YP_601156.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS2096] >gi|123257720|sp|Q1JA49.1|ACPS_STRPB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|123258140|sp|Q1JK99.1|ACPS_STRPC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|94542675|gb|ABF32724.1| holo-(acyl-carrier protein) synthase [Streptococcus pyogenes MGAS9429] >gi|94546565|gb|ABF36612.1| holo-synthase [Streptococcus pyogenes MGAS2096] (118 aa)
Score = 105, Expect = 1.5e-03, Identities = 41/108 (37%), Positives = 57/108 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIEL----LLSVSYSSNNITA 108
           MI+G GIDL EI   E++  Q +  FA+++LT  E A +        + S+LA  WS KEA  KA+   I  L F  +EI   N    C I  K        +S+S+S N + A
  S:     1 MIVGHGIDLQEISAIEKVY-QRNPRFAQKILTEQELAIFESF-PYKRRLSYLAGRWSGKEAFVKAIGTGIGRLTFQDIEIL--NDVRGCPILTKSPFKGNSFISISHSGNYVQA 110
>gi|126651488|ref|ZP_01723692.1| hypothetical protein BB14905_07389 [Bacillus sp. B14905] >gi|126591741|gb|EAZ85837.1| hypothetical protein BB14905_07389 [Bacillus sp. B14905] (139 aa)
Score = 105, Expect = 1.5e-03, Identities = 28/67 (41%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTE---YAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+D+VEI R E+  ++TD  F  R+L++ E   +  Y++ R    K  FLA  ++ KEA  KA+ 
  S:    23 MIKGIGLDIVEIDRIEKAMKRTDK-FKDRILSTREKKIFDGYSETR----KIEFLAGRFAAKEAFSKAMG 87
>gi|169350454|ref|ZP_02867392.1| hypothetical protein CLOSPI_01222 [Clostridium spiroforme DSM 1552] >gi|169292774|gb|EDS74907.1| hypothetical protein CLOSPI_01222 [Clostridium spiroforme DSM 1552] (110 aa)
Score = 105, Expect = 1.6e-03, Identities = 28/78 (35%), Positives = 43/78 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPL--FSQLEI 78
           MI GIG D+V++ R      +    FA ++LT  E+  Y   + D +K  FL   ++ KEA +KAV   + L  F+ +EI
  S:     1 MIKGIGCDIVDLNRLNDCLDE----FACKILTFKEFEIYRNKKTDKQKREFLGGRFAGKEAFFKAVGIEEKLVSFNDVEI 76
>gi|19746745|ref|NP_607881.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS8232] >gi|21911100|ref|NP_665368.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS315] >gi|28895215|ref|NP_801565.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes SSI-1] >gi|50914871|ref|YP_060843.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS10394] >gi|56808268|ref|ZP_00366036.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus pyogenes M49 591] >gi|94991110|ref|YP_599210.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS10270] >gi|94994988|ref|YP_603086.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS10750] >gi|139473189|ref|YP_001127904.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes str. Manfredo] >gi|166198236|sp|Q1JF93.1|ACPS_STRPD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198237|sp|Q1J544.1|ACPS_STRPF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198238|sp|A2RCT2.1|ACPS_STRPG Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54036695|sp|P63474|ACPS_STRP8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54040679|sp|P63473|ACPS_STRP3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797666|sp|Q5XAA3|ACPS_STRP6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|19748974|gb|AAL98380.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes MGAS8232] >gi|21905310|gb|AAM80171.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes MGAS315] >gi|28810461|dbj|BAC63398.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes SSI-1] >gi|50903945|gb|AAT87660.1| Holo-[acyl-carrier protein] synthase [Streptococcus pyogenes MGAS10394] >gi|94544618|gb|ABF34666.1| holo-synthase [Streptococcus pyogenes MGAS10270] >gi|94548496|gb|ABF38542.1| holo-synthase [Streptococcus pyogenes MGAS10750] >gi|134271435|emb|CAM29655.1| holo-[acyl-carrier protein] synthase [Streptococcus pyogenes str. Manfredo] (118 aa)
Score = 105, Expect = 1.7e-03, Identities = 41/108 (37%), Positives = 57/108 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIEL----LLSVSYSSNNITA 108
           MI+G GIDL EI   E++  Q +  FA+++LT  E A +        + S+LA  WS KEA  KA+   I  L F  +EI   N    C I  K        +S+S+S N + A
  S:     1 MIVGHGIDLQEISAIEKVY-QRNPRFAQKILTEQELAIFESF-PYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEIL--NDVRGCPILTKSPFKGNSFISISHSGNYVQA 110
>gi|14719535|pdb|1F7L|A Chain A, Holo-(Acyl Carrier Protein) Synthase In Complex With Coenzyme A At 1.5a (121 aa)
Score = 105, Expect = 1.8e-03, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG+D+ E+KR   +A +    FA+R+LT +E   Y +L  +  K+ FLA  ++ KEA  KA  
  S:     2 IYGIGLDITELKRIASMAGRQKR-FAERILTRSELDQYYEL-SEKRKNEFLAGRFAAKEAFSKAFG 65
>gi|14719536|pdb|1F7T|A Chain A, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719537|pdb|1F7T|B Chain B, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719538|pdb|1F7T|C Chain C, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719539|pdb|1F7T|D Chain D, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719540|pdb|1F7T|E Chain E, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719541|pdb|1F7T|F Chain F, Holo-(Acyl Carrier Protein) Synthase At 1.8a (122 aa)
Score = 105, Expect = 1.8e-03, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG+D+ E+KR   +A +    FA+R+LT +E   Y +L  +  K+ FLA  ++ KEA  KA  
  S:     3 IYGIGLDITELKRIASMAGRQKR-FAERILTRSELDQYYEL-SEKRKNEFLAGRFAAKEAFSKAFG 66
>gi|89094546|ref|ZP_01167484.1| holo-(acyl-carrier protein) synthase [Oceanospirillum sp. MED92] >gi|89081145|gb|EAR60379.1| holo-(acyl-carrier protein) synthase [Oceanospirillum sp. MED92] (123 aa)
Score = 104, Expect = 2.1e-03, Identities = 27/67 (40%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+++I R     ++T    A+R+LTS E A +    K ++++ FLA  +S KEAI KA+ 
  S:     1 MIKGIGTDILQISRMATSLQRTPR-LAERILTSAELALF---EKTTDRARFLAKRFSAKEAIVKALG 63
>gi|42779351|ref|NP_976598.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus ATCC 10987] >gi|166984386|ref|ZP_02255737.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus AH187] >gi|168162567|ref|ZP_02597800.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus H3081.97] >gi|59797814|sp|Q73ET8|ACPS_BACC1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|42735266|gb|AAS39206.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus ATCC 10987] (119 aa)
Score = 104, Expect = 2.1e-03, Identities = 32/83 (38%), Positives = 48/83 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQ 83
           MI+GIGID++E+ R E++       F +R+LT +E  + AK  K S  + F+A  ++ KEA  KAV   I    S L+I  +N 
  S:     1 MIVGIGIDIIELNRIEKMI-DGKLKFMERILTESER-NVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRND 82
>gi|149183249|ref|ZP_01861693.1| 4'-phosphopantetheinyl transferase [Bacillus sp. SG-1] >gi|148849045|gb|EDL63251.1| 4'-phosphopantetheinyl transferase [Bacillus sp. SG-1] (118 aa)
Score = 104, Expect = 2.2e-03, Identities = 25/53 (47%), Positives = 32/53 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLA 53
           MI GIG+D+VEIKR  QL  +    F +R+LT  E  HY+ L K   +  FLA
  S:     1 MIKGIGLDIVEIKRIAQLTERRPK-FIRRVLTEAEIDHYSTL-KGGRRYEFLA 51
>gi|91227848|ref|ZP_01262021.1| 4'-phosphopantetheinyl transferase [Vibrio alginolyticus 12G01] >gi|91188358|gb|EAS74654.1| 4'-phosphopantetheinyl transferase [Vibrio alginolyticus 12G01] (126 aa)
Score = 104, Expect = 2.3e-03, Identities = 22/66 (33%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ EI+R E+   ++   FA+R+L+  E A +++L+    +  +LA  +++KEA  KA+ 
  S:     3 IIGLGTDIAEIERIEKALARSGEPFAQRILSEEEMAKFSQLKL---QGRYLAKRFAVKEAASKALG 65
>gi|85059761|ref|YP_455463.1| 4'-phosphopantetheinyl transferase [Sodalis glossinidius str. 'morsitans'] >gi|123519064|sp|Q2NS17.1|ACPS_SODGM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|84780281|dbj|BAE75058.1| holo-(acyl-carrier protein) synthase [Sodalis glossinidius str. 'morsitans'] (126 aa)
Score = 104, Expect = 2.3e-03, Identities = 27/77 (35%), Positives = 48/77 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKP--LFSQLEI 78
           I+GIG D+VEI R E +  ++ +  A+R+L+  E+  Y   ++ ++   FLA  +++KEA  KA+   I+    F+Q E+
  S:     3 IVGIGTDIVEIGRIEAVVSRSGDRLARRILSPDEWRQY---QQHNQLVRFLAKRFAVKEAASKALGTGIRDGLAFTQFEV 79
>gi|47567487|ref|ZP_00238199.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus G9241] >gi|47555889|gb|EAL14228.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus G9241] (119 aa)
Score = 103, Expect = 2.5e-03, Identities = 32/83 (38%), Positives = 48/83 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQ 83
           MI+GIGID++E+ R E++       F +R+LT +E  + AK  K S  + F+A  ++ KEA  KAV   I    S L+I  +N 
  S:     1 MIVGIGIDIIELNRIEKML-DGKLKFMERILTESER-NVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRND 82
>gi|14719507|pdb|1F80|A Chain A, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) >gi|14719508|pdb|1F80|B Chain B, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) >gi|14719509|pdb|1F80|C Chain C, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) (120 aa)
Score = 103, Expect = 2.7e-03, Identities = 25/64 (39%), Positives = 39/64 (60%)
  Q:     4 GIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           GIG+D+ E+KR   +A +    FA+R+LT +E   Y +L  ++ K+ FLA  ++ KEA  KA  
  S:     3 GIGLDITELKRIASMAGRQKR-FAERILTRSELDQYYEL-SEARKNEFLAGRFAAKEAFSKAFG 64
>gi|71894122|ref|YP_278230.1| holo-acyl-carrier protein synthase [Mycoplasma synoviae 53] (95 aa)
Score = 103, Expect = 2.7e-03, Identities = 30/105 (28%), Positives = 55/105 (52%)
  Q:     9 LVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQ 113
           +V I RF+   ++    F +RLL+  E   + KL  +  K  FLA  W++KEAI+KA N     F+++ + K N  +N +        +S+S+ ++ + A  + +
  S:     1 MVTISRFKNKNKE----FIERLLSEEELVEFNKLDNEESKELFLARSWAIKEAIFKADNSYFK-FNKINLIKINNEWNFK-----NFKISISHENDLLIAFVIKE 95
>gi|71023577|ref|XP_762018.1| hypothetical protein UM05871.1 [Ustilago maydis 521] >gi|46101583|gb|EAK86816.1| hypothetical protein UM05871.1 [Ustilago maydis 521] (954 aa)
Score = 103, Expect = 2.7e-03, Identities = 30/65 (46%), Positives = 43/65 (66%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTD-------------------------NCFAKRLLTSTEYAHYAKLRKDSEKSS--------FLAVHWSLKEAIYKAV 66
           ILGIGID++ + R  QLA++                           N  AKR+L  +E+  Y  L +   ++S        F+A  WS KEA YKA+
  S:   557 ILGIGIDILHVPRLRQLAQRRKCLSNDVSAGANECSKGHRIGELAALNKLAKRILCESEWEEYHDLAQSQSETSATYTHLEQFIANRWSAKEAAYKAL 654
>gi|148543491|ref|YP_001270861.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri F275] >gi|184152899|ref|YP_001841240.1| holo-[acyl-carrier protein] synthase [Lactobacillus reuteri F275] >gi|166918337|sp|A5VI50.1|ACPS_LACRF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|148530525|gb|ABQ82524.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri F275] >gi|183224243|dbj|BAG24760.1| holo-[acyl-carrier protein] synthase [Lactobacillus reuteri F275] (120 aa)
Score = 103, Expect = 3.0e-03, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIGID+ EI+R ++ A    + F + +LT TE   Y++         +LA  WSLKE+  KA
  S:     1 MIKGIGIDITEIERVKKAAT-AHSQFIQHVLTPTELEQYSQF-SGQRSVEYLAGRWSLKESFAKA 63
>gi|170699583|ref|ZP_02890623.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria IOP40-10] >gi|172060073|ref|YP_001807725.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria MC40-6] >gi|170135534|gb|EDT03822.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria IOP40-10] >gi|171992590|gb|ACB63509.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria MC40-6] (146 aa)
Score = 103, Expect = 3.0e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V+I R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDVVQISRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|161525336|ref|YP_001580348.1| 4'-phosphopantetheinyl transferase [Burkholderia multivorans ATCC 17616] >gi|189349927|ref|YP_001945555.1| holo-[acyl-carrier protein] synthase [Burkholderia multivorans ATCC 17616] >gi|160342765|gb|ABX15851.1| holo-acyl-carrier-protein synthase [Burkholderia multivorans ATCC 17616] >gi|189333949|dbj|BAG43019.1| holo-[acyl-carrier protein] synthase [Burkholderia multivorans ATCC 17616] (146 aa)
Score = 103, Expect = 3.1e-03, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIVQVSRVAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|37527212|ref|NP_930556.1| 4'-phosphopantetheinyl transferase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|59797834|sp|Q7N1X9|ACPS_PHOLL Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|36786646|emb|CAE15710.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Photorhabdus luminescens subsp. laumondii TTO1] (126 aa)
Score = 102, Expect = 3.3e-03, Identities = 23/66 (34%), Positives = 39/66 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+VEI R E +  ++    AKR+L+  E+  Y   ++  +   FLA  +++KEA  KA+ 
  S:     3 IIGLGTDIVEIARIEGVVERSGERLAKRILSELEWEQY---QQHEKPVRFLAKRFAVKEAAAKALG 65
>gi|115351068|ref|YP_772907.1| 4'-phosphopantetheinyl transferase [Burkholderia ambifaria AMMD] >gi|122323652|sp|Q0BH00.1|ACPS_BURCM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|115281056|gb|ABI86573.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria AMMD] (146 aa)
Score = 102, Expect = 3.4e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V+I R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDVVQISRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|119774021|ref|YP_926761.1| Holo-(acyl-carrier-protein) synthase [Shewanella amazonensis SB2B] >gi|166198226|sp|A1S3Y5.1|ACPS_SHEAM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|119766521|gb|ABL99091.1| Holo-(acyl-carrier-protein) synthase [Shewanella amazonensis SB2B] (125 aa)
Score = 102, Expect = 3.4e-03, Identities = 26/66 (39%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFE-QLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           +LG+G D+VEI+R   QL R  D   AKR+LT +E A +       ++  +LA  ++ KEA+ KA+ 
  S:     3 VLGLGTDIVEIERIRSQLERGGDR-LAKRILTESELAIFV---GSGQRELYLAKRFAAKEAVAKALG 65
>gi|116628422|ref|YP_821041.1| 4'-phosphopantetheinyl transferase [Streptococcus thermophilus LMD-9] >gi|122266983|sp|Q03IX7.1|ACPS_STRTD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116101699|gb|ABJ66845.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus thermophilus LMD-9] (119 aa)
Score = 102, Expect = 3.5e-03, Identities = 36/114 (31%), Positives = 59/114 (51%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIE--LLLSVSYSSNNITAICLAQQ 114
           MI G GIDL EI   ++ A   +  FAK++LT  E+  +  L  + + S FLA  W+ KEA  KA    I  + F  +EI   ++          E  + +S+S+S + + A  + ++
  S:     1 MIFGHGIDLQEISAVKK-AYDRNPRFAKKVLTPKEWERFESLSGERQMS-FLAGRWAGKEAFSKAWGTGIGAVGFKDIEILNNDKGAPVVTQSPFEGNVFISISHSGDFVQASVILEK 116
>gi|171854178|emb|CAM12172.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Candidatus Phytoplasma australiense] (124 aa)
Score = 102, Expect = 3.6e-03, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           +  IGIDLVEIK+ +++  Q     A R+L+S E   +        + +FL   W+ KEA++KA+
  S:     3 VQNIGIDLVEIKKIQKIGIQ---VIATRILSSQEKKIFLTFCNQERQLTFLGGRWAAKEALFKAL 64
>gi|71904185|ref|YP_280988.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS6180] >gi|90111955|sp|Q48RM7|ACPS_STRPM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71803280|gb|AAX72633.1| holo-[acyl-carrier protein] synthase [Streptococcus pyogenes MGAS6180] (118 aa)
Score = 102, Expect = 3.7e-03, Identities = 40/108 (37%), Positives = 57/108 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIEL----LLSVSYSSNNITA 108
           MI+G GIDL EI   E++  Q +  FA+++LT  E A +        + S+LA  W+ KEA  KA+   I  L F  +EI   N    C I  K        +S+S+S N + A
  S:     1 MIVGHGIDLQEISAIEKV-YQRNPRFAQKILTEQELAIFESF-PYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEIL--NDVRGCPILTKSPFKGNSFISISHSGNYVQA 110
>gi|30260426|ref|NP_842803.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Ames] >gi|47525507|ref|YP_016856.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183269|ref|YP_026521.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Sterne] >gi|49480319|ref|YP_034577.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65317678|ref|ZP_00390637.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Bacillus anthracis str. A2012] >gi|118475998|ref|YP_893149.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis str. Al Hakam] >gi|165871559|ref|ZP_02216205.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0488] >gi|166995276|ref|ZP_02261736.1| holo- [Bacillus cereus AH820] >gi|167634179|ref|ZP_02392501.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0442] >gi|167640318|ref|ZP_02398583.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0193] >gi|170687791|ref|ZP_02879006.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0465] >gi|170707834|ref|ZP_02898284.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0389] >gi|177653365|ref|ZP_02935575.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0174] >gi|190567415|ref|ZP_03020329.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis Tsiankovskii-I] >gi|196036030|ref|ZP_03103431.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus W] >gi|196041134|ref|ZP_03108430.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus NVH0597-99] >gi|196046246|ref|ZP_03113473.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus 03BB108] >gi|166198174|sp|A0R8U9.1|ACPS_BACAH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797763|sp|Q6HPE3|ACPS_BACHK Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61211622|sp|Q81JG3|ACPS_BACAN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|30253747|gb|AAP24289.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Ames] >gi|47500655|gb|AAT29331.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177196|gb|AAT52572.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Sterne] >gi|49331875|gb|AAT62521.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118415223|gb|ABK83642.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis str. Al Hakam] >gi|164712663|gb|EDR18194.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0488] >gi|167511720|gb|EDR87101.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0193] >gi|167530493|gb|EDR93208.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0442] >gi|170127192|gb|EDS96069.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0389] >gi|170668318|gb|EDT19066.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0465] >gi|172081405|gb|EDT66478.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0174] >gi|190561542|gb|EDV15513.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis Tsiankovskii-I] >gi|195991399|gb|EDX55366.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus W] >gi|196022991|gb|EDX61671.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus 03BB108] >gi|196028069|gb|EDX66680.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus NVH0597-99] (119 aa)
Score = 102, Expect = 3.8e-03, Identities = 32/83 (38%), Positives = 47/83 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQ 83
           MI+GIGID++E+ R E++       F +R+LT  E  + AK  K S  + F+A  ++ KEA  KAV   I    S L+I  +N 
  S:     1 MIVGIGIDIIELNRIEKML-DGKLKFMERILTENER-NVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRND 82
>gi|148284513|ref|YP_001248603.1| 4'-phosphopantetheinyl transferase [Orientia tsutsugamushi str. Boryong] >gi|166198214|sp|A5CDM0.1|ACPS_ORITB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|146739952|emb|CAM79984.1| Holo-[acyl carrier protein] synthase [Orientia tsutsugamushi Boryong] (131 aa)
Score = 102, Expect = 3.9e-03, Identities = 23/67 (34%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D++ I R EQL  +    F  R+L   E   Y  L    ++++F+A  ++ KE++ KA+ 
  S:     1 MIYGIGTDIIHIPRIEQLINKYSTKFINRILGKNEITIYQSLSI-KQQTNFVAKRFAGKESVAKAIG 66
>gi|52144991|ref|YP_081839.1| holo-[acyl-carrier protein] synthase [Bacillus cereus E33L] >gi|59797688|sp|Q63GX2|ACPS_BACCZ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|51978460|gb|AAU20010.1| holo-[acyl-carrier protein] synthase [Bacillus cereus E33L] (119 aa)
Score = 102, Expect = 4.0e-03, Identities = 32/83 (38%), Positives = 47/83 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQ 83
           MI+GIGID++E+ R E++       F +R+LT  E  + AK  K S  + F+A  ++ KEA  KAV   I    S L+I  +N 
  S:     1 MIVGIGIDIIELNRIEKML-DGKLKFMERILTENER-NVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRND 82
>gi|167586637|ref|ZP_02379025.1| holo-acyl-carrier-protein synthase [Burkholderia ubonensis Bu] (144 aa)
Score = 102, Expect = 4.1e-03, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIVQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|186475610|ref|YP_001857080.1| holo-acyl-carrier-protein synthase [Burkholderia phymatum STM815] >gi|184192069|gb|ACC70034.1| holo-acyl-carrier-protein synthase [Burkholderia phymatum STM815] (135 aa)
Score = 101, Expect = 4.2e-03, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   + ++T+  FA+++L   E    H    R  +   +FLA  +S+KEA  KA+ 
  S:     3 IYGIGTDIVQVSRVAAVMQRTNGRFAEKVLGPDELRVYHARHARSQARGLAFLATRFSVKEAFSKAIG 70
>gi|157371900|ref|YP_001479889.1| 4'-phosphopantetheinyl transferase [Serratia proteamaculans 568] >gi|166918339|sp|A8GI21.1|ACPS_SERP5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157323664|gb|ABV42761.1| holo-acyl-carrier-protein synthase [Serratia proteamaculans 568] (126 aa)
Score = 101, Expect = 4.4e-03, Identities = 21/64 (32%), Positives = 40/64 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           +LG+G D+VE+ R E +  ++ +  A+R+L+  E+  Y   ++  +   FLA  +++KEA+ KA
  S:     3 VLGLGTDIVEMARIEAVVERSGDRLARRVLSEAEWELY---QQHQQPVRFLAKRFAVKEAVAKA 63
>gi|110801975|ref|YP_697611.1| 4'-phosphopantetheinyl transferase [Clostridium perfringens SM101] >gi|123342038|sp|Q0SW89.1|ACPS_CLOPS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|110682476|gb|ABG85846.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens SM101] (133 aa)
Score = 101, Expect = 4.4e-03, Identities = 24/66 (36%), Positives = 38/66 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           MI+GIG+D++EI R  Q  R   N F  +L T  E  ++     +SE    +A +++ KEA+ KA+
  S:     1 MIIGIGVDIIEIGRVRQAIRNNKN-FLSKLFTEREIDYFISRNMNSE---VIAGNFAAKEAVSKAL 62
>gi|116495992|ref|YP_807726.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus casei ATCC 334] >gi|191639472|ref|YP_001988638.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4-phosphopantetheinyl transferase acpS) [Lactobacillus casei] >gi|122262608|sp|Q034T8.1|ACPS_LACC3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116106142|gb|ABJ71284.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus casei ATCC 334] >gi|190713774|emb|CAQ67780.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4-phosphopantetheinyl transferase acpS) [Lactobacillus casei BL23] (124 aa)
Score = 101, Expect = 4.5e-03, Identities = 25/67 (37%), Positives = 43/67 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           MI GIG+D+ ++ R  Q A++ ++ FA ++LT TE A+Y +L  D  ++  +L+  +S KE+  KA  
  S:     1 MIYGIGVDVTDLARI-QAAQEKNSGFAVKILTPTELANYQQL--DGRRAVEYLSGRFSAKESYSKAFG 65
>gi|189183167|ref|YP_001936952.1| holo-[acyl carrier protein] synthase [Orientia tsutsugamushi str. Ikeda] >gi|189179938|dbj|BAG39718.1| holo-[acyl carrier protein] synthase [Orientia tsutsugamushi str. Ikeda] (131 aa)
Score = 101, Expect = 4.6e-03, Identities = 23/67 (34%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D++ I R EQL  +    F  R+L   E   Y  L    ++++F+A  ++ KE++ KA+ 
  S:     1 MIYGIGTDIIHIPRIEQLINKYSTKFINRILGKNEITIYQSLSI-KQQTNFVAKRFAGKESVAKAIG 66
>gi|15675638|ref|NP_269812.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes M1 GAS] >gi|71911346|ref|YP_282896.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS5005] >gi|20137444|sp|Q99Y97|ACPS_STRP1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|13622848|gb|AAK34533.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes M1 GAS] >gi|71854128|gb|AAZ52151.1| holo-[acyl-carrier protein] synthase [Streptococcus pyogenes MGAS5005] (118 aa)
Score = 101, Expect = 4.9e-03, Identities = 40/108 (37%), Positives = 57/108 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIEL----LLSVSYSSNNITA 108
           MI+G GIDL EI   E++  Q +  FA+++LT  E A +        + ++LA  WS KEA  KA+   I  L F  +EI   N    C I  K        +S+S+S N + A
  S:     1 MIVGHGIDLQEISAIEKVY-QRNPRFAQKILTEQELAIFESF-PYKRRLNYLAGRWSGKEAFAKAIGTGIGRLTFQDIEIL--NDVRGCPILTKSPFKGNSFISISHSGNYVQA 110
>gi|168185664|ref|ZP_02620299.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum C str. Eklund] >gi|169296207|gb|EDS78340.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum C str. Eklund] (138 aa)
Score = 101, Expect = 5.0e-03, Identities = 32/80 (40%), Positives = 46/80 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTE--YAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV--NHIKPLFSQLEITK 80
           MI+GIG D+VEI R  +   +T N F  +L T+TE  Y    K+R +     F+A  ++ KEA+ KA+     K  F  +EI K
  S:     1 MIIGIGTDIVEIDRINRAIERTPN-FVSKLFTTTEIKYLISRKMRPE-----FVAGKFAAKEAVAKALGTGFRKFRFRDIEINK 78
>gi|73662115|ref|YP_300896.1| phosphopantetheinyl transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90111953|sp|Q49Z25|ACPS_STAS1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|72494630|dbj|BAE17951.1| phosphopantetheinyl transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (116 aa)
Score = 101, Expect = 5.0e-03, Identities = 24/67 (35%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+DL+EI R + L ++       R+LT  E   + +   +  K  FLA  ++ KEA  KA+ 
  S:     1 MIHGIGVDLIEISRIKNLYKRQSK-LVDRILTINEQHKFNQFNNEQRKMEFLAGRFATKEAFSKALG 66
>gi|18309273|ref|NP_561207.1| 4'-phosphopantetheinyl transferase [Clostridium perfringens str. 13] >gi|20137357|sp|Q8XNP1|ACPS_CLOPE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|18143949|dbj|BAB79997.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens str. 13] (133 aa)
Score = 101, Expect = 5.3e-03, Identities = 28/80 (35%), Positives = 47/80 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITK 80
           MI+GIG+D++EI+R  Q A Q +  F  +L T  E  ++     +SE    +A +++ KEA+ KA+   I+   F  +EI +
  S:     1 MIIGIGVDIIEIERVRQ-AIQNNKNFLSKLFTERELDYFISRNMNSE---VIAGNFAAKEAVSKALGTGIRGFSFKDIEILR 78
>gi|168207447|ref|ZP_02633452.1| holo- synthase [Clostridium perfringens E str. JGS1987] >gi|168210404|ref|ZP_02636029.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens B str. ATCC 3626] >gi|168216620|ref|ZP_02642245.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens NCTC 8239] >gi|169344075|ref|ZP_02865061.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens C str. JGS1495] >gi|182626835|ref|ZP_02954572.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens D str. JGS1721] >gi|169297810|gb|EDS79907.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens C str. JGS1495] >gi|170661192|gb|EDT13875.1| holo- synthase [Clostridium perfringens E str. JGS1987] >gi|170711500|gb|EDT23682.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens B str. ATCC 3626] >gi|177907844|gb|EDT70444.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens D str. JGS1721] >gi|182381373|gb|EDT78852.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens NCTC 8239] (133 aa)
Score = 101, Expect = 5.3e-03, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           MI+GIG+D++EI+R  Q A Q +  F  +L T  E  ++     +SE    +A +++ KEA+ KA+
  S:     1 MIIGIGVDIIEIERVRQ-AIQNNKNFLSKLFTEREIDYFISRNMNSE---VIAGNFAAKEAVSKAL 62
>gi|110799665|ref|YP_694747.1| 4'-phosphopantetheinyl transferase [Clostridium perfringens ATCC 13124] >gi|168212790|ref|ZP_02638415.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens CPE str. F4969] >gi|122959100|sp|Q0TUE3.1|ACPS_CLOP1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|110674312|gb|ABG83299.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens ATCC 13124] >gi|170715784|gb|EDT27966.1| holo-(acyl-carrier-protein) synthase [Clostridium perfringens CPE str. F4969] (133 aa)
Score = 101, Expect = 5.4e-03, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           MI+GIG+D++EI+R  Q A Q +  F  +L T  E  ++     +SE    +A +++ KEA+ KA+
  S:     1 MIIGIGVDIIEIERVRQ-AIQNNKNFLSKLFTEREIDYFISRNMNSE---VIAGNFAAKEAVSKAL 62
>gi|76579634|gb|ABA49109.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 1710b] (324 aa)
Score = 100, Expect = 6.0e-03, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:   184 IYGIGTDLAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 251
>gi|27364938|ref|NP_760466.1| 4'-phosphopantetheinyl transferase [Vibrio vulnificus CMCP6] >gi|29427706|sp|Q8DC72|ACPS_VIBVU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|27361084|gb|AAO09993.1|AE016802_36 Phosphopantetheinyl transferase [Vibrio vulnificus CMCP6] (126 aa)
Score = 100, Expect = 6.1e-03, Identities = 22/66 (33%), Positives = 40/66 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ EI+R E+   ++   FA+R+L++ E   +  L+   ++  FLA  ++ KEA  KA+ 
  S:     3 IVGLGTDIAEIERVEKALARSGVAFAERILSAQEMETFVSLK---QQGRFLAKRFAAKEAASKALG 65
>gi|124520609|ref|ZP_01695737.1| Phosphopantethiene-protein transferase [Bacillus coagulans 36D1] >gi|124497470|gb|EAY45029.1| Phosphopantethiene-protein transferase [Bacillus coagulans 36D1] (116 aa)
Score = 100, Expect = 6.1e-03, Identities = 27/67 (40%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIGID+VE++R ++L  +    F  R+LT  E   + KL  +  K  FLA  ++ KEA  KA  
  S:     1 MIKGIGIDIVELERIKKLYERQPR-FPGRILTKAEQQKFCKL-TEKRKIEFLAGRFAAKEAYSKAFG 65
>gi|90412090|ref|ZP_01220097.1| 4'-phosphopantetheinyl transferase [Photobacterium profundum 3TCK] >gi|90327068|gb|EAS43447.1| 4'-phosphopantetheinyl transferase [Photobacterium profundum 3TCK] (126 aa)
Score = 100, Expect = 6.2e-03, Identities = 22/66 (33%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ +I+R E++  ++ + FA+R+L  +E   Y  L+    K+ +LA  +++KEA  KA+ 
  S:     3 IIGLGTDIADIERVERVFARSGDTFAERILAPSELEIYHSLKL---KARYLAKRFAVKEAASKALG 65
>gi|134295168|ref|YP_001118903.1| 4'-phosphopantetheinyl transferase [Burkholderia vietnamiensis G4] >gi|166198185|sp|A4JCR5.1|ACPS_BURVG Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|134138325|gb|ABO54068.1| holo-acyl-carrier-protein synthase [Burkholderia vietnamiensis G4] (145 aa)
Score = 100, Expect = 6.3e-03, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIVQLSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|89053011|ref|YP_508462.1| 4'-phosphopantetheinyl transferase [Jannaschia sp. CCS1] >gi|123401415|sp|Q28V25.1|ACPS_JANSC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|88862560|gb|ABD53437.1| holo-(acyl-carrier-protein) synthase [Jannaschia sp. CCS1] (150 aa)
Score = 100, Expect = 6.3e-03, Identities = 24/67 (35%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R E    +  + F  R+ T  E A   ++    E ++  A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIEGTLERFGDRFRNRVFTDREQARAERM---PEPAAVYAKRWAAKEACSKALG 64
>gi|69935297|ref|ZP_00630277.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Paracoccus denitrificans PD1222] >gi|119383175|ref|YP_914231.1| 4'-phosphopantetheinyl transferase [Paracoccus denitrificans PD1222] >gi|166198215|sp|A1AZ41.1|ACPS_PARDP Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|119372942|gb|ABL68535.1| holo-acyl-carrier-protein synthase [Paracoccus denitrificans PD1222] (139 aa)
Score = 100, Expect = 6.3e-03, Identities = 25/67 (37%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R   +  +  + F +R+ T TE A   + R    +++ LA  W+ KEA  KA+ 
  S:     1 MILGIGSDLCNIDRIAGVLERHGDRFRRRVFTETELALAGRRR---HEAATLAKRWAAKEACSKALG 64
>gi|126438641|ref|YP_001059796.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 668] >gi|166198184|sp|A3NBS5.1|ACPS_BURP6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|126218134|gb|ABN81640.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 668] (143 aa)
Score = 100, Expect = 6.4e-03, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|83718999|ref|YP_442269.1| 4'-phosphopantetheinyl transferase [Burkholderia thailandensis E264] >gi|167619240|ref|ZP_02387871.1| 4'-phosphopantetheinyl transferase [Burkholderia thailandensis Bt4] >gi|123537168|sp|Q2SXT0.1|ACPS_BURTA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|83652824|gb|ABC36887.1| holo-(acyl-carrier-protein) synthase [Burkholderia thailandensis E264] (143 aa)
Score = 100, Expect = 6.4e-03, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|33519985|ref|NP_878817.1| holo-[acyl-carrier protein] synthase [Candidatus Blochmannia floridanus] >gi|61211615|sp|Q7VRR2|ACPS_BLOFL Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|33504331|emb|CAD83224.1| holo-[acyl-carrier protein] synthase [Candidatus Blochmannia floridanus] (125 aa)
Score = 100, Expect = 6.5e-03, Identities = 30/78 (38%), Positives = 45/78 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA-HYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKP---LFSQLEI 78
           MI GIGID+VEI R +++  ++ +  AKR+L  +E   +Y+K         FL+  ++ KEA+ KA          FSQ EI
  S:     1 MIYGIGIDIVEINRIKKIVIRSGDKLAKRILRKSELKLYYSK----EYPVRFLSKRFAAKEAVLKAFGTGMSQGITFSQFEI 78
>gi|53720031|ref|YP_109017.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei K96243] >gi|53725347|ref|YP_102343.1| 4'-phosphopantetheinyl transferase [Burkholderia mallei ATCC 23344] >gi|67641140|ref|ZP_00439925.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Burkholderia mallei GB8 horse 4] >gi|121600518|ref|YP_993766.1| 4'-phosphopantetheinyl transferase [Burkholderia mallei SAVP1] >gi|124386005|ref|YP_001028768.1| 4'-phosphopantetheinyl transferase [Burkholderia mallei NCTC 10229] >gi|126450408|ref|YP_001081324.1| 4'-phosphopantetheinyl transferase [Burkholderia mallei NCTC 10247] >gi|134277060|ref|ZP_01763775.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 305] >gi|167000783|ref|ZP_02266590.1| 4'-phosphopantetheinyl transferase [Burkholderia mallei PRL-20] >gi|167720554|ref|ZP_02403790.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei DM98] >gi|167816748|ref|ZP_02448428.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 91] >gi|167825155|ref|ZP_02456626.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 9] >gi|167895239|ref|ZP_02482641.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 7894] >gi|167903623|ref|ZP_02490828.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei NCTC 13177] >gi|167911872|ref|ZP_02498963.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 112] >gi|167919869|ref|ZP_02506960.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei BCC215] >gi|194313142|ref|YP_002009095.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei ATCC 10399] >gi|194501702|ref|YP_002031281.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 1655] >gi|194516828|ref|YP_002052417.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei S13] >gi|194524822|ref|YP_002060352.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei FMH] >gi|194528976|ref|YP_002064497.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei JHU] >gi|194574585|ref|YP_002109469.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei 2002721280] >gi|166198180|sp|A3MM38.1|ACPS_BURM7 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198181|sp|A2S9Z9.1|ACPS_BURM9 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198182|sp|A1V6B3.1|ACPS_BURMS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61211431|sp|Q62LS6|ACPS_BURMA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61211438|sp|Q63S99|ACPS_BURPS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|52210445|emb|CAH36428.1| putative holo-[acyl-carrier protein] synthase [Burkholderia pseudomallei K96243] >gi|52428770|gb|AAU49363.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei ATCC 23344] >gi|121229328|gb|ABM51846.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei SAVP1] >gi|124294025|gb|ABN03294.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei NCTC 10229] >gi|126243278|gb|ABO06371.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei NCTC 10247] >gi|134250710|gb|EBA50789.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 305] >gi|147748832|gb|EDK55906.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei FMH] >gi|147752986|gb|EDK60051.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei JHU] >gi|148026837|gb|EDK84858.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei 2002721280] >gi|160698518|gb|EDP88488.1| holo-(acyl-carrier-protein) synthase [Burkholderia mallei ATCC 10399] >gi|169652483|gb|EDS85176.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei S13] >gi|184214745|gb|EDU11788.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 1655] (143 aa)
Score = 100, Expect = 6.5e-03, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|167581155|ref|ZP_02374029.1| 4'-phosphopantetheinyl transferase [Burkholderia thailandensis TXDOH] (143 aa)
Score = 100, Expect = 6.5e-03, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|126454063|ref|YP_001067083.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 1106a] >gi|161357547|ref|ZP_02103422.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 1106b] >gi|161375052|ref|ZP_02114592.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 1710a] >gi|162210069|ref|YP_334272.2| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 1710b] >gi|167739547|ref|ZP_02412321.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei 14] >gi|167846652|ref|ZP_02472160.1| 4'-phosphopantetheinyl transferase [Burkholderia pseudomallei B7210] >gi|194507638|ref|YP_002020175.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei Pasteur 52237] >gi|194570392|ref|YP_002105392.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 406e] >gi|166198183|sp|A3NXL2.1|ACPS_BURP0 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|126227705|gb|ABN91245.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 1106a] >gi|157807071|gb|EDO84241.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei 406e] >gi|157938921|gb|EDO94591.1| holo-(acyl-carrier-protein) synthase [Burkholderia pseudomallei Pasteur 52237] (143 aa)
Score = 100, Expect = 6.7e-03, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|183599773|ref|ZP_02961266.1| hypothetical protein PROSTU_03280 [Providencia stuartii ATCC 25827] >gi|188022036|gb|EDU60076.1| hypothetical protein PROSTU_03280 [Providencia stuartii ATCC 25827] (127 aa)
Score = 99, Expect = 7.2e-03, Identities = 24/66 (36%), Positives = 43/66 (65%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+VEI R E + +++ +  AKR+LT  E+A + +    ++ + FLA  +++KEA  KA+ 
  S:     3 IVGLGTDIVEIARIEAVIKRSADSLAKRILTENEFAQFQQQ---AQPARFLAKRFAVKEAAAKALG 65
>gi|138893879|ref|YP_001124332.1| 4'-phosphopantetheinyl transferase [Geobacillus thermodenitrificans NG80-2] >gi|196250547|ref|ZP_03149237.1| holo-acyl-carrier-protein synthase [Geobacillus sp. G11MC16] >gi|166198200|sp|A4IJT3.1|ACPS_GEOTN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|134265392|gb|ABO65587.1| Holo-(acyl carrier protein) synthase [Geobacillus thermodenitrificans NG80-2] >gi|196209896|gb|EDY04665.1| holo-acyl-carrier-protein synthase [Geobacillus sp. G11MC16] (129 aa)
Score = 99, Expect = 8.4e-03, Identities = 25/67 (37%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIGID+VE++R + L  + +  F  R+LT  E   + +L   + +  FLA  ++ KEA  KA+ 
  S:     1 MIVGIGIDIVELERIQSLL-ERNRKFLDRILTPREREQFDQL-APARQVEFLAGRFAAKEAYAKALG 65
>gi|154151282|ref|YP_001404900.1| holo-acyl-carrier-protein synthase [Candidatus Methanoregula boonei 6A8] >gi|153999834|gb|ABS56257.1| holo-acyl-carrier-protein synthase [Candidatus Methanoregula boonei 6A8] (151 aa)
Score = 99, Expect = 8.6e-03, Identities = 35/109 (32%), Positives = 59/109 (54%)
  Q:     3 LGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHI---KPLFSQLEITKKNQ-----RYNCQIDPKIELLLSVSYSSNNITAICL 111
           +GIG D+ EI+RFE    +    F ++  T  E  +   L KD+  +  LA  ++ KEAI KA++ +   +  +  +EI    +     R N +   K+ + LS+S+SS    A C+
  S:    33 IGIGTDIEEIRRFENFRDRAVAAFLEKNFTREEREYC--LSKDA-PAPHLAARFAGKEAIIKAISSLNIPRIFYPDIEILNNERGVPCVRINTEHCEKLCIKLSLSHSSGMALAFCI 146
>gi|167837343|ref|ZP_02464226.1| 4'-phosphopantetheinyl transferase [Burkholderia thailandensis MSMB43] (143 aa)
Score = 99, Expect = 8.8e-03, Identities = 23/66 (34%), Positives = 35/66 (53%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG DL ++ R   +  +T   FA ++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDLAQVSRIAAVLERTGGRFAAKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|54310183|ref|YP_131203.1| 4'-phosphopantetheinyl transferase [Photobacterium profundum SS9] >gi|59797767|sp|Q6LMS5|ACPS_PHOPR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|46914624|emb|CAG21401.1| putative phosphopantetheinyl transferase [Photobacterium profundum SS9] (126 aa)
Score = 99, Expect = 8.9e-03, Identities = 21/66 (31%), Positives = 42/66 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ +I+R +++  ++ + FA+R+L  +E   Y  L+    K+ +LA  +++KEA  KA+ 
  S:     3 IIGLGTDIADIERVDKVFARSGDAFAERILAPSELVIYHSLKL---KARYLAKRFAVKEAASKALG 65
>gi|184154686|ref|YP_001843026.1| holo-[acyl-carrier protein] synthase [Lactobacillus fermentum IFO 3956] >gi|183226030|dbj|BAG26546.1| holo-[acyl-carrier protein] synthase [Lactobacillus fermentum IFO 3956] (119 aa)
Score = 98, Expect = 9.4e-03, Identities = 27/67 (40%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIGID+ EI R ++   +T + F  ++LT  E A  A L K+     ++A  +SLKEA  KA+ 
  S:     1 MIAGIGIDVAEIDRIKRAVEKTPS-FINKVLTKGEQAQLATL-KNQRYYEYIAGRFSLKEAYSKALG 65
>gi|167756923|ref|ZP_02429050.1| hypothetical protein CLORAM_02472 [Clostridium ramosum DSM 1402] >gi|167703098|gb|EDS17677.1| hypothetical protein CLORAM_02472 [Clostridium ramosum DSM 1402] (111 aa)
Score = 98, Expect = 9.7e-03, Identities = 35/114 (30%), Positives = 57/114 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDN-CFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA--VNHIKPLFSQLEI-TKKNQRYNCQIDPKIEL---LLSVSYSSNNITAICLAQQ 114
           MI GIG D+V++ R        DN CF  +LLT  E+  +       +K  FL   ++ KEA +KA  + H    F  +EI   KN +      PKI      +S+++ ++   A  + ++
  S:     1 MISGIGCDIVDLNRL-----NLDNECFVLKLLTKNEFLIFKNKNSLKQKKEFLGGRFAAKEAFFKAHGIEHGMLSFHDIEILNDKNGK------PKINYPNTFISIAHENDYAIAYVVVEE 110
>gi|71892311|ref|YP_278045.1| holo-[acyl-carrier-protein] synthase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|90111928|sp|Q492D3|ACPS_BLOPB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71796417|gb|AAZ41168.1| holo-[acyl-carrier-protein] synthase [Candidatus Blochmannia pennsylvanicus str. BPEN] (125 aa)
Score = 98, Expect = 9.7e-03, Identities = 26/78 (33%), Positives = 46/78 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN---HIKPLFSQLEI 78
           MI GIGID+V+I++ +++   + +  A R+L+ +E+  Y   +       FLA  ++ KEA+ KA     +    F+Q+EI
  S:     1 MIHGIGIDIVDIRKIKKIITHSGDKLATRILSKSEWKIY---KNKKHPVHFLAKRFAAKEAVSKAFGTGINQGVTFNQIEI 78
>gi|163938240|ref|YP_001643124.1| holo-acyl-carrier-protein synthase [Bacillus weihenstephanensis KBAB4] >gi|163860437|gb|ABY41496.1| holo-acyl-carrier-protein synthase [Bacillus weihenstephanensis KBAB4] (119 aa)
Score = 98, Expect = 1.0e-02, Identities = 31/83 (37%), Positives = 46/83 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQ 83
           MI+GIGID++E+ R E++       F +R+LT  E    A+  K S  + F+A  ++ KEA  KAV   I    S L+I  +N 
  S:     1 MIVGIGIDIIELNRIEKML-DGKLKFMERILTERERG-VAEGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRND 82
>gi|118594605|ref|ZP_01551952.1| phosphopantethiene/protein transferase domain [Methylophilales bacterium HTCC2181] >gi|118440383|gb|EAV47010.1| phosphopantethiene/protein transferase domain [Methylophilales bacterium HTCC2181] (126 aa)
Score = 98, Expect = 1.1e-02, Identities = 25/67 (37%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+VE+ R +    +  +  A ++LT  E A Y   +  S K +FLA  ++ KEA  KA+ 
  S:     1 MIFGIGTDVVEVIRIKDSLDKYGDKLAHKILTQEEMASY---QVSSRKENFLAKRFAAKEAFSKALG 64
>gi|34497527|ref|NP_901742.1| holo-[acyl-carrier-protein] synthase [Chromobacterium violaceum ATCC 12472] >gi|61211603|sp|Q7NWB8|ACPS_CHRVO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|34103382|gb|AAQ59744.1| holo-[acyl-carrier-protein] synthase [Chromobacterium violaceum ATCC 12472] (125 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/53 (45%), Positives = 30/53 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLA 53
           MI GIG DLVEI R E   R+      +RLLT+ E A +A     +E + FLA
  S:     1 MIYGIGTDLVEIARMEAWCRRWGEKAGRRLLTAAEQAEFA---AHAEPARFLA 50
>gi|78065722|ref|YP_368491.1| 4'-phosphopantetheinyl transferase [Burkholderia sp. 383] >gi|90111930|sp|Q39I69|ACPS_BURS3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|77966467|gb|ABB07847.1| Holo-acyl carrier protein synthase [Burkholderia sp. 383] (142 aa)
Score = 98, Expect = 1.1e-02, Identities = 22/66 (33%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+ ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIAQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|195941198|ref|ZP_03086580.1| 4'-phosphopantetheinyl transferase [Escherichia coli O157:H7 str. EC4024] (126 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/66 (36%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++ +  AKR+L+  E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVIARSGDRLAKRVLSDNEWAIW---EAHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|15613081|ref|NP_241384.1| holo-(acyl carrier protein) synthase [Bacillus halodurans C-125] >gi|20137512|sp|Q9KFG1|ACPS_BACHD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|10173131|dbj|BAB04237.1| holo-(acyl carrier protein) synthase [Bacillus halodurans C-125] (119 aa)
Score = 98, Expect = 1.1e-02, Identities = 23/67 (34%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G GID+VE++R + +  +    F K++LT  E   +A+L +   +  ++A  ++ KEA  KAV 
  S:     1 MIIGTGIDIVELERIQSMVEKHPR-FVKKILTENEQEVFARLSR-RRRLEYIAGRFAAKEAFVKAVG 65
>gi|114765714|ref|ZP_01444812.1| 4'-phosphopantetheinyl transferase [Roseovarius sp. HTCC2601] >gi|114541931|gb|EAU44966.1| 4'-phosphopantetheinyl transferase [Roseovarius sp. HTCC2601] (134 aa)
Score = 98, Expect = 1.1e-02, Identities = 31/67 (46%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R E+ LAR  D  F  R+ T TE    A+ RKD   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIERTLARFGDR-FRNRVFTETEQTK-AERRKDV--AGTYAKRWAAKEACSKALG 64
>gi|16799957|ref|NP_470225.1| hypothetical protein lin0884 [Listeria innocua Clip11262] >gi|20137392|sp|Q92DD0|ACPS_LISIN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|16413334|emb|CAC96116.1| lin0884 [Listeria innocua] (118 aa)
Score = 98, Expect = 1.2e-02, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIG+D++++ R +Q A + +  F +R+LT  E   Y K  + S K  FLA  ++ KEA  KA
  S:     1 MIKGIGLDMIDLDRVKQ-AVEKNPRFIERILTEKETKQYEKY-EGSRKIEFLAGRFAAKEAYAKA 63
>gi|107022214|ref|YP_620541.1| 4'-phosphopantetheinyl transferase [Burkholderia cenocepacia AU 1054] >gi|116689160|ref|YP_834783.1| 4'-phosphopantetheinyl transferase [Burkholderia cenocepacia HI2424] >gi|123072288|sp|Q1BXT7.1|ACPS_BURCA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198179|sp|A0K5W3.1|ACPS_BURCH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|105892403|gb|ABF75568.1| holo-(acyl-carrier-protein) synthase [Burkholderia cenocepacia AU 1054] >gi|116647249|gb|ABK07890.1| holo-acyl-carrier-protein synthase [Burkholderia cenocepacia HI2424] (148 aa)
Score = 98, Expect = 1.2e-02, Identities = 22/66 (33%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+ ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIAQVSRVAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|171322519|ref|ZP_02911312.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria MEX-5] >gi|171092146|gb|EDT37554.1| holo-acyl-carrier-protein synthase [Burkholderia ambifaria MEX-5] (146 aa)
Score = 98, Expect = 1.2e-02, Identities = 22/66 (33%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T   FA+++L   E    H  + R ++   ++LA  +S KEA  KA+ 
  S:     3 IYGIGTDIVQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAYLATRFSAKEAFSKAIG 70
>gi|194467666|ref|ZP_03073653.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri 100-23] >gi|194454702|gb|EDX43599.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri 100-23] (120 aa)
Score = 97, Expect = 1.3e-02, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIGID+ EI+R ++ A    + F + +LT  E   Y++         +LA  WSLKE+  KA
  S:     1 MIKGIGIDITEIERVKKAAT-AHSQFIQHVLTPPELEQYSQF-SGQRSVEYLAGRWSLKESFAKA 63
>gi|16130488|ref|NP_417058.1| holo-[acyl-carrier-protein] synthase 1 [Escherichia coli str. K-12 substr. MG1655] >gi|89109369|ref|AP_003149.1| holo-[acyl-carrier-protein] synthase 1 [Escherichia coli W3110] >gi|188494913|ref|ZP_03002183.1| holo-(acyl-carrier-protein) synthase [Escherichia coli 53638] >gi|194437638|ref|ZP_03069734.1| holo-(acyl-carrier-protein) synthase [Escherichia coli 101-1] >gi|118817|sp|P24224.3|ACPS_ECOLI Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|147138|gb|AAA24316.1| Dpj protein >gi|147556|gb|AAA21846.1| dpj >gi|1033152|gb|AAA79825.1| dpj gene product >gi|1788916|gb|AAC75616.1| holo-[acyl-carrier-protein] synthase 1 [Escherichia coli str. K-12 substr. MG1655] >gi|85675454|dbj|BAE76739.1| holo-[acyl-carrier-protein] synthase 1 [Escherichia coli W3110] >gi|188490112|gb|EDU65215.1| holo-(acyl-carrier-protein) synthase [Escherichia coli 53638] >gi|194423444|gb|EDX39435.1| holo-(acyl-carrier-protein) synthase [Escherichia coli 101-1] (126 aa)
Score = 97, Expect = 1.3e-02, Identities = 23/66 (34%), Positives = 39/66 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++ +  A+R+L+  E+A +   +   +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIW---KTHHQPVRFLAKRFAVKEAAAKAFG 65
>gi|91784703|ref|YP_559909.1| 4'-phosphopantetheinyl transferase [Burkholderia xenovorans LB400] >gi|91688657|gb|ABE31857.1| Holo-acyl carrier protein synthase [Burkholderia xenovorans LB400] (158 aa)
Score = 97, Expect = 1.3e-02, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T+  FA+++L   E    H    R  +   +FLA  +S KEA  KA+ 
  S:    12 IYGIGTDIVQVSRVAAVMTRTNGRFAEKVLGPDELRVYHARHARSAARGLAFLATRFSAKEAFSKAIG 79
>gi|170019154|ref|YP_001724108.1| holo-acyl-carrier-protein synthase [Escherichia coli ATCC 8739] >gi|189027329|sp|B1IVR4.1|ACPS_ECOLC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|169754082|gb|ACA76781.1| holo-acyl-carrier-protein synthase [Escherichia coli ATCC 8739] (126 aa)
Score = 97, Expect = 1.4e-02, Identities = 23/64 (35%), Positives = 39/64 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILG+G D+VEI R E +  ++ +  A+R+L+  E+A +   +   +   FLA  +++KEA  KA
  S:     3 ILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIW---KTHHQPVRFLAKRFAVKEAAAKA 63
>gi|170695426|ref|ZP_02886571.1| holo-acyl-carrier-protein synthase [Burkholderia graminis C4D1M] >gi|170139617|gb|EDT07800.1| holo-acyl-carrier-protein synthase [Burkholderia graminis C4D1M] (138 aa)
Score = 97, Expect = 1.4e-02, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T+  FA+++L   E    H    R  +   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIVQVSRVAAVMTRTNGRFAEKVLGPDELRVYHARNARSAARGLAFLATRFSAKEAFSKAIG 70
>gi|37681011|ref|NP_935620.1| 4'-phosphopantetheinyl transferase [Vibrio vulnificus YJ016] >gi|56748605|sp|Q7MHP2|ACPS_VIBVY Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|37199761|dbj|BAC95591.1| phosphopantetheinyl transferase [Vibrio vulnificus YJ016] (126 aa)
Score = 97, Expect = 1.4e-02, Identities = 22/66 (33%), Positives = 39/66 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+ EI+R E+   ++   FA+R+L+  E   +  L+   ++  FLA  ++ KEA  KA+ 
  S:     3 IVGLGTDIAEIERVEKALARSGVAFAERILSVQEMETFVSLK---QQGRFLAKRFAAKEAASKALG 65
>gi|114331752|ref|YP_747974.1| phosphopantethiene-protein transferase [Nitrosomonas eutropha C91] >gi|122313497|sp|Q0AF73.1|ACPS_NITEC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|114308766|gb|ABI60009.1| Phosphopantethiene-protein transferase [Nitrosomonas eutropha C91] (125 aa)
Score = 97, Expect = 1.4e-02, Identities = 24/67 (35%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG DLV+  R      +    FA+R+L  +E++ Y    + +    FLA  ++ KEA  KAV 
  S:     1 MIYGIGTDLVDPARIAGSLERYGERFARRVLADSEWSEYV---RQTRPEVFLAKRFAAKEAFSKAVG 64
>gi|152971419|ref|YP_001336528.1| 4'-phosphopantetheinyl transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166198202|sp|A6TCH7.1|ACPS_KLEP7 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|150956268|gb|ABR78298.1| 4'-phosphopantetheinyl transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (126 aa)
Score = 97, Expect = 1.5e-02, Identities = 31/94 (32%), Positives = 55/94 (58%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKP--LFSQLEITKKNQRYNCQID-PKIEL 95
           ILG+G D+VEI R E +  ++ +  A+R+L+  E++ +    +  +   FLA  +++KEA  KA+   I+    F+Q E+      YN ++  PK+ L
  S:     3 ILGLGTDIVEIARIEAVIARSGDRLARRVLSDHEWSIW---EQHQQPVRFLAKRFAVKEAAAKALGTGIRNGLAFNQFEV------YNDELGKPKLRL 91
>gi|32490947|ref|NP_871201.1| hypothetical protein WGLp198 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|30172819|sp|Q8D303|ACPS_WIGBR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|25166153|dbj|BAC24344.1| acpS [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (139 aa)
Score = 97, Expect = 1.5e-02, Identities = 31/81 (38%), Positives = 46/81 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSS--FLAVHWSLKEAIYKA--VNHIKPL-FSQLEITKKN 82
           I+GIGID+V ++R  ++     N F K++L+  E   Y +L+   +  S  FLA   + KEA  KA  +   K L FSQ E+   N
  S:     3 IIGIGIDIVNLERINKIILCYGNKFVKKILSFNEKKKYYELKNKKKNISVNFLAKRLAAKEAASKAFGLGMKKGLYFSQFEVLNNN 88
>gi|170767567|ref|ZP_02902020.1| holo-(acyl-carrier-protein) synthase [Escherichia albertii TW07627] >gi|170123901|gb|EDS92832.1| holo-(acyl-carrier-protein) synthase [Escherichia albertii TW07627] (126 aa)
Score = 97, Expect = 1.5e-02, Identities = 25/64 (39%), Positives = 40/64 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEY----AHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILG+G+D+VEI R E +  ++    A+R+L+  E+    AH+  +R       FLA  +++KEA  KA
  S:     3 ILGLGMDIVEIARIEAVIARSGERLARRVLSDNEWDIWKAHHQPVR-------FLAKRFAVKEAAAKA 63
>gi|22537825|ref|NP_688676.1| 4'-phosphopantetheinyl transferase [Streptococcus agalactiae 2603V/R] >gi|25011769|ref|NP_736164.1| 4'-phosphopantetheinyl transferase [Streptococcus agalactiae NEM316] >gi|76787432|ref|YP_330299.1| 4'-phosphopantetheinyl transferase [Streptococcus agalactiae A909] >gi|77406431|ref|ZP_00783489.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae H36B] >gi|77409006|ref|ZP_00785726.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae COH1] >gi|77412403|ref|ZP_00788711.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae CJB111] >gi|77414521|ref|ZP_00790667.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae 515] >gi|54036694|sp|P63472|ACPS_STRA5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54040678|sp|P63471|ACPS_STRA3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90111954|sp|Q3JZK4|ACPS_STRA1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|22534719|gb|AAN00549.1|AE014268_9 holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae 2603V/R] >gi|24413309|emb|CAD47388.1| unknown [Streptococcus agalactiae NEM316] >gi|76562489|gb|ABA45073.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae A909] >gi|77159419|gb|EAO70584.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae 515] >gi|77161538|gb|EAO72541.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae CJB111] >gi|77172390|gb|EAO75539.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae COH1] >gi|77174964|gb|EAO77775.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae H36B] (119 aa)
Score = 97, Expect = 1.5e-02, Identities = 25/67 (37%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G GIDL EI+   + A + +  FA+R+LT  E   +  +     + SFL   W+ KEA  KA+ 
  S:     1 MIVGHGIDLQEIEAITK-AYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALG 66
>gi|146312691|ref|YP_001177765.1| 4'-phosphopantetheinyl transferase [Enterobacter sp. 638] >gi|166918336|sp|A4WDD4.1|ACPS_ENT38 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|145319567|gb|ABP61714.1| holo-acyl-carrier-protein synthase [Enterobacter sp. 638] (126 aa)
Score = 96, Expect = 1.6e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILG+G D+VEI R E +  ++ +  A+R+L+  E+A +       +   FLA  +++KEA  KA
  S:     3 ILGLGTDIVEIGRIEAVIARSGDRLARRVLSDNEWAIW---ETHQQPVRFLAKRFAVKEAAAKA 63
>gi|170732448|ref|YP_001764395.1| holo-acyl-carrier-protein synthase [Burkholderia cenocepacia MC0-3] >gi|194556892|ref|YP_002091918.1| Holo-acyl carrier protein synthase [Burkholderia cenocepacia PC184] >gi|124870683|gb|EAY62399.1| Holo-acyl carrier protein synthase [Burkholderia cenocepacia PC184] >gi|169815690|gb|ACA90273.1| holo-acyl-carrier-protein synthase [Burkholderia cenocepacia MC0-3] (146 aa)
Score = 96, Expect = 1.6e-02, Identities = 22/66 (33%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+ ++ R   +  +T   FA+++L   E    H  + R ++   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIAQVSRVAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIG 70
>gi|169628604|ref|YP_001702253.1| putative holo-[acyl-carrier-protein] synthase [Mycobacterium abscessus] >gi|169240571|emb|CAM61599.1| Putative holo-[acyl-carrier-protein] synthase [Mycobacterium abscessus] (135 aa)
Score = 96, Expect = 1.7e-02, Identities = 31/89 (34%), Positives = 45/89 (50%)
  Q:     1 MILGIGIDLVEIKRF-EQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQI 89
           MI+GIGIDLV I  F EQLA      F     T  E    A   K   ++ +LA  W+ KEA+ KA +  +  +SQ  +  +N   + ++
  S:     1 MIVGIGIDLVTISEFGEQLA-SPGTAFGS-AFTPGERRDAAS--KTGGEARYLAARWAAKEAVIKAWSGSR--YSQRPVLPENIHRDIEV 84
>gi|88606943|ref|YP_505230.1| holo-(acyl-carrier-protein) synthase [Anaplasma phagocytophilum HZ] >gi|123750107|sp|Q2GK71.1|ACPS_ANAPZ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|88598006|gb|ABD43476.1| holo-(acyl-carrier-protein) synthase [Anaplasma phagocytophilum HZ] (122 aa)
Score = 96, Expect = 1.7e-02, Identities = 23/67 (34%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG+DLV  +R + L  +  N F  R+ +  E     K R +  ++   A  ++ KEA  KA+ 
  S:     1 MILGIGVDLVCTRRIQALIAKYGNKFTNRIFSEKEILDSLKYRDEYARARHFAKRFAAKEAYVKALG 67
>gi|161502271|ref|YP_001569383.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189027344|sp|A9MGY0.1|ACPS_SALAR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|160863618|gb|ABX20241.1| hypothetical protein SARI_00301 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (131 aa)
Score = 96, Expect = 1.8e-02, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L++ E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEISRIEAVISRSGERLARRVLSANEWAIW---ETHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|57650743|ref|YP_186877.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus COL] >gi|87160456|ref|YP_494674.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus USA300] >gi|88195972|ref|YP_500785.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151222188|ref|YP_001333010.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510283|ref|YP_001575942.1| holo-[acyl-carrier-protein] synthase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727744|ref|ZP_02760021.1| holo- [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123484987|sp|Q2FF54.1|ACPS_STAA3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|172048976|sp|A6QIR6.1|ACPS_STAAE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|189027353|sp|A8Z4X4.1|ACPS_STAAT Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|6225004|sp|Q9ZAH6|ACPS_STAA8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71152223|sp|Q5HED0|ACPS_STAAC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|3850850|emb|CAA76220.1| dpj protein [Staphylococcus aureus] >gi|57284929|gb|AAW37023.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus COL] >gi|87126430|gb|ABD20944.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203530|gb|ABD31340.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374988|dbj|BAF68248.1| holo-(acyl-carrier-protein) synthase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369092|gb|ABX30063.1| holo-[acyl-carrier-protein] synthase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (119 aa)
Score = 96, Expect = 1.8e-02, Identities = 24/67 (35%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+DL+EI R + L  +      +R+LT  E   +     +  K  FLA  ++ KEA  KA+ 
  S:     1 MIHGIGVDLIEIDRIQALYSKQPK-LVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALG 66
>gi|125717408|ref|YP_001034541.1| 4'-phosphopantetheinyl transferase [Streptococcus sanguinis SK36] >gi|166198240|sp|A3CLD6.1|ACPS_STRSV Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|125497325|gb|ABN43991.1| Acyl carrier protein synthase, putative [Streptococcus sanguinis SK36] (120 aa)
Score = 96, Expect = 1.8e-02, Identities = 37/114 (32%), Positives = 59/114 (51%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA--VNHIKPLFSQLEITKKNQR--YNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI G GID+ E+   E+ A   +  FAK++LT  E + + +L     K  FLA  W+ KEA  KA      K  F  LEI    Q   Y  +     ++ +S+S+++  +TA  + ++
  S:     1 MIKGHGIDIEELVAIER-AYLKNARFAKKVLTEAELSRFEEL-SGKRKIEFLAGRWAAKEAFSKAWGTGIGKLRFQDLEILNDRQGAPYFSRSPFTGKVWISLSHAAGLVTASVILEE 116
>gi|42561108|ref|NP_975559.1| holo-[acyl-carrier-protein] synthase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|188159260|ref|ZP_02998651.1| holo-[acyl-carrier-protein] synthase [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|61211517|sp|Q6MT35|ACPS_MYCMS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|42492605|emb|CAE77201.1| holo-[acyl-carrier-protein] synthase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (110 aa)
Score = 96, Expect = 1.9e-02, Identities = 33/113 (29%), Positives = 59/113 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQ 113
           MI  +GID+VE KR  +L ++    F  ++L++ E   +   +   +K  FLA  W++KEAI K ++    + ++++I   NQ+   Q      +L+S+S+       I L Q
  S:     1 MINNVGIDIVENKRI-KLKKE----FIIKVLSTNEIQTF-NTKTKKQKKEFLAGRWAVKEAIIKTLDQAISM-NKIDIEYVNQKPVIQNKELQNILISISHEKKYAIGIALKQ 106
>gi|146296072|ref|YP_001179843.1| holo-acyl-carrier-protein synthase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166198186|sp|A4XIB7.1|ACPS_CALS8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|145409648|gb|ABP66652.1| holo-acyl-carrier-protein synthase [Caldicellulosiruptor saccharolyticus DSM 8903] (123 aa)
Score = 96, Expect = 1.9e-02, Identities = 37/114 (32%), Positives = 66/114 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITK------KNQRYN-----CQIDPKIELLLSVSYSSNNITAICLAQQ 114
           MI  IGID+VE++RF+ + R   + F KR+ T  E  +   +R  +     +A +++ KEA+ KA++  I   F  +EI K      K + YN     C+      ++LS+S+ ++   A  +A++
  S:     1 MIFNIGIDIVEVERFKNIKRF--DSFLKRVFTQKELEY---IRSKNFNMLTIAGYFAAKEAVAKALSTGIVFGFKDIEIQKDTNGCPKVKLYNRAKEICENLKITNIVLSISHQNSVAVACAIAEK 121
>gi|145620857|ref|ZP_01776871.1| holo-acyl-carrier-protein synthase [Geobacter bemidjiensis Bem] >gi|144942845|gb|EDJ77956.1| holo-acyl-carrier-protein synthase [Geobacter bemidjiensis Bem] >gi|197087008|gb|ACH38279.1| holo-acyl-carrier-protein synthase [Geobacter bemidjiensis Bem] (125 aa)
Score = 96, Expect = 1.9e-02, Identities = 23/67 (34%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G G+D+VEI RFE+  +Q ++    R+ T +E   Y   +K S  +   A+ ++ KE+  KA+ 
  S:     1 MIYGTGVDIVEIARFEKFLQQGNDALFDRIFTPSEI-EYCSAKKHS--AQHYALRFAAKESFLKALG 64
>gi|116513508|ref|YP_812414.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275722|sp|Q04C46.1|ACPS_LACDB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116092823|gb|ABJ57976.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (137 aa)
Score = 96, Expect = 1.9e-02, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI  IG+D +E+ R  ++  + D  FA+++LT  E+A Y  L     K  +L   +++KEA  KA
  S:     1 MIKNIGVDQIEVDRIAKVVDRGDG-FARKVLTDREFAQYQDL-THKRKIEYLGGRFAIKEAFSKA 63
>gi|76798708|ref|ZP_00780929.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase)(4'-phosphopantetheinyl transferase acpS) [Streptococcus agalactiae 18RS21] >gi|76585933|gb|EAO62470.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase)(4'-phosphopantetheinyl transferase acpS) [Streptococcus agalactiae 18RS21] (82 aa)
Score = 96, Expect = 2.0e-02, Identities = 25/67 (37%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G GIDL EI+   + A + +  FA+R+LT  E   +  +     + SFL   W+ KEA  KA+ 
  S:     1 MIVGHGIDLQEIEAITK-AYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALG 66
>gi|170684119|ref|YP_001744752.1| holo-(acyl-carrier-protein) synthase [Escherichia coli SMS-3-5] >gi|170521837|gb|ACB20015.1| holo-(acyl-carrier-protein) synthase [Escherichia coli SMS-3-5] (126 aa)
Score = 96, Expect = 2.0e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +   +   +   FLA  +++KEA  KA
  S:     3 ILGLGTDIVEIARIESVIARSGERLARRVLSDNEWAIW---KTHHQPVRFLAKRFAVKEAAAKA 63
>gi|94676947|ref|YP_588728.1| holo-(acyl-carrier-protein) synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|123260568|sp|Q1LTI6.1|ACPS_BAUCH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|94220097|gb|ABF14256.1| holo-(acyl-carrier-protein) synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (146 aa)
Score = 96, Expect = 2.0e-02, Identities = 24/66 (36%), Positives = 35/66 (53%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILGIG D+VEI R   +  +    F  R+L+  EY  Y    + +    FLA  +++KEA  KA+ 
  S:     3 ILGIGTDIVEIARIHTVLVRCGERFIDRILSPIEYKQY---HQQNNSVHFLAKRFAVKEAAAKALG 65
>gi|104773513|ref|YP_618493.1| Holo-[acyl-carrier protein] synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122984014|sp|Q1GBP7.1|ACPS_LACDA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|103422594|emb|CAI97197.1| Holo-[acyl-carrier protein] synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (137 aa)
Score = 96, Expect = 2.1e-02, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI  IG+D +E+ R  ++  + D  FA+++LT  E+A Y  L     K  +L   +++KEA  KA
  S:     1 MIKNIGVDQIEVDRIAKVVDRGDG-FARKVLTDREFAQYQDL-THKRKIEYLGGRFAIKEAFSKA 63
>gi|58040239|ref|YP_192203.1| 4'-phosphopantetheinyl transferase [Gluconobacter oxydans 621H] >gi|81556984|sp|Q5FPZ9|ACPS_GLUOX Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|58002653|gb|AAW61547.1| Holo-[acyl-carrier protein] synthase [Gluconobacter oxydans 621H] (157 aa)
Score = 96, Expect = 2.1e-02, Identities = 23/67 (34%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILG+G DL  I R E+   +  + F  R+ T  E A+  +    +   S+ A  W+ KEA  KA+ 
  S:     1 MILGMGTDLCMISRIEKSVERFGDRFLNRVFTEAERAYADRFTGAARMGSY-AKRWAAKEACAKALG 66
>gi|187924871|ref|YP_001896513.1| holo-acyl-carrier-protein synthase [Burkholderia phytofirmans PsJN] >gi|187716065|gb|ACD17289.1| holo-acyl-carrier-protein synthase [Burkholderia phytofirmans PsJN] (140 aa)
Score = 95, Expect = 2.1e-02, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V++ R   +  +T+  FA+++L   E    H    R  +   +FLA  +S KEA  KA+ 
  S:     3 IYGIGTDIVQVSRVAAVMTRTNGRFAEKVLGPDELRVYHARHARSAARGLAFLATRFSAKEAFSKAIG 70
>gi|157151675|ref|YP_001449733.1| 4'-phosphopantetheinyl transferase [Streptococcus gordonii str. Challis substr. CH1] >gi|157076469|gb|ABV11152.1| holo-(acyl-carrier-protein) synthase [Streptococcus gordonii str. Challis substr. CH1] (144 aa)
Score = 95, Expect = 2.2e-02, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI+G GID+ E+    Q A + +  FAK++LT  E+  + +L     K  +LA  WS KEA  KA
  S:    25 MIIGHGIDIEELSSI-QRAYEKNARFAKKVLTEKEWFRFEEL-SGKRKIEYLAGRWSAKEAFSKA 87
>gi|56478594|ref|YP_160183.1| phosphopantetheinyl transferase (holo-ACP synthase) [Azoarcus sp. EbN1] >gi|81598581|sp|Q5P082|ACPS_AZOSE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56314637|emb|CAI09282.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Azoarcus sp. EbN1] (125 aa)
Score = 95, Expect = 2.2e-02, Identities = 24/67 (35%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+V+I+R ++   +    FA R+L ++E   +A  R   + + FLA  ++ KEA  KA+ 
  S:     1 MIHGIGTDIVQIERVQRSLDRHGARFAARILAASERDGFAASR---DPARFLAKRFAAKEAFGKALG 64
>gi|171057285|ref|YP_001789634.1| holo-acyl-carrier-protein synthase [Leptothrix cholodnii SP-6] >gi|170774730|gb|ACB32869.1| holo-acyl-carrier-protein synthase [Leptothrix cholodnii SP-6] (132 aa)
Score = 95, Expect = 2.2e-02, Identities = 22/67 (32%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+G D+ +I+R     ++  + FA+R+L   E     Y + + ++   S+LA  +S KEA  KA+ 
  S:     1 MIYGVGTDICDIRRIAATLQRRGDRFAERVLGPREIEVFRYRRAKVEARGLSYLATRFSAKEAFSKAIG 69
>gi|126728504|ref|ZP_01744320.1| 4'-phosphopantetheinyl transferase [Sagittula stellata E-37] >gi|126711469|gb|EBA10519.1| 4'-phosphopantetheinyl transferase [Sagittula stellata E-37] (153 aa)
Score = 95, Expect = 2.3e-02, Identities = 24/67 (35%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R  +   +  + F  R+ T TE    AK  + ++     A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIARTLDRFGDRFRTRVFTETE---QAKAERRADTPGTYAKRWAAKEACSKALG 64
>gi|56416715|ref|YP_153789.1| holo-(acyl-carrier-protein) synthase [Anaplasma marginale str. St. Maries] >gi|81599160|sp|Q5PAZ6|ACPS_ANAMM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56387947|gb|AAV86534.1| holo-(acyl-carrier-protein) synthase [Anaplasma marginale str. St. Maries] (120 aa)
Score = 95, Expect = 2.3e-02, Identities = 22/67 (32%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG+DLV ++R +QL  +  N F  R  +  E     + +     +   A  ++ KEA  KAV 
  S:     1 MIVGIGVDLVSVRRMQQLLERFGNRFTARAFSEVEIRDSLQYKNAHAVARHFAKRFAAKEAYVKAVG 67
>gi|24113905|ref|NP_708415.1| 4'-phosphopantetheinyl transferase [Shigella flexneri 2a str. 301] >gi|30063965|ref|NP_838136.1| 4'-phosphopantetheinyl transferase [Shigella flexneri 2a str. 2457T] >gi|74313125|ref|YP_311544.1| 4'-phosphopantetheinyl transferase [Shigella sonnei Ss046] >gi|82545015|ref|YP_408962.1| 4'-phosphopantetheinyl transferase [Shigella boydii Sb227] >gi|110806508|ref|YP_690028.1| 4'-phosphopantetheinyl transferase [Shigella flexneri 5 str. 8401] >gi|157155221|ref|YP_001463886.1| 4'-phosphopantetheinyl transferase [Escherichia coli E24377A] >gi|187730538|ref|YP_001881342.1| holo-(acyl-carrier-protein) synthase [Shigella boydii CDC 3083-94] >gi|191167964|ref|ZP_03029766.1| holo-(acyl-carrier-protein) synthase [Escherichia coli B7A] >gi|193064067|ref|ZP_03045152.1| holo-(acyl-carrier-protein) synthase [Escherichia coli E22] >gi|194429276|ref|ZP_03061803.1| holo-(acyl-carrier-protein) synthase [Escherichia coli B171] >gi|194432147|ref|ZP_03064436.1| holo-(acyl-carrier-protein) synthase [Shigella dysenteriae 1012] >gi|122957276|sp|Q0T1U2.1|ACPS_SHIF8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166918334|sp|A7ZQ07.1|ACPS_ECO24 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797860|sp|Q83K24|ACPS_SHIFL Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90111948|sp|Q31XS4|ACPS_SHIBS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90111950|sp|Q3YYV3|ACPS_SHISS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|24053006|gb|AAN44122.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Shigella flexneri 2a str. 301] >gi|30042221|gb|AAP17946.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Shigella flexneri 2a str. 2457T] >gi|73856602|gb|AAZ89309.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Shigella sonnei Ss046] >gi|81246426|gb|ABB67134.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Shigella boydii Sb227] >gi|110616056|gb|ABF04723.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Shigella flexneri 5 str. 8401] >gi|157077251|gb|ABV16959.1| holo-(acyl-carrier-protein) synthase [Escherichia coli E24377A] >gi|187427530|gb|ACD06804.1| holo-(acyl-carrier-protein) synthase [Shigella boydii CDC 3083-94] >gi|190901971|gb|EDV61718.1| holo-(acyl-carrier-protein) synthase [Escherichia coli B7A] >gi|192929302|gb|EDV82911.1| holo-(acyl-carrier-protein) synthase [Escherichia coli E22] >gi|194412684|gb|EDX28979.1| holo-(acyl-carrier-protein) synthase [Escherichia coli B171] >gi|194419676|gb|EDX35756.1| holo-(acyl-carrier-protein) synthase [Shigella dysenteriae 1012] (126 aa)
Score = 95, Expect = 2.3e-02, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +   +   +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWAIW---KTHHQPVRFLAKRFAVKEAAAKAFG 65
>gi|126726097|ref|ZP_01741939.1| 4'-phosphopantetheinyl transferase [Rhodobacterales bacterium HTCC2150] >gi|126705301|gb|EBA04392.1| 4'-phosphopantetheinyl transferase [Rhodobacterales bacterium HTCC2150] (134 aa)
Score = 95, Expect = 2.3e-02, Identities = 26/67 (38%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R + +  +  + F  R+ T TE    A+ RKD   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIQGVLDRFGDRFRNRVFTETEQ-RRAERRKDV--AGTYAKRWAAKEACSKALG 64
>gi|89900542|ref|YP_523013.1| 4'-phosphopantetheinyl transferase [Rhodoferax ferrireducens T118] >gi|122479393|sp|Q21XM1.1|ACPS_RHOFD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|89345279|gb|ABD69482.1| holo-(acyl-carrier-protein) synthase [Rhodoferax ferrireducens T118] (130 aa)
Score = 95, Expect = 2.4e-02, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFE-QLARQTDNCFAKRLLTSTEYAHY-AKLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           MI GIG D+ +++R    LAR  +  FA+++L+  E+A + A+  +  E+   FLA  +S KEA  KA+ 
  S:     1 MIYGIGTDICDVRRIRASLARHGER-FAQKILSDAEFATWQARSARWPERGVRFLATRFSAKEAFSKAIG 69
>gi|94311350|ref|YP_584560.1| 4'-phosphopantetheinyl transferase [Ralstonia metallidurans CH34] >gi|166198217|sp|Q1LKN5.1|ACPS_RALME Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|93355202|gb|ABF09291.1| holo-(acyl-carrier-protein) synthase [Ralstonia metallidurans CH34] (143 aa)
Score = 95, Expect = 2.5e-02, Identities = 22/67 (32%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           MI G+G D+++I R   +  +T   F +++L   E   Y   +  SEK   +FL   ++ KEA  KA+ 
  S:     1 MIYGVGTDIIQIDRVRGVMERTRGRFVEKILGPREMKIYLARKARSEKRGLAFLCTRFAAKEAFSKAIG 69
>gi|188533142|ref|YP_001906939.1| Holo-[acyl-carrier-protein] synthase [Erwinia tasmaniensis] >gi|188028184|emb|CAO96042.1| Holo-[acyl-carrier-protein] synthase [Erwinia tasmaniensis] (126 aa)
Score = 95, Expect = 2.5e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R   +  +T +  A+R+L+  E+  Y   +   +   FLA  +++KEA  KA  
  S:     3 ILGLGSDIVEIDRIAAVISRTGDRLARRVLSDNEWRQY---QSHQQPVRFLAKRFAVKEAASKAFG 65
>gi|134095249|ref|YP_001100324.1| holo-[acyl-carrier-protein] synthase (CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase) [Herminiimonas arsenicoxydans] >gi|189027330|sp|A4G6R4.1|ACPS_HERAR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|133739152|emb|CAL62201.1| holo-[acyl-carrier-protein] synthase (CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase) [Herminiimonas arsenicoxydans] (130 aa)
Score = 95, Expect = 2.7e-02, Identities = 27/67 (40%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFE-QLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+++I R E  L R  D  FA+R+L   E    H  K +  +    FLA  ++ KEA  KA+ 
  S:     1 MIYGIGTDIIKIARIEAALGRHGDR-FAERVLGVEELEKYHRRKAKVAARGLRFLATRFAAKEAFSKAIG 69
>gi|191162576|ref|ZP_03024455.1| holo-acyl-carrier-protein synthase [Geobacter sp. M21] >gi|190996130|gb|EDV71579.1| holo-acyl-carrier-protein synthase [Geobacter sp. M21] (125 aa)
Score = 94, Expect = 2.7e-02, Identities = 23/67 (34%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G G+D+VEI RFE+  +Q ++    R+ T +E   Y   +K S  +   A+ ++ KE+  KA+ 
  S:     1 MIYGTGVDIVEIARFEKFLQQGNDALFDRIFTPSEI-EYCSSKKHS--AQHYALRFAAKESFLKALG 64
>gi|84684007|ref|ZP_01011909.1| 4'-phosphopantetheinyl transferase [Rhodobacterales bacterium HTCC2654] >gi|84667760|gb|EAQ14228.1| 4'-phosphopantetheinyl transferase [Rhodobacterales bacterium HTCC2654] (133 aa)
Score = 94, Expect = 2.8e-02, Identities = 24/67 (35%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R   +  +  + F  R+ T TE   +   R+  E  ++ A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIAGVLERHGDRFRDRVFTETE--QFKAARRKDEAGTY-AKRWAAKEACSKALG 64
>gi|49475302|ref|YP_033343.1| 4'-phosphopantetheinyl transferase [Bartonella henselae str. Houston-1] >gi|61211491|sp|Q6G461|ACPS_BARHE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|49238108|emb|CAF27315.1| Acyl carrier protein synthase [Bartonella henselae str. Houston-1] (133 aa)
Score = 94, Expect = 2.9e-02, Identities = 24/67 (35%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G DL +I+R E++  +  + F +R+ T  E      L+K   KSS  A  ++ KEA  KA+ 
  S:     1 MIVGLGSDLTDIRRIERMLARYGDRFVQRIFTDIERNRSESLQK---KSSSYAKRFAAKEACAKALG 64
>gi|167549391|ref|ZP_02343150.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (126 aa)
Score = 94, Expect = 3.0e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIW---ESHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|153956181|ref|YP_001396946.1| 4'-phosphopantetheinyl transferase [Clostridium kluyveri DSM 555] >gi|189027325|sp|A5N379.1|ACPS_CLOK5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|146349039|gb|EDK35575.1| AcpS [Clostridium kluyveri DSM 555] (134 aa)
Score = 94, Expect = 3.0e-02, Identities = 21/67 (31%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+G+D+VEI+R ++ A +  N F  R+ +  E  +   L+  + +  F+A  ++ KEA+ K++ 
  S:     1 MIFGVGVDIVEIRRIKE-AIEKHNTFIDRIFSKNEIEY---LKNRNLRPEFVAGRFAAKEAVVKSLG 63
>gi|62181142|ref|YP_217559.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|168261372|ref|ZP_02683345.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|75481604|sp|Q57LD4|ACPS_SALCH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|62128775|gb|AAX66478.1| holo-[acyl-carrier-protein] synthase, subunit (CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase, phosphopanthetheinyltransferase) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (126 aa)
Score = 94, Expect = 3.0e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIW---ESHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|157363132|ref|YP_001469899.1| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Thermotoga lettingae TMO] >gi|157313736|gb|ABV32835.1| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Thermotoga lettingae TMO] (268 aa)
Score = 94, Expect = 3.2e-02, Identities = 23/67 (34%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIGID+V+I R E          +KR+L   E   +  ++   +K ++LA  ++ KEA +KA+ 
  S:     1 MIVGIGIDVVKIDRVEL-------SLSKRILGPLEQLEFESIK---DKKTYLAARFAAKEAFFKAIG 57
>gi|149246954|ref|XP_001527902.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] >gi|146447856|gb|EDK42244.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] (137 aa)
Score = 94, Expect = 3.2e-02, Identities = 35/114 (30%), Positives = 58/114 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNC---FAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV------------------NHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           + LGIG+D+V+  RF++L  +        A+R+L     AH  K   +  +  ++A  W+ KEA++K +                  N+ KP          N  +  + D   E  LSVS+  + I A  L Q+
  S:     6 ITLGIGVDIVKRSRFKRLLSKNPAFSVRLAQRILHPKHEAHRFKNMNNERQVQYIAGSWAAKEAVFKTLTPNEQEQFNFNEWYRYHDNNGKPFIW-------NDNFKVEND---EFHLSVSHDEDYIVATVLRQR 130
>gi|162448177|ref|YP_001621309.1| 4'-phosphopantetheinyl transferase [Acholeplasma laidlawii PG-8A] >gi|189027316|sp|A9NHV3.1|ACPS_ACHLI Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|161986284|gb|ABX81933.1| 4'-phosphopantetheinyl transferase [Acholeplasma laidlawii PG-8A] (118 aa)
Score = 94, Expect = 3.3e-02, Identities = 21/64 (32%), Positives = 38/64 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYK 64
           MI  IG DLVE++R + +       F  ++L   E   YAK+  ++ K ++LA  +++KE+++K
  S:     1 MIHAIGTDLVELERIKSIGIDR---FKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFK 61
>gi|49474064|ref|YP_032106.1| 4'-phosphopantetheinyl transferase [Bartonella quintana str. Toulouse] >gi|61211486|sp|Q6G084|ACPS_BARQU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|49239568|emb|CAF25925.1| Acyl carrier protein synthase [Bartonella quintana str. Toulouse] (133 aa)
Score = 94, Expect = 3.3e-02, Identities = 24/67 (35%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G DL++I+R E++  +  + F +R+ T  E      L+K   KSS  A  ++ KEA  KA+ 
  S:     1 MIVGLGNDLIDIRRIERMLVRYGDRFVQRIFTDIEQNKSESLQK---KSSSYAKRFAAKEACAKALG 64
>gi|152980533|ref|YP_001353064.1| holo-[acyl-carrier protein] synthase [Janthinobacterium sp. Marseille] >gi|189027331|sp|A6SXR7.1|ACPS_JANMA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|151280610|gb|ABR89020.1| holo-[acyl-carrier protein] synthase [Janthinobacterium sp. Marseille] (130 aa)
Score = 94, Expect = 3.3e-02, Identities = 26/67 (38%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRF-EQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSS--FLAVHWSLKEAIYKAVN 67
           MI GIG D+++I R    L R  D  FA+R+L   E   Y + +   E     FLA  ++ KEA  KA+ 
  S:     1 MIYGIGTDIIKIDRIAAALGRHGDR-FAERILGKEELEKYHRRKAKVEARGLRFLATRFAAKEAFSKAIG 69
>gi|167542551|ref|ZP_02338127.1| hypothetical protein Sentent_04680 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|194442775|ref|YP_002041840.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194401438|gb|ACF61660.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (126 aa)
Score = 94, Expect = 3.4e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIW---ETHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|157144501|ref|YP_001451820.1| 4'-phosphopantetheinyl transferase [Citrobacter koseri ATCC BAA-895] >gi|166198193|sp|A8AD21.1|ACPS_CITK8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157081706|gb|ABV11384.1| hypothetical protein CKO_00219 [Citrobacter koseri ATCC BAA-895] (126 aa)
Score = 94, Expect = 3.4e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIW---ETHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|16761489|ref|NP_457106.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16765897|ref|NP_461512.1| 4'-phosphopantetheinyl transferase [Salmonella typhimurium LT2] >gi|29140814|ref|NP_804156.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56412547|ref|YP_149622.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167557510|ref|ZP_02350523.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992708|ref|ZP_02573804.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168218927|ref|ZP_02644159.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168226113|ref|ZP_02651344.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168232155|ref|ZP_02657213.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168238322|ref|ZP_02663380.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168243367|ref|ZP_02668299.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168466662|ref|ZP_02700516.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168474139|ref|ZP_02703162.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168821433|ref|ZP_02833433.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194448465|ref|YP_002046639.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469034|ref|ZP_03075018.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736562|ref|YP_002115640.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|54036691|sp|P63467|ACPS_SALTI Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54040676|sp|P63466|ACPS_SALTY Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|81599591|sp|Q5PIJ4|ACPS_SALPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|25304183|pir||AG0828 holo-[acyl-carrier protein] synthase (EC 2.7.8.7) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16421124|gb|AAL21471.1| holo-[acyl-carrier-protein] synthase, subunit [Salmonella typhimurium LT2] >gi|16503789|emb|CAD02779.1| holo-[acyl-carrier protein] synthase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136439|gb|AAO68005.1| holo-[acyl-carrier protein] synthase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56126804|gb|AAV76310.1| holo-[acyl-carrier protein] synthase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|194406769|gb|ACF66988.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455398|gb|EDX44237.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194712064|gb|ACF91285.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195630683|gb|EDX49275.1| holo-(acyl-carrier-protein) synthase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (126 aa)
Score = 94, Expect = 3.4e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+A +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIW---ETHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|89070101|ref|ZP_01157431.1| 4'-phosphopantetheinyl transferase [Oceanicola granulosus HTCC2516] >gi|89044322|gb|EAR50465.1| 4'-phosphopantetheinyl transferase [Oceanicola granulosus HTCC2516] (137 aa)
Score = 93, Expect = 3.6e-02, Identities = 28/67 (41%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R E  LAR  D  F  R+ T  E    AK  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIEATLARFGDR-FRNRVFTDIE---QAKAERRADVAGTYAKRWAAKEACSKALG 64
>gi|15925061|ref|NP_372595.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927646|ref|NP_375179.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus N315] >gi|21283724|ref|NP_646812.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus MW2] >gi|49484297|ref|YP_041521.1| holo-[acyl-carrier protein] synthase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486865|ref|YP_044086.1| holo-[acyl-carrier protein] synthase [Staphylococcus aureus subsp. aureus MSSA476] >gi|82751674|ref|YP_417415.1| holo-acyl-carrier protein synthase [Staphylococcus aureus RF122] >gi|148268523|ref|YP_001247466.1| holo-acyl-carrier-protein synthase [Staphylococcus aureus subsp. aureus JH9] >gi|150394587|ref|YP_001317262.1| holo-acyl-carrier-protein synthase [Staphylococcus aureus subsp. aureus JH1] >gi|156980387|ref|YP_001442646.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus Mu3] >gi|166198235|sp|A7X4P8.1|ACPS_STAA1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|189027351|sp|A6U3F7.1|ACPS_STAA2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|189027352|sp|A5IUL7.1|ACPS_STAA9 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54036692|sp|P63469|ACPS_STAAN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54036693|sp|P63470|ACPS_STAAW Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54040677|sp|P63468|ACPS_STAAM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56748576|sp|Q6G7N8|ACPS_STAAS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56748588|sp|Q6GF02|ACPS_STAAR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90111951|sp|Q2YUI2|ACPS_STAAB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|13701866|dbj|BAB43158.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus N315] >gi|14247844|dbj|BAB58233.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus Mu50] >gi|21205166|dbj|BAB95860.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus MW2] >gi|49242426|emb|CAG41140.1| holo-[acyl-carrier protein] synthase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245308|emb|CAG43783.1| holo-[acyl-carrier protein] synthase [Staphylococcus aureus subsp. aureus MSSA476] >gi|82657205|emb|CAI81645.1| holo-acyl-carrier protein synthase [Staphylococcus aureus RF122] >gi|147741592|gb|ABQ49890.1| holo-acyl-carrier-protein synthase [Staphylococcus aureus subsp. aureus JH9] >gi|149947039|gb|ABR52975.1| holo-acyl-carrier-protein synthase [Staphylococcus aureus subsp. aureus JH1] >gi|156722522|dbj|BAF78939.1| holo-ACP synthase [Staphylococcus aureus subsp. aureus Mu3] (119 aa)
Score = 93, Expect = 3.6e-02, Identities = 24/67 (35%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+DL+EI R + L  +      +R+LT  E   +     +  K  FLA  ++ KEA  KA+ 
  S:     1 MIHGIGVDLIEIDRIKVLYSKQPK-LVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALG 66
>gi|71907661|ref|YP_285248.1| Holo-acyl carrier protein synthase:phosphopantethiene-protein transferase [Dechloromonas aromatica RCB] >gi|90111934|sp|Q47EF3|ACPS_DECAR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71847282|gb|AAZ46778.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Dechloromonas aromatica RCB] (125 aa)
Score = 93, Expect = 3.6e-02, Identities = 24/71 (33%), Positives = 39/71 (54%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKP 71
           MI GIG D+V + R   +  +  +    +LLT  E A ++K    ++K  FLA  ++ KEA  KA+   ++P
  S:     1 MIYGIGTDIVAVARLRGMWERHGDRVLDKLLTPQEIADFSKA---ADKGRFLAKRFAAKEAFSKALGTGVRP 69
>gi|15609660|ref|NP_217039.1| 4'-phosphopantetheinyl transferase [Mycobacterium tuberculosis H37Rv] >gi|31793704|ref|NP_856197.1| 4'-phosphopantetheinyl transferase [Mycobacterium bovis AF2122/97] >gi|121638406|ref|YP_978630.1| 4'-phosphopantetheinyl transferase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662360|ref|YP_001283883.1| 4'-phosphopantetheinyl transferase [Mycobacterium tuberculosis H37Ra] >gi|148823719|ref|YP_001288473.1| 4'-phosphopantetheinyl transferase [Mycobacterium tuberculosis F11] >gi|167967321|ref|ZP_02549598.1| 4'-phosphopantetheinyl transferase [Mycobacterium tuberculosis H37Ra] >gi|194544697|ref|YP_002079726.1| holo-[acyl-carrier protein] synthase acpS [Mycobacterium tuberculosis C] >gi|166198205|sp|A1KLL9.1|ACPS_MYCBP Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198209|sp|A5U5M1.1|ACPS_MYCTA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61217904|sp|P0A4W8|ACPS_MYCTU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61217906|sp|P0A4W9|ACPS_MYCBO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|2791425|emb|CAA16019.1| HOLO-[ACYL-CARRIER PROTEIN] SYNTHASE ACPS (HOLO-ACP SYNTHASE) (CoA:APO-[ACP]PANTETHEINEPHOSPHOTRANSFERASE) (CoA:APO-[ACYL-CARRIER PROTEIN]PANTETHEINEPHOSPHOTRANSFERASE) [Mycobacterium tuberculosis H37Rv] >gi|31619297|emb|CAD97413.1| HOLO-[ACYL-CARRIER PROTEIN] SYNTHASE ACPS (HOLO-ACP SYNTHASE) (CoA:APO-[ACP]PANTETHEINEPHOSPHOTRANSFERASE) (CoA:APO-[ACYL-CARRIER PROTEIN]PANTETHEINEPHOSPHOTRANSFERASE) [Mycobacterium bovis AF2122/97] >gi|121494054|emb|CAL72532.1| holo-[acyl-carrier protein] synthase acpS [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124601704|gb|EAY60714.1| holo-[acyl-carrier protein] synthase acpS [Mycobacterium tuberculosis C] >gi|134152240|gb|EBA44285.1| holo-[acyl-carrier protein] synthase acpS [Mycobacterium tuberculosis str. Haarlem] >gi|148506512|gb|ABQ74321.1| 4'-phosphopantetheinyl transferase [Mycobacterium tuberculosis H37Ra] >gi|148722246|gb|ABR06871.1| holo-[acyl-carrier protein] synthase acpS [Mycobacterium tuberculosis F11] (130 aa)
Score = 93, Expect = 3.6e-02, Identities = 29/106 (27%), Positives = 52/106 (49%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQI------DPKIELLLSVSYSSNNIT 107
           I+G+GIDLV I  F +   Q    FA+   T T         K S  +  LA  W+ KEA+ KA +  +  F+Q  +  ++   + ++       P++ L  +++    ++T
  S:     3 IVGVGIDLVSIPDFAEQVDQPGTVFAE---TFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSR--FAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVT 109
>gi|91775221|ref|YP_544977.1| phosphopantethiene-protein transferase domain-contain protein [Methylobacillus flagellatus KT] >gi|91775365|ref|YP_545121.1| phosphopantethiene-protein transferase domain-contain protein [Methylobacillus flagellatus KT] >gi|91709208|gb|ABE49136.1| phosphopantethiene--protein transferase domain [Methylobacillus flagellatus KT] >gi|91709352|gb|ABE49280.1| phosphopantethiene--protein transferase domain [Methylobacillus flagellatus KT] (126 aa)
Score = 93, Expect = 3.6e-02, Identities = 21/53 (39%), Positives = 31/53 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLA 53
           MI GIG D+VE+ R E+   +  + FA+R+L + E+  Y   R    K+ FLA
  S:     1 MIYGIGTDIVEVVRIEESLSRFGDAFARRILNAAEWQEYEASRV---KARFLA 50
>gi|15834995|ref|NP_296754.1| 4'-phosphopantetheinyl transferase [Chlamydia muridarum Nigg] >gi|13878324|sp|Q9PKT6|ACPS_CHLMU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|7190416|gb|AAF39234.1| holo-(acyl-carrier protein) synthase [Chlamydia muridarum Nigg] (125 aa)
Score = 93, Expect = 3.6e-02, Identities = 34/114 (29%), Positives = 63/114 (55%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAH-YAKLRKDSEKSSFLAVHWSLKEAIYKAVNH--IKPL-FSQLEITKKNQRYNCQIDPKI-------ELLLSVSYSSNNITAICLAQQT 115
           + GIG D++EI R  +      + F  ++ T  E A+ ++K    S+  + LAV ++ KEA+ KA+     K L + ++EI++  Q     +   +        +LLS+S+     TA+ +A+ T
  S:     1 MFGIGTDIIEIDRIRRAYHTYGDRFLNKIFTKGEQAYCFSK----SDPYASLAVRFAAKEAVSKALGTGIGKSLKWKEIEISRGTQHPQVSVPESLLALLEVKRILLSMSHCREYATAVAIAEVT 121
>gi|116872287|ref|YP_849068.1| holo-(acyl-carrier-protein) synthase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123463648|sp|A0AH03.1|ACPS_LISW6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116741165|emb|CAK20285.1| acpS [Listeria welshimeri serovar 6b str. SLCC5334] (118 aa)
Score = 93, Expect = 3.8e-02, Identities = 24/65 (36%), Positives = 39/65 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIG+D+++++R +Q+  +    F +R+LT  E   + K  + S K  FLA  ++ KEA  KA
  S:     1 MIKGIGLDMIDLERVKQVLEKNPR-FIERVLTEKEIKQFEKY-EGSRKIEFLAGRFAAKEAYAKA 63
>gi|24380197|ref|NP_722152.1| 4'-phosphopantetheinyl transferase [Streptococcus mutans UA159] >gi|29427724|sp|Q8DSF3|ACPS_STRMU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|24378202|gb|AAN59458.1|AE015010_7 putative acyl carrier protein synthase; AcpS [Streptococcus mutans UA159] (119 aa)
Score = 93, Expect = 3.8e-02, Identities = 37/114 (32%), Positives = 56/114 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEITKKNQRYNCQIDPKIE--LLLSVSYSSNNITAICLAQQ 114
           MI+G GIDL +I    Q A +  + FA ++LT  E   +  L K   +  +LA  W+ KEA  KA    I  L F  LEI   N+             + +S+S+S N + A  + ++
  S:     1 MIIGHGIDLQDIAAV-QRAHERSSRFASKVLTFKELEIFTSL-KGRRQVEYLAGRWAAKEAFSKAYGSGIGSLRFQDLEILANNKGAPIFTKSPFSGNIFISISHSKNYVEASVILEE 116
>gi|189499230|ref|YP_001958700.1| holo-acyl-carrier-protein synthase [Chlorobium phaeobacteroides BS1] >gi|189494671|gb|ACE03219.1| holo-acyl-carrier-protein synthase [Chlorobium phaeobacteroides BS1] (123 aa)
Score = 93, Expect = 3.8e-02, Identities = 28/82 (34%), Positives = 44/82 (53%)
  Q:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQRYN 86
           IG+D+V+I+R  +   +  + F +R+LT  E + Y K +KD   S  +A  ++ KEAI KAV   I   FS   +   N  + 
  S:     7 IGVDIVDIRRIRKSFEKYGDSFLRRVLTEKEIS-YCKGKKDMMPS--VAARFAAKEAISKAVGSGISGGFSWRSVEIDNDEHG 86
>gi|50365202|ref|YP_053627.1| holo-acyl carrier protein synthase [Mesoplasma florum L1] >gi|50363758|gb|AAT75743.1| holo-acyl carrier protein synthase [Mesoplasma florum L1] (111 aa)
Score = 93, Expect = 4.0e-02, Identities = 27/72 (37%), Positives = 38/72 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV--NHIKPL 72
           MI  IGID+VE KR     RQ    F  ++LT  E    + L     K  F+A  W++KE+I K +  N + P+
  S:     1 MIENIGIDIVENKRVN--LRQN---FLNKVLTKDELEKLSTLSSKKAKIEFVAGRWAVKESIIKTLKNNEVLPM 69
>gi|56698032|ref|YP_168403.1| 4'-phosphopantetheinyl transferase [Silicibacter pomeroyi DSS-3] >gi|81558329|sp|Q5LNK3|ACPS_SILPO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56679769|gb|AAV96435.1| holo-(acyl-carrier-protein) synthase [Silicibacter pomeroyi DSS-3] (148 aa)
Score = 93, Expect = 4.5e-02, Identities = 24/67 (35%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R E+   +  + F  R+ T  E     K  + S+ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIERTLDRFGDRFRNRVFTEIE---QRKAERRSDTAGTYAKRWAAKEACSKALG 64
>gi|160939253|ref|ZP_02086604.1| hypothetical protein CLOBOL_04147 [Clostridium bolteae ATCC BAA-613] >gi|158438216|gb|EDP15976.1| hypothetical protein CLOBOL_04147 [Clostridium bolteae ATCC BAA-613] (139 aa)
Score = 92, Expect = 5.0e-02, Identities = 24/67 (35%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILG+G DL+EI+R E+  ++  + F  R  T  E       R+    +S LA  +++KEA+ KA+ 
  S:     1 MILGVGTDLIEIRRMEKACKK--DYFVVRTFTDMES------RQAKGSASKLAGSFAVKEAVAKALG 59
>gi|116333169|ref|YP_794696.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus brevis ATCC 367] >gi|122270142|sp|Q03T07.1|ACPS_LACBA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116098516|gb|ABJ63665.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus brevis ATCC 367] (122 aa)
Score = 92, Expect = 5.0e-02, Identities = 23/67 (34%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G GID+ ++KR +++  +    F  ++LT  E   Y KL        F+A  WS KE+  KA+ 
  S:     1 MIYGTGIDITDLKRVQRVVERQPR-FLTKVLTPNERVDYQKL-SGQRALEFIAGRWSAKESYSKAMG 65
>gi|193068405|ref|ZP_03049368.1| holo-(acyl-carrier-protein) synthase [Escherichia coli E110019] >gi|192958357|gb|EDV88797.1| holo-(acyl-carrier-protein) synthase [Escherichia coli E110019] (126 aa)
Score = 92, Expect = 5.2e-02, Identities = 22/66 (33%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+  +   +   +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWGIW---KTHHQPVRFLAKRFAVKEAAAKAFG 65
>gi|169830666|ref|YP_001716648.1| holo-acyl-carrier-protein synthase [Candidatus Desulforudis audaxviator MP104C] >gi|169637510|gb|ACA59016.1| holo-acyl-carrier-protein synthase [Candidatus Desulforudis audaxviator MP104C] (131 aa)
Score = 92, Expect = 5.3e-02, Identities = 24/67 (35%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG+DLV +KR    + +T      RL T  E       R   E     A  ++ KEA++KA+ 
  S:     1 MILGIGVDLVSVKRIRSASERTGGRLLVRLFTPAERDCCRARRAAYE---CYAARFAAKEAVFKALG 64
>gi|83319324|ref|YP_424380.1| holo-(acyl-carrier-protein) synthase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535761|sp|Q2SS83.1|ACPS_MYCCT Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|83283210|gb|ABC01142.1| holo-(acyl-carrier-protein) synthase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (110 aa)
Score = 92, Expect = 5.4e-02, Identities = 32/113 (28%), Positives = 59/113 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPL-FSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQ 113
           MI  +GID+VE KR  +L  +    F  ++L++ E   +  ++   +K  FLA  W++KEAI K ++   P+  ++++I   N +   +      +L+S+S+       I L Q
  S:     1 MINNVGIDIVENKRI-KLKEE----FIVKVLSANEIKTF-NIKNKKQKREFLAGRWAIKEAIIKTLDQ--PISMNKIDIEYINDKPVIKNQELQNILISISHEKKYAVGIALKQ 106
>gi|16802926|ref|NP_464411.1| hypothetical protein lmo0885 [Listeria monocytogenes EGD-e] >gi|46907118|ref|YP_013507.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b F2365] >gi|47092093|ref|ZP_00229886.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b H7858] >gi|47094892|ref|ZP_00232506.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 1/2a F6854] >gi|153166203|ref|ZP_01926822.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N1-017] >gi|153178961|ref|ZP_01932248.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes F6900] >gi|153185406|ref|ZP_01935993.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J0161] >gi|153190278|ref|ZP_01937700.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J2818] >gi|153197805|ref|ZP_01942017.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes 10403S] >gi|153201586|ref|ZP_01943395.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes HPB2262] >gi|167014248|ref|ZP_02276781.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J1-194] >gi|167053018|ref|ZP_02279416.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL F2-515] >gi|167211821|ref|ZP_02282128.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes LO28] >gi|167214077|ref|ZP_02284384.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL R2-503] >gi|167453556|ref|ZP_02319779.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J2-064] >gi|20137363|sp|Q8Y8L2|ACPS_LISMO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797787|sp|Q721T0|ACPS_LISMF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|16410288|emb|CAC98963.1| lmo0885 [Listeria monocytogenes] >gi|46880385|gb|AAT03684.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b F2365] >gi|47016774|gb|EAL07693.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 1/2a F6854] >gi|47019533|gb|EAL10273.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b H7858] >gi|126941972|gb|EBA19844.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J0161] >gi|127632764|gb|EBA22206.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes 10403S] >gi|127766210|gb|EBA26552.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J2818] >gi|133727719|gb|EBA29417.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N1-017] >gi|133733649|gb|EBA35347.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes F6900] >gi|133735894|gb|EBA37592.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes HPB2262] (118 aa)
Score = 92, Expect = 5.7e-02, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIG+D+++++R +Q+  +    F +R+LT  E   + K  + + K  FLA  ++ KEA  KA
  S:     1 MIKGIGLDMIDLERVKQVVEKNPR-FIERVLTEKEIKQFEKY-EGNRKIEFLAGRFAAKEAYAKA 63
>gi|41408429|ref|NP_961265.1| 4'-phosphopantetheinyl transferase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|61211561|sp|Q73XH8|ACPS_MYCPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|41396785|gb|AAS04648.1| AcpS [Mycobacterium avium subsp. paratuberculosis K-10] (130 aa)
Score = 92, Expect = 5.8e-02, Identities = 25/88 (28%), Positives = 43/88 (48%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQI 89
           I+G+GIDLV I  F +   Q    F++   T T         K S  +  LA  W+ KEA+ KA +  +  F+Q  + +++   + ++
  S:     3 IVGVGIDLVSIPEFAEQVDQPGTVFSE---TFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSR--FAQRPVLREDIHRDIEV 85
>gi|153173817|ref|ZP_01929512.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N3-165] >gi|167403947|ref|ZP_02308762.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J2-003] >gi|168265455|ref|ZP_02687420.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J2-071] >gi|133730651|gb|EBA32349.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N3-165] (118 aa)
Score = 92, Expect = 5.9e-02, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIG+D+++++R +Q+  +    F +R+LT  E   + K  + + K  FLA  ++ KEA  KA
  S:     1 MIKGIGLDMIDLERVKQVVEKNPR-FIERVLTEKEIKQFEKY-EGNRKIEFLAGRFAAKEAYAKA 63
>gi|29375436|ref|NP_814590.1| holo-(acyl-carrier-protein) synthase [Enterococcus faecalis V583] >gi|59797855|sp|Q820V0|ACPS_ENTFA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|29342896|gb|AAO80660.1| holo-(acyl-carrier-protein) synthase [Enterococcus faecalis V583] (117 aa)
Score = 92, Expect = 5.9e-02, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI GIGID VE+ R + +  +    F +R+LT  E   + KL     +  FLA  ++ KEA  KA
  S:     1 MIKGIGIDAVELSRIKPIVEK-QGSFIQRVLTPNELTLFEKL-STKRQIEFLAGRFACKEAFSKA 63
>gi|172058813|ref|YP_001815273.1| holo-acyl-carrier-protein synthase [Exiguobacterium sibiricum 255-15] >gi|171991334|gb|ACB62256.1| holo-acyl-carrier-protein synthase [Exiguobacterium sibiricum 255-15] (128 aa)
Score = 91, Expect = 6.0e-02, Identities = 27/67 (40%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG+DLVE+++  Q L RQ      KR+LT+ E   +  L  D  +  +LA  ++ KEA  KA  
  S:     1 MIFGIGLDLVELEQIRQTLERQP--RIVKRVLTAEEQNRFYTL-SDKRQLEYLAGRFAAKEAFVKAFG 65
>gi|118602616|ref|YP_903831.1| holo-acyl-carrier-protein synthase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|189027342|sp|A1AWQ3.1|ACPS_RUTMC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|118567555|gb|ABL02360.1| holo-acyl-carrier-protein synthase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (127 aa)
Score = 91, Expect = 6.2e-02, Identities = 17/40 (42%), Positives = 25/40 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYA 40
           MI G+GID++ IKR E +  +    F KR+L+  E A +A
  S:     1 MIYGVGIDIINIKRVEHILSKNKQSFVKRVLSEHEQALFA 40
>gi|120405078|ref|YP_954907.1| 4'-phosphopantetheinyl transferase [Mycobacterium vanbaalenii PYR-1] >gi|119957896|gb|ABM14901.1| holo-acyl-carrier-protein synthase [Mycobacterium vanbaalenii PYR-1] (133 aa)
Score = 91, Expect = 6.2e-02, Identities = 25/64 (39%), Positives = 32/64 (50%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           I+GIGIDLV I  F +   +    FA+   T  E    A   K S  +  LA  W+ KEA+ KA
  S:     6 IVGIGIDLVSIPEFAEQVDRPGTVFAE-TFTPGERRDAAD--KSSSAARHLAARWAAKEAVIKA 66
>gi|146278607|ref|YP_001168766.1| 4'-phosphopantetheinyl transferase [Rhodobacter sphaeroides ATCC 17025] >gi|166198220|sp|A4WVP7.1|ACPS_RHOS5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|145556848|gb|ABP71461.1| holo-acyl-carrier-protein synthase [Rhodobacter sphaeroides ATCC 17025] (137 aa)
Score = 91, Expect = 6.3e-02, Identities = 27/67 (40%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R E+ LAR  D  F  R+ T  E    A+  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERVEKTLARFGDR-FRNRVFTPLE---QARAERRADVAGTYAKRWAAKEACSKALG 64
>gi|90416443|ref|ZP_01224374.1| 4'-phosphopantetheinyl transferase [marine gamma proteobacterium HTCC2207] >gi|90331642|gb|EAS46870.1| 4'-phosphopantetheinyl transferase [marine gamma proteobacterium HTCC2207] (125 aa)
Score = 91, Expect = 6.3e-02, Identities = 22/67 (32%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           M + IG D+VEI R  ++  +    F +R+L  +E   YA   +     +F+A  ++ KEAI KA+ 
  S:     1 MTIAIGTDIVEIARIAKVLERQAERFVERILCPSEQEQYASRGR---PVTFVATRFAAKEAIAKALG 64
>gi|37782752|gb|AAO43179.1| acyl carrier protein synthetase; AcpS [Mycobacterium smegmatis] (130 aa)
Score = 91, Expect = 6.3e-02, Identities = 23/64 (35%), Positives = 32/64 (50%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           I+G+GIDLV I  F +   +    FA+   T T       + K S  +  LA  W+ KEA+ KA
  S:     3 IVGVGIDLVSIPDFAEQVDRPGTVFAE---TFTPGERRDTVDKSSSAARHLAARWAAKEAVIKA 63
>gi|84515161|ref|ZP_01002524.1| 4'-phosphopantetheinyl transferase [Loktanella vestfoldensis SKA53] >gi|84511320|gb|EAQ07774.1| 4'-phosphopantetheinyl transferase [Loktanella vestfoldensis SKA53] (133 aa)
Score = 91, Expect = 6.3e-02, Identities = 26/67 (38%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R      +  + F  R+ T TE A  A+ R D+  +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIAGTLDRFGDRFRNRVFTPTEQAK-AEARHDTPGT--YAKRWAAKEACSKALG 64
>gi|164688911|ref|ZP_02212939.1| hypothetical protein CLOBAR_02559 [Clostridium bartlettii DSM 16795] >gi|164602115|gb|EDQ95580.1| hypothetical protein CLOBAR_02559 [Clostridium bartlettii DSM 16795] (126 aa)
Score = 91, Expect = 6.7e-02, Identities = 24/65 (36%), Positives = 39/65 (60%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           I GIGID++EI R E +  +T   F +R  T  E  ++   ++ + KS  +A +++ KEAI KA+
  S:     3 IFGIGIDIIEINRIENVLERTPR-FLERNFTEKEIDYF---KQKNFKSESIAGNFASKEAISKAI 63
>gi|145542370|ref|XP_001456872.1| hypothetical protein GSPATT00022647001 [Paramecium tetraurelia strain d4-2] >gi|124424686|emb|CAK89475.1| unnamed protein product [Paramecium tetraurelia] (129 aa)
Score = 91, Expect = 6.7e-02, Identities = 25/85 (29%), Positives = 46/85 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLAR-QTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYN 86
           I GIG+D+V  +R   + + Q    F  ++L  +E   +        +  FLA  W++KEA+ KA +  + +F ++EI +K+ + N
  S:     4 IKGIGVDIVNNQRMLNIIKAQYAERFLVKVLHPSEIEQFKGKSTIQLQQQFLASRWAVKEALVKASSFKELVFPEVEICRKHDKPN 89
>gi|187776661|ref|ZP_02993134.1| hypothetical protein CLOSPO_00176 [Clostridium sporogenes ATCC 15579] >gi|187775320|gb|EDU39122.1| hypothetical protein CLOSPO_00176 [Clostridium sporogenes ATCC 15579] (126 aa)
Score = 91, Expect = 6.7e-02, Identities = 29/79 (36%), Positives = 44/79 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPL-FSQLEIT 79
           MI GIG D++EI+R E+   +  N F  +L T  E   +    K + K  F+A  ++ KEA+ KA+   I+   F  +EIT
  S:     1 MIYGIGTDIIEIRRIEKAITRNKN-FTNKLFTKDEMDLW---EKKNFKLEFIAGRFAAKEAVSKALGTGIRDFNFKDIEIT 77
>gi|118619051|ref|YP_907383.1| 4'-phosphopantetheinyl transferase [Mycobacterium ulcerans Agy99] >gi|183983933|ref|YP_001852224.1| phosphopantetheinyl transferase AcpS [Mycobacterium marinum M] >gi|166198210|sp|A0PU93.1|ACPS_MYCUA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|118571161|gb|ABL05912.1| phosphopantetheinyl transferase AcpS [Mycobacterium ulcerans Agy99] >gi|183177259|gb|ACC42369.1| phosphopantetheinyl transferase AcpS [Mycobacterium marinum M] (130 aa)
Score = 91, Expect = 6.7e-02, Identities = 29/106 (27%), Positives = 50/106 (47%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQI------DPKIELLLSVSYSSNNIT 107
           I+G+GIDLV I  F +   Q    FA    T T         K S  +  LA  W+ KEA+ KA +  +  F+Q  +  ++   + ++       P++ L   ++    ++T
  S:     3 IVGVGIDLVSIPDFAEQVDQPGTAFAA---TFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSR--FAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGEIAKHLADVT 109
>gi|121605948|ref|YP_983277.1| 4'-phosphopantetheinyl transferase [Polaromonas naphthalenivorans CJ2] >gi|189027337|sp|A1VRS8.1|ACPS_POLNA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|120594917|gb|ABM38356.1| holo-acyl-carrier-protein synthase [Polaromonas naphthalenivorans CJ2] (130 aa)
Score = 91, Expect = 6.8e-02, Identities = 23/67 (34%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYA--KLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+G D+ +I+R      +    FA+R+L+  E A +     R      S+LA  +S KEA  KA+ 
  S:     1 MIYGLGTDICDIRRIRASLERHGERFAQRILSDAELATWTARSARWPDRGVSYLATRFSAKEAFSKAIG 69
>gi|163867990|ref|YP_001609194.1| 4'-phosphopantetheinyl transferase [Bartonella tribocorum CIP 105476] >gi|189027319|sp|A9IRM3.1|ACPS_BART1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|161017641|emb|CAK01199.1| acyl carrier protein synthase [Bartonella tribocorum CIP 105476] (133 aa)
Score = 91, Expect = 6.9e-02, Identities = 25/67 (37%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G DLV+I+R E++  +    F +R+ T  E      L+K+S  SS+ A  ++ KEA  KA+ 
  S:     1 MIVGLGNDLVDIRRIERMLVRYGERFIQRIFTDIERNRSENLKKNS--SSY-AKRFAAKEACAKALG 64
>gi|126461080|ref|YP_001042194.1| 4'-phosphopantetheinyl transferase [Rhodobacter sphaeroides ATCC 17029] >gi|166198219|sp|A3PGF6.1|ACPS_RHOS1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|126102744|gb|ABN75422.1| holo-acyl-carrier-protein synthase [Rhodobacter sphaeroides ATCC 17029] (137 aa)
Score = 91, Expect = 7.0e-02, Identities = 24/67 (35%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R E+   +    F  R+ T  E    AK  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRMEKTLARFGERFRNRVFTPLE---QAKAERRADVAGTYAKRWAAKEACSKALG 64
>gi|77462218|ref|YP_351722.1| 4'-phosphopantetheinyl transferase [Rhodobacter sphaeroides 2.4.1] >gi|90111947|sp|Q3J5W3|ACPS_RHOS4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|77386636|gb|ABA77821.1| Probable holo-acyl carrier protein synthase [Rhodobacter sphaeroides 2.4.1] (137 aa)
Score = 91, Expect = 7.1e-02, Identities = 24/67 (35%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R E+   +    F  R+ T  E    AK  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRMEKTLARFGERFRNRVFTPLE---QAKAERRADVAGTYAKRWAAKEACSKALG 64
>gi|114773404|ref|ZP_01450588.1| holo-(acyl-carrier protein) synthase [alpha proteobacterium HTCC2255] (130 aa)
Score = 91, Expect = 7.1e-02, Identities = 22/66 (33%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFEQLARQT--DNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+G+G D+V+I RFE++   +   +  A+++LT  E+  Y    + +  + FLA  +++KEA  KA+ 
  S:     3 IIGLGTDIVQISRFEEMEDTSVKRDRLAQKVLTPNEFDMYL---QHAHPARFLAKRFAVKEAAVKALG 67
>gi|167766637|ref|ZP_02438690.1| hypothetical protein CLOSS21_01143 [Clostridium sp. SS2/1] >gi|167711760|gb|EDS22339.1| hypothetical protein CLOSS21_01143 [Clostridium sp. SS2/1] (120 aa)
Score = 91, Expect = 7.5e-02, Identities = 26/64 (40%), Positives = 40/64 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYK 64
           MI GIG DLVEI R E++  +  +    R+ T+TE A YAK     + ++ LA ++++KEA+ K
  S:     1 MIAGIGTDLVEIYRIEEMILRGRHL--SRIFTTTELA-YAK-----DNATTLAGNFAVKEAVSK 56
>gi|85705110|ref|ZP_01036210.1| 4'-phosphopantetheinyl transferase [Roseovarius sp. 217] >gi|85670432|gb|EAQ25293.1| 4'-phosphopantetheinyl transferase [Roseovarius sp. 217] (136 aa)
Score = 91, Expect = 7.5e-02, Identities = 23/67 (34%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R  +   +  + F  R+ T  E    AK  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIARTLERFGDRFRNRVFTPVE---QAKAERRADVAGTYAKRWAAKEACSKALG 64
>gi|15643455|ref|NP_228501.1| holo-(acyl carrier protein) synthase [Thermotoga maritima MSB8] >gi|170288041|ref|YP_001738279.1| holo-acyl-carrier-protein synthase [Thermotoga sp. RQ2] >gi|8134303|sp|Q9WZF6|ACPS_THEMA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|4981215|gb|AAD35774.1|AE001741_7 holo-(acyl carrier protein) synthase [Thermotoga maritima MSB8] >gi|170175544|gb|ACB08596.1| holo-acyl-carrier-protein synthase [Thermotoga sp. RQ2] (169 aa)
Score = 90, Expect = 8.1e-02, Identities = 22/67 (32%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+GID++E++R           FA+R+L  +E   +   ++  E   F+A  ++LKEA +KA+ 
  S:     1 MIVGVGIDVLEVER-------VPEKFAERILGESEKRLFLTRKRRRE---FIAGRFALKEAFFKALG 57
>gi|145223120|ref|YP_001133798.1| 4'-phosphopantetheinyl transferase [Mycobacterium gilvum PYR-GCK] >gi|145215606|gb|ABP45010.1| 4'-phosphopantetheinyl transferase [Mycobacterium gilvum PYR-GCK] (133 aa)
Score = 90, Expect = 8.3e-02, Identities = 25/64 (39%), Positives = 32/64 (50%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           I+GIGIDLV I  F +   +    FA+   T  E    A   K S  +  LA  W+ KEA+ KA
  S:     6 IVGIGIDLVSIPDFAEQVDRPGTVFAE-TFTPGERRDAAD--KSSSAARHLAARWAAKEAVIKA 66
>gi|149200808|ref|ZP_01877783.1| 4'-phosphopantetheinyl transferase [Roseovarius sp. TM1035] >gi|149145141|gb|EDM33167.1| 4'-phosphopantetheinyl transferase [Roseovarius sp. TM1035] (136 aa)
Score = 90, Expect = 8.3e-02, Identities = 23/67 (34%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R  +   +  + F  R+ T  E    AK  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIARTLERFGDRFRNRVFTEVE---QAKAERRADVAGTYAKRWAAKEACSKALG 64
>gi|56962579|ref|YP_174305.1| 4'-phosphopantetheinyl transferase [Bacillus clausii KSM-K16] >gi|59797662|sp|Q5WJW1|ACPS_BACSK Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56908817|dbj|BAD63344.1| holo-[acyl-carrier protein] synthase [Bacillus clausii KSM-K16] (117 aa)
Score = 90, Expect = 8.3e-02, Identities = 23/42 (54%), Positives = 28/42 (66%)
  Q:     1 MILGIGIDLVEIKRFE-QLARQTDNCFAKRLLTSTEYAHYAKL 42
           MI+GIGIDL+E+KR E   ARQ    F  R+LTS E    A+L
  S:     1 MIVGIGIDLIELKRIEAAFARQPR--FPGRVLTSYEQDQMAQL 41
>gi|187603759|ref|ZP_02989971.1| holo-acyl-carrier-protein synthase [Exiguobacterium sp. AT1b] >gi|187484534|gb|EDU22526.1| holo-acyl-carrier-protein synthase [Exiguobacterium sp. AT1b] (122 aa)
Score = 90, Expect = 8.4e-02, Identities = 24/67 (35%), Positives = 38/67 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG+D+VE+ R  +  +Q    F KRLLT  EY   ++      +  F++  ++ KEA  KA+ 
  S:     1 MIVGIGVDIVELDRMARSMKQPR--FLKRLLTDAEY-ELSQQYPLPRQIEFVSGRFAAKEAYAKAIG 64
>gi|118587963|ref|ZP_01545373.1| 4'-phosphopantetheinyl transferase [Stappia aggregata IAM 12614] >gi|118439585|gb|EAV46216.1| 4'-phosphopantetheinyl transferase [Stappia aggregata IAM 12614] (143 aa)
Score = 90, Expect = 9.2e-02, Identities = 23/68 (33%), Positives = 37/68 (54%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNH 68
           MILGIG DL++I+R E+   +    F  R+ T  E     K  + +E+++  A  ++ KEA  KA+  
  S:     1 MILGIGSDLIDIRRIEKTLERFGERFTNRVFTEIE---RTKSDRRAERAASYAKRFAAKEACSKALGS 65
>gi|118443197|ref|YP_877344.1| 4'-phosphopantetheinyl transferase [Clostridium novyi NT] >gi|166198195|sp|A0PY92.1|ACPS_CLONN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|118133653|gb|ABK60697.1| holo-(acyl-carrier-protein) synthase [Clostridium novyi NT] (138 aa)
Score = 90, Expect = 9.2e-02, Identities = 28/80 (35%), Positives = 43/80 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV--NHIKPLFSQLEITK 80
           MI+GIG D+VEI R  +   +T N F  +L T  E  ++   +   E   F+A  ++ KE++ KA+     K  F  +EI K
  S:     1 MIIGIGTDIVEIDRINKSIERTPN-FINKLFTKKEIEYFISRKMRPE---FIAGKFAAKESVAKALGTGFRKFGFRDIEIDK 78
>gi|15803089|ref|NP_289120.1| 4'-phosphopantetheinyl transferase [Escherichia coli O157:H7 EDL933] >gi|12516980|gb|AAG57678.1|AE005487_2 CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Escherichia coli O157:H7 EDL933] (126 aa)
Score = 90, Expect = 9.2e-02, Identities = 24/66 (36%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEY----AHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+     H+  +R       FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWEIWKTHHQPVR-------FLAKRFAVKEAAAKAFG 65
>gi|15832683|ref|NP_311456.1| 4'-phosphopantetheinyl transferase [Escherichia coli O157:H7 str. Sakai] >gi|82777989|ref|YP_404338.1| 4'-phosphopantetheinyl transferase [Shigella dysenteriae Sd197] >gi|157162042|ref|YP_001459360.1| 4'-phosphopantetheinyl transferase [Escherichia coli HS] >gi|168712504|ref|ZP_02744781.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4045] >gi|168721400|ref|ZP_02753677.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4206] >gi|168734028|ref|ZP_02766305.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4115] >gi|168748367|ref|ZP_02773389.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4113] >gi|168757776|ref|ZP_02782783.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4401] >gi|168761184|ref|ZP_02786191.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4501] >gi|168768667|ref|ZP_02793674.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4486] >gi|168773511|ref|ZP_02798518.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4196] >gi|168778540|ref|ZP_02803547.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4076] >gi|168787923|ref|ZP_02812930.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC869] >gi|168793808|ref|ZP_02818815.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4042] >gi|168798945|ref|ZP_02823952.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC508] >gi|195936710|ref|ZP_03082092.1| 4'-phosphopantetheinyl transferase [Escherichia coli O157:H7 str. EC4024] >gi|166918335|sp|A8A373.1|ACPS_ECOHS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|20137348|sp|Q8XA39|ACPS_ECO57 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90111949|sp|Q32CV8|ACPS_SHIDS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|13362900|dbj|BAB36852.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Escherichia coli O157:H7 str. Sakai] >gi|81242137|gb|ABB62847.1| CoA:apo-[acyl-carrier-protein] pantetheinephosphotransferase [Shigella dysenteriae Sd197] >gi|157067722|gb|ABV06977.1| holo-(acyl-carrier-protein) synthase [Escherichia coli HS] >gi|187770624|gb|EDU34468.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4196] >gi|188017051|gb|EDU55173.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4113] >gi|189003193|gb|EDU72179.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4076] >gi|189355287|gb|EDU73706.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4401] >gi|189362251|gb|EDU80670.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4486] >gi|189368469|gb|EDU86885.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC4501] >gi|189372393|gb|EDU90809.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC869] >gi|189378572|gb|EDU96988.1| holo-(acyl-carrier-protein) synthase [Escherichia coli O157:H7 str. EC508] (126 aa)
Score = 90, Expect = 9.4e-02, Identities = 24/66 (36%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEY----AHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+     H+  +R       FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWEIWKTHHQPVR-------FLAKRFAVKEAAAKAFG 65
>gi|26248928|ref|NP_754968.1| 4'-phosphopantetheinyl transferase [Escherichia coli CFT073] >gi|91211889|ref|YP_541875.1| 4'-phosphopantetheinyl transferase [Escherichia coli UTI89] >gi|110642725|ref|YP_670455.1| 4'-phosphopantetheinyl transferase [Escherichia coli 536] >gi|117624784|ref|YP_853697.1| 4'-phosphopantetheinyl transferase [Escherichia coli APEC O1] >gi|191173999|ref|ZP_03035516.1| holo-(acyl-carrier-protein) synthase [Escherichia coli F11] >gi|122422872|sp|Q1R8H0.1|ACPS_ECOUT Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|123343741|sp|Q0TES5.1|ACPS_ECOL5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198198|sp|A1AE93.1|ACPS_ECOK1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|29427790|sp|Q8FF19|ACPS_ECOL6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|26109334|gb|AAN81536.1|AE016764_218 Holo-[acyl-carrier protein] synthase [Escherichia coli CFT073] >gi|91073463|gb|ABE08344.1| holo-[acyl-carrier protein] synthase [Escherichia coli UTI89] >gi|110344317|gb|ABG70554.1| holo-[acyl-carrier protein] synthase [Escherichia coli 536] >gi|115513908|gb|ABJ01983.1| 4'-phosphopantetheinyl transferase [Escherichia coli APEC O1] >gi|190905690|gb|EDV65312.1| holo-(acyl-carrier-protein) synthase [Escherichia coli F11] (126 aa)
Score = 90, Expect = 9.5e-02, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEY----AHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILG+G D+VEI R E +  ++    A+R+L+  E+     H+  +R       FLA  +++KEA  KA
  S:     3 ILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWEIWKTHHQPVR-------FLAKRFAVKEAAAKA 63
>gi|168178917|ref|ZP_02613581.1| holo- synthase [Clostridium botulinum NCTC 2916] >gi|182670071|gb|EDT82047.1| holo- synthase [Clostridium botulinum NCTC 2916] (126 aa)
Score = 90, Expect = 9.6e-02, Identities = 25/67 (37%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ EI+R E+   +  N F  +L T  E A +    K + K  F+A  ++ KEA+ KA+ 
  S:     1 MIYGIGTDITEIRRIEKAIIRNKN-FTNKLFTKDEMALW---EKKNFKLEFIAGRFAAKEAVSKALG 63
>gi|187251723|ref|YP_001876205.1| holo-acyl-carrier-protein synthase [Elusimicrobium minutum Pei191] >gi|186971883|gb|ACC98868.1| holo-acyl-carrier-protein synthase [Elusimicrobium minutum Pei191] (120 aa)
Score = 90, Expect = 9.7e-02, Identities = 31/113 (27%), Positives = 61/113 (53%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQ-----RYNCQIDPKIELLLSVSYSSNNITAICLAQQ 114
           I G+G D+VE++R  + A+  ++   +R+ + TE   Y   +K+  K   LAV ++ KEA+YKA+         +E++  +        N +     ++ +S+S++ N  TA+ L  +
  S:     3 ITGLGTDIVEVERIAEFAK--NSAALERVFSKTEL-EYCLNKKN--KYEHLAVRFAAKEAVYKALPFGGVALKDIEVSNLSDGSPQVTVNDKRAETFKINISLSHTKNYATAVALVTE 115
>gi|183222004|ref|YP_001840000.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase; 4'-phosphopantetheinyl transferase AcpS) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189912071|ref|YP_001963626.1| Phosphopantetheinyl transferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776747|gb|ABZ95048.1| Phosphopantetheinyl transferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167780426|gb|ABZ98724.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase; 4'-phosphopantetheinyl transferase AcpS) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (127 aa)
Score = 90, Expect = 1.0e-01, Identities = 24/66 (36%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTS--TEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           +L +G D+VE +R  +L ++  + F KR+ T    EY H     K  +   FLA  ++ KEA+ KA+N
  S:     1 MLSVGNDIVENERIRELLQKHGDRFLKRVFTDDEVEYCH-----KHKDPVPFLAGRFACKEAVIKALN 63
>gi|110004589|emb|CAK98926.1| putative holo-acyl-carrier-protein synthase [Spiroplasma citri] (113 aa)
Score = 90, Expect = 1.0e-01, Identities = 20/66 (30%), Positives = 35/66 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           MI  +GID+++ KR      +    F +++L+  E   YA     + +  FLA  W++KEA+ K +
  S:     1 MIKNVGIDIIQNKRI-----KLSTAFIQKVLSPVEIKQYAAFFNKNAQRQFLAGRWAVKEALIKTL 61
>gi|167730399|emb|CAO81311.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) [Candidatus Cloacamonas acidaminovorans] (125 aa)
Score = 89, Expect = 1.0e-01, Identities = 24/67 (35%), Positives = 43/67 (64%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG D++E++R  Q A + ++ F ++L T++E   Y   + +S +S   AV ++ KEA+ KA+ 
  S:     1 MIIGIGCDIIEVERI-QNAIEKNSRFCEKLYTTSEI-EYCSGKANSYQS--FAVRFAAKEAVMKALG 63
>gi|109900009|ref|YP_663264.1| holo-acyl-carrier-protein synthase [Pseudoalteromonas atlantica T6c] >gi|122971572|sp|Q15PH8.1|ACPS_PSEA6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|109702290|gb|ABG42210.1| holo-acyl-carrier-protein synthase [Pseudoalteromonas atlantica T6c] (126 aa)
Score = 89, Expect = 1.1e-01, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:     2 ILGIGIDLVEIKRFE-QLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ++G+G D++EI R E QL R   +  A+R+LT+TE A +    + S  + +LA  ++ KEA  KA+ 
  S:     3 VMGLGTDIIEIGRIEKQLTR--SHRLAQRVLTATELAIF---DEHSFPARYLAKRFAAKEAAVKALG 64
>gi|118472820|ref|YP_889014.1| 4'-phosphopantetheinyl transferase [Mycobacterium smegmatis str. MC2 155] >gi|166198206|sp|A0R1H6.1|ACPS_MYCS2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|118174107|gb|ABK75003.1| holo-(acyl-carrier-protein) synthase [Mycobacterium smegmatis str. MC2 155] (130 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/64 (37%), Positives = 32/64 (50%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           I+G+GIDLV I  F +   +    FA+   T  E    A   K S  +  LA  W+ KEA+ KA
  S:     3 IVGVGIDLVSIPDFAEQVDRPGTVFAE-TFTPGERRDAAD--KSSSAARHLAARWAAKEAVIKA 63
>gi|108800613|ref|YP_640810.1| 4'-phosphopantetheinyl transferase [Mycobacterium sp. MCS] >gi|119869752|ref|YP_939704.1| 4'-phosphopantetheinyl transferase [Mycobacterium sp. KMS] >gi|126436237|ref|YP_001071928.1| 4'-phosphopantetheinyl transferase [Mycobacterium sp. JLS] >gi|123368957|sp|Q1B5T0.1|ACPS_MYCSS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198207|sp|A3Q2R0.1|ACPS_MYCSJ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198208|sp|A1UJA6.1|ACPS_MYCSK Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|108771032|gb|ABG09754.1| phosphopantethiene--protein transferase domain protein [Mycobacterium sp. MCS] >gi|119695841|gb|ABL92914.1| holo-acyl-carrier-protein synthase [Mycobacterium sp. KMS] >gi|126236037|gb|ABN99437.1| holo-acyl-carrier-protein synthase [Mycobacterium sp. JLS] (130 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/64 (37%), Positives = 32/64 (50%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           I+G+GIDLV I  F +   +    FA+   T  E    A   K S  +  LA  W+ KEA+ KA
  S:     3 IVGVGIDLVSIPDFAEQVDRPGTVFAE-TFTPGERRDAAD--KSSSAARHLAARWAAKEAVIKA 63
>gi|145588597|ref|YP_001155194.1| holo-acyl-carrier-protein synthase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047003|gb|ABP33630.1| holo-acyl-carrier-protein synthase [Polynucleobacter sp. QLW-P1DMWA-1] (130 aa)
Score = 89, Expect = 1.1e-01, Identities = 21/67 (31%), Positives = 42/67 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYA-KLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           MI+GIG D+++I+R +    +T+   A+++L   E   +  +L ++ ++  +FLA  ++ KEA  KA+ 
  S:     1 MIIGIGTDILQIERLQAAYDRTNGRLAEKVLGPDEMLVFKHRLARNHKRGIAFLATRFAAKEAFSKAIG 69
>gi|56459914|ref|YP_155195.1| phosphopantetheinyl transferase (holo-ACP synthase) [Idiomarina loihiensis L2TR] >gi|61211404|sp|Q5R110|ACPS_IDILO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56178924|gb|AAV81646.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Idiomarina loihiensis L2TR] (126 aa)
Score = 89, Expect = 1.1e-01, Identities = 26/66 (39%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I G+G D+VE+ R EQ LAR   N   KR+LT  E     ++    ++++FLA  ++ KEA  KA  
  S:     3 IWGLGTDIVEVARIEQSLAR--GNSLVKRVLTPKE---QEEMTASVDEAAFLAKRFAAKEACSKAFG 64
>gi|39996902|ref|NP_952853.1| holo-(acyl-carrier-protein) synthase [Geobacter sulfurreducens PCA] >gi|61211570|sp|Q74C71|ACPS_GEOSL Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|39983790|gb|AAR35180.1| holo-(acyl-carrier-protein) synthase [Geobacter sulfurreducens PCA] (126 aa)
Score = 89, Expect = 1.1e-01, Identities = 23/65 (35%), Positives = 36/65 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI G GID+V+I RF++L  + +    +RL T  E  + A   + S+     A+ ++ KEA  KA
  S:     1 MIFGTGIDIVDITRFDRLVEEGNVRLFERLFTPHEMEYCAGKARSSQH---YALRFAAKEAFLKA 62
>gi|83951641|ref|ZP_00960373.1| 4'-phosphopantetheinyl transferase [Roseovarius nubinhibens ISM] >gi|83836647|gb|EAP75944.1| 4'-phosphopantetheinyl transferase [Roseovarius nubinhibens ISM] (143 aa)
Score = 89, Expect = 1.2e-01, Identities = 25/67 (37%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R      +  + F  R+ T TE    A+ R D+  +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIAGTLERFGDRFRNRVFTETEQ-RKAEARADT--AGTYAKRWAAKEACSKALG 64
>gi|153939870|ref|YP_001392757.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum F str. Langeland] >gi|152935766|gb|ABS41264.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum F str. Langeland] (126 aa)
Score = 89, Expect = 1.2e-01, Identities = 25/67 (37%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ EI+R E+   +  N F  +L T  E   +   +K + K  F+A  ++ KEAI KA+ 
  S:     1 MIYGIGTDITEIRRIEKAITRNKN-FINKLFTKNEMDLW---KKKNFKLEFIAGRFAAKEAISKALG 63
>gi|195977513|ref|YP_002122757.1| holo-[acyl-carrier-protein] synthase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974218|gb|ACG61744.1| holo-[acyl-carrier-protein] synthase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (118 aa)
Score = 89, Expect = 1.3e-01, Identities = 24/67 (35%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G GIDL +I   E++  + +  FA+++LT  E A + +   +  K ++LA  W+ KEA  KA+ 
  S:     1 MIVGHGIDLQDISAIEKVYLR-NARFARKVLTDKELALFEQFSHN-RKMTYLAGRWAGKEAFSKAMG 65
>gi|163857570|ref|YP_001631868.1| 4'-phosphopantetheinyl transferase [Bordetella petrii DSM 12804] >gi|163261298|emb|CAP43600.1| putative holo-[acyl-carrier-protein] synthase [Bordetella petrii] (145 aa)
Score = 89, Expect = 1.3e-01, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:     2 ILGIGIDLVEIKRFEQ-LARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG+DL+ I R E+ LAR  D  FA+++L   E    H  + R  +    FLA  ++ KEA  KA+ 
  S:    16 IAGIGMDLLRIDRVERALARHGDR-FAEKILGPEELQKFHARRARDAARGVRFLATRFAAKEAFSKAIG 83
>gi|21672528|ref|NP_660595.1| holo-[acyl-carrier protein] synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25008076|sp|Q8K9R3|ACPS_BUCAP Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|21623151|gb|AAM67806.1| holo-[acyl-carrier protein] synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (126 aa)
Score = 89, Expect = 1.3e-01, Identities = 30/81 (37%), Positives = 48/81 (59%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-----HIKPLFSQLEITKKN 82
           I+GIG D++EI R + +     +  A+R+L+  E   Y K+ K+  K  FLA  +++KEA  KA+       IK  F+Q+E+   N
  S:     3 IIGIGTDIIEIFRIKNIVYNFKDKLAERILSVQELEKY-KVNKNPIK--FLAKRFAVKEAASKALGTGISYGIK--FNQIELYNNN 83
>gi|88812353|ref|ZP_01127603.1| 4'-phosphopantetheinyl transferase [Nitrococcus mobilis Nb-231] >gi|88790360|gb|EAR21477.1| 4'-phosphopantetheinyl transferase [Nitrococcus mobilis Nb-231] (127 aa)
Score = 88, Expect = 1.4e-01, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+GIG D+V+ +R   +  +    FA+R+LT  E A +  L     +  FLA  +++KEA  KA+ 
  S:     3 IVGIGADVVDTERIRAIWGRHGQRFAQRILTLAERAEWNGL-----EVGFLARRFAVKEAAAKALG 63
>gi|83311355|ref|YP_421619.1| 4'-phosphopantetheinyl transferase [Magnetospirillum magneticum AMB-1] >gi|123541930|sp|Q2W515.1|ACPS_MAGMM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|82946196|dbj|BAE51060.1| Phosphopantetheinyl transferase [Magnetospirillum magneticum AMB-1] (131 aa)
Score = 88, Expect = 1.5e-01, Identities = 23/67 (34%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G DLV+I+R E    +    F  ++ T  E A  A+ R    +S   A  ++ KEA+ KA+ 
  S:     1 MIIGLGNDLVDIRRIEDSLERFGERFIAKVFTEAERA-TAERRSGRARSGAYAKRFAAKEALVKALG 66
>gi|171463195|ref|YP_001797308.1| holo-acyl-carrier-protein synthase [Polynucleobacter necessarius STIR1] >gi|171192733|gb|ACB43694.1| holo-acyl-carrier-protein synthase [Polynucleobacter necessarius STIR1] (136 aa)
Score = 88, Expect = 1.5e-01, Identities = 21/67 (31%), Positives = 41/67 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYA-KLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           MI+GIG D+++I+R +    +T    A+++L   E   +  +L ++ ++  +FLA  ++ KEA  KA+ 
  S:     1 MIIGIGTDILQIERLQAAYDRTKGRLAEKILGPDEMLVFQHRLARNHKRGIAFLATRFAAKEAFSKAIG 69
>gi|85057603|ref|YP_456519.1| holo-[acyl-carrier-protein] synthase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789708|gb|ABC65440.1| holo-[acyl-carrier-protein] synthase [Aster yellows witches'-broom phytoplasma AYWB] (126 aa)
Score = 88, Expect = 1.5e-01, Identities = 24/62 (38%), Positives = 38/62 (61%)
  Q:     4 GIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
            IGIDLVEIK+ +++ +      A R+L+S E+  Y  +     + +FLA  W+ KEA++KA
  S:     5 NIGIDLVEIKKIKKIGKDI---LAARILSSEEHQIYQTIPNTQSQLTFLAGRWASKEALFKA 63
>gi|15794913|ref|NP_284735.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis Z2491] >gi|20137556|sp|Q9RQW2|ACPS_NEIMA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|6274537|gb|AAF06685.1|AF163663_10 putative holo-[acyl-carrier protein] synthase Dpj [Neisseria meningitidis] >gi|121052792|emb|CAM09138.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis Z2491] (125 aa)
Score = 88, Expect = 1.5e-01, Identities = 17/44 (38%), Positives = 27/44 (61%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRK 44
           MI GIG D+V +KR  +L+++    FA+R+LT  E   + +  K
  S:     1 MIYGIGTDIVSLKRIVRLSKKFGQAFAERILTPEELLEFPQAGK 44
>gi|149913467|ref|ZP_01902000.1| holo-(acyl-carrier-protein) synthase [Roseobacter sp. AzwK-3b] >gi|149812587|gb|EDM72416.1| holo-(acyl-carrier-protein) synthase [Roseobacter sp. AzwK-3b] (137 aa)
Score = 88, Expect = 1.5e-01, Identities = 25/67 (37%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R      +  + F  R+ T  E  H A+ R+D   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIAGTLERFGDRFRNRVFTEIEQ-HKAERRQDV--AGTYAKRWAAKEACSKALG 64
>gi|187478946|ref|YP_786970.1| holo-[acyl-carrier protein] synthase [Bordetella avium 197N] >gi|115423532|emb|CAJ50068.1| holo-[acyl-carrier protein] synthase [Bordetella avium 197N] (147 aa)
Score = 88, Expect = 1.5e-01, Identities = 22/66 (33%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHY-AKLRKDSEKS-SFLAVHWSLKEAIYKAVN 67
           I GIG+DL+ I+R      +    FA+++L   E   + A+  +D+ +   FLA  ++ KEA  KA+ 
  S:    10 IAGIGLDLIRIERIAHALERHGERFARKVLGEQEMEKFLARSARDTVRGIRFLATRFAAKEAFSKAIG 77
>gi|94496066|ref|ZP_01302645.1| holo-(acyl-carrier-protein) synthase [Sphingomonas sp. SKA58] >gi|94424758|gb|EAT09780.1| holo-(acyl-carrier-protein) synthase [Sphingomonas sp. SKA58] (133 aa)
Score = 88, Expect = 1.6e-01, Identities = 23/67 (34%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G DL  I+R +    +  + F +R+ T  E A  A  R+   ++  LA  ++ KEA  KAV 
  S:     1 MIIGLGSDLCNIERIQNSLDRFGDRFIQRVFTPVEQAKAA--RRPLTRAGTLAKRFAAKEAFSKAVG 65
>gi|148264368|ref|YP_001231074.1| holo-acyl-carrier-protein synthase [Geobacter uraniireducens Rf4] >gi|146397868|gb|ABQ26501.1| holo-acyl-carrier-protein synthase [Geobacter uraniireducens Rf4] (129 aa)
Score = 88, Expect = 1.6e-01, Identities = 22/67 (32%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G G+D+V+I RFE+     +    +R+ T  E   Y   +K S +    A+ ++ KEA  KA+ 
  S:     5 MIFGTGVDIVDISRFERFVHDGNVALLQRIFTPLEL-DYCAAKKHSAQH--YALRFAAKEAFLKALG 68
>gi|39938926|ref|NP_950692.1| phosphopantetheinyl transferase [Onion yellows phytoplasma OY-M] >gi|61211527|sp|Q6YQD4|ACPS_ONYPE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|39722035|dbj|BAD04525.1| phosphopantetheinyl transferase [Onion yellows phytoplasma OY-M] (127 aa)
Score = 88, Expect = 1.7e-01, Identities = 24/62 (38%), Positives = 39/62 (62%)
  Q:     4 GIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
            IGIDLVEIK+ +++ +      A R+L+S E+  Y  ++    + +FLA  W+ KEA++KA
  S:     3 NIGIDLVEIKKIKKIGKDI---LAARILSSEEHQIYQIIQNPQSQLTFLAGRWASKEALFKA 61
>gi|187935448|ref|YP_001887552.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum B str. Eklund 17B] >gi|187723601|gb|ACD24822.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum B str. Eklund 17B] (123 aa)
Score = 88, Expect = 1.7e-01, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           MI GIG D+VEI+R ++  +   N F  R  T  E   Y KLRK +  +  ++ +++ KEA+ KA+
  S:     1 MIRGIGTDIVEIERIKKAIKSNPN-FINRFFTQKE-IEYFKLRKFNANT--ISGNFAAKEAVSKAL 62
>gi|57239071|ref|YP_180207.1| Holo-[acyl-carrier protein] synthase [Ehrlichia ruminantium str. Welgevonden] >gi|58579014|ref|YP_197226.1| Holo-[acyl-carrier protein] synthase [Ehrlichia ruminantium str. Welgevonden] >gi|81557320|sp|Q5HBI7|ACPS_EHRRW Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|57161150|emb|CAH58063.1| putative holo-[acyl-carrier-protein] synthase [Ehrlichia ruminantium str. Welgevonden] >gi|58417640|emb|CAI26844.1| Holo-[acyl-carrier protein] synthase [Ehrlichia ruminantium str. Welgevonden] (123 aa)
Score = 88, Expect = 1.7e-01, Identities = 34/98 (34%), Positives = 46/98 (46%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN-HIKPLFSQLEITKKNQRYN--------CQIDPKIELLLS 98
           MI+GIGID+V I R   L ++  N F K++ +  E     K      K+   A  ++ KEA  KA+           +IT  N  Y           ID K EL LS
  S:     1 MIVGIGIDIVYIPRILNLWKKFGNKFLKKVFSQEEIKDSNKYTSCEGKARHFAKRFAAKEAYVKALGTGFGKSIKMSDITTYNTLYGKPQITVKKSNIDYKAELSLS 107
>gi|84500564|ref|ZP_00998813.1| 4'-phosphopantetheinyl transferase [Oceanicola batsensis HTCC2597] >gi|84391517|gb|EAQ03849.1| 4'-phosphopantetheinyl transferase [Oceanicola batsensis HTCC2597] (138 aa)
Score = 87, Expect = 1.8e-01, Identities = 23/67 (34%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R +    +  + F  R+ T TE     K  + ++ +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIQGTLDRFGDRFRNRVFTETE---QRKAERRADVAGTYAKRWAAKEACSKALG 64
>gi|188588811|ref|YP_001922489.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum E3 str. Alaska E43] >gi|188499092|gb|ACD52228.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum E3 str. Alaska E43] (123 aa)
Score = 87, Expect = 1.8e-01, Identities = 27/78 (34%), Positives = 45/78 (57%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEI 78
           MI GIG D+VEI+R ++ A +++  F  R  T  E   Y KLRK +  +  ++ +++ KEA+ KA+      F  ++I
  S:     1 MIKGIGTDIVEIERIKK-AIESNPNFINRFFTEKE-IEYFKLRKFNANT--ISGNFAAKEAVSKALGSGFRGFGLMDI 74
>gi|161612653|ref|YP_001586618.1| 4'-phosphopantetheinyl transferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|189027345|sp|A9N1T5.1|ACPS_SALPB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|161362017|gb|ABX65785.1| hypothetical protein SPAB_00349 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (126 aa)
Score = 87, Expect = 1.8e-01, Identities = 22/66 (33%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILG+G D+VEI R E +  ++    A+R+L+  E+  +       +   FLA  +++KEA  KA  
  S:     3 ILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWDIW---ETHQQPVRFLAKRFAVKEAAAKAFG 65
>gi|189485216|ref|YP_001956157.1| phosphopantetheinyl transferase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287175|dbj|BAG13696.1| phosphopantetheinyl transferase [uncultured Termite group 1 bacterium phylotype Rs-D17] (111 aa)
Score = 87, Expect = 1.9e-01, Identities = 29/110 (26%), Positives = 63/110 (57%)
  Q:     3 LGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKI--------ELLLSVSYSSNNITAICLA 112
           + +GID+ E++RF +  R  D  F +R+    E + Y+  RK+   + +LA  ++ KEA++KA++     F+  +I+ +N +      P++         + +S+S++   + A+ +A
  S:     1 MNVGIDIEEVERFVKYVR--DKKFLERIFAKEEIS-YSIPRKNV--AQYLAARFAAKEAVWKALSTRNKKFTIADISVRNTKDG---KPQVYIKNKKYKRIDISLSHTDKYVAAVAIA 110
>gi|163733864|ref|ZP_02141306.1| 4'-phosphopantetheinyl transferase [Roseobacter litoralis Och 149] >gi|161392975|gb|EDQ17302.1| 4'-phosphopantetheinyl transferase [Roseobacter litoralis Och 149] (134 aa)
Score = 87, Expect = 2.0e-01, Identities = 25/67 (37%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R  +   +  + F  R+ T  E A  A+ R+D   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIARTLDRFGDRFRNRVFTDIEQAK-AERRRDV--AGTYAKRWAAKEACSKALG 64
>gi|110600519|ref|ZP_01388737.1| holo-(acyl-carrier-protein) synthase:phosphopantethiene--protein transferase domain [Geobacter sp. FRC-32] >gi|110548732|gb|EAT61940.1| holo-(acyl-carrier-protein) synthase:phosphopantethiene--protein transferase domain [Geobacter sp. FRC-32] (125 aa)
Score = 87, Expect = 2.1e-01, Identities = 21/67 (31%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G G+D+V+I RF++   + +    +R+ T  E   Y   +K S +    A+ ++ KEA  KA+ 
  S:     1 MIYGTGVDIVDISRFQRFVSENNTSLLQRVFTPREL-EYCSGKKHSAQH--FALRFAAKEAFLKALG 64
>gi|95930466|ref|ZP_01313202.1| phosphopantethiene--protein transferase domain [Desulfuromonas acetoxidans DSM 684] >gi|95133506|gb|EAT15169.1| phosphopantethiene--protein transferase domain [Desulfuromonas acetoxidans DSM 684] (127 aa)
Score = 87, Expect = 2.1e-01, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I GIG D+V+++RF++   + +    +RL T  E   YA  RK +  +  LA  ++ KEA  KA+ 
  S:     3 IAGIGTDIVDVERFDRFIDEDNQTLLQRLFTPGEL-DYALPRKCA--AQHLAARFACKEAFVKALG 65
>gi|99082401|ref|YP_614555.1| 4'-phosphopantetheinyl transferase [Silicibacter sp. TM1040] >gi|123378677|sp|Q1GDH3.1|ACPS_SILST Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|99038681|gb|ABF65293.1| holo-(acyl-carrier-protein) synthase [Silicibacter sp. TM1040] (142 aa)
Score = 87, Expect = 2.1e-01, Identities = 23/67 (34%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R + +  +  + F  R+ T  E    AK  +  + +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIQGVLDRFGDRFRNRVFTDVE---QAKSERRLDVAGTYAKRWAAKEACSKALG 64
>gi|170756152|ref|YP_001783038.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum B1 str. Okra] >gi|169121364|gb|ACA45200.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum B1 str. Okra] (126 aa)
Score = 87, Expect = 2.2e-01, Identities = 25/67 (37%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ EI+R E+   +  N F  +L T  E   +    K + K  F+A  ++ KEAI KA+ 
  S:     1 MIYGIGTDITEIRRIEKAITRNKN-FINKLFTKNEMDLW---EKKNFKLEFIAGRFAAKEAISKALG 63
>gi|168181948|ref|ZP_02616612.1| holo- synthase [Clostridium botulinum Bf] >gi|182674784|gb|EDT86745.1| holo- synthase [Clostridium botulinum Bf] (126 aa)
Score = 86, Expect = 2.3e-01, Identities = 25/67 (37%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ EI+R E+   +  N F  +L T  E   +    K + K  F+A  ++ KEAI KA+ 
  S:     1 MIYGIGTDITEIRRIEKAITRNKN-FINKLFTKNEMDLW---EKKNFKLEFIAGRFAAKEAISKALG 63
>gi|30250248|ref|NP_842318.1| acpS: holo-(acyl-carrier-protein) synthase [Nitrosomonas europaea ATCC 19718] >gi|61211626|sp|Q820I1|ACPS_NITEU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|30181043|emb|CAD86233.1| acpS: holo-(acyl-carrier-protein) synthase [Nitrosomonas europaea ATCC 19718] (125 aa)
Score = 86, Expect = 2.3e-01, Identities = 24/67 (35%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG DLV+  R      +    FA+R+L  +E+  Y +  K    + FLA  ++ KEA  KA  
  S:     1 MIYGIGTDLVDPARIASSLERYGEQFARRVLADSEWPDYLEHIK---PALFLAKRFAAKEAFSKATG 64
>gi|114770104|ref|ZP_01447642.1| 4'-phosphopantetheinyl transferase [alpha proteobacterium HTCC2255] >gi|114548941|gb|EAU51824.1| 4'-phosphopantetheinyl transferase [alpha proteobacterium HTCC2255] (133 aa)
Score = 86, Expect = 2.4e-01, Identities = 26/67 (38%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R ++   +    F  R+ T TE    A+ RKD   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIQKTIDRFGQRFKNRVFTVTEQ-DKAENRKDI--AGTYAKRWAAKEACSKALG 64
>gi|124265847|ref|YP_001019851.1| 4'-phosphopantetheinyl transferase [Methylibium petroleiphilum PM1] >gi|189027334|sp|A2SDH7.1|ACPS_METPP Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|124258622|gb|ABM93616.1| putative holo-(acyl-carrier protein) synthase [Methylibium petroleiphilum PM1] (132 aa)
Score = 86, Expect = 2.4e-01, Identities = 22/67 (32%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA--HYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ +I+R      +    FA+++L   E     Y   + ++   S+LA  +S KEA  KA+ 
  S:     1 MIFGIGTDICDIRRLRATYARRGERFAEKVLGPQELEVFRYRLAKVEARGLSYLATRFSAKEAFSKAIG 69
>gi|116625762|ref|YP_827918.1| holo-acyl-carrier-protein synthase [Solibacter usitatus Ellin6076] >gi|122252067|sp|Q01RT7.1|ACPS_SOLUE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116228924|gb|ABJ87633.1| holo-acyl-carrier-protein synthase [Solibacter usitatus Ellin6076] (125 aa)
Score = 86, Expect = 2.5e-01, Identities = 21/67 (31%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G G+DL E+ R ++   +  + F KR+ T  E A+   + + + K    A  ++ KEA  KA+ 
  S:     1 MIVGTGVDLAEVDRIQRSIERYGDKFIKRIYTPGEIAY---VERKANKFERYAARFAAKEAGMKAIG 64
>gi|23014393|ref|ZP_00054212.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Magnetospirillum magnetotacticum MS-1] (131 aa)
Score = 86, Expect = 2.6e-01, Identities = 24/79 (30%), Positives = 40/79 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEIT 79
           MI+G+G DLV+I+R E    +    F  ++ T  E A  A  R    ++   A  ++ KEA+ KA+      +  +E+T
  S:     1 MIIGLGNDLVDIRRIEDSLERFGQRFIDKVFTVAEQA-TADRRVGQARAGAYAKRFAAKEALVKALGKQGVGWRDMEVT 78
>gi|148269383|ref|YP_001243843.1| holo-acyl-carrier-protein synthase [Thermotoga petrophila RKU-1] >gi|147734927|gb|ABQ46267.1| holo-acyl-carrier-protein synthase [Thermotoga petrophila RKU-1] (169 aa)
Score = 85, Expect = 3.1e-01, Identities = 22/67 (32%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+G+G+D++EI R  +        FA+R+L   E   +    +  E   F+A  ++LKEA +KA+ 
  S:     1 MIIGVGVDILEIDRVPE-------KFAERILGKAEKRLFLARNRRKE---FIAGRFALKEAFFKALG 57
>gi|58617073|ref|YP_196272.1| Holo-[acyl-carrier protein] synthase [Ehrlichia ruminantium str. Gardel] >gi|75432815|sp|Q5FHL6|ACPS_EHRRG Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|58416685|emb|CAI27798.1| Holo-[acyl-carrier protein] synthase [Ehrlichia ruminantium str. Gardel] (123 aa)
Score = 85, Expect = 3.2e-01, Identities = 36/98 (36%), Positives = 49/98 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN------------------HIKPLFSQLEITKKNQRYNCQIDPKIELLLS 98
           MI+GIGID+V I R   L ++  N F K++ +  E     K      K+   A  ++ KEA  KA+                   H KP   Q+ + K N      ID K EL LS
  S:     1 MIVGIGIDVVYIPRILNLWKKFGNKFLKKVFSQEEIKDSNKYTSCEGKARHFAKRFAAKEAYVKALGTGFGKSIKMSDITTYNTLHGKP---QITVKKSN------IDYKAELSLS 107
>gi|119897937|ref|YP_933150.1| holo-[acyl-carrier-protein] synthase [Azoarcus sp. BH72] >gi|166198172|sp|A1K608.1|ACPS_AZOSB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|119670350|emb|CAL94263.1| holo-[acyl-carrier-protein] synthase [Azoarcus sp. BH72] (125 aa)
Score = 85, Expect = 3.2e-01, Identities = 23/67 (34%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+V I R      +    FA+R+L  +E   +   R   + + FLA  ++ KEA  KA+ 
  S:     1 MIHGIGTDIVHIARIRTSLERHGERFAERILAESEREAW---RASRDPARFLAKRFAAKEAFGKALG 64
>gi|85859374|ref|YP_461576.1| Holo- synthase [Syntrophus aciditrophicus SB] >gi|123516575|sp|Q2LTJ7.1|ACPS_SYNAS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|85722465|gb|ABC77408.1| Holo- synthase [Syntrophus aciditrophicus SB] (128 aa)
Score = 85, Expect = 3.3e-01, Identities = 20/61 (32%), Positives = 34/61 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEA 61
           M+ G GIDLV+I R E++  + D  F K++ +  E  + A       K +F A+H++ + A
  S:     1 MVHGTGIDLVDIDRLEKILMKWDMSFLKKVFSPAEIEYCA-------KRAFPAIHYAARFA 54
>gi|54023225|ref|YP_117467.1| 4'-phosphopantetheinyl transferase [Nocardia farcinica IFM 10152] >gi|61211422|sp|Q5Z0D8|ACPS_NOCFA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54014733|dbj|BAD56103.1| putative holo-ACP synthase [Nocardia farcinica IFM 10152] (145 aa)
Score = 85, Expect = 3.4e-01, Identities = 22/64 (34%), Positives = 31/64 (48%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           ILGIG+DLV I  F +   +T     +   T+ E  +      D  +S   A  W+ KEA+ KA
  S:     3 ILGIGLDLVTISEFAEQLERTGTTMLRESFTAGERRYCQSKGTDPARS--YAARWAAKEAVLKA 64
>gi|147676991|ref|YP_001211206.1| phosphopantetheinyl transferase [Pelotomaculum thermopropionicum SI] >gi|146273088|dbj|BAF58837.1| phosphopantetheinyl transferase [Pelotomaculum thermopropionicum SI] (153 aa)
Score = 85, Expect = 3.4e-01, Identities = 23/82 (28%), Positives = 47/82 (57%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHI--KPLFSQLEITKKNQ 83
           + GIG D++EI+R  + A +++  F +R+ T+ E   Y   ++D  + +  A  ++ KEA+ KA+        +S +EI + ++
  S:    28 LAGIGADIIEIERIRRAAERSNCRFLERVFTTAER-DYCDAKRD--RYACYAARFAAKEAVLKAMGRGLSGCRWSDVEIRRADE 108
>gi|148381341|ref|YP_001255882.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. ATCC 3502] >gi|153932139|ref|YP_001385718.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. ATCC 19397] >gi|153937698|ref|YP_001389124.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. Hall] >gi|148290825|emb|CAL84960.1| holo-[acyl-carrier protein] synthase [Clostridium botulinum A str. ATCC 3502] >gi|152928183|gb|ABS33683.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. ATCC 19397] >gi|152933612|gb|ABS39111.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. Hall] (126 aa)
Score = 85, Expect = 3.4e-01, Identities = 24/67 (35%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ EI+R E+   +  N F  +L T  E   +    K + K  F+A  ++ KEA+ KA+ 
  S:     1 MIYGIGTDITEIRRIEKAITRNKN-FINKLFTKNEMDLW---EKKNFKLEFIAGRFAAKEAVSKALG 63
>gi|170759721|ref|YP_001788730.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A3 str. Loch Maree] >gi|169406710|gb|ACA55121.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A3 str. Loch Maree] (126 aa)
Score = 85, Expect = 3.5e-01, Identities = 24/67 (35%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI GIG D+ EI+R E+   +  N F  +L T  E   +    K + K  F+A  ++ KEA+ KA+ 
  S:     1 MIYGIGTDITEIRRIEKAITRNKN-FINKLFTKNEMDLW---EKKNFKLEFIAGRFAAKEAVSKALG 63
>gi|16125805|ref|NP_420369.1| 4'-phosphopantetheinyl transferase [Caulobacter crescentus CB15] >gi|20137448|sp|Q9A807|ACPS_CAUCR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|13422945|gb|AAK23537.1| holo-(acyl-carrier-protein) synthase [Caulobacter crescentus CB15] (133 aa)
Score = 85, Expect = 3.6e-01, Identities = 24/67 (35%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG DL +I+R E+   +  + F  ++ T TE       RK    SS+ A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLCDIRRIEKSLERFGDRFTHKVFTETERTRSE--RKPDRASSY-AKRFAAKEACSKALG 64
>gi|15893780|ref|NP_347129.1| 4'-phosphopantetheinyl transferase [Clostridium acetobutylicum ATCC 824] >gi|20137419|sp|Q97LR5|ACPS_CLOAB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|15023349|gb|AAK78469.1|AE007563_9 Holo-acyl-carrier protein synthase [Clostridium acetobutylicum ATCC 824] (124 aa)
Score = 85, Expect = 3.7e-01, Identities = 21/67 (31%), Positives = 40/67 (59%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI G+G+D++EI R +  A   +  F ++L +  E A+   ++ +  K+ ++A  +S KEA+ KA+ 
  S:     1 MIKGVGVDIIEINRVKN-AIDRNYKFIEKLFSRREIAY---IKAEKTKAQYIAGRFSAKEAVSKALG 63
>gi|160874401|ref|YP_001553717.1| holo-acyl-carrier-protein synthase [Shewanella baltica OS195] >gi|189027347|sp|A9L5P0.1|ACPS_SHEB9 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|160859923|gb|ABX48457.1| holo-acyl-carrier-protein synthase [Shewanella baltica OS195] (127 aa)
Score = 85, Expect = 3.8e-01, Identities = 17/38 (44%), Positives = 24/38 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHY 39
           I+G+G D+VEI+R +    +  N  AKR+LT  E A Y
  S:     3 IVGLGTDIVEIERIQAHVARAGNKLAKRVLTEAELAIY 40
>gi|110678684|ref|YP_681691.1| 4'-phosphopantetheinyl transferase [Roseobacter denitrificans OCh 114] >gi|123362138|sp|Q16AI8.1|ACPS_ROSDO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|109454800|gb|ABG31005.1| holo-(acyl-carrier-protein) synthase [Roseobacter denitrificans OCh 114] (134 aa)
Score = 85, Expect = 3.8e-01, Identities = 25/67 (37%), Positives = 34/67 (50%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I+R  +   +  + F  R+ T  E    A+ RKD   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIERIARTLDRFGDRFRNRVFTDIEQVK-AERRKDV--AGTYAKRWAAKEACSKALG 64
>gi|40063414|gb|AAR38225.1| holo-(acyl-carrier-protein) synthase [uncultured marine bacterium 580] (126 aa)
Score = 84, Expect = 4.0e-01, Identities = 18/53 (33%), Positives = 33/53 (62%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLA 53
           MI G+G D+VE+ R  +   +  + FAK++L+  E+  +   +K++ K +FLA
  S:     1 MIYGVGTDVVEVSRIAKALERFGDGFAKKILSPEEFLVF---QKNNLKENFLA 50
>gi|91977120|ref|YP_569779.1| 4'-phosphopantetheinyl transferase [Rhodopseudomonas palustris BisB5] >gi|123749031|sp|Q136W1.1|ACPS_RHOPS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|91683576|gb|ABE39878.1| holo-(acyl-carrier-protein) synthase [Rhodopseudomonas palustris BisB5] (139 aa)
Score = 84, Expect = 4.0e-01, Identities = 23/67 (34%), Positives = 37/67 (55%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVH---WSLKEAIYKAVN 67
           MI+GIG DL++I R  ++  +    F  R+ T TE A     R+D + +   A +   ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDITRIAKVIERHGERFLDRIFTETERARAG--RRDKQPNLVAATYAKRFAAKEACSKALG 68
>gi|152992190|ref|YP_001357911.1| holo-[acyl-carrier protein] synthase [Sulfurovum sp. NBC37-1] >gi|166198242|sp|A6Q7U5.1|ACPS_SULNB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|151424051|dbj|BAF71554.1| holo-[acyl-carrier protein] synthase [Sulfurovum sp. NBC37-1] (119 aa)
Score = 84, Expect = 4.1e-01, Identities = 21/63 (33%), Positives = 34/63 (53%)
  Q:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           +G D+++I R E+L  +  + F +R L+  E A        ++K   LA +W+ KEAI KA  
  S:     3 VGTDIIQIDRIEKLIDRYGDTFKQRYLSKEEIAA-------AKKVETLAGYWAAKEAIAKAFG 58
>gi|42527412|ref|NP_972510.1| holo-(acyl-carrier-protein) synthase [Treponema denticola ATCC 35405] >gi|61211558|sp|Q73LF7|ACPS_TREDE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|41817997|gb|AAS12421.1| holo-(acyl-carrier-protein) synthase [Treponema denticola ATCC 35405] (123 aa)
Score = 84, Expect = 4.2e-01, Identities = 25/67 (37%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILG+GID+VE+ R E+     D    +R     E   Y   ++D    S LAV ++ KEA  KA+ 
  S:     1 MILGLGIDIVEVSRLEKW--LNDKKLLERFFNKEEL-EYVLSKRDGAAPS-LAVRFAAKEAFGKALG 63
>gi|124515691|gb|EAY57200.1| putative phosphopantetheinyl transferase [Leptospirillum sp. Group II UBA] (133 aa)
Score = 84, Expect = 4.2e-01, Identities = 20/66 (30%), Positives = 36/66 (54%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ++GIG D+V I+R E L  +    F  ++ T  E      +R+   K  +LA  +++KE++ KA+ 
  S:    10 LVGIGTDIVSIRRIEDLICRFGERFLDKVFTREE------VRESGGKPEYLAGRFAVKESVLKALG 69
>gi|88797951|ref|ZP_01113538.1| 4'-phosphopantetheinyl transferase [Reinekea sp. MED297] >gi|88779148|gb|EAR10336.1| 4'-phosphopantetheinyl transferase [Reinekea sp. MED297] (123 aa)
Score = 84, Expect = 4.3e-01, Identities = 22/64 (34%), Positives = 33/64 (51%)
  Q:     4 GIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           GIG D+V+I R   +  Q    F  R+LT  E   +    +  E  +FLA  ++ KEA+ KA+ 
  S:     3 GIGTDIVQISRIIGVYEQQSTRFIARILTDKEQVVFC---ERGESMNFLANRFAAKEAVSKALG 63
>gi|114327654|ref|YP_744811.1| holo-[acyl-carrier protein] synthase [Granulibacter bethesdensis CGDNIH1] >gi|122327375|sp|Q0BTG4.1|ACPS_GRABC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|114315828|gb|ABI61888.1| holo-[acyl-carrier protein] synthase [Granulibacter bethesdensis CGDNIH1] (145 aa)
Score = 84, Expect = 4.7e-01, Identities = 22/67 (32%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG D+ +I+R E +  +    F  R+ T+ E A  A+ R    +    A  ++ KEA  KA+ 
  S:     1 MIIGIGSDICDIRRIETVLERHGERFLSRVFTTAERAK-AERRNGRMRMGTYAKRFAAKEACAKALG 66
>gi|15611811|ref|NP_223462.1| 4'-phosphopantetheinyl transferase [Helicobacter pylori J99] >gi|7531039|sp|Q9ZL36|ACPS_HELPJ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|4155300|gb|AAD06316.1| HOLO-ACYL CARRIER PROTEIN SYNTHASE [Helicobacter pylori J99] (119 aa)
Score = 84, Expect = 4.8e-01, Identities = 25/62 (40%), Positives = 37/62 (59%)
  Q:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAV 66
           IGID+V I R E+  ++ +  F +R L+ +E      L KD  KSS +A  ++LKEA  KA+
  S:     2 IGIDIVSIARIEKCVKRFEMRFLERFLSPSEIV----LCKD--KSSSIAGFFALKEACSKAL 57
>gi|87312358|ref|ZP_01094450.1| acyl-carrier protein synthase [Blastopirellula marina DSM 3645] >gi|87284923|gb|EAQ76865.1| acyl-carrier protein synthase [Blastopirellula marina DSM 3645] (137 aa)
Score = 84, Expect = 4.8e-01, Identities = 22/66 (33%), Positives = 33/66 (50%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           I+GIG D++E  R  Q+  +    F  R+ T  E   Y   RK +  +   A  W+ KEA+ KA+ 
  S:     3 IVGIGTDIIECLRIAQMIERHGELFINRVYTPREI-DYCSSRKAA--TQHYAGRWAAKEAVLKAIG 65
>gi|78223091|ref|YP_384838.1| phosphopantethiene-protein transferase [Geobacter metallireducens GS-15] >gi|90111939|sp|Q39UG1|ACPS_GEOMG Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|78194346|gb|ABB32113.1| Phosphopantethiene-protein transferase [Geobacter metallireducens GS-15] (126 aa)
Score = 83, Expect = 5.3e-01, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKA 65
           MI G GID+V+I RFE+   + +    +RL T  E  + A     +  +   A+ ++ KEA  KA
  S:     1 MIFGTGIDIVDITRFERFLEERNTRLFERLFTIHEQEYCA---GKAHSAQHYALRFAAKEAFLKA 62
>gi|157374291|ref|YP_001472891.1| Holo-(acyl-carrier-protein) synthase [Shewanella sediminis HAW-EB3] >gi|189027350|sp|A8FSE0.1|ACPS_SHESH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157316665|gb|ABV35763.1| Holo-(acyl-carrier-protein) synthase [Shewanella sediminis HAW-EB3] (132 aa)
Score = 83, Expect = 5.4e-01, Identities = 20/37 (54%), Positives = 27/37 (72%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDN------C-FAKRLLTSTEYA 37
           MI+G+G D+VEI+R EQ   Q  +      C  AKR+LT +E A
  S:     1 MIVGLGTDIVEIERIEQKVPQAGDHEALAKCRLAKRVLTESEMA 44
>gi|13476440|ref|NP_108010.1| 4'-phosphopantetheinyl transferase [Mesorhizobium loti MAFF303099] >gi|20137423|sp|Q985A8|ACPS_RHILO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|14027201|dbj|BAB54155.1| acyl carrier protein synthase; AcpS [Mesorhizobium loti MAFF303099] (137 aa)
Score = 83, Expect = 5.6e-01, Identities = 22/67 (32%), Positives = 35/67 (52%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG DL++I+R E    +    F +R+ T  E A     R    +++  A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDIRRIENSLERHGQRFVQRIYTEVEQARSENRRA---RAASYAKRFAAKEACAKALG 64
>gi|75676111|ref|YP_318532.1| 4'-phosphopantetheinyl transferase [Nitrobacter winogradskyi Nb-255] >gi|90111942|sp|Q3SRB1|ACPS_NITWN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|74420981|gb|ABA05180.1| Holo-acyl carrier protein synthase [Nitrobacter winogradskyi Nb-255] (139 aa)
Score = 83, Expect = 5.7e-01, Identities = 25/67 (37%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           MI+GIG DL++I+R  ++  +  + F  R+ T  E A  A+ R  +EK   S  A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDIRRVAKVIERHGDRFLNRVFTEIERAK-AERRATNEKMVVSTYAKRFAAKEACAKALG 68
>gi|159042754|ref|YP_001531548.1| 4'-phosphopantetheinyl transferase [Dinoroseobacter shibae DFL 12] >gi|189027328|sp|A8LLD7.1|ACPS_DINSH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|157910514|gb|ABV91947.1| holo-acyl-carrier-protein synthase [Dinoroseobacter shibae DFL 12] (139 aa)
Score = 83, Expect = 5.7e-01, Identities = 23/67 (34%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEK--SSFLAVHWSLKEAIYKAVN 67
           MI+GIG DL  I+R E+   +  + F  R+ T  E     + + DS +  ++  A  W+ KEA  KA+ 
  S:     1 MIIGIGTDLANIERIERTLERFGDRFRHRVFTERE-----QRKADSRQQTAATYAKRWAAKEACSKALG 64
>gi|37523577|ref|NP_926954.1| acyl-carrier protein synthase [Gloeobacter violaceus PCC 7421] >gi|61211599|sp|Q7NE72|ACPS_GLOVI Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|35214582|dbj|BAC91949.1| acyl-carrier protein synthase [Gloeobacter violaceus PCC 7421] (132 aa)
Score = 83, Expect = 5.9e-01, Identities = 23/63 (36%), Positives = 32/63 (50%)
  Q:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           IG DLV I R E +  +    F  R+ T  E  HY  L     +++ LA  W+ KEA+ KA+ 
  S:    10 IGTDLVHIPRIEGMLERYGKQFLNRVYTEGE-QHYC-LASKPHRANRLAGRWAAKEAVTKALG 70
>gi|194333062|ref|YP_002014922.1| holo-acyl-carrier-protein synthase [Prosthecochloris aestuarii DSM 271] >gi|194310880|gb|ACF45275.1| holo-acyl-carrier-protein synthase [Prosthecochloris aestuarii DSM 271] (127 aa)
Score = 83, Expect = 5.9e-01, Identities = 29/113 (25%), Positives = 51/113 (45%)
  Q:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNH-IKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSNNITAICLAQQTPW 117
           IG+D+V+I R +    +    F +R+LT  E  H    RK  +  + +A  ++ KEA+ KA+   I   F    +   N  +   +   ++  L +  SS     I L+   P+
  S:    11 IGVDIVDISRIKASFEKYGESFLQRVLTGNEIRH---CRKKPDMMASVAARFAAKEALSKALGRGISEAFGWQSVEVLNDGFGRPVVNVLDKSLGIEASS---IKISLSHDGPF 118
>gi|68464841|ref|XP_723498.1| hypothetical protein CaO19.4812 [Candida albicans SC5314] >gi|68465218|ref|XP_723308.1| hypothetical protein CaO19.12275 [Candida albicans SC5314] >gi|46445335|gb|EAL04604.1| hypothetical protein CaO19.12275 [Candida albicans SC5314] >gi|46445532|gb|EAL04800.1| hypothetical protein CaO19.4812 [Candida albicans SC5314] (135 aa)
Score = 83, Expect = 6.1e-01, Identities = 36/113 (31%), Positives = 56/113 (49%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFA----KRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRY---NCQIDPKI----------ELLLSVSYSSNNITAICLAQQ 114
           +LGIG+D+V   RFE+L       F     KR+L         +      ++ +L   W+ KEA++K ++    L SQ E    NQ Y   +    P I          E  LS+S+  + + A  L Q+
  S:     7 VLGIGVDIVNSVRFERLLTAKSTSFGTRLSKRILHPEHELPLFQQMHSQRQAQYLTGSWAAKEALFKTLD----LNSQKEFN-FNQWYRFHDSNGKPFIWNDRYKLSDEEFHLSISHDDSLVIATVLRQK 131
>gi|126739725|ref|ZP_01755417.1| 4'-phosphopantetheinyl transferase [Roseobacter sp. SK209-2-6] >gi|126719371|gb|EBA16081.1| 4'-phosphopantetheinyl transferase [Roseobacter sp. SK209-2-6] (143 aa)
Score = 83, Expect = 6.2e-01, Identities = 25/67 (37%), Positives = 33/67 (49%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG DL  I R +    +  + F  R+ T TE    A+ R D   +   A  W+ KEA  KA+ 
  S:     1 MILGIGTDLANIDRIQGTLDRFGDRFRNRVFTETEQ-RKAERRLDV--AGTYAKRWAAKEACSKALG 64
>gi|139439472|ref|ZP_01772904.1| Hypothetical protein COLAER_01929 [Collinsella aerofaciens ATCC 25986] >gi|133775025|gb|EBA38845.1| Hypothetical protein COLAER_01929 [Collinsella aerofaciens ATCC 25986] (179 aa)
Score = 83, Expect = 6.2e-01, Identities = 21/64 (32%), Positives = 37/64 (57%)
  Q:     4 GIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           GIG+D+VEI R + +  +T + FA+R+ T  E A+       S  ++  A  ++ +EA+ KA+ 
  S:     5 GIGVDIVEISRMKSILEKTPS-FARRVFTEEERAY---CDASSRPAAHYASRFASREAVLKALG 64
>gi|15676363|ref|NP_273499.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis MC58] >gi|121635406|ref|YP_975651.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis FAM18] >gi|161870623|ref|YP_001599796.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis 053442] >gi|166198211|sp|A1KVH5.1|ACPS_NEIMF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|189027335|sp|A9M273.1|ACPS_NEIM0 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59798990|sp|P0A0Q5|ACPS_NEIMB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59798991|sp|P0A0Q6|ACPS_NEIMC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|6449091|gb|AAF08820.1|AF194079_7 Dpj [Neisseria meningitidis] >gi|7225677|gb|AAF40889.1| holo-(acyl-carrier-protein) synthase [Neisseria meningitidis MC58] >gi|120867112|emb|CAM10879.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis FAM18] >gi|161596176|gb|ABX73836.1| holo-(acyl-carrier protein) synthase [Neisseria meningitidis 053442] (125 aa)
Score = 82, Expect = 6.7e-01, Identities = 17/44 (38%), Positives = 25/44 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRK 44
           MI GIG D+V +KR  +L ++    FA R+LT  E   + +  K
  S:     1 MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGK 44
>gi|39935761|ref|NP_948037.1| 4'-phosphopantetheinyl transferase [Rhodopseudomonas palustris CGA009] >gi|61211522|sp|Q6N6C3|ACPS_RHOPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|39649614|emb|CAE28136.1| acyl carrier protein synthase [Rhodopseudomonas palustris CGA009] (146 aa)
Score = 82, Expect = 6.8e-01, Identities = 23/67 (34%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSE-KSSFLAVHWSLKEAIYKAVN 67
           MI+GIG DL++I R  ++  +    F  R+ T  E A   +  K SE  ++  A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDITRIAKVIERHGERFLDRVFTEAERAKAERRAKKSELVAATYAKRFAAKEACSKALG 68
>gi|167365093|ref|ZP_02299237.1| holo-acyl-carrier-protein synthase [Rhodopseudomonas palustris TIE-1] >gi|192291348|ref|YP_001991953.1| holo-acyl-carrier-protein synthase [Rhodopseudomonas palustris TIE-1] >gi|192285097|gb|ACF01478.1| holo-acyl-carrier-protein synthase [Rhodopseudomonas palustris TIE-1] (146 aa)
Score = 82, Expect = 7.1e-01, Identities = 23/67 (34%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSE-KSSFLAVHWSLKEAIYKAVN 67
           MI+GIG DL++I R  ++  +    F  R+ T  E A   +  K SE  ++  A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDITRIAKVIERHGERFLDRVFTEAERAKAERRAKKSELVAATYAKRFAAKEACSKALG 68
>gi|88658154|ref|YP_507542.1| holo-(acyl-carrier-protein) synthase [Ehrlichia chaffeensis str. Arkansas] >gi|123763756|sp|Q2GG91.1|ACPS_EHRCR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|88599611|gb|ABD45080.1| holo-(acyl-carrier-protein) synthase [Ehrlichia chaffeensis str. Arkansas] (123 aa)
Score = 82, Expect = 7.1e-01, Identities = 22/67 (32%), Positives = 31/67 (46%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MILGIG D+V + R   L ++    F KR+ +  E     K      +    A  ++ KEA  KAV 
  S:     1 MILGIGTDIVYVPRISNLWKKFGTKFLKRVFSEKEIEDSKKYTNFDAQVRHFAKRFAAKEAYVKAVG 67
>gi|59801845|ref|YP_208557.1| putative acyl-carrier protein synthase [Neisseria gonorrhoeae FA 1090] >gi|194099316|ref|YP_002002414.1| putative acyl-carrier protein synthase [Neisseria gonorrhoeae NCCP11945] >gi|75432414|sp|Q5F6P2|ACPS_NEIG1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59718740|gb|AAW90145.1| putative acyl-carrier protein synthase [Neisseria gonorrhoeae FA 1090] >gi|193934606|gb|ACF30430.1| putative acyl-carrier protein synthase [Neisseria gonorrhoeae NCCP11945] (125 aa)
Score = 82, Expect = 7.1e-01, Identities = 17/44 (38%), Positives = 25/44 (56%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRK 44
           MI GIG D+V +KR  +L ++    FA R+LT  E   + +  K
  S:     1 MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGK 44
>gi|148256034|ref|YP_001240619.1| 4'-phosphopantetheinyl transferase [Bradyrhizobium sp. BTAi1] >gi|166198177|sp|A5EKL9.1|ACPS_BRASB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|146408207|gb|ABQ36713.1| holo-(acyl-carrier-protein) synthase [Bradyrhizobium sp. BTAi1] (139 aa)
Score = 82, Expect = 7.2e-01, Identities = 24/67 (35%), Positives = 39/67 (58%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKS--SFLAVHWSLKEAIYKAVN 67
           MI+GIG DL++I+R  ++  +  + F  R+ T  E A  A+ R  +EK   +  A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDIRRVAEVIERHGDRFLNRIFTEAERAK-AERRAKNEKMVVATYAKRFAAKEACSKALG 68
>gi|50424521|ref|XP_460849.1| hypothetical protein DEHA0F12144g [Debaryomyces hansenii CBS767] >gi|49656518|emb|CAG89194.1| unnamed protein product [Debaryomyces hansenii CBS767] (148 aa)
Score = 82, Expect = 8.3e-01, Identities = 34/114 (29%), Positives = 59/114 (51%)
  Q:     1 MILGIGIDLVEIKRFEQL--------ARQTDNCFAKRLLTSTEYAHYAKLRKD---SEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKI----------ELLLSVSYSSNNITAICLAQQ 114
           + LGIG+D++   RF++L        +R T    ++ L    E   + + + +   +E  S ++  W+ KEA+YK ++       Q +     + YN Q  P I          E  LSVS+    + A  L Q+
  S:     7 ITLGIGVDIINTNRFKELLLSKGKLNSRFTSRISSRILHPEFELPKFNEFKDNNKLNECISLISGSWASKEAVYKTLDD--EYQRQFQFKNWYRYYNEQGKPFIRSDFYKKENEEFQLSVSHDDGLLVATVLRQE 139
>gi|71083745|ref|YP_266465.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Candidatus Pelagibacter ubique HTCC1062] >gi|91763219|ref|ZP_01265183.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Candidatus Pelagibacter ubique HTCC1002] >gi|90111945|sp|Q4FLS7|ACPS_PELUB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71062858|gb|AAZ21861.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Candidatus Pelagibacter ubique HTCC1062] >gi|91717632|gb|EAS84283.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Candidatus Pelagibacter ubique HTCC1002] (128 aa)
Score = 81, Expect = 8.8e-01, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           ILGIG+D+VE  R  +  +  +  F KR+ +S+E     K+   + K SF +  ++ KEA  KA+ 
  S:     3 ILGIGVDIVENIRIHKSLKNVN--FIKRVFSSSEILLAKKI---TNKKSFYSKRFAAKEAFSKAIG 63
>gi|124547999|ref|ZP_01706795.1| holo-acyl-carrier-protein synthase [Shewanella putrefaciens 200] >gi|124508832|gb|EAY52921.1| holo-acyl-carrier-protein synthase [Shewanella putrefaciens 200] (127 aa)
Score = 81, Expect = 9.1e-01, Identities = 16/38 (42%), Positives = 25/38 (65%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHY 39
           I+G+G D+VEI+R E    ++ +  A+R+LT  E A Y
  S:     3 IVGLGTDIVEIERIEAHVARSGDKLARRVLTEAELAIY 40
>gi|120599798|ref|YP_964372.1| holo-acyl-carrier-protein synthase [Shewanella sp. W3-18-1] >gi|166198232|sp|A1RMC3.1|ACPS_SHESW Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|120559891|gb|ABM25818.1| holo-acyl-carrier-protein synthase [Shewanella sp. W3-18-1] (127 aa)
Score = 81, Expect = 9.4e-01, Identities = 16/38 (42%), Positives = 25/38 (65%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHY 39
           I+G+G D+VEI+R E    ++ +  A+R+LT  E A Y
  S:     3 IVGLGTDIVEIERIEAHVARSGDKLARRVLTEAELAIY 40
>gi|91794113|ref|YP_563764.1| phosphopantethiene-protein transferase domain-contain protein [Shewanella denitrificans OS217] >gi|123060712|sp|Q12KI5.1|ACPS_SHEDO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|91716115|gb|ABE56041.1| phosphopantethiene--protein transferase domain [Shewanella denitrificans OS217] (126 aa)
Score = 81, Expect = 9.5e-01, Identities = 18/41 (43%), Positives = 26/41 (63%)
  Q:     2 ILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKL 42
           I+GIG D+VEI+R  +   +  +  AKR+LT  E A YA +
  S:     3 IIGIGTDIVEIERIREQRDRLGDKLAKRVLTLDELAIYAAV 43
>gi|167360075|ref|ZP_02294700.1| holo-acyl-carrier-protein synthase [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167073045|gb|EDR76896.1| holo-acyl-carrier-protein synthase [Rhizobium leguminosarum bv. trifolii WSM1325] (134 aa)
Score = 81, Expect = 9.8e-01, Identities = 22/67 (32%), Positives = 36/67 (53%)
  Q:     1 MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVN 67
           MI+GIG DL++I+R E+   +    F  R  T  E    A+  K + +++  A  ++ KEA  KA+ 
  S:     1 MIIGIGSDLIDIRRVEKSIERFGERFTHRCFTEIE---RARSDKRANRAASYAKRFAAKEACSKALG 64