>gi|13508334|ref|NP_110284.1| ribose-5-phosphate isomerase B [Mycoplasma pneumoniae M129] >gi|1723115|sp|P53527|RPIB_MYCPN Probable ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|1209769|gb|AAC43662.1| galactose-6-phosphate isomerase lacA subunit >gi|1673915|gb|AAB95895.1| galactose-6-phosphate isomerase/ribose 5-phosphate isomerase B [Mycoplasma pneumoniae M129] (152 aa)
Score = 804, Expect = 1.3e-84, Identities = 152/152 (100%), Positives = 152/152 (100%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK
  S:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
>gi|12045258|ref|NP_073069.1| ribose-5-phosphate isomerase B [Mycoplasma genitalium G37] >gi|66880533|ref|ZP_00405514.1| COG0698: Ribose 5-phosphate isomerase RpiB [Mycoplasma genitalium G-37] >gi|1723159|sp|P47636|RPIB_MYCGE Probable ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|3844988|gb|AAC71624.1| ribose 5-phosphate isomerase B [Mycoplasma genitalium G37] >gi|166078770|gb|ABY79388.1| ribose 5-phosphate isomerase B [synthetic Mycoplasma genitalium JCVI-1.0] (152 aa)
Score = 546, Expect = 1.2e-54, Identities = 100/149 (67%), Positives = 121/149 (81%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNS-LGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           M+  I+IASDHTGL LK ++ +HL+ ++  V+DLGP   D  DDYPD+AFL+A  ++ N +  LGILICGTGVGVCMAANK KG+LAALVV  KTAALARQHD+ANVLCLSSRFV   ENIKIVD+FL+A FEGGRH +R+ KII YE+E
  S:     1 MSFNIFIASDHTGLTLKKIISEHLKTKQFNVVDLGPNYFDANDDYPDFAFLVADKVKKNSDKDLGILICGTGVGVCMAANKVKGVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSENIKIVDDFLKANFEGGRHQRRIDKIIRYEKE 150
>gi|186457082|ref|ZP_02967394.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [bacterium Ellin514] >gi|184206718|gb|EDU03765.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [bacterium Ellin514] (723 aa)
Score = 366, Expect = 7.8e-34, Identities = 71/137 (51%), Positives = 94/137 (68%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + SDH G ELK ++ +HL    + V DLG T  +   DYPD+A  ++Q + ++   LG+LIC TGVG+CMAANK  G+ AALV D + AALAR+H+DANV+CL ++   PE   KIVD FL A FEGGRH +RV K+
  S:   170 LGSDHGGFELKEVLKRHLTSNGVSVTDLG-THSEESTDYPDFAQTVSQNVISHRAELGLLICTTGVGMCMAANKVPGVRAALVFDEQMAALARRHNDANVICLGAKITAPELAKKIVDAFLNAHFEGGRHERRVIKM 305
>gi|166157046|emb|CAO79503.1| putative ribose-5-phosphate isomerase B (Phosphoriboisomerase B) [uncultured candidate division WWE3 bacterium EJ0ADIGA11YD11] (149 aa)
Score = 354, Expect = 2.2e-32, Identities = 68/143 (47%), Positives = 96/143 (67%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           IYI+SDH G ELK+ +IK L  +   V+DLGP   +  DDYPDYA L+A+ +Q NP+++GILIC  GVG+ +AANK KG+ A++  +SK AA +R  D  N+L L S F+  EE ++I   +L   F G  RH +R+ KI ++E
  S:     2 IYISSDHRGYELKNYLIKELTPKGTIVMDLGPFNFNQDDDYPDYAKLVAKKIQENPHNMGILICANGVGMSIAANKFKGVRASISWNSKHAATSRNDDKTNILVLPSDFITKEEALEITQTWLSTDFSGEERHLRRIMKITSFE 145
>gi|152992257|ref|YP_001357978.1| ribose-5-phosphate isomerase B [Sulfurovum sp. NBC37-1] >gi|151424118|dbj|BAF71621.1| ribose 5-phosphate isomerase B [Sulfurovum sp. NBC37-1] (153 aa)
Score = 349, Expect = 7.7e-32, Identities = 71/145 (48%), Positives = 91/145 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
           M+   YIA+DH G  +K+ V + +     ++IDLGP   D +D YPD+A    + + ANP S GILICGTG+G+ +AANK  GI AAL  D  TA L RQH+DANVLC   R V       I+D F   +FEGGRH+ R+GKI A
  S:     1 MSKKFYIATDHAGYAVKAYVKELVTNLGHEIIDLGPDSADRVD-YPDFAKKCTEAVIANPGSFGILICGTGIGMSIAANKVSGIRAALCHDHYTAQLTRQHNDANVLCFGERVVGKGVIEDIIDAFASTEFEGGRHATRIGKIEA 144
>gi|152990457|ref|YP_001356179.1| ribose 5-phosphate isomerase B [Nitratiruptor sp. SB155-2] >gi|151422318|dbj|BAF69822.1| ribose 5-phosphate isomerase B [Nitratiruptor sp. SB155-2] (146 aa)
Score = 347, Expect = 1.3e-31, Identities = 69/143 (48%), Positives = 93/143 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           +YI  DH G  +K LVIK L+++  +V DLG    + +D YPDYA  +A+ + A+  S G+LICGTG+G+ +AANK KGI AA V D  TA +AR H+DAN++C   R V P     I+D +   +FEGGRH  RV KI+A E
  S:     4 VYIGCDHAGFAIKGLVIKLLQKRGYEVEDLGTYSSERVD-YPDYAEKVARAVAADKESFGVLICGTGIGMSIAANKIKGIRAAEVHDYYTAQMARAHNDANIVCFGERVVGPGVVESIIDAWCNTEFEGGRHENRVKKIMALE 145
>gi|169824039|ref|YP_001691650.1| ribose 5-phosphate isomerase [Finegoldia magna ATCC 29328] >gi|167830844|dbj|BAG07760.1| ribose 5-phosphate isomerase [Finegoldia magna ATCC 29328] (150 aa)
Score = 346, Expect = 1.8e-31, Identities = 66/146 (45%), Positives = 99/146 (67%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            I IA+DH G ELK  ++++++    +V+DLG    D +D YPDYA  + + +Q   + LGILICGTG+G+ +AANK +GI AA V D  +A ++R H++ANVLC+ +R +  E    I+  FL+ +FE GRH +RV KI+A+E+E
  S:     2 KIAIAADHGGFELKDSMVEYIKSLGNEVVDLGTNSADSVD-YPDYAKKVCEEIQKGNSDLGILICGTGIGMSLAANKFEGIRAACVSDVYSAKMSRNHNNANVLCIGARVIGDEVAKLIIKTFLENEFEAGRHQRRVDKIMAFEKE 146
>gi|31544344|ref|NP_852922.1| ribose-5-phosphate isomerase B [Mycoplasma gallisepticum R] >gi|31541188|gb|AAP56490.1| RpiB [Mycoplasma gallisepticum R] (159 aa)
Score = 343, Expect = 3.9e-31, Identities = 70/147 (47%), Positives = 98/147 (66%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQ---KLQVIDLGPTELDPLDDYPDYAFLLAQTMQ-ANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
            I   +DHTG+ LK  +I  L+ +   + +VIDLG  +    DDYPD+AF+L    +  N  ++G+ ICGTGVG+C+AANK K + A LV D + A LA QHD+ NVL L +R    + N +I+ +FL AQFEGGRH +RV KI  YE+++
  S:     8 KIIFVADHTGVFLKQELISMLKTEYHNQYEVIDLGSDDEKSADDYPDFAFMLEDYFKDENTRNIGVAICGTGVGICIAANKIKNVRAGLVTDVQYAELAIQHDNCNVLVLGARTTSIDVNKEILRKFLSAQFEGGRHQRRVDKISNYEKKQ 158
>gi|50364920|ref|YP_053345.1| ribose 5-phosphate isomerase [Mesoplasma florum L1] >gi|50363476|gb|AAT75461.1| ribose 5-phosphate isomerase [Mesoplasma florum L1] (146 aa)
Score = 343, Expect = 4.5e-31, Identities = 62/146 (42%), Positives = 98/146 (67%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           + IYIA+DHT +E+K+ +  HLE++  +VIDLG  + +  + Y +    LA+ + A+ N+ GI +CGTG+G+ +AANK KG  A LV + +TA L RQH++AN+L   +R +  ++ + +VD FL  +FEGGRH +RVG +  Y +
  S:     2 NKIYIANDHTAIEMKNAIKNHLEKKGYEVIDLGNNDGNSCN-YANIGITLAEAVVADENNKGIALCGTGIGISIAANKVKGARAGLVYEVQTAELTRQHNNANILATGARLIAVDKALLLVDTFLNTEFEGGRHQERVGTLDEYNK 146
>gi|119357143|ref|YP_911787.1| ribose-5-phosphate isomerase [Chlorobium phaeobacteroides DSM 266] >gi|119354492|gb|ABL65363.1| ribose-5-phosphate isomerase [Chlorobium phaeobacteroides DSM 266] (148 aa)
Score = 340, Expect = 8.9e-31, Identities = 61/139 (43%), Positives = 94/139 (67%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I + SDH G E+K+ VI+ L++ + +V+D+GP   + +D YPD+A  + +++       G+L+CGTG+GV ++ANK KGI AAL  + + A LARQH++AN++C S+RF   E   K +  +  A+FEGGRH +RV KI
  S:     3 IAVGSDHAGYEMKNHVIQWLQENRYEVVDMGPFNEESVD-YPDFARKVGESVAEGSCQQGVLLCGTGIGVSISANKVKGIRAALACNPEFATLARQHNNANIICFSARFTDRETIAKSLQNWFAAEFEGGRHERRVNKI 140
>gi|34557704|ref|NP_907519.1| ribose-5-phosphate isomerase B [Wolinella succinogenes DSM 1740] >gi|34483421|emb|CAE10419.1| RIBOSE 5-PHOSPHATE ISOMERASE [Wolinella succinogenes] (143 aa)
Score = 339, Expect = 1.3e-30, Identities = 69/138 (50%), Positives = 89/138 (64%)
  Q:     8 YIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +IA+DH G  +K  V + + Q+  +VIDLGP   D +D YPDYA  L Q +  N  S GILICGTG+G+ + AN+ KGI AAL  D+ TA L R H+DANVLC+  R V       I++ FL   FEGGRH+ R+GKI
  S:     4 FIATDHAGFSIKDHVKEFIRQKGHEVIDLGPASADRVD-YPDYAHELCQKVLENRESAGILICGTGIGMSITANRHKGIRAALCHDAYTATLTRMHNDANVLCMGERVVGLGVVDSILEAFLSTPFEGGRHACRIGKI 140
>gi|169344231|ref|ZP_02865213.1| ribose 5-phosphate isomerase B [Clostridium perfringens C str. JGS1495] >gi|169297690|gb|EDS79790.1| ribose 5-phosphate isomerase B [Clostridium perfringens C str. JGS1495] (154 aa)
Score = 338, Expect = 1.7e-30, Identities = 69/151 (45%), Positives = 94/151 (62%)
  Q:     1 MQMNH-PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           M++N   I I  DH G  LK+ VIKHLE++ ++V D G    D  D YPD +  +A+ +       GILICGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V P   + IVD FL ++FEGGRH  R+ KI A E +
  S:     1 MEVNEMKIAIGCDHGGFNLKNTVIKHLEEKGIEVKDFGTYSTDSCD-YPDISIQVAEAVAKKEFEYGILICGTGIGISIAANKVPGIRAALCSDTFSAHATRQHNNANILAIGERVVGPGLALDIVDTFLNSEFEGGRHQNRIDKITAIEEK 151
>gi|182624051|ref|ZP_02951839.1| ribose 5-phosphate isomerase B [Clostridium perfringens D str. JGS1721] >gi|177910944|gb|EDT73298.1| ribose 5-phosphate isomerase B [Clostridium perfringens D str. JGS1721] (149 aa)
Score = 336, Expect = 2.9e-30, Identities = 67/145 (46%), Positives = 90/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  DH G  LK+ VIKHLE++ ++V D G    D  D YPD +  +A+ +       GILICGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V P   + IVD FL ++FEGGRH  R+ KI A E +
  S:     3 IAIGCDHGGFNLKNTVIKHLEEKGIEVKDFGTYSTDSCD-YPDISIQVAEAVAKKEFEYGILICGTGIGISIAANKVPGIRAALSSDTFSAHATRQHNNANILAMGERVVGPGLALDIVDTFLNSEFEGGRHQNRIDKITAIEEK 146
>gi|18311180|ref|NP_563114.1| ribose-5-phosphate isomerase B [Clostridium perfringens str. 13] >gi|110800386|ref|YP_696877.1| ribose-5-phosphate isomerase B [Clostridium perfringens ATCC 13124] >gi|110802734|ref|YP_699473.1| ribose-5-phosphate isomerase B [Clostridium perfringens SM101] >gi|168210128|ref|ZP_02635753.1| ribose 5-phosphate isomerase B [Clostridium perfringens B str. ATCC 3626] >gi|168213698|ref|ZP_02639323.1| ribose 5-phosphate isomerase B [Clostridium perfringens CPE str. F4969] >gi|168215827|ref|ZP_02641452.1| ribose 5-phosphate isomerase B [Clostridium perfringens NCTC 8239] >gi|18145863|dbj|BAB81904.1| ribose 5-phosphate isomerase [Clostridium perfringens str. 13] >gi|110675033|gb|ABG84020.1| ribose 5-phosphate isomerase B [Clostridium perfringens ATCC 13124] >gi|110683235|gb|ABG86605.1| ribose 5-phosphate isomerase b [Clostridium perfringens SM101] >gi|170711788|gb|EDT23970.1| ribose 5-phosphate isomerase B [Clostridium perfringens B str. ATCC 3626] >gi|170714766|gb|EDT26948.1| ribose 5-phosphate isomerase B [Clostridium perfringens CPE str. F4969] >gi|182382193|gb|EDT79672.1| ribose 5-phosphate isomerase B [Clostridium perfringens NCTC 8239] (149 aa)
Score = 336, Expect = 2.9e-30, Identities = 67/145 (46%), Positives = 90/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  DH G  LK+ VIKHLE++ ++V D G    D  D YPD +  +A+ +       GILICGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V P   + IVD FL ++FEGGRH  R+ KI A E +
  S:     3 IAIGCDHGGFNLKNTVIKHLEEKGIEVKDFGTYSTDSCD-YPDISIQVAEAVAKKEFEYGILICGTGIGISIAANKVPGIRAALCSDTFSAHATRQHNNANILAMGERVVGPGLALDIVDTFLNSEFEGGRHQNRIDKITAIEEK 146
>gi|71083739|ref|YP_266459.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1062] >gi|91763225|ref|ZP_01265189.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1002] >gi|71062852|gb|AAZ21855.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1062] >gi|91717638|gb|EAS84289.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1002] (141 aa)
Score = 334, Expect = 4.7e-30, Identities = 61/140 (43%), Positives = 94/140 (67%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I+++SDH G +LK L+  HL+++K+   DLGP   + +D YPDYA  +A+ ++ N N  GIL+CG+G+G+ +AAN+ K I AA   + K+  L+R H++AN++ L SR +  +  I  V  FL  +FEGGRH+KR+ KI
  S:     3 KIFLSSDHAGYKLKELIKLHLDKKKINYTDLGPFNSESVD-YPDYAHKVAKKVKTNNNHAGILVCGSGMGMNIAANRHKNIRAAQCFNLKSTKLSRLHNNANIITLGSRLLTKKTAINCVSVFLNTKFEGGRHAKRIKKI 141
>gi|149194498|ref|ZP_01871594.1| ribose-5-phosphate isomerase B [Caminibacter mediatlanticus TB-2] >gi|149135242|gb|EDM23722.1| ribose-5-phosphate isomerase B [Caminibacter mediatlanticus TB-2] (142 aa)
Score = 333, Expect = 6.4e-30, Identities = 64/138 (46%), Positives = 94/138 (68%)
  Q:     8 YIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +I +DH G E+K  VI +L+++ ++V DLG    + +D YPD A  +A  +  N  S GILICG+G+G+ +AANK KGI AAL  D  TA++AR+H++AN+LC  +R V   E   I++ +L ++FEGGRH +RV KI
  S:     4 FIGTDHAGFEVKDFVIDYLQKKGIEVEDLGCYSTESVD-YPDLAHKVANAVLENEGSKGILICGSGIGMSLAANKHKGIRAALCHDYYTASMARKHNNANILCFGARIVGKGEIESILEGWLNSEFEGGRHQRRVEKI 140
>gi|94968291|ref|YP_590339.1| ribose-5-phosphate isomerase [Acidobacteria bacterium Ellin345] >gi|94550341|gb|ABF40265.1| ribose-5-phosphate isomerase [Acidobacteria bacterium Ellin345] (152 aa)
Score = 331, Expect = 1.1e-29, Identities = 67/146 (45%), Positives = 93/146 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I + +DH G ELK+ V +HL QQ + V D G    D +D YPD+A  +A T+       G+L+CGTG+G+ M+ANK  GI AA       A L+RQH+DAN+L L +R + PE    IVD +++AQFEGGRH +RV KI   E+++
  S:     3 IALGADHAGFELKNQVKQHLTQQGIDVQDFGTNTPDSVD-YPDFAQRVADTVAVGGVERGVLVCGTGIGMAMSANKVPGIRAANCHTILEAELSRQHNDANILTLGARVLEPEAAFAIVDAWMKAQFEGGRHQRRVDKIHQIEQQE 147
>gi|168177476|ref|ZP_02612140.1| ribose 5-phosphate isomerase B [Clostridium botulinum NCTC 2916] >gi|182671381|gb|EDT83355.1| ribose 5-phosphate isomerase B [Clostridium botulinum NCTC 2916] (145 aa)
Score = 330, Expect = 1.2e-29, Identities = 66/144 (45%), Positives = 94/144 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + SDH GL LK+ +IKHLE + +++ D G T  +   DYPDYA  +A+ + A     GILICGTG+G+ +AANK KG+ AAL  D+ +A   R+H++AN+L L  R V     + IVD FL A+F+GGRH  R+ K++  E+
  S:     3 IALGSDHAGLPLKNEIIKHLEGKGIEIKDFG-TYTEESCDYPDYAQKVAEKVVAKEFDFGILICGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAEFQGGRHENRINKMMGIEK 145
>gi|15896134|ref|NP_349483.1| ribose-5-phosphate isomerase B [Clostridium acetobutylicum ATCC 824] >gi|15025927|gb|AAK80823.1|AE007785_8 Ribose 5-phosphate isomerase, RpiB [Clostridium acetobutylicum ATCC 824] (152 aa)
Score = 330, Expect = 1.2e-29, Identities = 66/145 (45%), Positives = 91/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G  LK  VIKHLE + ++V D G T  D   DYPDYA  +A+ +       GILICGTG+G+ ++ANK  GI AA+  D+  A  +R+H++AN+L +  R V P   I IVD FL ++F+G RH +R+ KI   E++
  S:     3 IAIGSDHAGFSLKKEVIKHLESKNIEVKDFG-TLTDESCDYPDYALKVAEEVAQKNFEFGILICGTGIGISISANKVPGIRAAVCTDTFCAHASREHNNANILAMGERVVGPGLAIDIVDTFLNSKFQGDRHQRRIDKITQIEKK 146
>gi|188587449|ref|YP_001918994.1| ribose-5-phosphate isomerase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352136|gb|ACB86406.1| ribose-5-phosphate isomerase [Natranaerobius thermophilus JW/NM-WN-LF] (162 aa)
Score = 330, Expect = 1.2e-29, Identities = 67/143 (46%), Positives = 93/143 (65%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           IASDH GLELK  +I HL+   +++ DLG  + D   DYPDYA  L Q +  N  S GIL+CGTG+G+ ++ANK  GI AAL  D  +A +AR+H+DAN++ L  R +     +++VD FL + F GGRH +RV KI   E++
  S:    19 IASDHGGLELKQEIINHLQDSGIKIEDLGCYQ-DESVDYPDYAEKLTQKLVNNEISYGILVCGTGIGISISANKVPGIRAALCHDCFSARMAREHNDANIIALGERIIGKGLALEVVDTFLNSPFGGGRHERRVNKITKLEQK 160
>gi|95929571|ref|ZP_01312313.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfuromonas acetoxidans DSM 684] >gi|95134268|gb|EAT15925.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfuromonas acetoxidans DSM 684] (150 aa)
Score = 330, Expect = 1.3e-29, Identities = 67/144 (46%), Positives = 94/144 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           + IASDH GLELK +++ +L+QQ + V DLG    D +D YPDYA L+A+ +       GIL+CGTG+G+ +AANK  G+ AAL  D  TA +AR+H++AN+L L  R + PE   ++V  +    +EGGRH  R+ KII  ER
  S:     2 LLIASDHGGLELKQILVDYLKQQGVDVKDLGVHAEDSVD-YPDYAALVAEPISKQEADQGILVCGTGIGMSIAANKFPGVRAALAHDEFTAQMAREHNNANILVLGGRVLDPELACRMVSVWYDGAYEGGRHQNRLNKIIQLER 144
>gi|167924974|ref|ZP_02512065.1| ribose 5-phosphate isomerase, RpiB [Mycoplasma mycoides subsp. mycoides LC str. GM12] (147 aa)
Score = 329, Expect = 1.5e-29, Identities = 63/147 (42%), Positives = 98/147 (66%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M++ IYI +DH+ +E+K  ++KHL+++  +VIDLG  +    + Y     ++A+ + ++ NS GI+ICGTG+G+ +AANK K   AALV + +TA LAR H+DAN+L L +R +   + I +VD FL   FEGGRH +RV  +  Y+
  S:     1 MSNRIYIGNDHSAVEMKQAIVKHLQEKNYEVIDLGNNDGKSCN-YAKIGQVVAEHVVSDTNSRGIVICGTGIGISIAANKVKTARAALVYEKETAELARIHNDANILALGARIIAISKAINLVDVFLNTPFEGGRHIERVNTLNEYK 146
>gi|187777265|ref|ZP_02993738.1| hypothetical protein CLOSPO_00817 [Clostridium sporogenes ATCC 15579] >gi|187774193|gb|EDU37995.1| hypothetical protein CLOSPO_00817 [Clostridium sporogenes ATCC 15579] (145 aa)
Score = 329, Expect = 1.7e-29, Identities = 66/144 (45%), Positives = 94/144 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + SDH GL LK+ +IKHLE + +++ D G T  +   DYPDYA  +A+ + A     GIL+CGTG+G+ +AANK KG+ AAL  D+ +A   R+H++AN+L L  R V     + IVD FL A+F+GGRH  RV K++  E+
  S:     3 IALGSDHAGLPLKNEIIKHLEGKGIEIKDFG-TYTEESCDYPDYAQNVAEKVVAKEFDFGILVCGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAKFQGGRHENRVNKMMGIEK 145
>gi|153938808|ref|YP_001389507.1| ribose-5-phosphate isomerase B [Clostridium botulinum F str. Langeland] >gi|170757081|ref|YP_001779771.1| ribose 5-phosphate isomerase B [Clostridium botulinum B1 str. Okra] >gi|170759805|ref|YP_001785473.1| ribose 5-phosphate isomerase B [Clostridium botulinum A3 str. Loch Maree] >gi|152934704|gb|ABS40202.1| ribose 5-phosphate isomerase B [Clostridium botulinum F str. Langeland] >gi|169122293|gb|ACA46129.1| ribose 5-phosphate isomerase B [Clostridium botulinum B1 str. Okra] >gi|169406794|gb|ACA55205.1| ribose 5-phosphate isomerase B [Clostridium botulinum A3 str. Loch Maree] (145 aa)
Score = 329, Expect = 1.8e-29, Identities = 65/144 (45%), Positives = 94/144 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + SDH GL LK+ +IKHLE + +++ D G T  +   DYPDYA  +A+ + A     GIL+CGTG+G+ +AANK KG+ AAL  D+ +A   R+H++AN+L L  R V     + IVD FL A+F+GGRH  R+ K++  E+
  S:     3 IALGSDHAGLPLKNEIIKHLEGKGIEIKDFG-TYTEESCDYPDYAQKVAEKVVAKEFDFGILVCGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAEFQGGRHENRINKMMGIEK 145
>gi|78188871|ref|YP_379209.1| ribose/galactose isomerase [Chlorobium chlorochromatii CaD3] >gi|78171070|gb|ABB28166.1| ribose-5-phosphate isomerase [Chlorobium chlorochromatii CaD3] (150 aa)
Score = 328, Expect = 2.6e-29, Identities = 62/143 (43%), Positives = 88/143 (61%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   I + SDH G E K  V+  LE    +V D+GP   + +D YPDYA  + + +       G+L+CGTG+GV +AANK KG+ AAL  + + A LARQH++AN+LC+ +RF   E   + +  + +A FEGGRH +RV KI
  S:     1 MTMKIAVGSDHAGFEFKKTVVAWLEAHGYEVEDMGPHNEESVD-YPDYAHHVGRAVAGGHCDSGVLLCGTGIGVSVAANKIKGVRAALACNPEFATLARQHNNANILCMPARFTNRETIEQCLHNWFEASFEGGRHERRVNKI 142
>gi|78777314|ref|YP_393629.1| ribose-5-phosphate isomerase B [Sulfurimonas denitrificans DSM 1251] >gi|78497854|gb|ABB44394.1| ribose-5-phosphate isomerase [Sulfurimonas denitrificans DSM 1251] (145 aa)
Score = 327, Expect = 2.8e-29, Identities = 64/141 (45%), Positives = 92/141 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
            YIA+DH GL+LK   ++ L+ +  +V+DLGP   D +D YPDYA  + + +  + ++ GILICG+G+G+ MAAN+   I AAL  D+ TA++AR H+DANVLC   R +       I+D ++   FEGGRH +RV KI A
  S:     3 FYIATDHAGLDLKDYTVELLKDKGHEVVDLGPFCKDRVD-YPDYATKVCEAVLKDNSAFGILICGSGIGMSMAANRYSNIRAALCHDAYTASVARGHNDANVLCFGERIIGKGVAESIIDAWIAGSFEGGRHEQRVAKIEA 142
>gi|148378150|ref|YP_001252691.1| ribose 5-phosphate isomerase B [Clostridium botulinum A str. ATCC 3502] >gi|153931351|ref|YP_001382551.1| ribose-5-phosphate isomerase B [Clostridium botulinum A str. ATCC 19397] >gi|153935683|ref|YP_001386103.1| ribose-5-phosphate isomerase B [Clostridium botulinum A str. Hall] >gi|148287634|emb|CAL81699.1| ribose 5-phosphate isomerase [Clostridium botulinum A str. ATCC 3502] >gi|152927395|gb|ABS32895.1| ribose 5-phosphate isomerase B [Clostridium botulinum A str. ATCC 19397] >gi|152931597|gb|ABS37096.1| ribose 5-phosphate isomerase B [Clostridium botulinum A str. Hall] (145 aa)
Score = 327, Expect = 2.9e-29, Identities = 65/144 (45%), Positives = 94/144 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + SDH GL LK+ +IKHLE + +++ D G T  +   DYPDYA  +A+ + A     GIL+CGTG+G+ +AANK KG+ AAL  D+ +A   R+H++AN+L L  R V     + IVD FL A+F+GGRH  R+ K++  E+
  S:     3 IALGSDHAGLPLKNEIIKHLEGKGIEIKDFG-TYTEESCDYPDYAQKVAEKVVAKEFDFGILVCGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAEFQGGRHENRINKMMRIEK 145
>gi|189346775|ref|YP_001943304.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium limicola DSM 245] >gi|189340922|gb|ACD90325.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium limicola DSM 245] (144 aa)
Score = 327, Expect = 3.0e-29, Identities = 61/139 (43%), Positives = 91/139 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I + SDH G ELK+ V++ L++   + +D+GP   + +D YPDYA  + +++       G+L+CGTG+GV ++ANK KGI AAL    + A LARQH++AN++C S+RF   E   K ++ +  A FEGGRH +RV KI
  S:     3 IAVGSDHAGFELKNYVVQWLQENGHEPVDMGPFNEESVD-YPDYARKVGESIVDGTCQEGVLLCGTGIGVSISANKVKGIRAALACRPEFATLARQHNNANIICFSARFTDRETIAKSLENWFAADFEGGRHERRVNKI 140
>gi|168182247|ref|ZP_02616911.1| ribose 5-phosphate isomerase B [Clostridium botulinum Bf] >gi|182674711|gb|EDT86672.1| ribose 5-phosphate isomerase B [Clostridium botulinum Bf] (145 aa)
Score = 327, Expect = 3.3e-29, Identities = 65/144 (45%), Positives = 94/144 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + SDH GL LK+ +IKHLE + +++ D G T  +   DYPDYA  +A+ + A     GIL+CGTG+G+ +AANK KG+ AAL  D+ +A   R+H++AN+L L  R V     + IVD FL A+F+GGRH  R+ K++  E+
  S:     3 IALGSDHAGLPLKNEIIKHLEGKGIEIKDFG-TYTEESCDYPDYAQKVAEKVVAKEFDFGILVCGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAKFQGGRHENRINKMMEIEK 145
>gi|168205565|ref|ZP_02631570.1| ribose 5-phosphate isomerase B [Clostridium perfringens E str. JGS1987] >gi|170662921|gb|EDT15604.1| ribose 5-phosphate isomerase B [Clostridium perfringens E str. JGS1987] (149 aa)
Score = 326, Expect = 4.0e-29, Identities = 65/145 (44%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  DH G  LK+ VIKHLE++ ++V D G    D  D YPD +  +A+ +       GILICGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V     + IVD FL ++FEGGRH  R+ KI + E +
  S:     3 IAIGCDHGGFNLKNTVIKHLEEKGIEVKDFGTYSTDSCD-YPDISIQVAEAVAKKEFEYGILICGTGIGISIAANKVPGIRAALCSDTFSAHATRQHNNANILAMGERVVGSGLALDIVDTFLNSEFEGGRHQNRIDKITSIEEK 146
>gi|21673876|ref|NP_661941.1| ribose-5-phosphate isomerase [Chlorobium tepidum TLS] >gi|21647012|gb|AAM72283.1| ribose-5-phosphate isomerase [Chlorobium tepidum TLS] (144 aa)
Score = 326, Expect = 4.4e-29, Identities = 63/139 (45%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I + SDH G+ELK  V+  LE+      D+GP   + +D YPDY   +A+ +       GIL+CGTG+G+ +AANK KG+ AA V + + AALARQH+DANVL   +RF       KI++ +  ++FEGGRH +RV KI
  S:     3 IAVGSDHAGVELKKFVLSWLEKHCYDFEDMGPYSAESVD-YPDYGHKVAEAVARGDFDQGILMCGTGIGISIAANKVKGVRAANVCNPEYAALARQHNDANVLAFGARFNDDSSAAKILESWFASEFEGGRHQRRVDKI 140
>gi|126645804|ref|ZP_01718321.1| ribose 5-phosphate isomerase B [Algoriphagus sp. PR1] >gi|126577436|gb|EAZ81656.1| ribose 5-phosphate isomerase B [Algoriphagus sp. PR1] (145 aa)
Score = 324, Expect = 5.8e-29, Identities = 68/143 (47%), Positives = 86/143 (60%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   I I  DH G E K+ +I  LE Q  +V D GP   D   DYPDY   L+  ++A    LGI+ICG+G GV + ANK +GI AAL  +   AAL+RQH++ANVL L +RF+  E   K+ + FL   FEGGRH  RV KI
  S:     1 MAKKIAIGGDHAGFEYKAKMISKLESQGYEVKDFGPFS-DASVDYPDYVHPLSTAIEAGEYELGIVICGSGNGVAITANKHQGIRAALCWNEDLAALSRQHNNANVLALPARFISYELAEKLAETFLTTDFEGGRHQNRVNKI 142
>gi|150388178|ref|YP_001318227.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Alkaliphilus metalliredigens QYMF] >gi|149948040|gb|ABR46568.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Alkaliphilus metalliredigens QYMF] (149 aa)
Score = 324, Expect = 6.7e-29, Identities = 68/145 (46%), Positives = 91/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G ELK+L+ +HL  +KL+V+D G    D  D Y DYA  +A+ +     + GILICGTG+G+ +AANK  GI  ALV D  +A    +H+D+NVL L  R V P   ++IVD +L A F+GGRH KR+ KI   E +
  S:     3 IAIGSDHGGYELKNLIKEHLLNKKLEVVDFGTESTDSCD-YADYAQGVAEAVAKGDYARGILICGTGIGISIAANKVPGIRCALVGDCFSAKATTEHNDSNVLALGGRVVGPGLALEIVDIWLSATFQGGRHQKRIDKITDIESK 146
>gi|42561413|ref|NP_975864.1| ribose 5-phosphate isomerase, RpiB [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492911|emb|CAE77506.1| ribose 5-phosphate isomerase, RpiB [Mycoplasma mycoides subsp. mycoides SC str. PG1] (165 aa)
Score = 324, Expect = 7.0e-29, Identities = 62/149 (41%), Positives = 97/149 (65%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + M++ IYI +DH+ +E+K  ++KHL+++  +VIDLG  +    + Y     ++A+ +  + NS GI+ICGTG+G+ +AANK K   AALV + +T  LAR H+DAN+L L +R +   + I +VD FL   FEGGRH +RV  +  Y+
  S:    17 VSMSNRIYIGNDHSAVEMKQAIVKHLQEKNYEVIDLGNNDGKSCN-YAKIGQVVAEHVVNDTNSRGIVICGTGIGISIAANKVKTARAALVYEKETVELARIHNDANILALGARIIAISKAINLVDVFLNTPFEGGRHIERVNTLNEYK 164
>gi|85858032|ref|YP_460234.1| ribose 5-phosphate isomerase [Syntrophus aciditrophicus SB] >gi|85721123|gb|ABC76066.1| ribose 5-phosphate isomerase [Syntrophus aciditrophicus SB] (152 aa)
Score = 323, Expect = 8.0e-29, Identities = 67/150 (44%), Positives = 94/150 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           M   I I +DH G +LK  V   LE++   V D+G T+ +   DYPD+   +A  + A   S GIL+CG+GVG+ + ANK  GI AA+ +D++TA L+R H+D N+L L+ R  +PE   +IVD +L+  FEGGRH  R+ KI A E EK
  S:     1 MEQKIIIGADHAGFQLKETVKSFLEEKGWVVSDIG-TDSEEAVDYPDFGEKVAGAVSAGVFSRGILVCGSGVGMAIVANKFDGIRAAVCLDTETARLSRLHNDTNILILAGRRTLPETARQIVDVWLETPFEGGRHRGRLDKIRALENEK 149
>gi|110598193|ref|ZP_01386470.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Chlorobium ferrooxidans DSM 13031] >gi|110340207|gb|EAT58705.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Chlorobium ferrooxidans DSM 13031] (144 aa)
Score = 323, Expect = 9.2e-29, Identities = 63/139 (45%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH G E K  V+  LE+      D+GP   + +D YPD+A  +AQ + A     G+L+CGTG+GV +AANK KGI AAL  + + A LARQH++AN++C S+RF       + +  +  A+FEGGRH +RV KI
  S:     3 IAVASDHAGFESKKTVVAWLEKHGYACSDMGPYNEESVD-YPDFARKVAQGVAAGEFDQGVLLCGTGIGVSIAANKVKGIRAALACNPEFATLARQHNNANIICFSARFSDKATIEQSLQNWFSAEFEGGRHERRVEKI 140
>gi|78186879|ref|YP_374922.1| ribose/galactose isomerase [Pelodictyon luteolum DSM 273] >gi|78166781|gb|ABB23879.1| ribose-5-phosphate isomerase [Pelodictyon luteolum DSM 273] (144 aa)
Score = 323, Expect = 9.3e-29, Identities = 63/139 (45%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH G+E K  ++  LE       D+GP   D +D YPDYA  +  ++ +  +  GIL+CGTG+GV ++ANK  GI AAL    + A LARQH+DAN+LC S+RF       + +D +  A FEGGRH +RV KI
  S:     3 IAVASDHAGVEFKKDIVAWLESHGHACTDMGPYTEDSVD-YPDYAHKVGHSVASGESDQGILLCGTGIGVSISANKIPGIRAALCCRPEFATLARQHNDANILCFSARFTDLASIHESLDNWFSADFEGGRHQRRVDKI 140
>gi|78043323|ref|YP_361351.1| ribose-5-phosphate isomerase B [Carboxydothermus hydrogenoformans Z-2901] >gi|77995438|gb|ABB14337.1| ribose 5-phosphate isomerase B [Carboxydothermus hydrogenoformans Z-2901] (159 aa)
Score = 322, Expect = 1.0e-28, Identities = 67/145 (46%), Positives = 91/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I +DH G  LK  + KHLE++ + VID G    + +D YPD+   +A+ +       GI+ICGTG+G+ +AANK  GI AAL  D+ +A  AR+H+DANVL L +R V     + IVD FL A FEGGRH++RV KI   E +
  S:     3 IAIGADHAGFNLKEEIKKHLEKKGIAVIDKGTYSAESVD-YPDFGEAVAEAVVQKEVDFGIVICGTGIGISIAANKVPGIRAALCSDTFSAHSAREHNDANVLALGARVVGVGLALDIVDTFLGASFEGGRHARRVEKIAGIEEK 146
>gi|110639997|ref|YP_680207.1| ribose 5-phosphate isomerase B [Cytophaga hutchinsonii ATCC 33406] >gi|110282678|gb|ABG60864.1| ribose 5-phosphate isomerase B [Cytophaga hutchinsonii ATCC 33406] (145 aa)
Score = 321, Expect = 1.3e-28, Identities = 64/143 (44%), Positives = 86/143 (60%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M + I +  DH G   K  +I +LE Q  + ID GP     +D YPD++  +A+ ++    + GILICG+G GVCM ANK + I A L    + A L RQH++ANVLCL +RF+  EE I  V  F++  FEGGRH  RV KI
  S:     1 MAYTIALGGDHAGYTYKKEIIAYLETQGHKTIDCGPFSEASVD-YPDFSHPVAEAVETGKATFGILICGSGNGVCMTANKHQHIRAGLCWTPEIAMLTRQHNNANVLCLPARFIPIEEAIACVKMFVETAFEGGRHEGRVNKI 142
>gi|153951312|ref|YP_001398006.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. doylei 269.97] >gi|152938758|gb|ABS43499.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. doylei 269.97] (145 aa)
Score = 321, Expect = 1.5e-28, Identities = 67/143 (46%), Positives = 92/143 (64%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +   IYIASDH G ELK  +   L+++ +   DLG       D YPDYA LLA+ +  +  S GILICG+G+G+ +AAN+ K I  AL  +S +A LAR+H+DANVL L  R +  E  I I+++F+Q  FEGGRH +R+ KI
  S:     2 LREKIYIASDHAGFELKEKICALLKEKNIIFNDLGTNTCASCD-YPDYAHLLAEKI--DERSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGIELAIDIIEKFIQTPFEGGRHMQRIQKI 141
>gi|117928805|ref|YP_873356.1| ribose-5-phosphate isomerase B [Acidothermus cellulolyticus 11B] >gi|117649268|gb|ABK53370.1| ribose 5-phosphate isomerase [Acidothermus cellulolyticus 11B] (160 aa)
Score = 321, Expect = 1.5e-28, Identities = 63/143 (44%), Positives = 93/143 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           +Y+ASDH G ELK+ +I+ L +Q  + +D GP    P DDYP Y    A+   A+ +S G++I G+G G  +AANK +GI AAL+ + +TAALAR H+DANV  + +R     + I++VD FL+  F G  RH++R+G I  +E
  S:     3 VYVASDHAGFELKTRLIEWLAEQGYEPVDCGPVVFQPDDDYPPYVIDAARRTAADRDSFGVVIGGSGNGEQIAANKVRGIRAALIWNDETAALARAHNDANVASIGARQHTIRDAIRLVDIFLRTPFSGEPRHARRIGMISEFE 146
>gi|15792254|ref|NP_282077.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237753|ref|YP_179001.1| ribose 5-phosphate isomerase B [Campylobacter jejuni RM1221] >gi|86150642|ref|ZP_01068864.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88596659|ref|ZP_01099896.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 84-25] >gi|148926606|ref|ZP_01810288.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni CG8486] >gi|57166557|gb|AAW35336.1| ribose 5-phosphate isomerase B [Campylobacter jejuni RM1221] >gi|85838903|gb|EAQ56170.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88191500|gb|EAQ95472.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360250|emb|CAL35045.1| ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145845300|gb|EDK22394.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni CG8486] (145 aa)
Score = 319, Expect = 2.4e-28, Identities = 67/143 (46%), Positives = 91/143 (63%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +   IYIASDH G ELK  +   L+++ +   DLG       D YPDYA LLA+ +  N  S GILICG+G+G+ +AAN+ K I  AL  +S +A LAR+H+DANVL L  R +  E  I I+++F+Q  FE GRH +R+ KI
  S:     2 LREKIYIASDHAGFELKEKICVFLKEKNIIFNDLGTNTCASCD-YPDYAHLLAEKI--NKRSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDIIEKFIQTPFEEGRHMQRIQKI 141
>gi|124516691|gb|EAY58199.1| Ribose 5-phosphate isomerase RpiB [Leptospirillum sp. Group II UBA] (158 aa)
Score = 319, Expect = 2.6e-28, Identities = 64/143 (44%), Positives = 91/143 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I SDH G  LK  + K LE+    ++D+G    + +D YPDYA  +A+ + A    +GIL+CGTG+GV +AANK KGI AAL+ + +TA+LA +H++ANV+C   R V  ++       FL A FEGGRH +R+ +I A E
  S:     9 IVIGSDHAGYPLKESLRKRLEKDGYPLLDVGTFSEESVD-YPDYAEKVARALHAGEGDIGILLCGTGIGVSIAANKIKGIRAALIYNDETASLAHRHNNANVICFGGREVSEDQAHTWTRLFLSASFEGGRHQRRIDEISALE 150
>gi|158321593|ref|YP_001514100.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Alkaliphilus oremlandii OhILAs] >gi|158141792|gb|ABW20104.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Alkaliphilus oremlandii OhILAs] (149 aa)
Score = 319, Expect = 2.6e-28, Identities = 67/145 (46%), Positives = 90/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G  LK L+ KHL+++   + D G T+     DYPD+A  + + + A     GILICGTG+G+ +AANK  G+  ALV D  +A   RQH+DAN+L L  R V P   ++IVD +L A+FEGGRH  RV KI   E++
  S:     3 IAIGSDHGGYGLKELIRKHLQEKGFDIKDFG-TDSTASVDYPDFAKAVGEAVVAGEFQRGILICGTGIGISIAANKIPGVRCALVGDCFSAKATRQHNDANILALGERVVGPGLALEIVDIWLSAEFEGGRHQGRVDKIADIEKK 146
>gi|157736886|ref|YP_001489569.1| ribose-5-phosphate isomerase B [Arcobacter butzleri RM4018] >gi|157698740|gb|ABV66900.1| ribose 5-phosphate isomerase [Arcobacter butzleri RM4018] (151 aa)
Score = 318, Expect = 3.0e-28, Identities = 68/140 (48%), Positives = 94/140 (67%)
  Q:     8 YIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIK-IVDEFLQAQFEGGRHSKRVGKIIA 147
           +I +DH G+E+K+ V    EQ+  QV DLGP   D +D YPDYA  + + +  N  ++GILICG+G+G+ MAANK  GI AAL  +  +A +AR+H+DANV+CL  R V  E  I+ I+  + +A+FEGGRH  RV KI A
  S:     4 FIGADHAGIEIKAFVKDLFEQRGHQVEDLGPFNKDRVD-YPDYASKVCKKVLENEGTMGILICGSGLGMSMAANKFDGIRAALCHNEYSARMARKHNDANVICLGER-VSGEGMIEAIIKAWDKAEFEGGRHEGRVAKINA 142
>gi|28210068|ref|NP_781012.1| ribose-5-phosphate isomerase B [Clostridium tetani E88] >gi|28202503|gb|AAO34949.1| ribose 5-phosphate isomerase [Clostridium tetani E88] (149 aa)
Score = 318, Expect = 3.2e-28, Identities = 67/143 (46%), Positives = 92/143 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I + SDH GL+LK  +IKHLE + +++ D G T+ +   DYPDYA  +A  +      LGILICGTG+G+ +AANK  GI AAL  D+ +A   R+H++AN+L L  R V     + IVD FL ++F+GGRH KR+ KI   E
  S:     3 IALGSDHAGLKLKKEIIKHLEGKDIELKDFG-TDAEESCDYPDYAKEVANQVADKNYDLGILICGTGIGISIAANKVPGIRAALCSDTFSAHSCREHNNANILALGERVVGLGLALDIVDTFLSSEFQGGRHQKRLDKISGIE 144
>gi|83591208|ref|YP_431217.1| ribose-5-phosphate isomerase [Moorella thermoacetica ATCC 39073] >gi|83574122|gb|ABC20674.1| ribose-5-phosphate isomerase [Moorella thermoacetica ATCC 39073] (181 aa)
Score = 318, Expect = 3.5e-28, Identities = 64/143 (44%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + + SDH G  LK  +  +L +Q +   D G    + +D YPDYA  +A  + +     GIL CGTG+GVC+AANK  GI AAL  D+ +A  AR+H+DAN+L L  R + P   ++IVD +L+A+F GGRH++RV KI A E
  S:    21 VALGSDHGGFHLKMAIKDYLNRQGIANHDFGTYNAESVD-YPDYAHKVAAAVASGEYDRGILCCGTGIGVCIAANKVPGIRAALCHDTFSARAAREHNDANILTLGERVIGPGLALEIVDTWLKAEFSGGRHARRVQKISAIE 162
>gi|160943028|ref|ZP_02090266.1| hypothetical protein FAEPRAM212_00505 [Faecalibacterium prausnitzii M21/2] >gi|158445722|gb|EDP22725.1| hypothetical protein FAEPRAM212_00505 [Faecalibacterium prausnitzii M21/2] (148 aa)
Score = 317, Expect = 4.7e-28, Identities = 65/147 (44%), Positives = 84/147 (57%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M  PI +A+DH G ELK  V  HLE+  L+ ID G    D +D YPD A      + +      +L CGTGVG+ MAANK KGI A    DS +    R+H+DAN LC+  R V      ++VD FL  +FEGGRH +R+ K+ A E
  S:     1 MAKPIALAADHGGFELKEAVKAHLEELGLEYIDFGTHSTDSVD-YPDMAVPACDAVVSGQCEKALLFCGTGVGISMAANKIKGIRACCCSDSFSCEYTRRHNDANALCMGGRVVGAGLACQLVDIFLNTEFEGGRHQRRIDKLTALE 146
>gi|20806675|ref|NP_621846.1| ribose 5-phosphate isomerase RpiB [Thermoanaerobacter tengcongensis MB4] >gi|20515126|gb|AAM23450.1| Ribose 5-phosphate isomerase RpiB [Thermoanaerobacter tengcongensis MB4] (302 aa)
Score = 316, Expect = 5.3e-28, Identities = 61/150 (40%), Positives = 96/150 (64%)
  Q:     2 QMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           +++  I + SDH G ELK ++ K+LE++ +   D G    + +D YPDYA  +A+ + +   + GIL+CGTG+G+ + ANK  GI AA V D  +A  A++H++AN+LC+  R   P   I +V+E+L A F+GGRH KR+ KI   E++
  S:   151 KVDRMIALGSDHAGYELKEVIKKYLEEKGIPYKDFGTFNEESVD-YPDYALKVAEAVASGECTEGILVCGTGIGMSITANKVPGIRAAHVEDVFSARAAKEHNNANILCMGGRVTGPGLAIMMVEEWLNATFQGGRHQKRIDKITEIEKK 299
>gi|145219703|ref|YP_001130412.1| ribose-5-phosphate isomerase [Prosthecochloris vibrioformis DSM 265] >gi|145205867|gb|ABP36910.1| ribose-5-phosphate isomerase [Prosthecochloris vibrioformis DSM 265] (144 aa)
Score = 316, Expect = 5.6e-28, Identities = 62/139 (44%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G+E K  +   L     +  D+GP   + +D YPDYA  +A+ + A     GIL+CGTG+GV ++ANK  GI AAL    + A LARQH++ANVLC+S+RF      +  ++ +  A+FEGGRH +RV KI
  S:     3 IAIGSDHAGVEFKKEIAAWLAAHGHECTDMGPYTEESVD-YPDYAHKVARAVAAGEYEQGILLCGTGLGVSISANKVPGIRAALACRPEFATLARQHNNANVLCMSARFTDSAAIVTTLEHWFAAEFEGGRHQRRVEKI 140
>gi|88805083|ref|ZP_01120603.1| ribose-5-phosphate isomerase B [Robiginitalea biformata HTCC2501] >gi|88785962|gb|EAR17131.1| ribose-5-phosphate isomerase B [Robiginitalea biformata HTCC2501] (169 aa)
Score = 315, Expect = 6.4e-28, Identities = 63/146 (43%), Positives = 94/146 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKT--AALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYEREK 152
           IYIASDH G ELK+ + +HL      V DLGP   DP DDYPD+    A+ + ANP SLG+++ G+G G  +AANK +G+ AAL         +L+R H+ AN+L L +RF+  EE I +++ +L+  +    RH +R+ K+ AYE+++
  S:    13 IYIASDHAGFELKNALCRHLAASGRDVEDLGPYAYDPEDDYPDFILPAAEAVAANPGSLGVVLGGSGQGEALAANKVEGVRAALYYGGPRDIVSLSRTHNQANILSLGARFLDEEEAIAVLELWLETPYGREERHVRRINKVRAYEQKR 161
>gi|167753226|ref|ZP_02425353.1| hypothetical protein ALIPUT_01497 [Alistipes putredinis DSM 17216] >gi|167659157|gb|EDS03287.1| hypothetical protein ALIPUT_01497 [Alistipes putredinis DSM 17216] (150 aa)
Score = 315, Expect = 6.5e-28, Identities = 60/143 (41%), Positives = 90/143 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   I IASDH G E+K  ++ +L  +   V+D GP   + +D YPD+A  LA  +++     GI +CG+G G+ +  NK +GI A LV D + A L RQH++ANV+ L +RF+  ++ ++ V+EFL   FEGGRH +R+ KI
  S:     1 MEKKIGIASDHAGYEMKEFLVGYLAAKGWDVLDFGPESEESVD-YPDFAHPLANAIESGELERGIGLCGSGEGMAITLNKHQGIRAGLVWDKQIAHLIRQHNNANVIVLPARFITNDQAVEFVEEFLATDFEGGRHQRRIEKI 142
>gi|57239139|ref|YP_180275.1| ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|57161218|emb|CAH58133.1| ribose 5-phosphate isomerase B [Ehrlichia ruminantium str. Welgevonden] (146 aa)
Score = 315, Expect = 7.2e-28, Identities = 60/143 (41%), Positives = 91/143 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAY 148
            I+I+SDH G+EL+  +  +LE     V D G    D + DYPDY   +   + +N +  GILICGTG+G+ +AAN+ K + AAL   ++ A  AR+H++ANVLCL +R++  E+   IV +FL  +F  GRH++R+ KI +Y
  S:     3 KIFISSDHAGVELRLFIKLYLESLSYTVEDYGCVISDVIVDYPDYVQDVVHCVTSNDSGFGILICGTGIGMSIAANRYKKVRAALCYTTELARFAREHNNANVLCLGARYITYEKAKLIVYKFLNTKFAEGRHTQRIEKIDSY 145
>gi|58579090|ref|YP_197302.1| ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58617147|ref|YP_196346.1| ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Gardel] >gi|58416759|emb|CAI27872.1| Ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Gardel] >gi|58417716|emb|CAI26920.1| Ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Welgevonden] (148 aa)
Score = 315, Expect = 7.5e-28, Identities = 60/143 (41%), Positives = 91/143 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAY 148
            I+I+SDH G+EL+  +  +LE     V D G    D + DYPDY   +   + +N +  GILICGTG+G+ +AAN+ K + AAL   ++ A  AR+H++ANVLCL +R++  E+   IV +FL  +F  GRH++R+ KI +Y
  S:     5 KIFISSDHAGVELRLFIKLYLESLSYTVEDYGCVISDVIVDYPDYVQDVVHCVTSNDSGFGILICGTGIGMSIAANRYKKVRAALCYTTELARFAREHNNANVLCLGARYITYEKAKLIVYKFLNTKFAEGRHTQRIEKIDSY 147
>gi|154149471|ref|YP_001406600.1| ribose 5-phosphate isomerase B [Campylobacter hominis ATCC BAA-381] >gi|153805480|gb|ABS52487.1| ribose 5-phosphate isomerase B [Campylobacter hominis ATCC BAA-381] (148 aa)
Score = 315, Expect = 8.1e-28, Identities = 61/145 (42%), Positives = 89/145 (61%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           MQ+   I+IASDH G + K +  K L Q   +VIDLG  +     DYPD+A+ L++ +  +  + GILICGTG+G+ +AAN+   I  AL  D+ TA LAR+H+DAN+L    R +   E   I+  F   +F GGRH++R+ K+
  S:     1 MQI-EKIFIASDHAGFDAKQIAKKTLNQMNFEVIDLGTNDSQKSVDYPDFAYALSKEIAKDEKNYGILICGTGIGISIAANRNPKIRCALCHDALTAKLAREHNDANILAFGGRILGSAEIESIIKIFFNTEFLGGRHARRIAKL 144
>gi|86150810|ref|ZP_01069026.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841980|gb|EAQ59226.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 260.94] (145 aa)
Score = 315, Expect = 8.2e-28, Identities = 66/143 (46%), Positives = 91/143 (63%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +   IYIASDH G ELK  +   L+++ +   DLG       D YPDYA LLA+ +  +  S GILICG+G+G+ +AAN+ K I  AL  +S +A LAR+H+DANVL L  R +  E  I I+++F+Q  FE GRH +R+ KI
  S:     2 LREKIYIASDHAGFELKEKICVFLKEKNIIFNDLGTNTCTSCD-YPDYAHLLAEKI--DERSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDIIEKFIQTPFEEGRHMQRIQKI 141
>gi|83593163|ref|YP_426915.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83576077|gb|ABC22628.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] (162 aa)
Score = 314, Expect = 8.4e-28, Identities = 66/139 (47%), Positives = 87/139 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH G+ELK+L++ HL      V+DLG    + +D YPD A  LAQ ++A     G+LICGTG+G+ +A N+   +  ALV D+  A LARQH+DANVL L  R   PE      D FL   FEGGRH++RV K+
  S:    20 IALASDHGGVELKALLVDHLRATGHDVLDLGTQGPESVD-YPDIANTLAQALRAGRAGRGVLICGTGIGISIAINRHADMRGALVHDAFGARLARQHNDANVLVLGGRTTGPEIAKDCADIFLSTPFEGGRHARRVAKL 157
>gi|86152741|ref|ZP_01070946.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121613326|ref|YP_001000599.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 81-176] >gi|157415182|ref|YP_001482438.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 81116] >gi|167005530|ref|ZP_02271288.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni 81-176] >gi|85843626|gb|EAQ60836.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87248897|gb|EAQ71860.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 81-176] >gi|157386146|gb|ABV52461.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni 81116] (145 aa)
Score = 314, Expect = 1.0e-27, Identities = 66/143 (46%), Positives = 91/143 (63%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +   IYIASDH G ELK  +   L+++ +   DLG       D YPDYA LLA+ +  +  S GILICG+G+G+ +AAN+ K I  AL  +S +A LAR+H+DANVL L  R +  E  I I+++F+Q  FE GRH +R+ KI
  S:     2 LREKIYIASDHAGFELKEKICVFLKEKNIIFNDLGTNTCASCD-YPDYAHLLAEKI--DERSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDIIEKFIQTPFEEGRHMQRIQKI 141
>gi|56965623|ref|YP_177357.1| ribose-5-phosphate isomerase B [Bacillus clausii KSM-K16] >gi|56911869|dbj|BAD66396.1| ribose 5-phosphate isomerase B [Bacillus clausii KSM-K16] (149 aa)
Score = 314, Expect = 1.1e-27, Identities = 65/145 (44%), Positives = 88/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I IASDH G  L++ +   LE+  L   D G  + +   DYPDYA  +A+ +       GILICGTG+G+ +AANK KGI  ALV D+ +A   RQH+D N++ L  R + P   ++IV  +L   FEGGRH  R+GKI AYE +
  S:     3 IAIASDHGGTRLRAEITAMLEEMGLSYKDFG-CDCEGSVDYPDYALPVAEKVAQGEFDRGILICGTGIGMSIAANKVKGIRCALVHDTFSAKATRQHNDTNMIALGERVIGPGLAVEIVQTWLGEAFEGGRHQTRIGKIAAYEEK 146
>gi|19705179|ref|NP_602674.1| ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713120|gb|AAL93973.1| Ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (149 aa)
Score = 313, Expect = 1.1e-27, Identities = 63/140 (45%), Positives = 91/140 (65%)
  Q:     6 PIYIASDHTGLELKSLVIKHL-EQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I + +DH G ELK  + +HL +++ ++VID G    + +D YP Y  L+A+++       GIL+CGTG+G+ +AANK KGI AA   ++  A L R+H++AN+L L +R V     + IVDEFL A FEGGRH KRV +I
  S:     2 KIALGADHGGYELKEKIKQHLAKKEGIEVIDFGTNSTESVD-YPKYGHLVAKSVVDKEVDFGILVCGTGIGISIAANKIKGIRAANCTNTTMAKLTREHNNANILALGARIVGDVLALDIVDEFLSASFEGGRHQKRVDQI 141
>gi|150021067|ref|YP_001306421.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermosipho melanesiensis BI429] >gi|149793588|gb|ABR31036.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermosipho melanesiensis BI429] (145 aa)
Score = 313, Expect = 1.2e-27, Identities = 63/139 (45%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G ELK  + K+L  + + V+D G    + +D YPD+A  +  +++      GILICGTG+G+ +AANK KGI AAL    + A+LAR+H++AN+L L  R +  E    I+D FL A FEGGRH +R+ KI
  S:     3 IAIGSDHAGFELKEKIKKYLMDKDIDVLDFGTDNKESVD-YPDFAEKVGTSVKNKEVEFGILICGTGIGMSIAANKIKGIRAALCTIPEMASLARKHNNANILVLPGRLIGFELATWILDAFLNATFEGGRHERRISKI 140
>gi|86134789|ref|ZP_01053371.1| ribose 5-phosphate isomerase B [Tenacibaculum sp. MED152] >gi|85821652|gb|EAQ42799.1| ribose 5-phosphate isomerase B [Polaribacter dokdonensis MED152] (144 aa)
Score = 313, Expect = 1.4e-27, Identities = 62/139 (44%), Positives = 89/139 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G E K  +IKHLE++   V++ G T+ +   DYPD     A  +++    LGI++CG+G G  M ANK +GI AAL  +++  AL RQH+DAN+L + +RFV  ++ +  VD FL  +FEGGRH+ RV KI
  S:     3 IAIGNDHAGTEYKFEIIKHLEEKGYTVLNFG-TDTNNSMDYPDAIHPTADALESGKAELGIILCGSGNGAQMTANKHQGIRAALCWNNELVALTRQHNDANILTIPARFVSLQQALGFVDVFLNTEFEGGRHANRVNKI 140
>gi|194333868|ref|YP_002015728.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Prosthecochloris aestuarii DSM 271] >gi|194311686|gb|ACF46081.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Prosthecochloris aestuarii DSM 271] (142 aa)
Score = 312, Expect = 1.7e-27, Identities = 62/139 (44%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G ELK  V   LE    +V D+GP   D   DYPDYA  +AQ +       G+L+CG+G+GV ++ANK +GI AAL  + + A+LARQH++AN++C  +RF   +     +  +  A+FEGGRH +RV KI
  S:     3 IAIGSDHAGYELKKTVKSWLEDHGHEVNDMGPYS-DESVDYPDYARKVAQAVADGEYQQGVLLCGSGIGVSVSANKIRGIRAALAFNPEIASLARQHNNANIICFPARFTDADTIKTSLGNWFSAEFEGGRHERRVQKI 140
>gi|118445012|ref|YP_879009.1| ribose-5-phosphate isomerase B [Clostridium novyi NT] >gi|118135468|gb|ABK62512.1| ribose 5-phosphate isomerase B [Clostridium novyi NT] (149 aa)
Score = 311, Expect = 2.0e-27, Identities = 63/145 (43%), Positives = 92/145 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  DH G+ELK  VI+HL+++ ++V D G T  +   DYP+Y   +A+ + A     GI+ICGTG+G+ ++ANK  G  AAL  D+ +A   R+H++AN+L L +R   P   + IVD FL A FEGGRH +R+ KI   E++
  S:     3 IAIGCDHGGVELKKTVIEHLQEKGIEVKDFG-TYTEESCDYPEYGQKVAEEVVAKNYDFGIVICGTGIGISISANKVPGARAALCHDTFSAHATREHNNANILALGARVTGPGLALDIVDAFLGATFEGGRHERRIDKISEIEKK 146
>gi|154249475|ref|YP_001410300.1| ribose 5-phosphate isomerase B [Fervidobacterium nodosum Rt17-B1] >gi|154153411|gb|ABS60643.1| ribose 5-phosphate isomerase B [Fervidobacterium nodosum Rt17-B1] (145 aa)
Score = 310, Expect = 2.4e-27, Identities = 64/139 (46%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I SDH   ELK  V ++L  + ++VID G   ++ +D YPDYA  +A+ +++     GIL+CGTG+G+ +AANK KGI AAL +    A  AR+H+DANVL L  R +  E     VD FL + FEGGRH +RV KI
  S:     3 VAIGSDHAAFELKEKVKEYLRNKGIEVIDCGTYSIESVD-YPDYAKKVAEKVKSKECHFGILMCGTGIGMSIAANKIKGIRAALCLFPDMATYARKHNDANVLVLPGRLMGIELAKWTVDAFLDSSFEGGRHERRVKKI 140
>gi|70699885|gb|AAZ06854.1| ribose 5-phosphate isomerase [Microbacterium arborescens] (181 aa)
Score = 310, Expect = 2.8e-27, Identities = 63/143 (44%), Positives = 92/143 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTM----QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           I+IA+DH GLE  + +  HL +    V+D GP E DPLDDYP +    AQ +    QA   +LG++  G+G G  +AANK  G+ AALV +  TA LAR+H+DANV+ + +R    +E +  +D F+   F G  RH++R+G++ AYE
  S:     3 IHIATDHAGLEFSTQLQHHLAEAGHDVVDHGPIEYDPLDDYPAFCIRAAQAVVRDQQAGVEALGVVFGGSGNGEQIAANKVHGVRAALVWNIPTAELAREHNDANVIAIGARQHTFDEAVTFIDRFIATPFSGEERHARRIGQLAAYE 150
>gi|84686941|ref|ZP_01014825.1| ribose 5-phosphate isomerase B [Rhodobacterales bacterium HTCC2654] >gi|84665138|gb|EAQ11618.1| ribose 5-phosphate isomerase B [Rhodobacterales bacterium HTCC2654] (146 aa)
Score = 310, Expect = 2.9e-27, Identities = 60/142 (42%), Positives = 88/142 (61%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           M  N  I ++SDH  +EL+  + KH+E +  + +D+GPT  +    YP +    AQ + +   +LGI++CGTG G+ MAANK  GI   +  D+ +A + RQH+DAN+L L +R V     + IVD FL A+FEGGRH+ RV
  S:     1 MTQNKRIVLSSDHAAIELRQTIAKHIEAEGWEAVDIGPTTPES-THYPLHGQAAAQKVASGECALGIILCGTGQGIMMAANKVAGIRCGVCSDTFSARMIRQHNDANILSLGARVVGEGLALDIVDAFLNAEFEGGRHATRV 141
>gi|83319834|ref|YP_424069.1| ribose 5-phosphate isomerase B, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283720|gb|ABC01652.1| ribose 5-phosphate isomerase B, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (165 aa)
Score = 310, Expect = 2.9e-27, Identities = 60/149 (40%), Positives = 94/149 (63%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + M++ IYI +DH+ +E+K  ++ HL+ +  +VIDLG  +    + Y      +A+ +  + NS GI+ICGTG+G+ +AANK K   AALV + +T  LAR H+DAN++ L +R +   + I +VD FL   FEGGRH +RV  +  Y+
  S:    17 VSMSNRIYIGNDHSAVEMKQAIVNHLKSKNYEVIDLGNNDGKSCN-YAKIGQTVAEYVVKDTNSRGIVICGTGIGISIAANKVKNARAALVYEKETTELARIHNDANIIALGARMIAIPKAINLVDIFLNTPFEGGRHIERVDTLNEYK 164
>gi|194336446|ref|YP_002018240.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Pelodictyon phaeoclathratiforme BU-1] >gi|194308923|gb|ACF43623.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Pelodictyon phaeoclathratiforme BU-1] (144 aa)
Score = 310, Expect = 3.0e-27, Identities = 60/139 (43%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I + SDH G   K  V   LE+   +  D+GP   + +D YPDYA  +A+ + A     GIL+CGTG+GV ++ANK KGI AAL  + + A LARQH++AN++C S+RF       + +  +    FEGGRH +RV KI
  S:     3 IAVGSDHAGFTFKKTVTDWLERHDYEFDDMGPYNEESVD-YPDYARKVAEAVAAQQCDSGILLCGTGIGVSISANKIKGIRAALACNPEFATLARQHNNANIICFSARFTDKATIEQSLHNWFTTDFEGGRHQRRVNKI 140
>gi|118726902|ref|ZP_01575517.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] >gi|118663717|gb|EAV70363.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] (149 aa)
Score = 309, Expect = 3.3e-27, Identities = 63/145 (43%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G  LK+ +IK LE + L+V D G    D +D YPDY   +A+ + +     GILICGTG+G+ +AANK  G+ AAL  DS  A + RQH+DAN++ +  R V P     I++ +L+ +F GGRH  R+ KI   E++
  S:     2 IAIGSDHAGYLLKADIIKFLESKGLEVKDFGTNCPDSVD-YPDYGRAVAEAVASKECEKGILICGTGIGISIAANKVPGVRAALCTDSYMAKMCRQHNDANIIAIGERVVGPGLAFDIIETWLETEFLGGRHQNRLDKISDIEKK 145
>gi|47092284|ref|ZP_00230075.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|153168826|ref|ZP_01928587.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|167015753|ref|ZP_02278286.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J1-194] >gi|167215323|ref|ZP_02285630.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL R2-503] >gi|167218449|ref|ZP_02288085.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J1-175] >gi|167455124|ref|ZP_02321347.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J2-064] >gi|47019263|gb|EAL10005.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|133726060|gb|EBA27758.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] (146 aa)
Score = 309, Expect = 3.4e-27, Identities = 61/146 (41%), Positives = 92/146 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            + I  DH G  LK  ++KHL ++ ++V+D+G T  D   D+P YA  +A  + +  + LGIL CGTG+G+ +AANK  GI AA+V D+ +A   R+H+++NVLCL  R +     + IVD +L+A F G RH +R+ KI   ER+
  S:     2 KLTIGCDHGGRRLKDAIVKHLREKDIEVVDIG-TYTDESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNVLCLGERVIGEGLALLIVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|16801882|ref|NP_472150.1| ribose-5-phosphate isomerase B [Listeria innocua Clip11262] >gi|16415357|emb|CAC98047.1| lin2821 [Listeria innocua] (151 aa)
Score = 309, Expect = 3.5e-27, Identities = 62/143 (43%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +  N    GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:     6 VAIASDHGGIELRKSIISYLESVGISYEEFGPEAPESVD-YPGLAITVSEKVVNNEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYE 147
>gi|125975080|ref|YP_001038990.1| ribose-5-phosphate isomerase [Clostridium thermocellum ATCC 27405] >gi|196251796|ref|ZP_03150462.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium thermocellum DSM 4150] >gi|125715305|gb|ABN53797.1| ribose-5-phosphate isomerase [Clostridium thermocellum ATCC 27405] >gi|196198736|gb|EDX93567.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium thermocellum DSM 4150] (149 aa)
Score = 309, Expect = 3.5e-27, Identities = 62/145 (42%), Positives = 94/145 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G  LK  +   L+++  +VID G T  +   DYPD+   +A+ +++     GI+ICGTG+G+ +AANK  GI AA+  +S  A ++R+H+DAN+L L  R V  +  + IVD +L+A+F+GGRH+ RVGKI   E++
  S:     3 IGIGSDHGGYNLKREIADFLKKRGYEVIDFG-THGNESVDYPDFGLKVAEAVKSGECDRGIVICGTGLGISIAANKVPGIRAAVCTNSYMARMSREHNDANILALGERVVGLDLALDIVDTWLKAEFQGGRHATRVGKIGEIEKK 146
>gi|57241152|ref|ZP_00369099.1| sugar-phosphate isomerase [Campylobacter lari RM2100] >gi|57018073|gb|EAL54848.1| sugar-phosphate isomerase [Campylobacter lari RM2100] (145 aa)
Score = 309, Expect = 3.5e-27, Identities = 63/145 (43%), Positives = 88/145 (60%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
           +   IYIASDH G  LK  +I  L+++ +   DLGP   D  D YPDYA LL+  +  N  S GIL+CG+G+G+ +AAN+   I  AL  +  +A L+R+H+DANVL L SR    +   +I++ F+   F GGRH  R+ KI A
  S:     2 LREKIYIASDHAGFILKQEIINFLQEKNISFEDLGPFSNDRCD-YPDYAHLLSSKI--NETSFGILVCGSGIGMSIAANRHTNIRCALCNEPLSAKLSREHNDANVLALGSRLTGIDMAFEIINNFINTSFSGGRHCARISKIEA 143
>gi|123418985|ref|XP_001305454.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] >gi|121886973|gb|EAX92524.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] (144 aa)
Score = 309, Expect = 3.6e-27, Identities = 62/143 (43%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I +  DH G  LK  VI  ++    +VID+G    + +D YPD+A   A+ +++    LG+LICGTG+G+ +AANK KGI  AL  +  TA L RQH++AN++ + +R + PE  I IV  FL   F G RH +RV KI+A E
  S:     3 IVVGCDHGGFALKQTVIDTVKSLGHEVIDVGTNSTESVD-YPDFAQAAAKEIESGNAQLGVLICGTGIGISIAANKCKGIRCALCHEHLTAQLCRQHNNANIVAMGARIIGPETAIDIVKTFLTTDFLGDRHERRVNKIMALE 144
>gi|146296223|ref|YP_001179994.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409799|gb|ABP66803.1| ribose-5-phosphate isomerase [Caldicellulosiruptor saccharolyticus DSM 8903] (150 aa)
Score = 309, Expect = 4.0e-27, Identities = 64/143 (44%), Positives = 88/143 (61%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   + I +DH G  LK  V KHL+++ ++  D G    +  D YPD A  +A  ++      GILICGTG+G+ +AANK KGI AAL  D+ +A  AR H++AN+L + +R +      +IVD FL AQFEGGRH +RV KI
  S:     1 MKLKLAIGADHAGFRLKEAVKKHLDKRGIEYKDFGTYSEESCD-YPDIARDVAIAVKNGEFDFGILICGTGIGISIAANKIKGIRAALCHDTFSAKAARAHNNANILAMGARVIGEGLACEIVDSFLSAQFEGGRHQRRVDKI 142
>gi|193212635|ref|YP_001998588.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobaculum parvum NCIB 8327] >gi|193086112|gb|ACF11388.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobaculum parvum NCIB 8327] (144 aa)
Score = 308, Expect = 4.5e-27, Identities = 62/141 (43%), Positives = 88/141 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
           I + SDH G+E+K  VI  LE+      D+GP   + +D YPD+A  +   +       GIL+CGTG+G+ +AANK KGI A L    + AALARQH++ANVLC ++RF       KI++ +  ++FEGGRH +RV K+ A
  S:     3 IAVGSDHAGVEMKKSVIAWLEKNGHTAEDMGPYTEESVD-YPDFAHKVCSAVLEGKADQGILMCGTGIGMSIAANKVKGIRAGLACGPEFAALARQHNNANVLCFAARFNDVPTAEKILESWFASEFEGGRHQRRVDKLEA 142
>gi|171323824|ref|ZP_02912342.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus sp. WCH70] >gi|171090135|gb|EDT36447.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus sp. WCH70] (148 aa)
Score = 308, Expect = 4.8e-27, Identities = 62/143 (43%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  + K +++  ++ IDLG  E +   DYPDYA  +A+ +       GILICGTG+G+ +AANK KGI  AL  D  +A L RQH+D+N+L +  R + P    +I   +L  +FEGGRH++RV KI  YE
  S:     3 VAIASDHGGIHIREEIKKLMDEMGIEYIDLG-CECETSVDYPDYAIPVAEKVANGEVDRGILICGTGIGMTIAANKVKGIRCALCHDVYSAKLTRQHNDSNILAMGERVIGPGLAREIAKVWLTTEFEGGRHARRVEKITQYE 144
>gi|157163956|ref|YP_001466477.1| ribose 5-phosphate isomerase B [Campylobacter concisus 13826] >gi|157101381|gb|EAT97956.2| ribose 5-phosphate isomerase B [Campylobacter concisus 13826] (147 aa)
Score = 308, Expect = 4.9e-27, Identities = 59/139 (42%), Positives = 91/139 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +++ASDH G ELK+ + + ++    +V+DLG  + + +D YPDYA LLA  ++  PN  G+L+CGTG+G+ +AAN+ + +  AL  D  TA LAR+H+DANV+   +R +     I   + FL+ +F GGRH +RV KI
  S:     6 VFLASDHAGFELKNELKEAIKGLGYEVVDLGTNDKNSVD-YPDYAHLLASKLE--PNCYGVLVCGTGIGISIAANRHENVRCALCHDEFTARLAREHNDANVIAFGARVIGAGVAISAAEAFLKTEFAGGRHERRVQKI 141
>gi|134097936|ref|YP_001103597.1| ribose-5-phosphate isomerase B [Saccharopolyspora erythraea NRRL 2338] >gi|133910559|emb|CAM00672.1| ribose 5-phosphate isomerase RpiB [Saccharopolyspora erythraea NRRL 2338] (156 aa)
Score = 308, Expect = 5.0e-27, Identities = 62/144 (43%), Positives = 89/144 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           +Y+ SDH G ELK+ ++K L +Q  +V D+GP E D  DDYP +    A+ + A+  SLG+++ G+G G  +AANK  G  AAL  +  TA LARQH++A +  + +R    EE   IV+ FL   FEGGRH +R+  +  YER
  S:     3 VYLGSDHAGFELKNHLVKWLTEQGHEVTDVGPAEYDAQDDYPPFCVETARRVVADEGSLGLVLGGSGNGEQIAANKVPGARAALTWNVDTAKLARQHNNALLAGIGARMHTVEEVQAIVEAFLGTDFEGGRHQRRIDLLTDYER 146
>gi|163767560|ref|ZP_02174571.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter sp. K] >gi|196173088|gb|ACG74061.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter sp. K] (147 aa)
Score = 308, Expect = 5.2e-27, Identities = 64/148 (43%), Positives = 87/148 (58%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           M   +   SDH GL L++  +K       +V DLGP   + +D YPDYA  +A+ + A    LGIL+CGTG+G+ ++ANK  G+ AA  V    A +AR H+DANVLC+  R +       +V  FL+  FEGGRH +RV KI A ER
  S:     1 MAERVIAGSDHAGLNLRAEAVKVARAAGFEVEDLGPFSSESVD-YPDYARQVAEAVAAGRARLGILVCGTGIGMSISANKVHGVRAAHCVTEFDARMARAHNDANVLCIGERVLGLGVAAAVVKAFLETPFEGGRHQRRVDKIGALER 147
>gi|167038486|ref|YP_001666064.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038771|ref|YP_001661756.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter sp. X514] >gi|166853011|gb|ABY91420.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter sp. X514] >gi|166857320|gb|ABY95728.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter pseudethanolicus ATCC 33223] (148 aa)
Score = 308, Expect = 5.3e-27, Identities = 59/145 (40%), Positives = 93/145 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + +DH G ELK  + K+L+++ +   D G    + +D YPDYA  +A+ + ++  S GIL+CGTG+G+ +AANK  GI AA   D  +A  A++H++AN+LCL  R   P   + +V+E+L A F+GGRH +R+ KI   E++
  S:     2 IALGADHGGYELKEAIKKYLDEKGIAYKDFGTFGTESVD-YPDYALKVAEAVASHECSEGILVCGTGIGMSIAANKVPGIRAAHAEDVFSAKAAKEHNNANILCLGGRITGPGLAVMMVEEWLNATFQGGRHQRRIDKIAEIEKK 145
>gi|167456163|ref|ZP_02322383.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417771|gb|EDR84474.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter dehalogenans 2CP-1] (147 aa)
Score = 307, Expect = 5.5e-27, Identities = 64/148 (43%), Positives = 87/148 (58%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           M   +   SDH GL L++  +K       +V DLGP   + +D YPDYA  +A+ + A    LGIL+CGTG+G+ ++ANK  G+ AA  V    A +AR H+DANVLC+  R +       +V  FL+  FEGGRH +RV KI A ER
  S:     1 MAERVIAGSDHAGLNLRAEAVKVARAAGFEVEDLGPFSGESVD-YPDYARQVAEAVAAGRARLGILVCGTGIGMSISANKVHGVRAAHCVTEFDARMARAHNDANVLCIGERVLGLGLGAAVVKAFLETPFEGGRHQRRVDKIGALER 147
>gi|118475668|ref|YP_892329.1| ribose 5-phosphate isomerase B [Campylobacter fetus subsp. fetus 82-40] >gi|118414894|gb|ABK83314.1| ribose 5-phosphate isomerase B [Campylobacter fetus subsp. fetus 82-40] (148 aa)
Score = 307, Expect = 5.9e-27, Identities = 64/143 (44%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I+IASDH G + K  V  +L   +  V+DLG    D   DYPD+A  +A+ +  N    GILICGTG+G+ +AAN+   I  AL  D+ TA LAR+H+DANVLC   R V       +V  F   +F GGRH KRV K+  Y+
  S:     6 IFIASDHAGFDTKEFVKSYLSNFEFDVVDLGAYSKDMSVDYPDFADKMAENIN-NDFKFGILICGTGIGISIAANRHPHIRCALCHDATTAKLAREHNDANVLCFGGRIVGTSIIQDMVKVFFTTEFAGGRHEKRVYKLGNYK 147
>gi|29831969|ref|NP_826603.1| ribose-5-phosphate isomerase B [Streptomyces avermitilis MA-4680] >gi|29609086|dbj|BAC73138.1| putative ribose-5-phosphate isomerase [Streptomyces avermitilis MA-4680] (159 aa)
Score = 307, Expect = 6.1e-27, Identities = 61/143 (42%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           +Y+ SDH G ELK+ +++ L+    + +D GP   D  DDYP +    A+   A+P++LGI+I G+G G  +AANK KG+ AAL    +TA+L RQH+DANV+ + +R    EE  K V+ FL   F G  RH +R+  + AYE
  S:     1 MYLGSDHAGFELKNHLVEWLKAAGHEPVDCGPHIYDAQDDYPPFCLRAAEGAAADPDALGIVIGGSGNGEQIAANKVKGVRAALAWSEETASLGRQHNDANVVAVGARMHTQEEATKFVETFLNTPFSGDARHIRRIDMLSAYE 144
>gi|72162601|ref|YP_290258.1| ribose-5-phosphate isomerase B [Thermobifida fusca YX] >gi|71916333|gb|AAZ56235.1| ribose/galactose isomerase:Ribose 5-phosphate isomerase, actinobacteria [Thermobifida fusca YX] (166 aa)
Score = 307, Expect = 6.3e-27, Identities = 62/143 (43%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           IYI SDH G ELK  ++  L++Q   VID GP   D  DDYP +    A+ +  +P +LGI++ G+G G  +AANK KG+ AALV  ++TA LAR+H++ANV+ + +R    +E    VD FL   + G  RHS+R+  +  YE
  S:    14 IYIGSDHAGYELKQHLVSWLQKQGHDVIDAGPAVYDAADDYPPFVLRAAEGVAKDPEALGIVLGGSGNGEQIAANKVKGVRAALVWSNETAKLAREHNNANVISIGARMHTIDEATGFVDTFLTTPYSGEERHSRRIRMLSDYE 157
>gi|123473739|ref|XP_001320056.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] >gi|121902853|gb|EAY07833.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] (144 aa)
Score = 307, Expect = 6.4e-27, Identities = 61/143 (42%), Positives = 86/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + +  DH G  LK  VI  ++    +VID+G    + +D YPDYA   A  +Q+     G+LICGTG+G+ +AANK KGI  AL  +  TA L RQH++AN++ + +R + PE  I IV  FL   F G RH +RV KI++ E
  S:     3 VVVGCDHGGFALKQTVIDTIKSLGHEVIDVGTNSTESVD-YPDYAQKAAHEIQSGNAQFGVLICGTGIGISIAANKCKGIRCALCHEHLTAELCRQHNNANIVAMGARIIGPETAIDIVKTFLTTNFLGDRHERRVCKIMSLE 144
>gi|116872125|ref|YP_848906.1| ribose-5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741003|emb|CAK20123.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] (146 aa)
Score = 306, Expect = 7.2e-27, Identities = 62/145 (42%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I +DH G+ELK ++I+ L++   +V D G    +   DYP+Y   +A+ + A    LGILICGTGVG+ +AANK KGI A +  +  +A L+R+H++ N+L   SR +  E    IV  +L+A+FEGGRH  RV  I   E E
  S:     3 IAIGNDHVGIELKPIIIRFLKELGHEVEDFGAF-TNERTDYPEYGKKVAENVAAGKADLGILICGTGVGISIAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVIGSEMAKMIVQNWLEAEFEGGRHQNRVTMIAGIENE 146
>gi|46908841|ref|YP_015230.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|153197691|ref|ZP_01941918.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|153204311|ref|ZP_01945108.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|168266872|ref|ZP_02688837.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J2-071] >gi|46882114|gb|AAT05407.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|127632864|gb|EBA22298.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|133734091|gb|EBA35789.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (146 aa)
Score = 306, Expect = 7.5e-27, Identities = 60/146 (41%), Positives = 92/146 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            + I  DH G  LK  ++KHL ++ ++V+D+G T  D   D+P YA  +A  + +  + LGIL CGTG+G+ +AANK  GI AA+V D+ +A   R+H+++NVLCL  R +     + +VD +L+A F G RH +R+ KI   ER+
  S:     2 KLTIGCDHGGRRLKDAIVKHLREKDIEVVDIG-TYTDESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNVLCLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|169835933|ref|ZP_02869121.1| ribose 5-phosphate isomerase B [candidate division TM7 single-cell isolate TM7a] (142 aa)
Score = 306, Expect = 8.0e-27, Identities = 58/140 (41%), Positives = 92/140 (65%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I I +DH G+E K+ +++ L  +  ++I++G   LD +D YPD A  +++ +     + GILICGTG+G+ +AANK  GI AAL  +  TA L+R H+DAN++ L +R +  +  +  V+ F+  +FEGGRH++RVGKI
  S:     2 KIVIGNDHAGVEFKNKIMQALRSKGYEIINVGTDTLDSVD-YPDIAKEVSKKIINKEANFGILICGTGIGISIAANKINGIRAALCHNEYTARLSRLHNDANIIALGARVLGEDLGLACVETFINTEFEGGRHARRVGKI 140
>gi|86137131|ref|ZP_01055709.1| ribose 5-phosphate isomerase B [Roseobacter sp. MED193] >gi|85826455|gb|EAQ46652.1| ribose 5-phosphate isomerase B [Roseobacter sp. MED193] (149 aa)
Score = 306, Expect = 8.1e-27, Identities = 58/142 (40%), Positives = 89/142 (62%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           M  +  + ++SDH  ++L+  + +H+  Q  +V+DLGPT  +  D YP +    A+ + A    LGI++CGTG G+ MAANK KGI   +  D+ +A + RQH+DAN+L + +R V     + IVD FL A+FEGGRH+ R+
  S:     1 MTASKRVVLSSDHADIQLRQTIAEHIANQGWEVLDLGPTTSESTD-YPKHGREAAERVAAGDCDLGIIVCGTGQGIMMAANKVKGIRCGVCADTFSARMIRQHNDANMLSIGARVVGKGLALDIVDAFLSAEFEGGRHATRM 141
>gi|193216300|ref|YP_001997499.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chloroherpeton thalassium ATCC 35110] >gi|193089777|gb|ACF15052.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chloroherpeton thalassium ATCC 35110] (142 aa)
Score = 306, Expect = 8.6e-27, Identities = 58/137 (42%), Positives = 88/137 (64%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + SDH G++ K+ V   L +   + +DLGP   +  D YPDYA  +AQ + +   + G+L+CG+GVGV + ANK KG+ AAL    + A+LARQH++ANV+C  +R++   E  + +  + +A FEGGRH +RV KI
  S:     5 LGSDHAGVQKKAFVKDWLIRNGHEAVDLGPYSEESCD-YPDYARKVAQAVASGEVAQGVLLCGSGVGVSIVANKTKGVRAALAYQPEIASLARQHNNANVICFPARYMNESEIEQCLKNWFEADFEGGRHERRVSKI 140
>gi|47095478|ref|ZP_00233087.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153175981|ref|ZP_01931240.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|153180838|ref|ZP_01933834.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] >gi|153185566|ref|ZP_01936116.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153192433|ref|ZP_01939425.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|47016088|gb|EAL07012.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126941702|gb|EBA19581.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127763937|gb|EBA24755.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|133728694|gb|EBA30392.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|133731785|gb|EBA33483.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] (151 aa)
Score = 305, Expect = 9.2e-27, Identities = 61/143 (42%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+ ++EGGRH+ RVG+I AYE
  S:     6 VAIASDHGGIELRKSIISYLESVGISYEEFGPETPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYE 147
>gi|167213289|ref|ZP_02283596.1| ribose-5-phosphate isomerase B [Listeria monocytogenes LO28] (165 aa)
Score = 305, Expect = 9.9e-27, Identities = 61/143 (42%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+ ++EGGRH+ RVG+I AYE
  S:    20 VAIASDHGGIELRKSIISYLESVGISYEEFGPETPESVD-YPRLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYE 161
>gi|159039418|ref|YP_001538671.1| ribose-5-phosphate isomerase B [Salinispora arenicola CNS-205] >gi|157918253|gb|ABV99680.1| ribose 5-phosphate isomerase [Salinispora arenicola CNS-205] (155 aa)
Score = 305, Expect = 9.9e-27, Identities = 61/146 (41%), Positives = 90/146 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYEREK 152
           +Y+ SDH G ELK+ +  HL ++   V+D+GP   DP DDYP +       + A+  SLG++I G+G G  +AANK  GI AAL  +  TA LAR+H++ANV+ + +R    +E   IV+ FL   F G  RHS+R+ ++  YER +
  S:     3 VYLGSDHAGFELKAHLANHLAKEGYDVVDVGPQAYDPDDDYPAFCLHTGDRVVADGGSLGVVIGGSGNGEQIAANKIDGIRAALAWNIDTAHLAREHNNANVVAIGARQHTLDEATAIVEAFLTTPFSGKQRHSRRIDQVADYERTR 149
>gi|86159167|ref|YP_465952.1| ribose-5-phosphate isomerase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85775678|gb|ABC82515.1| ribose-5-phosphate isomerase [Anaeromyxobacter dehalogenans 2CP-C] (147 aa)
Score = 305, Expect = 1.0e-26, Identities = 65/148 (43%), Positives = 86/148 (58%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           M   +   SDH GL L++  +K        V DLGP   + +D YPDYA  +A+ + A    LGIL+CGTG+G+ ++ANK  GI AA  V    A +AR H+DANVLC+  R +       +V  FL+  FEGGRH +RV KI A ER
  S:     1 MAERVIAGSDHAGLHLRAEAVKVARAAGFDVEDLGPFTGESVD-YPDYARQVAEAVAAGRARLGILVCGTGIGMSISANKVHGIRAAHCVTEFDARMARAHNDANVLCMGERVLGLGVAAAVVKAFLETPFEGGRHQRRVDKIGALER 147
>gi|167058737|ref|ZP_02280994.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL F2-515] (168 aa)
Score = 305, Expect = 1.0e-26, Identities = 61/143 (42%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+ ++EGGRH+ RVG+I AYE
  S:    20 VAIASDHGGIELRKSIISYLESVGISYEEFGPEAPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYE 161
>gi|150026516|ref|YP_001297342.1| ribose 5-phosphate isomerase [Flavobacterium psychrophilum JIP02/86] >gi|149773057|emb|CAL44541.1| Ribose 5-phosphate isomerase [Flavobacterium psychrophilum JIP02/86] (142 aa)
Score = 305, Expect = 1.0e-26, Identities = 58/139 (41%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G + K  +++ LEQ+   + + G    D +D YPD+   +A  +       GI+ICG+G G+ M+ANK +GI AAL    + A+LARQH+DAN++ + +R+   ++ I++VD FL   FEGGRH+ RVGKI
  S:     3 ISIGNDHAGPDYKKAIVQFLEQKGHIITNHGTDSFDSVD-YPDFGHKVAIDVTNRKADFGIIICGSGNGIAMSANKHQGIRAALCWTKEIASLARQHNDANIISIPARYTSIQQAIEMVDTFLNTTFEGGRHATRVGKI 140
>gi|16804699|ref|NP_466184.1| hypothetical protein lmo2662 [Listeria monocytogenes EGD-e] >gi|47095466|ref|ZP_00233075.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153175969|ref|ZP_01931228.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|153180826|ref|ZP_01933822.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] >gi|153185578|ref|ZP_01936128.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153192421|ref|ZP_01939413.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|167213277|ref|ZP_02283584.1| hypothetical protein LmonL_23728 [Listeria monocytogenes LO28] >gi|167405462|ref|ZP_02310218.1| hypothetical protein LmonocytFSL_21963 [Listeria monocytogenes FSL J2-003] >gi|16412162|emb|CAD00875.1| lmo2662 [Listeria monocytogenes] >gi|47016076|gb|EAL07000.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126941714|gb|EBA19593.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127763925|gb|EBA24743.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|133728682|gb|EBA30380.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|133731773|gb|EBA33471.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] (146 aa)
Score = 305, Expect = 1.0e-26, Identities = 59/146 (40%), Positives = 92/146 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            + I  DH G  LK  ++KHL ++ ++V+D+G T  D   D+P YA  +A  + +  + LGIL CGTG+G+ +AANK  GI AA+V D+ +A   R+H+++N+LCL  R +     + +VD +L+A F G RH +R+ KI   ER+
  S:     2 KLTIGCDHGGRRLKDAIVKHLREKDIEVVDIG-TYTDESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNILCLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|94987051|ref|YP_594984.1| ribose 5-phosphate isomerase RpiB [Lawsonia intracellularis PHE/MN1-00] >gi|94731300|emb|CAJ54663.1| Ribose 5-phosphate isomerase RpiB [Lawsonia intracellularis PHE/MN1-00] (142 aa)
Score = 305, Expect = 1.1e-26, Identities = 63/139 (45%), Positives = 83/139 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +YIASDH G  LK+ +I+ L+     V DLGP   +P D YP YA  + + +     S GILICGTG+G+ MAAN+ KGI AAL      A   R H++AN+LCL  R +     I+IV+ FL   FEGGRH +R+   
  S:     4 VYIASDHAGFSLKNTLIEQLQDNDYIVRDLGPMTSEPCD-YPLYAQYVCEQVLDEIGSFGILICGTGIGMSMAANRIKGIRAALCTSEFQARATRLHNNANILCLGERVIGKSIAIEIVNIFLTTPFEGGRHLQRIASF 141
>gi|157828278|ref|YP_001494520.1| ribose-5-phosphate isomerase B [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932982|ref|YP_001649771.1| ribose-5-phosphate isomerase B [Rickettsia rickettsii str. Iowa] >gi|157800759|gb|ABV76012.1| ribose-5-phosphate isomerase B [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908069|gb|ABY72365.1| ribose 5-phosphate isomerase [Rickettsia rickettsii str. Iowa] (144 aa)
Score = 305, Expect = 1.1e-26, Identities = 63/141 (44%), Positives = 90/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L++ D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  +  TA  A+ H+DAN+L L ++ + P+    I+D+FL  QFEGGRHS R+ KI
  S:     4 YNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNIFTAENAKAHNDANILILGAKTIDPKIVFDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|16804711|ref|NP_466196.1| ribose-5-phosphate isomerase B [Listeria monocytogenes EGD-e] >gi|16412174|emb|CAD00887.1| lmo2674 [Listeria monocytogenes] (151 aa)
Score = 305, Expect = 1.2e-26, Identities = 61/143 (42%), Positives = 90/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+ ++EGGRH+ RVG+I AYE
  S:     6 VAIASDHGGIELRKSIISYLESVGISYEEFGPETPESVD-YPRLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYE 147
>gi|189500263|ref|YP_001959733.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium phaeobacteroides BS1] >gi|189495704|gb|ACE04252.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium phaeobacteroides BS1] (142 aa)
Score = 304, Expect = 1.3e-26, Identities = 59/139 (42%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G  LK +V   L++   +V D+GP   + +D YPD+A  +A+ +       G+L+CG+G+GV + ANK KGI AAL  + + A+LARQH++ANVLC  +R+       + ++ +  A+FEGGRH +RV KI
  S:     3 IAIGSDHAGYALKKIVYSWLDKHGYEVDDMGPWSEESVD-YPDFARKVAEAVSRGDADQGVLLCGSGIGVSIVANKVKGIRAALAFNPEIASLARQHNNANVLCFPARYSDSGTIEQSLENWFNAEFEGGRHERRVLKI 140
>gi|167403604|ref|ZP_02308429.1| hypothetical protein LmonocytFSL_03441 [Listeria monocytogenes FSL J2-003] (149 aa)
Score = 304, Expect = 1.3e-26, Identities = 62/147 (42%), Positives = 95/147 (64%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
            I IA+DH G +LK  +  HL +    V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGGRH+ R+ K+ A E ++
  S:     2 EIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGGRHNTRLEKLAALEEQE 146
>gi|147679160|ref|YP_001213375.1| ribose 5-phosphate isomerase RpiB [Pelotomaculum thermopropionicum SI] >gi|146275257|dbj|BAF61006.1| ribose 5-phosphate isomerase RpiB [Pelotomaculum thermopropionicum SI] (153 aa)
Score = 304, Expect = 1.4e-26, Identities = 63/145 (43%), Positives = 88/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + +ASDH G  LK  VI  L +  +   D G    DP+D YPD A  +A+ ++      G+L CGTG+GV + ANK  GI AAL  D+ +A  AR+H+DAN+L +  R + P     IV  +LQA+F+GGRH++RV KI   E+E
  S:     3 VAVASDHGGFRLKEEVIGLLRELGIAYRDFGTYSEDPVD-YPDMALAVAEAVRKGEYDRGVLCCGTGIGVAICANKVPGIRAALCHDTFSARAAREHNDANILTMGQRVIGPGLARDIVATWLQAEFQGGRHARRVDKIRCIEQE 146
>gi|108758725|ref|YP_632929.1| ribose 5-phosphate isomerase B [Myxococcus xanthus DK 1622] >gi|108462605|gb|ABF87790.1| ribose 5-phosphate isomerase B [Myxococcus xanthus DK 1622] (147 aa)
Score = 304, Expect = 1.5e-26, Identities = 59/136 (43%), Positives = 85/136 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           + +ASDH GLEL+  ++  L  + +   D+GP   D +D YPD+A  +++ + +   +LG+L+CGTG+G+ + ANK KGI AAL      A +AR H+DANVLCL  R V       I++ FL   FEGGRH +RV
  S:     3 VILASDHAGLELRQELVAALTARGVAHEDVGPVTRDSVD-YPDFAARVSRAVTSGEATLGVLVCGTGIGMSIVANKHKGIRAALCTTEFEARMARAHNDANVLCLGQRVVGAGVGRAILEAFLSTAFEGGRHERRV 137
>gi|168185919|ref|ZP_02620554.1| ribose 5-phosphate isomerase B [Clostridium botulinum C str. Eklund] >gi|169296051|gb|EDS78184.1| ribose 5-phosphate isomerase B [Clostridium botulinum C str. Eklund] (149 aa)
Score = 304, Expect = 1.5e-26, Identities = 61/145 (42%), Positives = 92/145 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  DH G++LK  VI+HL+++ ++V D G T  +   DYP+Y   +A+ + A     GI+ICGTG+G+ ++ANK  G  AAL  D+ +A   R+H++AN+L L +R   P   + IVD FL + FEGGRH +R+ KI   E++
  S:     3 IAIGCDHGGVDLKRTVIEHLQEKGIEVKDFG-TYTEESCDYPEYGQKVAEEVVAKNYDFGIVICGTGIGISISANKVPGARAALCHDTFSAHATREHNNANILALGARVTGPGLALDIVDSFLGSTFEGGRHERRIEKISDIEKK 146
>gi|57504983|ref|ZP_00370935.1| sugar-phosphate isomerase [Campylobacter coli RM2228] >gi|57019255|gb|EAL55961.1| sugar-phosphate isomerase [Campylobacter coli RM2228] (145 aa)
Score = 304, Expect = 1.5e-26, Identities = 65/143 (45%), Positives = 90/143 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLD-DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +   IYIASDH G  LK  +   LE++++   DLG    DP   DYPDYA LLA  +  +  S GILICG+G+G+ +AAN+ K I  AL  +S +A LAR+H+DANVL    R +  +  I +++ F+Q  F+ GRH KR+ KI
  S:     2 LREKIYIASDHAGFLLKEKICAFLEEKQIPFDDLGTK--DPTSCDYPDYAHLLASKI--DEQSFGILICGSGIGISIAANRHKNIRCALCNESLSAKLARKHNDANVLAFGGRLIGIDAAIDMIENFIQTPFDQGRHVKRIQKI 141
>gi|150008300|ref|YP_001303043.1| ribose 5-phosphate isomerase B [Parabacteroides distasonis ATCC 8503] >gi|149936724|gb|ABR43421.1| ribose 5-phosphate isomerase B [Parabacteroides distasonis ATCC 8503] (143 aa)
Score = 303, Expect = 1.6e-26, Identities = 61/137 (44%), Positives = 82/137 (59%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + SDH G ELK  +   L+++ L   D G    D  D YPD+A L+ + ++A     GI +CGTG G+ M  NK +G+ AAL      A LAR+H+DANVL +  RF+  EE  KIV+ FL   FEGGRH +R+ KI
  S:     6 LCSDHAGFELKEYIKTILDERGLSYKDFGTYSSDSCD-YPDFAHLMGKAVEAGEVYPGIAVCGTGNGISMTLNKHRGVRAALCWREDIAKLAREHNDANVLSMPGRFISKEEAKKIVEIFLDTPFEGGRHQRRIDKI 141
>gi|116874027|ref|YP_850808.1| ribose 5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742905|emb|CAK22029.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] (146 aa)
Score = 303, Expect = 1.6e-26, Identities = 59/146 (40%), Positives = 91/146 (62%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            + I  DH G  LK  ++KHL ++ + V+D+G T  D   D+P YA  +A  + +  + LGIL CGTG+G+ +AANK  GI AA+V D+ +A   R+H+++N+LCL  R +     + +VD +L+A F G RH +R+ KI   ER+
  S:     2 KLTIGCDHGGRRLKDAIVKHLREKNIDVVDIG-TYTDESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNILCLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|144897821|emb|CAM74685.1| Ribose/galactose isomerase [Magnetospirillum gryphiswaldense MSR-1] (149 aa)
Score = 303, Expect = 1.6e-26, Identities = 60/139 (43%), Positives = 91/139 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH GLE+K++V   L+++   V+DLG  +   +D YPD+A  +AQ ++    + G+L+CG+G+G+ +AAN+   + AALV DS  A + R H+DANVL L  R   PE   + ++ FL   FEGGRH++RV K+
  S:     6 IALASDHGGLEMKAMVAALLQEKGFGVLDLGAHDGQSVD-YPDFAVAMAQALKDGRATRGVLMCGSGIGISIAANRFAHVRAALVHDSYGARMCRLHNDANVLVLGGRTTGPEVAKECIEIFLATPFEGGRHARRVAKL 143
>gi|167015764|ref|ZP_02278297.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J1-194] (165 aa)
Score = 303, Expect = 1.8e-26, Identities = 61/143 (42%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:    20 VAIASDHGGIELRKSIISYLESVGISYEEFGPEAPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYE 161
>gi|51891215|ref|YP_073906.1| ribose 5-phosphate isomerase [Symbiobacterium thermophilum IAM 14863] >gi|51854904|dbj|BAD39062.1| ribose 5-phosphate isomerase [Symbiobacterium thermophilum IAM 14863] (146 aa)
Score = 303, Expect = 1.8e-26, Identities = 63/140 (45%), Positives = 88/140 (62%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            + +ASDH G++LK+ VI  L+    +V DLG  +    D YPDYA  +A+ + A     G+LICGTG+G+ +AANK  G+ AAL  +  +A +AR H+DANVLCL +R V      +IV  F   + EGGRH++RV KI
  S:     2 KVAVASDHGGIDLKATVISVLKSLGCEVADLGTHDRSSCD-YPDYAQKVAEGVAAGEYQRGVLICGTGIGMSIAANKVAGVRAALCNEIYSARMARAHNDANVLCLGARVVGSGVAEEIVRAFFTTEHEGGRHARRVEKI 140
>gi|73748479|ref|YP_307718.1| ribose-5-phosphate isomerase B [Dehalococcoides sp. CBDB1] >gi|73660195|emb|CAI82802.1| putative ribose-5-phosphate isomerase [Dehalococcoides sp. CBDB1] (152 aa)
Score = 303, Expect = 1.9e-26, Identities = 62/148 (41%), Positives = 89/148 (60%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           N  I I +DH G +LK+ ++  L    L+V+DLG    +  DDYPD+A  +A+ +       GI+ICG+GVG C+ ANK KGI A L  D  +A    +HDD NVLCL +R +  E   +I+  FL A+F G  RH +R+ K++  E+E
  S:     3 NISIAIGADHGGYDLKTGILPFLNHLGLKVLDLGACTYNSADDYPDFAQTVARNVACGKTDRGIIICGSGVGACITANKIKGIRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIISAFLNARFTGEERHKRRLEKLLKVEKE 151
>gi|15829083|ref|NP_326443.1| ribose-5-phosphate isomerase B [Mycoplasma pulmonis UAB CTIP] >gi|14090027|emb|CAC13785.1| RIBOSE-5-PHOSPHATE ISOMERASE [Mycoplasma pulmonis] (155 aa)
Score = 303, Expect = 1.9e-26, Identities = 63/137 (45%), Positives = 86/137 (62%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNS--LGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I IASDH G  LK  + KH + Q  +VIDLG T  +    Y +Y   LA+ MQ   N    GI ICGTG+G+  A N+ +GI+AA V   + A LA+ H++ANVL L SR +  E+ +KI+D++ Q+ FEGGRH  R+
  S:     3 KIAIASDHAGYSLKESIKKHYKDQNYEVIDLG-TNSEESTSYSEYGHKLAEYMQNKDNKVDFGIGICGTGLGISYALNRHEGIIAARVTSEEDAYLAKAHNNANVLALGSRQISLEKAVKIIDKYQQSSFEGGRHIPRI 140
>gi|124006451|ref|ZP_01691284.1| ribose 5-phosphate isomerase B [Microscilla marina ATCC 23134] >gi|123987864|gb|EAY27544.1| ribose 5-phosphate isomerase B [Microscilla marina ATCC 23134] (142 aa)
Score = 303, Expect = 1.9e-26, Identities = 63/139 (45%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I  DH G   K  V+  L+ + + V D GP   + +D YPD+   +A+ + A    LGILICG+G GV M ANK + + AAL   ++ AALARQH++ANVLC+ +RFV       +V+ FL   FEGGRH +RV KI
  S:     3 IAIGGDHAGFAYKEAVVALLKDKGVAVEDFGPFSEESVD-YPDFVHPVAKKVDAKEADLGILICGSGNGVAMTANKYQSVRAALCWQTELAALARQHNNANVLCIPARFVDLALAKNMVETFLNESFEGGRHERRVNKI 140
>gi|77919042|ref|YP_356857.1| ribose 5-phosphate isomerase B [Pelobacter carbinolicus DSM 2380] >gi|77545125|gb|ABA88687.1| ribose-5-phosphate isomerase [Pelobacter carbinolicus DSM 2380] (151 aa)
Score = 303, Expect = 2.0e-26, Identities = 59/143 (41%), Positives = 91/143 (63%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           IASDH GLELK  V  +L+Q+ ++V DLG    D +D YPD+   + + +       GILICGTG+G+ + ANK  G+ AAL+ D  TA ++++H++AN++ +  R +  ++  ++V  +L A FEGGRH KR+ KI   E +
  S:     4 IASDHGGLELKEQVKAYLKQRNIEVRDLGTDNGDSVD-YPDFGERVGRAISTGEAEKGILICGTGIGMSIVANKFPGVRAALIWDEFTARMSKEHNNANIIVMGGRMLSDDKASQMVGVWLDATFEGGRHQKRLDKIAQIEED 145
>gi|163841998|ref|YP_001626403.1| ribose-5-phosphate isomerase B [Renibacterium salmoninarum ATCC 33209] >gi|162955474|gb|ABY24989.1| ribose 5-phosphate isomerase [Renibacterium salmoninarum ATCC 33209] (178 aa)
Score = 303, Expect = 2.0e-26, Identities = 66/148 (44%), Positives = 98/148 (66%)
  Q:     3 MNHP-IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNS----LGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           M+ P ++IA+DH GLEL + +I HL  +  +VID GP+  DP DDYP +    AQ   A+  +    LGI++ G+G G  +AANK +GI AALV + +TA LAR+H+DANV+ +  R    +E   +++ FL   F +G RH +R+GKI  +E+
  S:    19 MSTPRVHIATDHAGLELSAHLISHLGDRGYEVIDHGPSSYDPEDDYPAFCIHAAQAAMADTKAGVFALGIVLGGSGNGEQIAANKVEGIRAALVWNLETAKLAREHNDANVVAVGGRQHSVDEATGLIEAFLAEPFSDGERHVRRIGKIAHFEQ 172
>gi|169335783|ref|ZP_02862976.1| hypothetical protein ANASTE_02208 [Anaerofustis stercorihominis DSM 17244] >gi|169258521|gb|EDS72487.1| hypothetical protein ANASTE_02208 [Anaerofustis stercorihominis DSM 17244] (150 aa)
Score = 303, Expect = 2.0e-26, Identities = 63/146 (43%), Positives = 88/146 (60%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFL-QAQFEGGRHSKRVGKIIAYERE 151
            I IASDH G ELK  +I+  +++    +D G    + +D YPDYA    + + A     GILICGTG+G+ +AANK KGI AA   D  +A + +QH++ANV+ L  R   PE   +I+  +L + +F GGRH  RV KI AYE +
  S:     2 KIVIASDHGGYELKQFLIETFKKEGYDFVDYGTNSEESVD-YPDYAIKTCEDVAAGKFDRGILICGTGIGISIAANKVKGIRAAHCTDCFSAKMCKQHNNANVIVLGGRITGPELAAEILRTYLNEKEFLGGRHENRVNKIKAYEEK 147
>gi|167344766|ref|ZP_02290607.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J1-208] (165 aa)
Score = 302, Expect = 2.0e-26, Identities = 61/143 (42%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:    20 VAIASDHGGIELRKSIISYLESVGISYEEFGPETPESVD-YPGLAITVSEKVVNREVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQIAAYE 161
>gi|154509456|ref|ZP_02045098.1| hypothetical protein ACTODO_01987 [Actinomyces odontolyticus ATCC 17982] >gi|153799090|gb|EDN81510.1| hypothetical protein ACTODO_01987 [Actinomyces odontolyticus ATCC 17982] (169 aa)
Score = 302, Expect = 2.1e-26, Identities = 63/144 (43%), Positives = 87/144 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYER 150
           ++I +DH G ELK  V+ HL +    V+D G    D LDDYP +    AQ +   P SLGI+I G+G G  MAAN  +G+ AALV    TA LAR+H+DANV+ + +R    EE + ++D FL+  F G  RH +R+  +  YER
  S:    21 VHIGTDHAGFELKEKVVAHLREAGHDVVDHGAHTYDALDDYPPFCIEAAQAVVDEPGSLGIVIGGSGNGEQMAANCVEGVRAALVWSDATARLAREHNDANVVAVGARQHSEEEALALIDAFLETPFSGDERHQRRIDLMKDYER 165
>gi|167215332|ref|ZP_02285639.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL R2-503] (168 aa)
Score = 302, Expect = 2.2e-26, Identities = 61/143 (42%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:    20 VAIASDHGGIELRKSIISYLESVGISYEEFGPEAPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYE 161
>gi|153204323|ref|ZP_01945120.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|167405471|ref|ZP_02310227.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-003] >gi|168266881|ref|ZP_02688846.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-071] >gi|133734103|gb|EBA35801.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (151 aa)
Score = 302, Expect = 2.2e-26, Identities = 61/143 (42%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:     6 VAIASDHGGIELRKSIISYLESVGISYEEFGPEAPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYE 147
>gi|46908853|ref|YP_015242.1| ribose-5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47092296|ref|ZP_00230087.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|116874039|ref|YP_850820.1| ribose-5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153168838|ref|ZP_01928599.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|167455135|ref|ZP_02321358.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-064] >gi|46882126|gb|AAT05419.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47019275|gb|EAL10017.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|116742917|emb|CAK22041.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] >gi|133726072|gb|EBA27770.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] (151 aa)
Score = 302, Expect = 2.3e-26, Identities = 61/143 (42%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:     6 VAIASDHGGIELRKSIISYLESVGISYEEFGPEAPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYE 147
>gi|189466413|ref|ZP_03015198.1| hypothetical protein BACINT_02788 [Bacteroides intestinalis DSM 17393] >gi|189434677|gb|EDV03662.1| hypothetical protein BACINT_02788 [Bacteroides intestinalis DSM 17393] (144 aa)
Score = 302, Expect = 2.6e-26, Identities = 65/139 (46%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G ELK  V   LE +  +  D G    +  D Y D+A  LA  ++A     GI ICG+G G+ M  NK +GI AAL   ++ A LARQH+DANVL +  RF+  EE   I+ EF   QFEGGRH KR+ KI
  S:     4 IGICSDHAGFELKQYVKGWLETKGWEYKDFGTYTTESCD-YADFAHPLALAVEAGECYPGIAICGSGEGISMTLNKHQGIRAALCWTAEIAHLARQHNDANVLVMPGRFISTEEADMIMREFFSTQFEGGRHQKRIEKI 141
>gi|167763471|ref|ZP_02435598.1| hypothetical protein BACSTE_01845 [Bacteroides stercoris ATCC 43183] >gi|167698765|gb|EDS15344.1| hypothetical protein BACSTE_01845 [Bacteroides stercoris ATCC 43183] (145 aa)
Score = 302, Expect = 2.6e-26, Identities = 64/139 (46%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I + SDH G ELK  V   LE +     D G    +  D YPD+A  LAQ ++A     GI ICG+G G+ M  NK +GI AAL   ++ A LARQH+DANVL +  RF+  EE   I+ EF    FEGGRH +R+ KI
  S:     4 IGLCSDHAGFELKEYVRGWLEAKGWPYKDYGTYSTESCD-YPDFAHQLAQAVEAGECYPGIAICGSGNGINMTLNKHQGIRAALCWTAEIAHLARQHNDANVLVMPGRFIGTEEADMIMTEFFNTSFEGGRHQRRIDKI 141
>gi|57234553|ref|YP_181419.1| ribose-5-phosphate isomerase B [Dehalococcoides ethenogenes 195] >gi|57234618|ref|YP_181385.1| ribose-5-phosphate isomerase B [Dehalococcoides ethenogenes 195] >gi|57225001|gb|AAW40058.1| ribose-5-phosphate isomerase, putative [Dehalococcoides ethenogenes 195] >gi|57225066|gb|AAW40123.1| ribose-5-phosphate isomerase, putative [Dehalococcoides ethenogenes 195] (152 aa)
Score = 301, Expect = 2.9e-26, Identities = 61/148 (41%), Positives = 89/148 (60%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           N  + I +DH G  LK+ ++  L Q  ++V+DLG    D  DDYPD+A  +A+ +       GI+ICG+GVG C+ ANK KG+ A L  D  +A    +HDD NVLCL +R +  E   +I+  FL A+F G  RH +R+ K++  E+E
  S:     3 NISVAIGADHGGYGLKTDLLPFLNQLGIKVLDLGACTYDSADDYPDFALAVARKVACGQTDRGIIICGSGVGACITANKIKGVRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIITAFLNARFTGEERHKRRLEKLLQAEKE 151
>gi|167363518|ref|ZP_02297904.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167069632|gb|EDR73722.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Rhizobium leguminosarum bv. trifolii WSM1325] (149 aa)
Score = 301, Expect = 3.0e-26, Identities = 61/149 (40%), Positives = 88/149 (59%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M   + I ++SDH  ++L+  +  H+  Q    +D+GPT  +    YP +    A+ + +     GI++CGTG G+ MAANK KGI   + VD+ +A + RQH+DAN+L +  R V     + IVD FL AQFEGGRH+ RVG I A E
  S:     1 MTATNRIALSSDHAAIQLRQAIAGHIAAQGWVAVDIGPTTPES-THYPKHGEAAARLVASGDCRFGIILCGTGQGIMMAANKVKGIRCGVCVDTFSARMIRQHNDANMLSIGVRVVGEGLALDIVDAFLTAQFEGGRHATRVGMIEALE 148
>gi|153197703|ref|ZP_01941930.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|127632876|gb|EBA22310.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] (151 aa)
Score = 301, Expect = 3.0e-26, Identities = 61/143 (42%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+EL+  +I +LE   +   + GP   + +D YP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L   +EGGRH+ RVG+I AYE
  S:     6 VAIASDHGGIELRKSIISYLESVGISYEEFGPETPESVD-YPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLNTDYEGGRHANRVGQITAYE 147
>gi|147669260|ref|YP_001214078.1| ribose-5-phosphate isomerase B [Dehalococcoides sp. BAV1] >gi|146270208|gb|ABQ17200.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Dehalococcoides sp. BAV1] (152 aa)
Score = 301, Expect = 3.0e-26, Identities = 62/148 (41%), Positives = 89/148 (60%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           N  I I +DH G +LK+ ++  L    L+V+DLG    +  DDYPD+A  +A+ +       GI+ICG+GVG C+ ANK KGI A L  D  +A    +HDD NVLCL +R +  E   +I+  FL A+F G  RH +R+ K++  E+E
  S:     3 NISIAIGADHGGYDLKTDILPFLNHLGLKVLDLGACTYNSSDDYPDFAQTVARNVACGKTDRGIIICGSGVGACITANKIKGIRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIISAFLNARFTGEERHKRRLEKLLKVEKE 151
>gi|157964374|ref|YP_001499198.1| ribose-5-phosphate isomerase B [Rickettsia massiliae MTU5] >gi|157844150|gb|ABV84651.1| Ribose-5-phosphate isomerase [Rickettsia massiliae MTU5] (149 aa)
Score = 301, Expect = 3.2e-26, Identities = 63/141 (44%), Positives = 89/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L++ D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  D  TA  A+ H+DAN+L L ++ +  +    I+D+FL  QFEGGRHS R+ KI
  S:     9 YNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNDILTAENAKAHNDANILILGAKTIGQKIVFDIIDKFLTTQFEGGRHSTRLSKI 148
>gi|34580661|ref|ZP_00142141.1| ribose-5-phosphate isomerase [Rickettsia sibirica 246] >gi|28262046|gb|EAA25550.1| ribose-5-phosphate isomerase [Rickettsia sibirica 246] (144 aa)
Score = 300, Expect = 3.7e-26, Identities = 63/141 (44%), Positives = 89/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L++ D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN+   I AAL  +  TA  A+ H+DAN+L L ++ + P+    I+D+FL  QFEGGRHS R+ KI
  S:     4 YNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRNSEIRAALCNNILTAENAKAHNDANILILGAKTIDPKIVCDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|83856108|ref|ZP_00949637.1| ribose 5-phosphate isomerase B, putative [Croceibacter atlanticus HTCC2559] >gi|83849908|gb|EAP87776.1| ribose 5-phosphate isomerase B, putative [Croceibacter atlanticus HTCC2559] (143 aa)
Score = 300, Expect = 3.9e-26, Identities = 55/139 (39%), Positives = 90/139 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G   K+ ++++L+ + ++VI+ G    D +D YPD+   +A  +++N  +LGI+ICG+G G  M ANK +G+ +AL    +   LAR+H+DAN+L + +RF   ++ +++V  FL  +FEGGRH  RV KI
  S:     3 IAIGNDHAGTFYKNTIVEYLKSENIEVINYGTNSEDSVD-YPDFVHPVAADVESNSVNLGIIICGSGNGASMTANKHQGVRSALCWTKEITKLAREHNDANILSIPARFTSVQQALEMVKVFLNTEFEGGRHQTRVDKI 140
>gi|196249765|ref|ZP_03148461.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus sp. G11MC16] >gi|196210641|gb|EDY05404.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus sp. G11MC16] (148 aa)
Score = 300, Expect = 4.1e-26, Identities = 58/145 (40%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + IASDH G+ ++  +   L++  ++  D G  + +   DYPDYA  +A+ +       GILICGTG+G+ +AANK KG+  AL  D  +A L R H+D+N+L +  R + P    +I   +L+ +FEGGRH++R+GKI  YE E
  S:     3 VAIASDHGGIRIREEIKALLDEMGIEYTDFG-CDCETSVDYPDYALPVAEKVARGEFDRGILICGTGIGMTIAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIGPGLAREIAKAWLETEFEGGRHARRIGKIADYENE 146
>gi|50843092|ref|YP_056319.1| ribose-5-phosphate isomerase B [Propionibacterium acnes KPA171202] >gi|50840694|gb|AAT83361.1| sugar isomerase [Propionibacterium acnes KPA171202] (157 aa)
Score = 300, Expect = 4.2e-26, Identities = 62/143 (43%), Positives = 85/143 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE-GGRHSKRVGKIIAYE 149
           ++I +DH   ELK  ++  L +   QV+D G    D  DDYPDY    AQ + A+P SLGI++ G+G G  +AANK KGI AAL    + A LAR H++ANV+ L  R    EE  +IV+ FL   F    RH +R+ K+I +E
  S:     8 VHIGTDHAAFELKEYLVGKLTEAGYQVVDHGAASYDSQDDYPDYCIPCAQAVMADPGSLGIVLGGSGNGEQIAANKVKGIRAALAYTVEIAELARLHNNANVVSLGGRMQTQEEAWQIVETFLTTDFSPEDRHQRRIDKLIRWE 151
>gi|16801872|ref|NP_472140.1| hypothetical protein lin2811 [Listeria innocua Clip11262] >gi|16415347|emb|CAC98037.1| lin2811 [Listeria innocua] (146 aa)
Score = 300, Expect = 4.5e-26, Identities = 59/146 (40%), Positives = 90/146 (61%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            + I  DH G  LK  ++KHL ++ ++V+D+G T  D   D+P YA  +A  + +    LGIL CGTG+G+ +AANK  GI AA+V D+ +A   R+H+++NVLCL  R +     + +VD +L+  F G RH +R+ KI   ER+
  S:     2 KLTIGCDHGGRRLKDAIVKHLREKDIEVVDIG-TYTDESVDFPSYAEEVANQVVSGQADLGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNVLCLGERVIGEGLALLLVDTWLEGSFAGDRHKRRLDKITELERK 146
>gi|153808012|ref|ZP_01960680.1| hypothetical protein BACCAC_02298 [Bacteroides caccae ATCC 43185] >gi|149129621|gb|EDM20835.1| hypothetical protein BACCAC_02298 [Bacteroides caccae ATCC 43185] (144 aa)
Score = 299, Expect = 4.8e-26, Identities = 62/139 (44%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +A DH G ELK  V   LE +     D G      +D YPDYA  LA  +++     GI ICG+G G+ M  NK +G+ AAL  +++ A LARQH+DAN+L +  RF+  EE   I+ EF   QFEGGRH  R+ KI
  S:     4 IGLACDHAGFELKEYVRGWLEAKGWAYKDFGTNSTASVD-YPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGVRAALCWNAEIAHLARQHNDANILVMPGRFISTEEADMILTEFFSTQFEGGRHQNRINKI 141
>gi|160946570|ref|ZP_02093773.1| hypothetical protein PEPMIC_00528 [Peptostreptococcus micros ATCC 33270] >gi|158446954|gb|EDP23949.1| hypothetical protein PEPMIC_00528 [Peptostreptococcus micros ATCC 33270] (143 aa)
Score = 299, Expect = 5.1e-26, Identities = 58/137 (42%), Positives = 88/137 (64%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I +DH+ +E+K+ ++K LE+   +VI++G    + +D YP +   + + +  N NSLGI ICGTG+G+ +A NK KGI A L  +S +A + R+H++ANVLCL +R    E    IV  F++  FEGGRH KR+
  S:     2 KIIIGNDHSAVEMKNELVKFLEEMGHEVINVGTDGTESVD-YPLFGQAVCKKVLENKNSLGIAICGTGIGISIACNKVKGIRAGLCSESFSARMTRKHNNANVLCLGARVTGIELAKDIVKTFIEEDFEGGRHQKRI 137
>gi|182438708|ref|YP_001826427.1| putative ribose-5-phosphate isomerase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178467224|dbj|BAG21744.1| putative ribose-5-phosphate isomerase [Streptomyces griseus subsp. griseus NBRC 13350] (162 aa)
Score = 299, Expect = 5.4e-26, Identities = 59/143 (41%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           +Y+ SDH G ELK+ +++ L     + +D GP   D  DDYP +    A+   A+P+SLGI+I G+G G  +AANK KG+ AAL    +TAAL R+H++ANV+ +  R    EE+ K V+ FL   +    RH++R+  + AYE
  S:     3 VYLGSDHAGYELKNHLVEWLGAHGHEAVDCGPHIYDAQDDYPPFCLRAAEKTAADPDSLGIVIGGSGNGEQIAANKVKGVRAALAWSEQTAALGREHNNANVVAIGGRMHTVEESTKFVEIFLATPYSNEERHTRRIEMLTAYE 146
>gi|91213638|ref|YP_543624.1| ribose-5-phosphate isomerase B [Escherichia coli UTI89] >gi|117626378|ref|YP_859701.1| ribose-5-phosphate isomerase B [Escherichia coli APEC O1] >gi|91075212|gb|ABE10093.1| ribose 5-phosphate isomerase B [Escherichia coli UTI89] >gi|115515502|gb|ABJ03577.1| ribose 5-phosphate isomerase B [Escherichia coli APEC O1] (149 aa)
Score = 299, Expect = 5.4e-26, Identities = 65/146 (44%), Positives = 87/146 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G   L+   DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+++
  S:     4 IAFGCDHVGFILKHEIVAHLVERDVEVIDKGTWSLER-TDYPHYASQVALAVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQQR 148
>gi|88855147|ref|ZP_01129812.1| ribose-5-phosphate isomerase B [marine actinobacterium PHSC20C1] >gi|88815675|gb|EAR25532.1| ribose-5-phosphate isomerase B [marine actinobacterium PHSC20C1] (162 aa)
Score = 299, Expect = 5.4e-26, Identities = 62/143 (43%), Positives = 91/143 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNS----LGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           I+IA+DH GLE  + + +HL     +VID GP E D LDDYP +    A+ + A+  +    LG++  G+G G  +AANK  GI AALV +  TAALARQH+DANV+ + +R    +E  + +D F+   F G  RH++R+ ++  YE
  S:     3 IHIATDHAGLEFSATLQQHLTDAGHEVIDHGPVEYDALDDYPGFCIAAARGVAADQTAGIQALGVVFGGSGNGEQIAANKVTGIRAALVWNDSTAALARQHNDANVISIGARQHTVDEATRFIDLFIAEPFSGEERHARRIAQLAEYE 150
>gi|3282092|emb|CAA07515.1| hypothetical protein [Thermotoga neapolitana] (143 aa)
Score = 299, Expect = 5.5e-26, Identities = 64/139 (46%), Positives = 87/139 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH   ELK  V  +L  + ++V+D G T  +   DYPDYA  + Q++ +N    GIL+CGTG+G+ +AAN+ +GI AAL +    A LAR H++ANVL L  R +  E    IVD FL   F+GGRH +R+ KI
  S:     3 IAIASDHAAFELKEKVKNYLLNKGIEVLDHG-THSEESVDYPDYAKKVVQSVLSNEVDYGILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANVLVLPGRLIGSELAFWIVDTFLSTPFDGGRHERRIRKI 140
>gi|163746618|ref|ZP_02153976.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Oceanibulbus indolifex HEL-45] >gi|161380503|gb|EDQ04914.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Oceanibulbus indolifex HEL-45] (149 aa)
Score = 299, Expect = 5.6e-26, Identities = 60/143 (41%), Positives = 87/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I+SDH  + L+  + +H+  +  +V D+GPT  +  D YP +    A+ + A    LGILICGTG G+ MAANK KGI   +  D+ +A + R H+DAN+L + +R +     ++IVD FL  +FEGGRH +RV  I A E
  S:     7 IIISSDHADIALRQDIARHVADRGYEVEDIGPTTAESTD-YPKHGEAAARRIAAGEFDLGILICGTGQGIMMAANKVKGIRCGVCADTFSAKMIRAHNDANMLSMGARVIGGGLALEIVDAFLDTEFEGGRHGRRVDMITAIE 148
>gi|119960820|ref|YP_948119.1| ribose-5-phosphate isomerase B [Arthrobacter aurescens TC1] >gi|119947679|gb|ABM06590.1| ribose 5-phosphate isomerase [Arthrobacter aurescens TC1] (160 aa)
Score = 299, Expect = 5.6e-26, Identities = 60/143 (41%), Positives = 91/143 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDY----AFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYE 149
           ++IA+DH G+EL + ++ HL  +  +V+D GP E D LDDYP +       +    +A  ++LGI++ G+G G  +AANK  G+ AAL  +  TA LAR+H+DANV+ +  R    EE  ++++ FLQ  F    RH +R+GKI  YE
  S:     6 VHIATDHAGMELSAHLVSHLTAKGYEVVDHGPKEYDALDDYPSFCINAGLAVVADQKAGVHALGIVLGGSGNGEQIAANKVNGVRAALAWNLSTAKLAREHNDANVVAVGGRQHTVEEATELIEAFLQEPFSNDERHVRRIGKIAVYE 153
>gi|153005594|ref|YP_001379919.1| ribose 5-phosphate isomerase B [Anaeromyxobacter sp. Fw109-5] >gi|152029167|gb|ABS26935.1| ribose 5-phosphate isomerase B [Anaeromyxobacter sp. Fw109-5] (147 aa)
Score = 299, Expect = 5.9e-26, Identities = 60/143 (41%), Positives = 85/143 (59%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   +   SDH GL L++  +K   +   +V D+GP   + +D YPDYA  +A+ + +    LG+L+CGTG+G+ +AANK KG  AA       A +AR H+DANVLC+  R V       IV  FL+ +FEGGRH +RV K+
  S:     1 MADRVIAGSDHAGLSLRAEAVKVAREAGFEVEDVGPFSGESVD-YPDYARQVAEAVASGRARLGLLVCGTGIGMSIAANKVKGARAAHCASEYEARMARLHNDANVLCIGERVVGLGLGAAIVKAFLETRFEGGRHERRVQKL 142
>gi|189462753|ref|ZP_03011538.1| hypothetical protein BACCOP_03450 [Bacteroides coprocola DSM 17136] >gi|189430553|gb|EDU99537.1| hypothetical protein BACCOP_03450 [Bacteroides coprocola DSM 17136] (144 aa)
Score = 298, Expect = 6.2e-26, Identities = 65/139 (46%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH G ELK  V + LE +  +  D G    D  D YPD+A  LA  ++A     GI ICG+G G+ M  NK +GI AAL    + A LARQH+DANVL +  RF+  E   KI+ EF    FEGGRH  R+ KI
  S:     4 IGLASDHAGFELKQYVKQWLEAKGWEYKDFGTYSTDSCD-YPDFAHPLALAVEAGECYPGIAICGSGEGIGMTLNKHQGIRAALCWIPEIAHLARQHNDANVLVMPGRFINTEMADKIMSEFFTTDFEGGRHQARIDKI 141
>gi|83311437|ref|YP_421701.1| ribose 5-phosphate isomerase RpiB [Magnetospirillum magneticum AMB-1] >gi|82946278|dbj|BAE51142.1| Ribose 5-phosphate isomerase RpiB [Magnetospirillum magneticum AMB-1] (150 aa)
Score = 298, Expect = 7.0e-26, Identities = 60/145 (41%), Positives = 88/145 (60%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M     + IA DH G+ELK L+ K L      V+DLG    + +D YPD+A  LA  +++     G+L+CGTG+G+ +AAN+   + AALV D+  A + RQH+DANVL +  R   PE     +  F++ +FEGGRH++RV K+
  S:     1 MMSTKIMAIACDHGGIELKELLAKDLAASGWSVLDLGTNGPESVD-YPDFAVTLADALKSGKAERGVLLCGTGIGISIAANRFPHVRAALVHDAFGARMCRQHNDANVLVMGGRTTGPEVARDCLKIFIETEFEGGRHARRVSKL 144
>gi|116670954|ref|YP_831887.1| ribose-5-phosphate isomerase B [Arthrobacter sp. FB24] >gi|116611063|gb|ABK03787.1| ribose 5-phosphate isomerase [Arthrobacter sp. FB24] (164 aa)
Score = 298, Expect = 7.1e-26, Identities = 62/143 (43%), Positives = 91/143 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDY----AFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYE 149
           ++IA+DH G+EL + ++ HL  +   V+D GP   D LDDYP +    A  +     A  N+LGI++ G+G G  +AANK KG+ AAL  +  TA LAR+H+DANV+ +  R    +E  +I++ FL+  F    RH +R+GKI AYE
  S:    10 VHIATDHAGMELSAHLVTHLTAKGYTVVDHGPKVYDALDDYPSFCINAALAVVADQAAGINALGIVLGGSGNGEQIAANKVKGVRAALAWNLSTATLAREHNDANVVAVGGRQHSVDEATEIIEAFLREPFSNDERHVRRIGKIAAYE 157
>gi|118468978|ref|YP_888945.1| ribose-5-phosphate isomerase B [Mycobacterium smegmatis str. MC2 155] >gi|118170265|gb|ABK71161.1| ribose 5-phosphate isomerase [Mycobacterium smegmatis str. MC2 155] (159 aa)
Score = 298, Expect = 7.3e-26, Identities = 60/144 (41%), Positives = 85/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G E K  +I HLE+   + ID G  E D  DDYP +    A+   A+P SLGI++ G+G G  +AANK  G  AAL    +TA LAR+H++AN++ +  R    EE + IVD FL   + E  RH +R+  +  YER
  S:     3 VYVGADHAGFEFKKTIIAHLEKNGHEPIDCGAYEYDADDDYPAFCIAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARAALAWSVETAQLAREHNNANLIGIGGRMHTTEEALAIVDAFLTTPWSEAERHQRRIDILAEYER 147
>gi|46201724|ref|ZP_00208223.1| COG0698: Ribose 5-phosphate isomerase RpiB [Magnetospirillum magnetotacticum MS-1] (142 aa)
Score = 298, Expect = 7.7e-26, Identities = 61/141 (43%), Positives = 89/141 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
           + IA DH G++LK ++IK L      V+DLG    + +D YPD+A  LAQ ++      G+L+CGTG+G+ +AAN+   I AALV D+  A + RQH+DANVL +  R + PE     +  F + +FEGGRH++RV K+ A
  S:     1 MAIACDHGGVDLKDVLIKDLAASGWTVLDLGTDGPESVD-YPDFAVKLAQALKDGKAERGVLLCGTGIGISIAANRFDHIRAALVHDAFGARMCRQHNDANVLVMGGRTIGPEVARDCLKIFTETEFEGGRHARRVSKLSA 140
>gi|153173351|ref|ZP_01929131.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|133731059|gb|EBA32757.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] (149 aa)
Score = 297, Expect = 7.9e-26, Identities = 61/144 (42%), Positives = 92/144 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
            I IA+DH G +LK  +  HL +    V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGGRH+ R+ K+   E
  S:     2 EIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGGRHNTRLQKLAKLE 143
>gi|56421906|ref|YP_149224.1| ribose-5-phosphate isomerase B [Geobacillus kaustophilus HTA426] >gi|56381748|dbj|BAD77656.1| ribose 5-phosphate isomerase [Geobacillus kaustophilus HTA426] (148 aa)
Score = 297, Expect = 8.1e-26, Identities = 57/143 (39%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  +   L++  ++  D G  + +   DYPDYA  +A+ +       GILICGTG+G+ +AANK KG+  AL  D  +A L R H+D+N+L +  R + P    +I   +L+ +FEGGRH++R+GKI  YE
  S:     3 VAIASDHGGIRIREEIKALLDEMGIEYTDFG-CDCETSVDYPDYALPVAEKVARGEFDRGILICGTGIGMTIAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIGPGLAREIAKAWLETEFEGGRHARRIGKIAEYE 144
>gi|51893475|ref|YP_076166.1| ribose-5-phosphate isomerase B [Symbiobacterium thermophilum IAM 14863] >gi|51857164|dbj|BAD41322.1| ribose 5-phosphate isomerase [Symbiobacterium thermophilum IAM 14863] (154 aa)
Score = 297, Expect = 8.7e-26, Identities = 62/146 (42%), Positives = 87/146 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I +DH G E+K  +  HLE    +V++ G T+     DYP Y   +A+ + A     GILICGTGVG+ +AANK +GI A +  +  TA L++QH++ N+L   +R V  +    IVDE+L A FEGGRH +RV  I   ER +
  S:     3 IAIGNDHVGTEMKRAIAAHLESLGHEVVNFG-TDSTERTDYPIYGERVARAVAAGEVDCGILICGTGVGISLAANKVRGIRAVVCSEPYTARLSKQHNNTNILAFGARVVGVDLAKMIVDEWLNASFEGGRHQRRVDMIADIERRE 147
>gi|16802541|ref|NP_464026.1| hypothetical protein lmo0498 [Listeria monocytogenes EGD-e] >gi|47094724|ref|ZP_00232339.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153186319|ref|ZP_01936660.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153189859|ref|ZP_01937334.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|153195132|ref|ZP_01939930.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|167052669|ref|ZP_02279067.1| hypothetical protein LmonF_05381 [Listeria monocytogenes FSL F2-515] >gi|16409874|emb|CAC98577.1| lmo0498 [Listeria monocytogenes] >gi|47016864|gb|EAL07782.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126941201|gb|EBA19094.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127634735|gb|EBA24115.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|127766507|gb|EBA26844.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] (149 aa)
Score = 297, Expect = 8.7e-26, Identities = 61/144 (42%), Positives = 92/144 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
            I IA+DH G +LK  +  HL +    V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGGRH+ R+ K+   E
  S:     2 EIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGGRHNTRLQKLAELE 143
>gi|15616329|ref|NP_244634.1| ribose-5-phosphate isomerase B [Bacillus halodurans C-125] >gi|10176391|dbj|BAB07486.1| ribose 5-phosphate epimerase (pentose phosphate) [Bacillus halodurans C-125] (145 aa)
Score = 297, Expect = 9.0e-26, Identities = 60/143 (41%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + I SDH G+ +K+ +I+ +E+  +Q  D G  +     DY DYA  +A+ + A     GILICGTG+G+ +AANK KGI  AL  D  +A   R+H+D+NVL +  R + P    +I   +L  +FEGGRH++R+GKI  YE
  S:     3 VAIGSDHGGVNIKNEIIQLMEELGMQYEDFG-CDCTTSVDYSDYAIPVAEKVAAGEFDRGILICGTGIGMSIAANKVKGIRCALCHDVFSAKATREHNDSNVLAMGERVIGPGLAREIAQTWLTTEFEGGRHARRIGKIAEYE 144
>gi|29345756|ref|NP_809259.1| ribose 5-phosphate isomerase B [Bacteroides thetaiotaomicron VPI-5482] >gi|29337649|gb|AAO75453.1| ribose 5-phosphate isomerase B [Bacteroides thetaiotaomicron VPI-5482] (144 aa)
Score = 297, Expect = 9.0e-26, Identities = 63/139 (45%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +A DH G ELK  V   LE +     D G      +D YPDYA  LA  +++     GI ICG+G G+ M  NK +GI AAL  +++ A LARQH+DAN+L +  RF+  EE   I+ EF   QFEGGRH  R+ KI
  S:     4 IGLACDHAGFELKEYVRGWLEVKGWAYKDFGTNSAASVD-YPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGIRAALCWNAEIAHLARQHNDANILVMPGRFISTEEADMILTEFFSTQFEGGRHQNRIDKI 141
>gi|134300994|ref|YP_001114490.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Desulfotomaculum reducens MI-1] >gi|134053694|gb|ABO51665.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfotomaculum reducens MI-1] (152 aa)
Score = 297, Expect = 9.2e-26, Identities = 61/148 (41%), Positives = 92/148 (62%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           N  I + SDH G E+K  + ++L+ Q   V D+G    +  D YPD+A  + + +++     GILICGTGVG+ +A NK  G+ AA V   + A LAR+H++ANVL + SRF+   +   IV++F+  +F G RH+KRV KI A E++
  S:     3 NISIVLGSDHAGFEMKEQIKEYLQGQGHTVQDMGCNGTESCD-YPDFALAVGEKIRSGQCQQGILICGTGVGMAIAVNKVPGVRAANVFAPEIAQLAREHNNANVLTMGSRFIDLAQAKAIVEKFINTEFAGDRHAKRVDKISAIEKK 149
>gi|89897675|ref|YP_521162.1| hypothetical protein DSY4929 [Desulfitobacterium hafniense Y51] >gi|89337123|dbj|BAE86718.1| hypothetical protein [Desulfitobacterium hafniense Y51] (154 aa)
Score = 297, Expect = 9.4e-26, Identities = 57/144 (39%), Positives = 89/144 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + +DH G ELK+ +  HLE+Q ++++D G    D +D YP Y F +   +      LGI++CGTG+G+ +AANK  G+ AA+  ++ +A +AR+H++AN+L L  R       + IVD F++  F GGRH+ RV  I A E+
  S:     8 IALGADHGGYELKNEIRAHLEEQGIEILDFGTNTKDSVD-YPRYGFYVGDAVTKGKADLGIVVCGTGLGISIAANKVPGVRAAVCTETYSARMAREHNNANILALGGRVTGLGLALDIVDMFVKTPFAGGRHACRVDLIDAIEK 150
>gi|158317059|ref|YP_001509567.1| ribose-5-phosphate isomerase B [Frankia sp. EAN1pec] >gi|158112464|gb|ABW14661.1| ribose 5-phosphate isomerase [Frankia sp. EAN1pec] (161 aa)
Score = 297, Expect = 9.5e-26, Identities = 63/144 (43%), Positives = 87/144 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYER 150
           +++ SDH G  LK  ++  L +     +D GP E DP DDYP +    A    A P+SLGI+I G+G G  +AANK  G+ AALV   +TA LARQH+DANV+ + +R     E +++V+ FL   F G  RH +R+  I AYER
  S:     3 VHLGSDHAGFHLKKALVARLAELGHAPVDHGPVEYDPDDDYPPFVMAAAAAAAAEPDSLGIVIGGSGNGEVIAANKVDGVRAALVWSEQTATLARQHNDANVISVGARMHSLPEAVELVEIFLATPFSGEQRHLRRLRMISAYER 147
>gi|167940919|ref|ZP_02527994.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Ureaplasma urealyticum serovar 8] >gi|167959358|ref|ZP_02546429.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972250|ref|ZP_02554527.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974275|ref|ZP_02556552.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975329|ref|ZP_02557606.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988939|ref|ZP_02570610.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168362406|ref|ZP_02695585.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168807949|ref|ZP_02829008.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Ureaplasma urealyticum serovar 2] >gi|195867378|ref|ZP_03079382.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903580|gb|EDT49869.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209289|gb|EDU06332.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018662|gb|EDU56702.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998031|gb|EDU67128.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660130|gb|EDX53510.1| ribose-5-phosphate isomerase B [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660854|gb|EDX54107.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (153 aa)
Score = 297, Expect = 1.0e-25, Identities = 62/150 (41%), Positives = 98/150 (65%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGP-TELDPLDDYPDYAFLLAQTM--QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           M   IY  +DH   E+K  +I HL+Q+  ++ID G   EL  ++ Y  YA  +A  +   A  +SLGIL+CGTG+G+ MAA+K KG   AL+ +  +A LA++H++ANV+ + +R    E+ IK++D+FL+++F G RH KR+  I  YE+ +
  S:     1 MIKKIYFGNDHAAYEIKDQIIAHLKQKGYEIIDEGAQVELGSVN-YSPYALKVANDVVNDAKNDSLGILLCGTGIGMNMAASKVKGARVALIYNESSAKLAKEHNNANVITIGARENSLEQIIKMIDDFLESKFMGERHQKRLDIITEYEKNQ 152
>gi|116512341|ref|YP_809557.1| ribose-5-phosphate isomerase B [Lactococcus lactis subsp. cremoris SK11] >gi|116107995|gb|ABJ73135.1| ribose-5-phosphate isomerase [Lactococcus lactis subsp. cremoris SK11] (149 aa)
Score = 296, Expect = 1.1e-25, Identities = 60/144 (41%), Positives = 89/144 (61%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I SDH G ELK L+I +LE+   +V D GP   +   DYP Y   +A+ + A     G+LICGTGVG+ ++ANK +GI A +  +  +A L+++H++ N++   SR V  E    IV E+L+A +EGGRH+KR+  I   E E+
  S:     5 IGSDHVGFELKPLIIDYLEELGHEVTDFGPFSTER-TDYPIYGKKVAEEVAAGHFDGGVLICGTGVGISISANKVRGIRAVVCSEPYSAKLSKEHNNTNIVAFGSRVVGSELAKMIVKEWLEAIYEGGRHAKRIEMITELETEQ 147
>gi|15892325|ref|NP_360039.1| ribose-5-phosphate isomerase B [Rickettsia conorii str. Malish 7] >gi|81528380|sp|Q92IL8|Y402_RICCN Putative sugar phosphate isomerase RC0402 >gi|15619469|gb|AAL02940.1| ribose-5-phosphate isomerase [EC:5.3.1.6] [Rickettsia conorii str. Malish 7] (144 aa)
Score = 296, Expect = 1.1e-25, Identities = 62/141 (43%), Positives = 89/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L++ D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  +  TA  A+ H+DAN+L L ++ +  +    I+D+FL  QFEGGRHS R+ KI
  S:     4 YNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNILTAENAKAHNDANILILGAKTIDQKIVFDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|170781888|ref|YP_001710220.1| putative sugar-phosphate isomerase [Clavibacter michiganensis subsp. sepedonicus] >gi|169156456|emb|CAQ01604.1| putative sugar-phosphate isomerase [Clavibacter michiganensis subsp. sepedonicus] (162 aa)
Score = 296, Expect = 1.1e-25, Identities = 60/143 (41%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQAN----PNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           I+IA+DH GL+    + +HL  Q   V+D GPT  DPLDDYP +    A+ + A+      +LG++  G+G G  +AANK +G+ AALV +  TA LARQH+DANV+ + +R    EE    +D F+   F    RH++R+ ++  YE
  S:     3 IHIATDHAGLDFSRFLAEHLGAQGHDVVDHGPTSYDPLDDYPSFCIRAARAVVADQRGGTTALGVVFGGSGNGEQIAANKVEGVRAALVWNLSTAVLARQHNDANVISIGARQHTVEEATAFIDAFIAEPFSAEERHARRIAQLAEYE 150
>gi|16802778|ref|NP_464263.1| ribose-5-phosphate isomerase B [Listeria monocytogenes EGD-e] >gi|47095301|ref|ZP_00232912.1| sugar-phosphate isomerases, RpiB/LacA/LacB family subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|153173657|ref|ZP_01929371.1| hypothetical protein LMIG_02031 [Listeria monocytogenes FSL N3-165] >gi|153178830|ref|ZP_01932117.1| hypothetical protein LMMG_01369 [Listeria monocytogenes F6900] >gi|153184167|ref|ZP_01934950.1| hypothetical protein LMOG_00847 [Listeria monocytogenes J0161] >gi|153190119|ref|ZP_01937564.1| hypothetical protein LMPG_00493 [Listeria monocytogenes J2818] >gi|153195372|ref|ZP_01940170.1| hypothetical protein LMRG_00424 [Listeria monocytogenes 10403S] >gi|167211705|ref|ZP_02282012.1| ribose-5-phosphate isomerase B [Listeria monocytogenes LO28] >gi|167403815|ref|ZP_02308635.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-003] >gi|16410125|emb|CAC98814.1| lmo0736 [Listeria monocytogenes] >gi|47016372|gb|EAL07294.1| sugar-phosphate isomerases, RpiB/LacA/LacB family subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|126943231|gb|EBA20960.1| hypothetical protein LMOG_00847 [Listeria monocytogenes J0161] >gi|127634975|gb|EBA24355.1| hypothetical protein LMRG_00424 [Listeria monocytogenes 10403S] >gi|127766437|gb|EBA26775.1| hypothetical protein LMPG_00493 [Listeria monocytogenes J2818] >gi|133730737|gb|EBA32435.1| hypothetical protein LMIG_02031 [Listeria monocytogenes FSL N3-165] >gi|133733518|gb|EBA35216.1| hypothetical protein LMMG_01369 [Listeria monocytogenes F6900] (148 aa)
Score = 296, Expect = 1.1e-25, Identities = 61/145 (42%), Positives = 90/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I +DH G+ELK +++ +L+    +V D G    +   DYP+Y   +A+++ A  + LGILICG+GVG+ +AANK  GI A +  +  +A L+R+H++ N+L   SR V  E    IV  +L A+FEGGRH+KRV  I   E E
  S:     3 IAIGNDHVGIELKPVIVAYLQDLGHEVDDFGAFS-NERTDYPEYGKKVAESVAAGKSDLGILICGSGVGISIAANKVNGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVGAELAKMIVQNWLDAEFEGGRHAKRVEMIARIEDE 146
>gi|168337737|ref|ZP_02694352.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Ureaplasma urealyticum serovar 10] (153 aa)
Score = 296, Expect = 1.2e-25, Identities = 62/150 (41%), Positives = 98/150 (65%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGP-TELDPLDDYPDYAFLLAQTM--QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           M   IY  +DH   E+K  +I HL+Q+  ++ID G   EL  ++ Y  YA  +A  +   A  +SLGIL+CGTG+G+ MAA+K KG   AL+ +  +A LA++H++ANV+ + +R    E+ IK++D+FL+++F G RH KR+  I  YE+ +
  S:     1 MIKKIYFGNDHAAYEIKDQIIAHLKQKGYEIIDEGAQVELGSVN-YSPYALKVANDVVNDAKNDSLGILLCGTGIGMNMAASKVKGARVALIYNESSAKLAKEHNNANVITIGARENSLEQIIKMIDDFLESKFVGERHQKRLDIITEYEKNQ 152
>gi|153815702|ref|ZP_01968370.1| hypothetical protein RUMTOR_01939 [Ruminococcus torques ATCC 27756] >gi|145846943|gb|EDK23861.1| hypothetical protein RUMTOR_01939 [Ruminococcus torques ATCC 27756] (146 aa)
Score = 296, Expect = 1.2e-25, Identities = 62/145 (42%), Positives = 91/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I +DH+ LELK+ +I  L+++  +V+D G    +  D YP Y  ++A+ + A     GILICGTG+G+ +AANK KGI AA+  +  TA +AR H++ N+L   +R V  E    IV+ +L A+FEGGRH +RV  I A E +
  S:     3 IGIGNDHSALELKAEIISFLKEKGHEVVDYGTNSSESCD-YPVYGEIVARAVAAGEVEQGILICGTGLGISLAANKVKGIRAAVCSEPFTAKMARVHNNCNILAFGARVVGAELAKMIVETWLDAEFEGGRHQRRVDLITAIEEK 146
>gi|148323537|gb|EDK88787.1| ribose-5-phosphate isomerase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (149 aa)
Score = 296, Expect = 1.2e-25, Identities = 62/140 (44%), Positives = 86/140 (61%)
  Q:     6 PIYIASDHTGLELKSLVIKHL-EQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I + +DH G ELK  + ++L ++  ++VID G    + +D YP Y   +A  + +     GIL+C TGVG+ +AANK KG+ AAL  D+ TA L R+H+DAN+L L S  V     + IVD FL   FEGGRH KRV +I
  S:     2 KIALGADHAGFELKEKIKEYLLKKGGIEVIDKGTNNKESVD-YPKYGHAVANAVVSKEVDFGILVCTTGVGISIAANKIKGVRAALCTDTTTAKLTREHNDANILALGSGIVGQFVALDIVDTFLSTSFEGGRHQKRVDQI 141
>gi|163786941|ref|ZP_02181389.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] >gi|159878801|gb|EDP72857.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] (144 aa)
Score = 296, Expect = 1.3e-25, Identities = 58/139 (41%), Positives = 82/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G + K  V+KHLE +   + + G   LD +D YPD+   +A+ +      LGILICG+  GV M ANK + + A +   S+   L R H++AN++C+ +RF    + IK+VD FL   FEGGRH  RV KI
  S:     3 ISIGNDHAGPDYKQAVVKHLETKGYTITNYGTDTLDSVD-YPDFVHPVAKDVNDGNADLGILICGSANGVAMTANKYQNVRAGVCWTSEITELTRLHNNANIICIPARFTSIPQAIKMVDTFLNTAFEGGRHQNRVDKI 140
>gi|166031409|ref|ZP_02234238.1| hypothetical protein DORFOR_01098 [Dorea formicigenerans ATCC 27755] >gi|166028814|gb|EDR47571.1| hypothetical protein DORFOR_01098 [Dorea formicigenerans ATCC 27755] (154 aa)
Score = 296, Expect = 1.3e-25, Identities = 57/145 (39%), Positives = 91/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I +DH  +++K+ V+++LE +  +V++ G    +  + YP+Y   + + + A    LGILICGTGVG+ +AANK KG+ A +  +  +A L+RQH++ N+L   +R +  E    I+DE+L A+FEGGRH  RV  I A E +
  S:    11 IGIGNDHAAVDMKNQVVEYLEGKGYEVVNFGTDTYESCN-YPEYGEKVGRAVAAGDVDLGILICGTGVGISLAANKVKGVRAVVCSEPYSAKLSRQHNNTNILAFGARVIGIELAKMIIDEWLNAEFEGGRHQTRVDMITAIENK 154
>gi|60681153|ref|YP_211297.1| putative ribose 5-phosphate isomerase [Bacteroides fragilis NCTC 9343] >gi|60492587|emb|CAH07359.1| putative ribose 5-phosphate isomerase [Bacteroides fragilis NCTC 9343] (144 aa)
Score = 296, Expect = 1.3e-25, Identities = 62/139 (44%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I  DH G ELK  V   LE +  +  D G    D  D YPD+A  LA  ++A+    GI ICG+G G+ M  NK +GI AAL   ++ A +AR H+DANVL +  R++  EE   I+ EF   +FEGGRH KR+ KI
  S:     4 IGICCDHAGFELKEYVRGWLEAKGWEYKDFGTYSTDSCD-YPDFAHPLALAVEASECYPGIAICGSGNGISMTLNKHQGIRAALCWTAEIAHMARLHNDANVLVMPGRYISTEEADMIMTEFFSTEFEGGRHQKRIDKI 141
>gi|160888946|ref|ZP_02069949.1| hypothetical protein BACUNI_01366 [Bacteroides uniformis ATCC 8492] >gi|156861413|gb|EDO54844.1| hypothetical protein BACUNI_01366 [Bacteroides uniformis ATCC 8492] (145 aa)
Score = 295, Expect = 1.3e-25, Identities = 64/139 (46%), Positives = 80/139 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G ELK  V   LE +     D G    +  D YPD+A  LA  ++A     GI ICG+G G+ +  NK +GI AAL   ++ A LARQH+DANVL +  RF+  EE   I+ EF    FEGGRH +RV KI
  S:     4 IGICSDHAGFELKEYVRGWLEAKGWAYKDFGTYSTESCD-YPDFAHPLALAVEAGECYPGIAICGSGEGISITLNKHQGIRAALCWTAEIAHLARQHNDANVLVMPGRFISTEEADMIMREFFSTPFEGGRHQRRVDKI 141
>gi|91205093|ref|YP_537448.1| ribose-5-phosphate isomerase B [Rickettsia bellii RML369-C] >gi|157827571|ref|YP_001496635.1| ribose-5-phosphate isomerase B [Rickettsia bellii OSU 85-389] >gi|119368374|sp|Q1RJV5|Y278_RICBR Putative sugar phosphate isomerase RBE_0278 >gi|91068637|gb|ABE04359.1| Ribose-5-phosphate isomerase [Rickettsia bellii RML369-C] >gi|157802875|gb|ABV79598.1| ribose-5-phosphate isomerase B [Rickettsia bellii OSU 85-389] (144 aa)
Score = 295, Expect = 1.3e-25, Identities = 62/141 (43%), Positives = 91/141 (64%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS++I++L+++ L V D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL V+  TA  A+ H+DAN+L L ++ V  +    I+D+FL  +FEGGRHS R+ KI
  S:     4 YDIVIASDHSGYELKSIIIEYLQKKSLSVYDCGTHNTQSVD-YPDYAKKVVNNIIEKLARIGILIGDTGIGMSIAANRSSEIRAALCVNVSTAESAKAHNDANILVLGAKTVDHKTVFDIIDKFLATKFEGGRHSVRLLKI 143
>gi|89210215|ref|ZP_01188607.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] >gi|89160288|gb|EAR79944.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] (322 aa)
Score = 295, Expect = 1.3e-25, Identities = 63/148 (42%), Positives = 92/148 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           ++  I I SDH G E+K  +IK L++    V D+G T+ D   DYPD+A+ +A  + +     G+L+CGTG+G+ +AANK +G+ AAL  D  +A  AR H++ANVL L SR +      +IV  +L+A F+G RH +RV KI   ER
  S:   173 IDMKIAIGSDHAGYEMKQEIIKLLDELGYDVSDMG-TDSDESVDYPDFAYKVASGVASGEYDRGLLVCGTGIGMSIAANKVEGVRAALCHDVFSARAARNHNNANVLALGSRVIGIGLAKEIVKTWLEAGFDGDRHERRVNKITRIER 319
>gi|153956294|ref|YP_001397059.1| ribose-5-phosphate isomerase B [Clostridium kluyveri DSM 555] >gi|146349152|gb|EDK35688.1| Predicted sugar isomerase of the lacAB/rpiB family [Clostridium kluyveri DSM 555] (149 aa)
Score = 295, Expect = 1.4e-25, Identities = 59/145 (40%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + SDH G  LK  +I+HL+ + L++ D G    +  D YPDYA  + + + +     GIL+CGTG+G+ +AANK  G+ AAL  D+ +A   R+H++AN+L +  R V     + IVD FL  +F+GGRH KR+ KI   E++
  S:     3 IALGSDHAGFPLKKEIIEHLKNKGLELEDFGTFSEESCD-YPDYALKVGEQVVSKNYDFGILVCGTGIGISIAANKIPGVRAALCGDTFSAHACREHNNANILAIGQRVVGVGLALDIVDNFLFTEFQGGRHQKRIDKIGEIEKK 146
>gi|188589882|ref|YP_001919886.1| ribose 5-phosphate isomerase B [Clostridium botulinum E3 str. Alaska E43] >gi|188500163|gb|ACD53299.1| ribose 5-phosphate isomerase B [Clostridium botulinum E3 str. Alaska E43] (149 aa)
Score = 295, Expect = 1.5e-25, Identities = 62/141 (43%), Positives = 85/141 (60%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I  DH G ELK  +IK LE +  +V D G    +  D YPD +  +A+ + A    LGIL+CGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V     + IV  F+ ++FEG RH KR+ KI A E
  S:     5 IGCDHGGFELKQEIIKFLESEGHEVKDFGTHSTESCD-YPDISLPVAEAIVAKEFELGILVCGTGIGIGIAANKVPGIRAALCSDTFSAHATRQHNNANILTMGQRVVGTGLALDIVKTFISSEFEGDRHQKRIDKISAIE 144
>gi|157363208|ref|YP_001469975.1| ribose 5-phosphate isomerase B [Thermotoga lettingae TMO] >gi|157313812|gb|ABV32911.1| ribose 5-phosphate isomerase B [Thermotoga lettingae TMO] (145 aa)
Score = 295, Expect = 1.6e-25, Identities = 61/139 (43%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I  DH G +LK  +  +L  +   ++D G    D +D YPD+A  +A  ++      GILICGTG+G+ +AAN+ KGI AAL +  + A LAR H++AN+L L  RF+  E    IVD F++ +FEGGRH  RV KI
  S:     3 IAIGCDHAGFKLKEAIKGYLVSKGFNILDEGTYSEDSVD-YPDFAAKVALDIKNQRADFGILICGTGIGMSIAANRIKGIRAALCLFPEMAKLARSHNNANILVLPGRFIAVELAQWIVDAFIEEKFEGGRHENRVQKI 140
>gi|149277471|ref|ZP_01883612.1| ribose 5-phosphate isomerase B [Pedobacter sp. BAL39] >gi|149231704|gb|EDM37082.1| ribose 5-phosphate isomerase B [Pedobacter sp. BAL39] (146 aa)
Score = 295, Expect = 1.6e-25, Identities = 57/139 (41%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G E K L+ +   + +++  D G    D +D YPD+A  +A+ +++   + GIL+CG+  GV + ANK + I AA+    + A LAR H+DAN++C+ +RFV PE   ++++ FL   FEGGRH+ RVGKI
  S:     9 IAIGADHAGFEYKELIKEWFAEHEIK--DFGTFSADSVD-YPDFAHPVAEAVESKAFTFGILVCGSANGVAITANKHQHIRAAICWLKEIAELARLHNDANIICIPARFVSPELAKEMINTFLTTAFEGGRHAGRVGKI 144
>gi|89095613|ref|ZP_01168507.1| ribose-5-phosphate isomerase B [Bacillus sp. NRRL B-14911] >gi|89089359|gb|EAR68466.1| ribose-5-phosphate isomerase B [Bacillus sp. NRRL B-14911] (146 aa)
Score = 295, Expect = 1.7e-25, Identities = 59/143 (41%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  +   +E+  ++  D G  E     DYPDYA  +A+ + +     GILICGTG+G+ ++ANK KGI  ALV D  +A   RQH+D+N+L +  R + P    +I   +L+ +FEGGRH+ R+GKI  YE
  S:     3 VAIASDHGGVNIREEMKHLMEEMGIEYEDFG-CECGVSFDYPDYALPVAEKVASGEFDKGILICGTGIGMSISANKVKGIRCALVHDVFSAKATRQHNDSNILAMGERVIGPGLAREIAKTWLETEFEGGRHANRIGKIKTYE 144
>gi|167471528|ref|ZP_02336232.1| ribose-5-phosphate isomerase B [Rickettsia africae ESF-5] (144 aa)
Score = 294, Expect = 1.8e-25, Identities = 62/141 (43%), Positives = 89/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L++ D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  +  TA  A+ H+DAN+L L ++ +  +    I+D+FL  QFEGGRHS R+ KI
  S:     4 YNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNILTAENAKAHNDANILILGAKTIDQKIVCDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|99082154|ref|YP_614308.1| ribose-5-phosphate isomerase [Silicibacter sp. TM1040] >gi|99038434|gb|ABF65046.1| ribose-5-phosphate isomerase [Silicibacter sp. TM1040] (149 aa)
Score = 294, Expect = 1.8e-25, Identities = 61/149 (40%), Positives = 87/149 (58%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M  +  I ++SDH  + L+  + KH+E     V DLGPT  +    YP +    A+ + A  + LGIL+CGTG G+ MAANK KGI   +  D+ +A + R H+DAN+L + +R V     ++IVD FL+ +FEGGRH  RV  I   E
  S:     1 MTASKRIVLSSDHAAIALRRTIAKHIEALGYTVTDLGPTTPES-THYPKHGEAAARHVAAGESDLGILLCGTGQGIMMAANKVKGIRCGVCSDTFSAQMIRAHNDANMLSIGARVVGEGLALEIVDAFLKTEFEGGRHGTRVDMITEIE 148
>gi|53712941|ref|YP_098933.1| ribose 5-phosphate isomerase B [Bacteroides fragilis YCH46] >gi|52215806|dbj|BAD48399.1| ribose 5-phosphate isomerase B [Bacteroides fragilis YCH46] (144 aa)
Score = 294, Expect = 1.8e-25, Identities = 62/139 (44%), Positives = 80/139 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I  DH G ELK  V   LE +  +  D G    D  D YPD+A  LA  ++A     GI ICG+G G+ M  NK +GI AAL   ++ A +AR H+DANVL +  R++  EE   I+ EF   +FEGGRH KR+ KI
  S:     4 IGICCDHAGFELKEYVRGWLEAKGWEYKDFGTYSTDSCD-YPDFAHPLALAVEAGECYPGIAICGSGNGISMTLNKHQGIRAALCWTAEIAHMARLHNDANVLVMPGRYISTEEADMIMTEFFSTEFEGGRHQKRIDKI 141
>gi|26250907|ref|NP_756947.1| ribose-5-phosphate isomerase B [Escherichia coli CFT073] >gi|26111339|gb|AAN83521.1|AE016771_32 Ribose 5-phosphate isomerase B [Escherichia coli CFT073] (149 aa)
Score = 294, Expect = 1.8e-25, Identities = 65/146 (44%), Positives = 86/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+++
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALAVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQQR 148
>gi|15643838|ref|NP_228886.1| sugar-phosphate isomerase [Thermotoga maritima MSB8] >gi|148270785|ref|YP_001245245.1| ribose 5-phosphate isomerase B [Thermotoga petrophila RKU-1] >gi|170289515|ref|YP_001739753.1| ribose 5-phosphate isomerase B [Thermotoga sp. RQ2] >gi|4981625|gb|AAD36157.1|AE001768_6 sugar-phosphate isomerase [Thermotoga maritima MSB8] >gi|147736329|gb|ABQ47669.1| ribose-5-phosphate isomerase [Thermotoga petrophila RKU-1] >gi|170177018|gb|ACB10070.1| ribose 5-phosphate isomerase B [Thermotoga sp. RQ2] (143 aa)
Score = 294, Expect = 1.9e-25, Identities = 62/139 (44%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH   ELK  V  +L  + ++V D G    + +D YPDYA  + Q++ +N    GIL+CGTG+G+ +AAN+ +GI AAL +    A LAR H++AN+L L  R +  E    IVD FL   F+GGRH +R+ KI
  S:     3 IAIASDHAAFELKEKVKNYLLGKGIEVEDHGTYSEESVD-YPDYAKKVVQSILSNEADFGILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANILVLPGRLIGAELAFWIVDTFLSTPFDGGRHERRIRKI 140
>gi|15604168|ref|NP_220683.1| ribose-5-phosphate isomerase B [Rickettsia prowazekii str. Madrid E] >gi|51473495|ref|YP_067252.1| ribose-5-phosphate isomerase B [Rickettsia typhi str. Wilmington] >gi|81554875|sp|Q9ZDM8|Y299_RICPR Putative sugar phosphate isomerase RP299 >gi|81826320|sp|Q68X72|Y290_RICTY Putative sugar phosphate isomerase RT0290 >gi|3860860|emb|CAA14760.1| GALACTOSE-6-PHOSPHATE ISOMERASE LACB SUBUNIT (lacA) [Rickettsia prowazekii] >gi|51459807|gb|AAU03770.1| ribose 5-phosphate epimerase; 5-phosphoribose isomerase.; D-ribose-5-phosphate ketol-isomerase.; Phosphopentoseisomerase.; Phosphoriboisomerase.; Ribose 5-phosphate isomerase.; Ribose phosphate isomerase. [Rickettsia typhi str. Wilmington] (144 aa)
Score = 294, Expect = 2.0e-25, Identities = 63/141 (44%), Positives = 89/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L + D G  +   +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  D  TA  A+ H+DAN+L L ++ V  +    I+D+FL  +FEGGRHS R+ KI
  S:     4 YNIVIASDHSGYELKSKIINYLEQKCLNIYDCGTQDTQTVD-YPDYAKKVVDIIIEKAAPIGILISDTGIGMSIAANRSSEIRAALCNDILTAENAKAHNDANILILGAKSVDNKIVFNIIDKFLTTKFEGGRHSTRLSKI 143
>gi|187934781|ref|YP_001884699.1| ribose 5-phosphate isomerase B [Clostridium botulinum B str. Eklund 17B] >gi|187722934|gb|ACD24155.1| ribose 5-phosphate isomerase B [Clostridium botulinum B str. Eklund 17B] (149 aa)
Score = 294, Expect = 2.0e-25, Identities = 62/141 (43%), Positives = 85/141 (60%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I  DH G ELK  +IK LE +  +V D G    +  D YPD +  +A+ + A    LGIL+CGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V     + IV  F+ ++FEG RH KR+ KI A E
  S:     5 IGCDHGGFELKQEIIKFLESEGHKVKDFGTHSTESCD-YPDISLPVAEAVVAKEFELGILVCGTGIGIGIAANKVPGIRAALCSDTFSAHATRQHNNANILTMGQRVVGTGLALDIVKTFISSEFEGDRHQKRIDKISAIE 144
>gi|91215347|ref|ZP_01252318.1| ribose 5-phosphate isomerase B [Psychroflexus torquis ATCC 700755] >gi|91186299|gb|EAS72671.1| ribose 5-phosphate isomerase B [Psychroflexus torquis ATCC 700755] (143 aa)
Score = 294, Expect = 2.0e-25, Identities = 61/142 (42%), Positives = 89/142 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAY 148
           I I +DH G   K+ ++ +L+ Q ++V + G    D +D YPD+   +A  ++   +SLGI+ICG+G G  M ANK +GI +AL   S+  ALA+QH++ANVL + SRFV  EE +  V  FL+  F+GGRH  RV KI  +
  S:     3 ISIGNDHAGTFYKNKIVDYLKSQNIEVHNHGTNSEDSVD-YPDFVHPVAIDVEDGTSSLGIIICGSGNGANMTANKHQGIRSALCWTSELVALAKQHNNANVLSIPSRFVSLEEALDFVTVFLKTPFDGGRHHHRVDKIACH 143
>gi|163754546|ref|ZP_02161668.1| ribose 5-phosphate isomerase B [Kordia algicida OT-1] >gi|161325487|gb|EDP96814.1| ribose 5-phosphate isomerase B [Kordia algicida OT-1] (144 aa)
Score = 294, Expect = 2.0e-25, Identities = 57/139 (41%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G + K+ +  HLE +   + + G    D +D YPD+   +A  +++     GI+ICG+G G  M ANK + + AAL    +  ALARQH+DAN+L + +RF    + I +VD FL+ +FEGGRH +RV KI
  S:     4 IAIGNDHAGTDYKNAITAHLEAKGYTIQNYGTNSDDSVD-YPDFIHPVATDVESGKVPFGIIICGSGNGAAMTANKHQKVRAALCWTKEIVALARQHNDANILSIPARFTSLPQAIAMVDTFLETEFEGGRHQRRVAKI 141
>gi|88801779|ref|ZP_01117307.1| ribose 5-phosphate isomerase B [Polaribacter irgensii 23-P] >gi|88782437|gb|EAR13614.1| ribose 5-phosphate isomerase B [Polaribacter irgensii 23-P] (145 aa)
Score = 293, Expect = 2.3e-25, Identities = 61/139 (43%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G   K  +IKHLE +  +V++ G T+ D   DYPD     A  ++    + GI++CG+G G  M ANK +GI AAL  +++  AL RQH++AN+L + +RFV  ++ I  VD FL   FEGGRH  RV KI
  S:     3 IAIGNDHAGTIYKFEIIKHLESKGYEVLNFG-TDTDASMDYPDAIHPTATAVENGTAAFGIILCGSGNGAQMTANKHQGIRAALCWNNELVALTRQHNNANILTIPARFVSLQQAIGFVDIFLTTDFEGGRHGDRVEKI 140
>gi|32266867|ref|NP_860899.1| ribose-5-phosphate isomerase B [Helicobacter hepaticus ATCC 51449] >gi|32262919|gb|AAP77965.1| ribose 5-phosphate isomerase RpiB [Helicobacter hepaticus ATCC 51449] (147 aa)
Score = 293, Expect = 2.3e-25, Identities = 59/137 (43%), Positives = 86/137 (62%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +DH G +LK   I  L+++  ++IDL P + +   DYPDYA  + + +    N  GILICG+G+G+ +AAN+ K I AAL VD+  A +AR H+DANVLC+  R     E   I++ F+ ++FEG RH  RV K+
  S:     5 IGTDHAGFKLKEFTISFLQKKGFEIIDLAP-QTNQRVDYPDYAKKVCEAVGEEVNRRGILICGSGIGMSIAANRFKHIRAALCVDAYMAKMARAHNDANVLCMGERISGLGEVESILEAFVSSEFEGERHLVRVEKL 140
>gi|158521074|ref|YP_001528944.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Desulfococcus oleovorans Hxd3] >gi|158509900|gb|ABW66867.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Desulfococcus oleovorans Hxd3] (148 aa)
Score = 293, Expect = 2.4e-25, Identities = 61/135 (45%), Positives = 88/135 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQ--KLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKR 141
           I IASDH G   K  +I +L +     +V DLGP +  P+D YP YA ++A  + A     GILICG+G+G+ M AN+ +G+ AAL V  + A L+RQH+ +NVLCL+ R V  EENI+IV+ +L   + +  RH++R
  S:     3 IIIASDHAGFRTKRDIIDYLRRNHATWEVTDLGPEDDAPVD-YPIYAHMVASAVAAGDYRRGILICGSGIGMSMMANRFQGVRAALCVTPQMAELSRQHNRSNVLCLAGRLVELEENIQIVNTWLNTDYTDEARHTRR 139
>gi|160936520|ref|ZP_02083887.1| hypothetical protein CLOBOL_01410 [Clostridium bolteae ATCC BAA-613] >gi|158440311|gb|EDP18056.1| hypothetical protein CLOBOL_01410 [Clostridium bolteae ATCC BAA-613] (146 aa)
Score = 293, Expect = 2.5e-25, Identities = 60/143 (41%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I +DHT +ELK+++ + +E++  +VIDLG    +  D YP Y   + + +      LGI ICGTGVG+ +AANK KGI A +  +  TA L+R H+++NVL   +R V  E    I + +L A+FEGGRH +RV  I+  E
  S:     3 IAIGNDHTAIELKNIIKEFVEEKGYEVIDLGTNSTESCD-YPIYGEKVGRAVADGQADLGIAICGTGVGISLAANKVKGIRACVCSEPYTAKLSRVHNNSNVLAFGARVVGSELAKMITEAWLDAEFEGGRHERRVNMIMEIE 144
>gi|126662737|ref|ZP_01733736.1| ribose 5-phosphate isomerase B [Flavobacteria bacterium BAL38] >gi|126626116|gb|EAZ96805.1| ribose 5-phosphate isomerase B [Flavobacteria bacterium BAL38] (143 aa)
Score = 293, Expect = 2.5e-25, Identities = 56/139 (40%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G + K  +++ LE++   + + G    D +D YPD+   +A  +++     GI+ICG+G G+ M  NK + I AAL    + AALARQH+DAN+L + +R+   ++ I++VD FL   FEGGRH+ RV KI
  S:     3 ISIGNDHAGPDYKKAIVQFLEEKGHTIYNHGTDTFDSVD-YPDFGHPVAYDVESKKADFGIVICGSGNGIAMTVNKHQDIRAALCWTKEIAALARQHNDANILSIPARYTSIQQAIEMVDTFLNTSFEGGRHANRVKKI 140
>gi|150015119|ref|YP_001307373.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|149901584|gb|ABR32417.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium beijerinckii NCIMB 8052] (149 aa)
Score = 293, Expect = 2.5e-25, Identities = 55/137 (40%), Positives = 87/137 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I +  DH G+ LK  + KHL  + ++V D G    + ++ YP+YA  +++ + +    LGIL CGTG+G+ +AANK KGI AA+V D  +A + R+H++ NVLCL  R       + IVD ++ ++F+GGRHS+R+
  S:     5 KIALGCDHGGINLKGAIKKHLISKNIEVEDFGTNSSESVN-YPEYAIKVSKAVISKECDLGILCCGTGIGMSIAANKHKGIRAAVVGDCFSAKMTREHNNTNVLCLGERVTGEGLALTIVDTWINSKFQGGRHSERL 140
>gi|157147975|ref|YP_001455294.1| ribose-5-phosphate isomerase B [Citrobacter koseri ATCC BAA-895] >gi|157085180|gb|ABV14858.1| hypothetical protein CKO_03782 [Citrobacter koseri ATCC BAA-895] (151 aa)
Score = 293, Expect = 2.6e-25, Identities = 65/145 (44%), Positives = 85/145 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I    DH G  LK  ++ HL Q+ + VID G T      DYP YA  +AQ + +     GIL+CGTGVG+ + ANK  G+ A +  +  +A L+RQH+D NVL   SR V  E    IVD +L A FEGGRH KRV  I+A E++
  S:     6 IAFGCDHVGFILKQDILTHLTQRGITVIDKG-TWSPERTDYPHYASEVAQAVVSGEVDGGILVCGTGVGISITANKFAGVRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLDAGFEGGRHQKRVEAIMAIEQQ 149
>gi|116748815|ref|YP_845502.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Syntrophobacter fumaroxidans MPOB] >gi|116697879|gb|ABK17067.1| ribose-5-phosphate isomerase [Syntrophobacter fumaroxidans MPOB] (146 aa)
Score = 293, Expect = 2.7e-25, Identities = 54/136 (39%), Positives = 83/136 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I +  DH G ELK  ++ HL     +V+D G   L+ +D YP YA  +A+ +       GIL+CG+G+G+ M AN+  GI A L  +   A ++R+H+D+NVLC+  RF   +  ++IVD +L+  FEGGRH +R+
  S:     3 IMVGCDHGGFELKEKIVAHLGTLGHEVVDAGTNSLESVD-YPHYAMKVARAVARGEADRGILVCGSGIGMNMTANRVSGIRAVLAYEPYGAIMSRRHNDSNVLCMGGRFTGLDMALQIVDVWLREPFEGGRHQRRI 137
>gi|167749702|ref|ZP_02421829.1| hypothetical protein EUBSIR_00660 [Eubacterium siraeum DSM 15702] >gi|167657325|gb|EDS01455.1| hypothetical protein EUBSIR_00660 [Eubacterium siraeum DSM 15702] (144 aa)
Score = 293, Expect = 2.7e-25, Identities = 64/143 (44%), Positives = 84/143 (58%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I SDH G ELK  V K L+   ++ ID G        DYPD A    + +++     GILICGTG+G+ ++ANK KGI AAL  D  TA   R H+DANVLC+  R +      +IV  FL  +FEGGRH+ RV K++A E +
  S:     4 IGSDHAGYELKCEVKKFLDGLGVEYIDCGCN--GERADYPDIAEKTCEKIKSGECDKGILICGTGIGISISANKIKGIRAALCQDYYTAKYTRLHNDANVLCMGGRVIGAGTAEEIVRVFLSTEFEGGRHAARVDKMMALENK 144
>gi|170683862|ref|YP_001746484.1| ribose 5-phosphate isomerase B [Escherichia coli SMS-3-5] >gi|170521580|gb|ACB19758.1| ribose 5-phosphate isomerase B [Escherichia coli SMS-3-5] (149 aa)
Score = 293, Expect = 2.9e-25, Identities = 65/146 (44%), Positives = 85/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALVVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRR 148
>gi|110644448|ref|YP_672178.1| ribose-5-phosphate isomerase B [Escherichia coli 536] >gi|191171978|ref|ZP_03033523.1| ribose 5-phosphate isomerase B [Escherichia coli F11] >gi|110346040|gb|ABG72277.1| ribose 5-phosphate isomerase B [Escherichia coli 536] >gi|190907743|gb|EDV67337.1| ribose 5-phosphate isomerase B [Escherichia coli F11] (149 aa)
Score = 293, Expect = 2.9e-25, Identities = 65/146 (44%), Positives = 85/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASHVALAVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRR 148
>gi|154492677|ref|ZP_02032303.1| hypothetical protein PARMER_02314 [Parabacteroides merdae ATCC 43184] >gi|154086982|gb|EDN86027.1| hypothetical protein PARMER_02314 [Parabacteroides merdae ATCC 43184] (143 aa)
Score = 292, Expect = 3.3e-25, Identities = 60/137 (43%), Positives = 81/137 (59%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + SDH G ELK  V + L+ + L   D G    +  D YPDYA  LA+ ++A     GI ICG+G G+ M  NK +GI AAL    + A LAR+H++AN+L +  RF+  EE    V+ FL   FEGGRH +R+ KI
  S:     6 LCSDHAGYELKEFVKQILDSKGLAYKDFGTDSTESCD-YPDYAHPLAKAVEAGEVYPGIAICGSGNGIAMTLNKHQGIRAALCWQEEIARLAREHNNANILVMPGRFISQEEATHTVEAFLSTPFEGGRHQRRIDKI 141
>gi|109648010|ref|ZP_01371913.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfitobacterium hafniense DCB-2] >gi|109641100|gb|EAT50655.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfitobacterium hafniense DCB-2] (149 aa)
Score = 292, Expect = 3.4e-25, Identities = 56/144 (38%), Positives = 89/144 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I + +DH G ELK+ +  HLE+Q ++++D G    D ++ YP Y F +   +      LGI++CGTG+G+ +AANK  G+ AA+  ++ +A +AR+H++AN+L L  R       + IVD F++  F GGRH+ RV  I A E+
  S:     3 IALGADHGGYELKNEIRAHLEEQGIEILDFGTNTKDSVE-YPRYGFYVGDAVTKGKADLGIVVCGTGLGISIAANKVPGVRAAVCTETYSARMAREHNNANILALGGRVTGLGLALDIVDMFVKTPFAGGRHACRVDLIEAIEK 145
>gi|34810961|pdb|1NN4|A Chain A, Structural Genomics, RpibALSB >gi|34810962|pdb|1NN4|B Chain B, Structural Genomics, RpibALSB >gi|34810963|pdb|1NN4|C Chain C, Structural Genomics, RpibALSB >gi|34810964|pdb|1NN4|D Chain D, Structural Genomics, RpibALSB (162 aa)
Score = 292, Expect = 3.4e-25, Identities = 65/146 (44%), Positives = 85/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:    17 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRR 161
>gi|145596026|ref|YP_001160323.1| ribose-5-phosphate isomerase B [Salinispora tropica CNB-440] >gi|145305363|gb|ABP55945.1| ribose 5-phosphate isomerase [Salinispora tropica CNB-440] (155 aa)
Score = 292, Expect = 3.7e-25, Identities = 60/146 (41%), Positives = 87/146 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYEREK 152
           +Y+ SDH G ELK+ +  HL ++   VID+GP   DP DDYP +       + A+  SLG++I G+G G  +AANK  G+ AAL     TA LAR+H++ANV+ +  R    +E   IV+ FL   F E  RH +R+ ++  YER +
  S:     3 VYLGSDHAGFELKAHLANHLAKEGYDVIDVGPHAYDPDDDYPAFCLHTGDRVVADQGSLGVVIGGSGNGEQIAANKIDGVRAALAWSIDTAHLAREHNNANVVAVGGRQHTLDEATAIVEAFLTTPFSEKQRHVRRIDQVADYERTR 149
>gi|163738834|ref|ZP_02146248.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis BS107] >gi|161388162|gb|EDQ12517.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis BS107] (151 aa)
Score = 292, Expect = 3.8e-25, Identities = 56/139 (40%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + ++SDH  +EL+  +  H+     +V+D+GPT  +    YP +    A+ + +    LGI++CGTG G+ MAANK KGI   +  D+ +A + RQH++AN+L + +R V     I+IVD FL A+FEGGRH+ RV  I
  S:     9 VVLSSDHAAIELRQAIADHITANGWEVVDIGPTTPESTH-YPKHGAAAAERVASGDCDLGIILCGTGQGIMMAANKVKGIRCGVCSDTFSAKMIRQHNNANMLSIGARVVGDSLAIEIVDAFLNAEFEGGRHATRVDMI 146
>gi|160883733|ref|ZP_02064736.1| hypothetical protein BACOVA_01705 [Bacteroides ovatus ATCC 8483] >gi|156110818|gb|EDO12563.1| hypothetical protein BACOVA_01705 [Bacteroides ovatus ATCC 8483] (144 aa)
Score = 291, Expect = 3.9e-25, Identities = 61/139 (43%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +A DH G ELK  V   LE +     D G      +D YPDYA  LA  +++     GI ICG+G G+ M  NK +G+ AAL  +++ A LARQH+DANVL +  RF+  EE   I+ EF   +F+GGRH  R+ KI
  S:     4 IGLACDHAGFELKEYVRGWLEAKGWAYKDFGTNSTASVD-YPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGVRAALCWNAEIAHLARQHNDANVLVMPGRFISTEEADMILTEFFSTKFDGGRHQNRIDKI 141
>gi|125623797|ref|YP_001032280.1| ribose-5-phosphate isomerase B [Lactococcus lactis subsp. cremoris MG1363] >gi|124492605|emb|CAL97550.1| ribose 5-phosphate isomerase B [Lactococcus lactis subsp. cremoris MG1363] (149 aa)
Score = 291, Expect = 4.0e-25, Identities = 59/144 (40%), Positives = 88/144 (61%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I SDH G ELK L+I + E+   +V D GP   +   DYP Y   +A+ + A     G+LICGTGVG+ ++ANK +GI A +  +  +A L+++H++ N++   SR V  E    IV E+L+A +EGGRH+KR+  I   E E+
  S:     5 IGSDHVGFELKPLIIDYREELGHEVTDFGPFSTER-TDYPIYGKKVAEEVAAGHFDGGVLICGTGVGISISANKVRGIRAVVCSEPYSAKLSKEHNNTNIMAFGSRVVGSELAKMIVKEWLEAIYEGGRHAKRIEMITELETEQ 147
>gi|16131916|ref|NP_418514.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K-12 substr. MG1655] >gi|89110812|ref|AP_004592.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli W3110] >gi|170021910|ref|YP_001726864.1| ribose 5-phosphate isomerase B [Escherichia coli ATCC 8739] >gi|170083544|ref|YP_001732864.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K12 substr. DH10B] >gi|188493675|ref|ZP_03000945.1| ribose 5-phosphate isomerase B [Escherichia coli 53638] >gi|191168772|ref|ZP_03030549.1| ribose 5-phosphate isomerase B [Escherichia coli B7A] >gi|194437203|ref|ZP_03069301.1| ribose 5-phosphate isomerase B [Escherichia coli 101-1] >gi|731980|sp|P37351.2|RPIB_ECOLI Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|536934|gb|AAA96989.1| yjcA [Escherichia coli] >gi|1197467|emb|CAA57688.1| ribose phosphate isomerase B [Escherichia coli] >gi|1790528|gb|AAC77051.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K-12 substr. MG1655] >gi|85676843|dbj|BAE78093.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli W3110] >gi|169756838|gb|ACA79537.1| ribose 5-phosphate isomerase B [Escherichia coli ATCC 8739] >gi|169891379|gb|ACB05086.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K12 substr. DH10B] >gi|188488874|gb|EDU63977.1| ribose 5-phosphate isomerase B [Escherichia coli 53638] >gi|190901199|gb|EDV60971.1| ribose 5-phosphate isomerase B [Escherichia coli B7A] >gi|194423759|gb|EDX39748.1| ribose 5-phosphate isomerase B [Escherichia coli 101-1] (149 aa)
Score = 291, Expect = 4.2e-25, Identities = 65/146 (44%), Positives = 85/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRR 148
>gi|56698012|ref|YP_168383.1| ribose 5-phosphate isomerase B [Silicibacter pomeroyi DSS-3] >gi|56679749|gb|AAV96415.1| ribose 5-phosphate isomerase B [Silicibacter pomeroyi DSS-3] (149 aa)
Score = 291, Expect = 4.3e-25, Identities = 58/145 (40%), Positives = 86/145 (59%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M  +  I ++SDH  ++L+  V  H+  Q  +V+D+GP   +    YP +    A+ + +   SLGI++CGTG G+ MAANK  GI   +  D+ +A + R H+DAN+L L +R V     + IVD FL A+FEGGRH+ RV  I
  S:     1 MTASKRIVLSSDHAAIDLRRAVADHISAQGWEVVDIGPQTTESTH-YPKHGRAAAERVASGDCSLGIILCGTGQGIMMAANKVAGIRCGVCFDTFSARMIRMHNDANMLSLGARVVGEGLALDIVDAFLSAEFEGGRHATRVDMI 144
>gi|193063020|ref|ZP_03044112.1| ribose 5-phosphate isomerase B [Escherichia coli E22] >gi|192931279|gb|EDV83881.1| ribose 5-phosphate isomerase B [Escherichia coli E22] (149 aa)
Score = 291, Expect = 4.5e-25, Identities = 65/146 (44%), Positives = 85/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQWR 148
>gi|177672396|ref|ZP_02945158.1| ribose 5-phosphate isomerase [Micrococcus luteus NCTC 2665] >gi|172070854|gb|EDT56903.1| ribose 5-phosphate isomerase [Micrococcus luteus NCTC 2665] (157 aa)
Score = 291, Expect = 4.6e-25, Identities = 61/143 (42%), Positives = 93/143 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANP----NSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYE 149
           ++IA+DH G+EL + +++HL     +++D GPTE DP DDYP +    A+ + A+     +SLGI++ G+G G  +AANK  G+ AAL  +  TA LAR H+DANV+ +  R    EE  ++++ FL   F +  RH +R+GKI  YE
  S:     3 VHIATDHAGMELSAHLVEHLTAAGYEMVDHGPTEYDPQDDYPGFCINAARAVVADREQGLDSLGIVLGGSGNGEQIAANKVAGVRAALAWNLDTARLARAHNDANVVAVGGRQHSLEEATELIEAFLAEPFSQDERHVRRIGKIAHYE 150
>gi|187736119|ref|YP_001878231.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Akkermansia muciniphila ATCC BAA-835] >gi|187426171|gb|ACD05450.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Akkermansia muciniphila ATCC BAA-835] (566 aa)
Score = 291, Expect = 4.6e-25, Identities = 60/144 (41%), Positives = 89/144 (61%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGK 144
           M   + I I +DH G++LK  V + L+    +V D+G    +  D Y DYA  +A ++    N  GILIC +G+G+ +AAN+  G+ AAL   +  AAL+RQH+D+N+LCL+S +V  E    ++D +L A FEGGRH +RV K
  S:     5 MNTTYKIAIGADHAGVDLKETVAELLKAWGHEVTDMGTMTKNSCD-YSDYANAVASSIADGTNDRGILICRSGIGMSIAANRWVGVRAALCRTAPAAALSRQHNDSNLLCLASAYVDNESVEDVLDAWLHADFEGGRHERRVVK 147
>gi|150004854|ref|YP_001299598.1| ribose 5-phosphate isomerase B [Bacteroides vulgatus ATCC 8482] >gi|149933278|gb|ABR39976.1| ribose 5-phosphate isomerase B [Bacteroides vulgatus ATCC 8482] (144 aa)
Score = 291, Expect = 5.0e-25, Identities = 62/137 (45%), Positives = 80/137 (58%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +ASDH G ELK  V   L ++     D G    +  D Y DYA  LA  ++A     G+ ICG+G G+ M  NK +GI AAL    + A L+RQH+DANVL +  RF+  E   KI+DEF  + FEGGRH KR+ KI
  S:     6 LASDHAGFELKEFVKTWLTEKGYPCKDFGTYSTESCD-YADYAHPLALAIEAGECGPGVAICGSGEGISMTLNKHQGIRAALCWMPEIAHLSRQHNDANVLVMPGRFIDHEMAEKILDEFFNSGFEGGRHQKRIEKI 141
>gi|154174574|ref|YP_001407936.1| ribose 5-phosphate isomerase B [Campylobacter curvus 525.92] >gi|112802134|gb|EAT99478.1| ribose 5-phosphate isomerase B [Campylobacter curvus 525.92] (149 aa)
Score = 290, Expect = 5.9e-25, Identities = 59/139 (42%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I+IASDH G ELK+ +   L     +VIDLG  +     DYPD+A  +A+ + +     G+LICGTG+G+ +AAN+ + I  AL  D  TA LAR+H+DANV+   +R +      +++  F   +F+GGRH +RVGKI
  S:     6 IFIASDHAGFELKNELKTILSNLGHEVIDLGTNDGKTSVDYPDFAHSMAKNLASK--CYGVLICGTGIGISIAANRHQNIRCALCHDEFTARLAREHNDANVIAFGARVIGAGVAGEMLKVFFSTEFQGGRHERRVGKI 142
>gi|16080745|ref|NP_391573.1| ribose-5-phosphate isomerase B [Bacillus subtilis subsp. subtilis str. 168] >gi|732387|sp|P39156|YWLF_BACSU Putative sugar phosphate isomerase ywlF >gi|556884|emb|CAA86108.1| Similar to Escherichia coli yjcA gene product [Bacillus subtilis] >gi|2636217|emb|CAB15709.1| ywlF [Bacillus subtilis subsp. subtilis str. 168] >gi|1095422|prf||2108403G ipc-32d gene (149 aa)
Score = 290, Expect = 6.1e-25, Identities = 56/145 (38%), Positives = 90/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + IASDH G+ +++ + + +++ +++ ID+G        DYPDYAF +A+ + +     GILICGTG+G+ ++ANK KGI  AL  D+ +A   R+H+D N+L +  R + P    +I   +L  +F GGRH  R+GKI  YE +
  S:     3 VAIASDHGGVHIRNEIKELMDELQIEYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEFTGGRHQTRIGKISDYEEK 147
>gi|154503781|ref|ZP_02040841.1| hypothetical protein RUMGNA_01605 [Ruminococcus gnavus ATCC 29149] >gi|153795881|gb|EDN78301.1| hypothetical protein RUMGNA_01605 [Ruminococcus gnavus ATCC 29149] (173 aa)
Score = 289, Expect = 7.3e-25, Identities = 60/143 (41%), Positives = 89/143 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I +DH+ LELK+ +I+ L+++  +V+D G T+     DYP Y   + + + A     GILICGTG+G+ +AANK KG+ AA+  +  TA ++R H++ NVL   +R V  E    IVD +L  +FEGGRH +RV  I+  E
  S:    30 IGIGNDHSALELKAEIIEFLKEKGHEVVDFG-TDSSESCDYPKYGEAVGRAVVAKEVDCGILICGTGLGISLAANKVKGVRAAVCSEPFTAKMSRAHNNCNVLAFGARVVGAELAKMIVDVWLNTEFEGGRHQRRVDMIMEIE 171
>gi|126699938|ref|YP_001088835.1| ribose-5-phosphate isomerase 1 [Clostridium difficile 630] >gi|145952727|ref|ZP_01801735.1| hypothetical protein CdifQ_04002684 [Clostridium difficile QCD-32g58] >gi|168696923|ref|ZP_02729200.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-37x79] >gi|168713185|ref|ZP_02745462.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-63q42] >gi|168725423|ref|ZP_02757700.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-76w55] >gi|168729941|ref|ZP_02762218.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-97b34] >gi|196127567|ref|ZP_03119316.1| ribose-5-phosphate isomerase 1 [Clostridium difficile ATCC 43255] >gi|196159269|ref|ZP_03119830.1| ribose-5-phosphate isomerase 1 [Clostridium difficile CIP 107932] >gi|115251375|emb|CAJ69207.1| ribose-5-phosphate isomerase 1 [Clostridium difficile 630] (148 aa)
Score = 289, Expect = 7.3e-25, Identities = 58/146 (39%), Positives = 92/146 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            I I  DH G ELK  + ++L  + ++V D+G    + +D +P YA  ++Q +Q+  + LGIL CGTG+G+ +AANK KGI AA+V D  +A   R+H++ NVLCL  R +     ++IV+E+L + + G RH++R+  I   E+E
  S:     2 KISIGCDHGGYELKEYIKENLINKGIEVEDVGTNSKESVD-FPIYAKKVSQNVQSKKSDLGILCCGTGIGMSIAANKFKGIRAAVVSDCFSAKATREHNNTNVLCLGERVIGKGLAMRIVEEWLNSSYNGERHARRLQMIDDIEKE 146
>gi|30265341|ref|NP_847718.1| ribose-5-phosphate isomerase B [Bacillus anthracis str. Ames] >gi|47530880|ref|YP_022229.1| ribose-5-phosphate isomerase B [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188153|ref|YP_031406.1| ribose-5-phosphate isomerase B [Bacillus anthracis str. Sterne] >gi|52140245|ref|YP_086586.1| ribose-5-phosphate isomerase B [Bacillus cereus E33L] >gi|118480354|ref|YP_897505.1| ribose-5-phosphate isomerase B [Bacillus thuringiensis str. Al Hakam] >gi|30260019|gb|AAP29204.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus anthracis str. Ames] >gi|47506028|gb|AAT34704.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182080|gb|AAT57456.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus anthracis str. Sterne] >gi|51973714|gb|AAU15264.1| ribose 5-phosphate isomerase (ribose 5-phosphate epimerase) [Bacillus cereus E33L] >gi|118419579|gb|ABK87998.1| ribose-5-phosphate isomerase [Bacillus thuringiensis str. Al Hakam] (147 aa)
Score = 289, Expect = 7.8e-25, Identities = 59/143 (41%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GIL+CGTG+G+ +AANK  GI  ALV D+ +A   R+H+D N+L +  R +       I   +L  +FEGGRH  RVGKI  YE
  S:     3 VVIASDHGGMNIRKELVSLLEELNIEYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFEGGRHENRVGKIKTYE 145
>gi|149197613|ref|ZP_01874663.1| ribose 5-phosphate isomerase B, putative [Lentisphaera araneosa HTCC2155] >gi|149139183|gb|EDM27586.1| ribose 5-phosphate isomerase B, putative [Lentisphaera araneosa HTCC2155] (145 aa)
Score = 289, Expect = 8.3e-25, Identities = 57/139 (41%), Positives = 80/139 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH G E    +  +LE Q  +V   G   LD  D YPD+    A+T+        IL+C  G+G+ M ANK  GILAALV   +TA + RQH  +NVLCL +     +E +  +  +++ +FEGGRH +R+GK+
  S:     3 ISIASDHAGFEFNKKLKDYLESQGHEVQSFGCEGLDSCD-YPDFGIPAAKTVSTGEADRAILVCNNGIGMSMLANKLDGILAALVYSEETARMTRQHHGSNVLCLGAAQFSEDELLAFIKAWMETEFEGGRHGRRIGKV 140
>gi|159119546|ref|XP_001709991.1| Ribose 5-phosphate isomerase [Giardia lamblia ATCC 50803] >gi|157438109|gb|EDO82317.1| Ribose 5-phosphate isomerase [Giardia lamblia ATCC 50803] (145 aa)
Score = 289, Expect = 8.5e-25, Identities = 59/143 (41%), Positives = 82/143 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           +  ASDH G +L+  + +       +V+DLG TE D   DYPD+A +  + + +      IL+CGTG+G+ +AANK KGI  AL      A +AR+H++AN L L  R   PE    I+  FL   FEGGRH+ R+ KI A E
  S:     3 VAFASDHGGRDLRMFLQQRASAHGYEVMDLG-TESDASVDYPDFAKIGCEAVTSGRADCCILVCGTGIGISIAANKMKGIRCALCSTEYDAEMARKHNNANALALGGRTTGPEVAASILSRFLSTNFEGGRHAARIAKISAME 144
>gi|34764832|ref|ZP_00145210.1| Ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27885826|gb|EAA23192.1| Ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (149 aa)
Score = 288, Expect = 9.2e-25, Identities = 60/140 (42%), Positives = 85/140 (60%)
  Q:     6 PIYIASDHTGLELKSLVIKHL-EQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I + +DH G ELK  + ++L ++  +++ID G    + +D YP Y   +A  + +     GIL+C TGVG+ +AANK KG+ AAL  D+ TA L R+H+DAN+L L S  V     + IVD FL   FEGGRH  RV +I
  S:     2 KIALGADHAGFELKEKIKEYLLKKGGIEIIDKGTNSKESVD-YPKYGHAVANAVVSKEVDFGILVCTTGVGISIAANKIKGVRAALCTDTTTAKLTREHNDANILALGSGIVGQFVALDIVDTFLSTAFEGGRHKTRVDQI 141
>gi|120437637|ref|YP_863323.1| ribose/galactose isomerase family protein [Gramella forsetii KT0803] >gi|117579787|emb|CAL68256.1| ribose/galactose isomerase family protein [Gramella forsetii KT0803] (146 aa)
Score = 288, Expect = 9.3e-25, Identities = 55/141 (39%), Positives = 88/141 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
           I I +DH G + K ++ + LE     V + G    D +D YPD+   +AQ ++     LGI+ICG+G G  M ANK +G+ +AL  +++ A L+R+H+DAN+L + +RFV  +   ++++ F+  +FEGGRH +RV KI A
  S:     3 ISIGNDHAGTDYKQMIQEKLESMGHTVTNYGTNAEDSVD-YPDFVHPVAQDVENKKADLGIIICGSGNGANMTANKHQGVRSALCWNTEIAKLSREHNDANILSIPARFVSKDLATQMMETFVNTEFEGGRHQRRVDKIPA 142
>gi|49481302|ref|YP_039309.1| ribose-5-phosphate isomerase B [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49332858|gb|AAT63504.1| ribose 5-phosphate isomerase (ribose 5-phosphate epimerase) [Bacillus thuringiensis serovar konkukian str. 97-27] (147 aa)
Score = 288, Expect = 9.5e-25, Identities = 59/143 (41%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GIL+CGTG+G+ +AANK  GI  ALV D+ +A   R+H+D N+L +  R +       I   +L  +FEGGRH  RVGKI  YE
  S:     3 VVIASDHGGMNIRKELVSLLEELNVEYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFEGGRHENRVGKIKTYE 145
>gi|196166143|ref|ZP_03126674.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-23m63] (148 aa)
Score = 288, Expect = 1.1e-24, Identities = 57/146 (39%), Positives = 92/146 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            I I  DH G ELK  + ++L  + +++ D+G    + +D +P YA  ++Q +Q+  + LGIL CGTG+G+ +AANK KGI AA+V D  +A   R+H++ NVLCL  R +     ++IV+E+L + + G RH++R+  I   E+E
  S:     2 KISIGCDHGGYELKEYIKENLINKGIEIEDVGTNSKESVD-FPIYAKKVSQNVQSKKSDLGILCCGTGIGMSIAANKFKGIRAAVVSDCFSAKATREHNNTNVLCLGERVIGKGLAMRIVEEWLNSSYNGERHARRLQMIDDIEKE 146
>gi|163811865|ref|ZP_02203547.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Dehalococcoides sp. VS] >gi|157404521|gb|EDO70559.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Dehalococcoides sp. VS] (152 aa)
Score = 288, Expect = 1.1e-24, Identities = 60/148 (40%), Positives = 86/148 (58%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           N  + I +DH G  LK  ++  L Q    V+DLG    +  DDYPD+A  +A+ +       GI+ICG+GVG C+ ANK KG+ A L  D  +A    +HDD NVLCL +R +  E   +I+  FL A+F G  RH +R+ K++  E+E
  S:     3 NISVAIGADHGGYGLKIDLLPFLNQLGADVLDLGACAYNSTDDYPDFALAVARKVACGQTDRGIIICGSGVGACITANKIKGVRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIITAFLNARFTGEERHKRRMEKLLQAEKE 151
>gi|42784488|ref|NP_981735.1| ribose-5-phosphate isomerase B [Bacillus cereus ATCC 10987] >gi|42740420|gb|AAS44343.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus cereus ATCC 10987] (147 aa)
Score = 287, Expect = 1.2e-24, Identities = 58/143 (40%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + +ASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GIL+CGTG+G+ +AANK  GI  ALV D+ +A   R+H+D N+L +  R +       I   +L  +FEGGRH  RVGKI  YE
  S:     3 VVVASDHGGMNIRKELVSLLEELNIEYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFEGGRHENRVGKIKTYE 145
>gi|169832285|ref|YP_001718267.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Candidatus Desulforudis audaxviator MP104C] >gi|169639129|gb|ACA60635.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Candidatus Desulforudis audaxviator MP104C] (152 aa)
Score = 287, Expect = 1.2e-24, Identities = 65/143 (45%), Positives = 83/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I IA DH G +LK  V+  L+    QV D G T  +   DYPD    +A+ +        IL+CGTG+GV M ANK  G+ AA+  D  +A  +R H+DANVL L  R V P     IV  +LQ +FEGGRH++RVGKI A E
  S:     3 IAIACDHGGFKLKQEVLDCLKDSGFQVQDCG-TFSEASVDYPDVVLPVAEAVARGEWDRAILLCGTGIGVAMVANKVPGVRAAVAHDPYSARHSRAHNDANVLALGERVVGPGLARDIVTVWLQTEFEGGRHARRVGKIAAVE 144
>gi|168265121|ref|ZP_02687086.1| hypothetical protein LmonFSL_02247 [Listeria monocytogenes FSL J2-071] (149 aa)
Score = 287, Expect = 1.3e-24, Identities = 62/146 (42%), Positives = 95/146 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I IA+DH G +LK  +  HL +   +V D G   L+ +D +P+YA  +   + A  N LG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGGRH  R+GK+ A E ++
  S:     3 IAIAADHGGFQLKEKIRTHLIESGYKVKDFGCYSLESVD-FPEYAAKVGHFV-ATENRLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHMTRLGKLAALEEQE 146
>gi|21221084|ref|NP_626863.1| ribose-5-phosphate isomerase B [Streptomyces coelicolor A3(2)] >gi|6900897|emb|CAB71802.1| putative sugar-phosphate isomerase [Streptomyces coelicolor A3(2)] (159 aa)
Score = 287, Expect = 1.4e-24, Identities = 58/143 (40%), Positives = 86/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYE 149
           +Y+ SDH G ELK+ +++ L     + +D GP   D  DDYP +    A+   A+  +LGI+I G+G G  +AANK KG+ AAL    +TA+L RQH++ANV+ + +R    EE  K V+ FL   F G  RH +R+  + +YE
  S:     1 MYLGSDHAGFELKNHLVEWLAAAGHEPVDCGPHIYDAQDDYPPFCLRAAERTAADQGALGIVIGGSGNGEQIAANKVKGVRAALAWSEETASLGRQHNNANVVAVGARMHTQEEATKFVETFLGTPFSGDERHIRRIDMLTSYE 144
>gi|149369338|ref|ZP_01889190.1| ribose 5-phosphate isomerase B [unidentified eubacterium SCB49] >gi|149356765|gb|EDM45320.1| ribose 5-phosphate isomerase B [unidentified eubacterium SCB49] (142 aa)
Score = 287, Expect = 1.4e-24, Identities = 55/139 (39%), Positives = 83/139 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G + K  ++K+LE Q  +V++ G   LD +D YPD+A  +++ +       GILICG+  GV M ANK   + A +    +  +L RQH+DANV+C+ +R+    + + +V+ FL   FEGGRH  RV KI
  S:     3 IAIGNDHAGPDYKFAIVKYLEDQGHEVVNFGTDTLDSVD-YPDFANPVSKAVNDGEVPYGILICGSANGVAMTANKYPKVRAGICWTKEITSLTRQHNDANVICIPARYTSIPQAVGMVETFLNTAFEGGRHQNRVAKI 140
>gi|77973185|ref|ZP_00828736.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia frederiksenii ATCC 33641] (148 aa)
Score = 286, Expect = 1.5e-24, Identities = 61/146 (41%), Positives = 88/146 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I  DH G+ LK  + +HL  + + VID G  E D   DYP Y   +A+ + +   +LGI+ CG+G+G+ +AANK KGI A +  +  +A L+R+H++ NVL   SR +  +    IVD +L A+FEG RH KRV  I A E E+
  S:     3 IAIGCDHVGIILKPAITEHLIARGITVIDKGAHE-DTRTDYPIYGKAVAEAVVSGEANLGIVFCGSGIGISIAANKVKGIRAVVCSEPYSAKLSREHNNTNVLSFGSRVIGSDLAKMIVDAWLDAKFEGERHQKRVEMIAAIEEEQ 147
>gi|54020254|ref|YP_116102.1| ribose-5-phosphate isomerase B [Mycoplasma hyopneumoniae 232] >gi|53987427|gb|AAV27628.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (144 aa)
Score = 286, Expect = 1.6e-24, Identities = 55/137 (40%), Positives = 83/137 (60%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I SDH G + K  +I++L+ Q  +V DLGP   + +  Y  Y   LA  +  NP  +GI ICGTG+G+  A N+ K I AA V     A  A+ H++ANV+ LS RF   +E+I  + +FL+ ++EGGRH +R+ ++
  S:     7 ITSDHAGFKRKEEIIEYLKNQGFEVNDLGPKNEESVS-YAVYGNKLANFLLENPEQIGIAICGTGLGMSYALNRFKKIRAARVTSENDAYFAKLHNNANVIALSGRFNSKDESISFIKKFLETEYEGGRHQERIDEL 142
>gi|92112490|ref|YP_572418.1| ribose-5-phosphate isomerase [Chromohalobacter salexigens DSM 3043] >gi|91795580|gb|ABE57719.1| ribose-5-phosphate isomerase [Chromohalobacter salexigens DSM 3043] (166 aa)
Score = 286, Expect = 1.6e-24, Identities = 57/145 (39%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + +  D    ELK+L+I+H+     + +D G  + +P+  YPD A  +A+ ++A     G+L+CGTG+GV ++ANK +GI AA   D+ +AA AR  +DA ++ L +R V PE    IV  FL  +F GG   ++V +I+AYERE
  S:    15 VALGGDEAAYELKALLIEHVRALGHEAVDFGTYDAEPVL-YPDVAVKVARAIEAGEVERGVLVCGTGIGVAISANKVRGIRAAQAHDTYSAAKARSSNDAQIVTLGARVVGPELAKTIVTTFLATEFAGGGSREKVARILAYERE 158
>gi|139437097|ref|ZP_01771257.1| Hypothetical protein COLAER_00235 [Collinsella aerofaciens ATCC 25986] >gi|133776744|gb|EBA40564.1| Hypothetical protein COLAER_00235 [Collinsella aerofaciens ATCC 25986] (155 aa)
Score = 286, Expect = 1.7e-24, Identities = 56/136 (41%), Positives = 87/136 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I +DH  +ELK+++ +HL+++  +V++ G T+     DYP   + + + +      LGILICGTGVG+ +AANK +G+ A +  +  +A L+R H++ NVL   +R V  E    IVDE+L A+FEGGRH +RV
  S:     3 IGIGNDHAAVELKNIISEHLKERGCEVVNFG-TDTSESFDYPIAGYKVGKAVANGDVDLGILICGTGVGISLAANKVEGVRAVVCSEPFSAKLSRMHNNTNVLAFGARVVGSELAKMIVDEWLDAEFEGGRHERRV 137
>gi|118580167|ref|YP_901417.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Pelobacter propionicus DSM 2379] >gi|118502877|gb|ABK99359.1| ribose-5-phosphate isomerase [Pelobacter propionicus DSM 2379] (148 aa)
Score = 285, Expect = 1.9e-24, Identities = 57/145 (39%), Positives = 88/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH GL+LK  + ++L  + ++V D+G    D +D YP +   +A+ + +     GIL+CGTG+G+ +AANK  GI AAL  D     +A++H++AN+L L  R +  +E   IV  +L A FEGGRH  R+ +I   E++
  S:     2 IVIGSDHGGLDLKQALTRYLADRAIKVSDIGTDNGDSVD-YPRFGLKVAEMVASGSADRGILVCGTGIGMSIAANKVPGIRAALATDVFMGRMAKEHNNANILVLGGRVLDEQEACDIVGVWLDATFEGGRHQGRLDQIAEIEKK 145
>gi|52082223|ref|YP_081014.1| ribose-5-phosphate isomerase B [Bacillus licheniformis ATCC 14580] >gi|52787615|ref|YP_093444.1| ribose-5-phosphate isomerase B [Bacillus licheniformis ATCC 14580] >gi|52005434|gb|AAU25376.1| Ribose/galactose isomerase [Bacillus licheniformis ATCC 14580] >gi|52350117|gb|AAU42751.1| YwlF [Bacillus licheniformis DSM 13] (149 aa)
Score = 285, Expect = 2.0e-24, Identities = 57/143 (39%), Positives = 85/143 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  ++  +++  ++  D G        DYPDYAF +AQ +       GILICGTG+G+ ++ANK KGI  ALV D  +A + R+H+D NVL +  R + P    +I   +L  +F  GRH+ R+GKI  YE
  S:     3 VIIASDHGGINIRKEIMALMDELNIEYEDYGCECGSGSVDYPDYAFPVAQKVANGEADRGILICGTGIGMSISANKVKGIRCALVHDVFSAKMTREHNDTNVLAMGERVIGPGLAREIAKVWLTTEFSAGRHAVRIGKIADYE 145
>gi|163741454|ref|ZP_02148845.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis 2.10] >gi|161385188|gb|EDQ09566.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis 2.10] (151 aa)
Score = 285, Expect = 2.0e-24, Identities = 54/139 (38%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + ++SDH  +EL+  +  H+     +V+D+GPT  +    YP +    A+ + +    LGI++CGTG G+ MAANK KG+   +  ++ +A + RQH++AN+L + +R V     I+IVD FL A+FEGGRH+ RV  I
  S:     9 VVLSSDHAAIELRQAIADHIAANGWEVVDIGPTTPESTH-YPKHGAAAAERVASGDCDLGIILCGTGQGIMMAANKVKGVRCGVCSETFSAKMIRQHNNANMLSIGARVVGDSLAIEIVDAFLNAEFEGGRHATRVDMI 146
>gi|108562978|ref|YP_627294.1| ribose-5-phosphate isomerase B [Helicobacter pylori HPAG1] >gi|107836751|gb|ABF84620.1| ribose 5-phosphate isomerase [Helicobacter pylori HPAG1] (153 aa)
Score = 285, Expect = 2.1e-24, Identities = 61/143 (42%), Positives = 83/143 (58%)
  Q:     3 MNHP-----IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           MN P     ++I SDH GL L   V   LE +  ++    PT      DYPDYA L+ Q +  NP S GIL+C TG+G+ M AN+ KGI AAL +D+  A + R H++ANVLCL  +         I++ F   +FE GRH  R+ K+
  S:     1 MNKPLNIAQVFIGSDHAGLHLAEFVKHFLEDKDFKIQAFLPT---MRVDYPDYAKLVCQKVLENPQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVTESILEAFFSTEFEQGRHVLRIQKL 145
>gi|152977504|ref|YP_001377021.1| ribose-5-phosphate isomerase B [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026256|gb|ABS24026.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus cereus subsp. cytotoxis NVH 391-98] (147 aa)
Score = 285, Expect = 2.2e-24, Identities = 58/143 (40%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + +ASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GILICGTG+G+ +AANK  GI  ALV D+ +A   R+H+D+N+L +  R +       I   +L   +EGGRH  RVGKI  YE
  S:     3 VVVASDHGGINIRKEIVNLLEELNIEYIDLGCECEAGSVDYPDFAFPAAEMVAKGEVDRGILICGTGIGMSIAANKVHGIRCALVHDTFSARATREHNDSNMLAMGERVIGAGLARDIAKIWLTTDYEGGRHENRVGKIKTYE 145
>gi|154687807|ref|YP_001422968.1| ribose-5-phosphate isomerase B [Bacillus amyloliquefaciens FZB42] >gi|154353658|gb|ABS75737.1| YwlF [Bacillus amyloliquefaciens FZB42] (149 aa)
Score = 285, Expect = 2.2e-24, Identities = 57/143 (39%), Positives = 86/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  +   L++ +++ ID+G        DY DYAF +A+ +       GILICGTG+G+ ++ANK KGI  AL  D+ +A   R+H+D NVL +  R + P    +I   +L  +F GGRH +R+GKI  YE
  S:     3 VAIASDHGGVHIREEIKSLLDELQIEYIDMGCECGAGSVDYSDYAFPVAEKVVNGEADRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREIAKVWLTTEFTGGRHERRIGKIADYE 145
>gi|194341683|gb|EDX22649.1| ribose-5-phosphate isomerase B [Streptomyces sp. Mg1] (161 aa)
Score = 285, Expect = 2.3e-24, Identities = 55/144 (38%), Positives = 87/144 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYER 150
           +Y+ SDH G ELK+ ++  L+    + +D GP   D +DDYP +    A+   A+ +SLGI+I G+G G  +AANK KG+ A L    +TA L R+H++ANV+ +  R    +E +  ++ FL   + G  RH++R+  + AYER
  S:     3 VYLGSDHAGFELKNHLVDWLKNNGHEPVDCGPHIYDAVDDYPPFCLRAAEKTAADADSLGIVIGGSGNGEQIAANKVKGVRAILAWSVETAKLGREHNNANVISVGGRMHTQDEAVSFIEAFLATPYSGEERHTRRIEMLSAYER 147
>gi|116619956|ref|YP_822112.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Solibacter usitatus Ellin6076] >gi|116223118|gb|ABJ81827.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Solibacter usitatus Ellin6076] (150 aa)
Score = 285, Expect = 2.4e-24, Identities = 62/145 (42%), Positives = 86/145 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           + +ASDH G+ LK+ VI+ L +   +  DLG    DP+D YPDYA  +   +        ILICG+G G C+AANK KGI AA   DS +A    + D+ NV CL +R +  E  +++V  +L+AQF G  RH +R+ KI A E E
  S:     3 LALASDHAGVALKARVIEELRKDGHETADLGTCTTDPVD-YPDYAMAVGLAVLTGQAERAILICGSGAGACVAANKLKGIRAATCHDSFSARQCVEDDNVNVFCLGARVIGTELAVELVRIYLKAQFSGLERHKRRLAKIAALEAE 147
>gi|83951650|ref|ZP_00960382.1| ribose 5-phosphate isomerase B [Roseovarius nubinhibens ISM] >gi|83836656|gb|EAP75953.1| ribose 5-phosphate isomerase B [Roseovarius nubinhibens ISM] (149 aa)
Score = 285, Expect = 2.5e-24, Identities = 59/149 (39%), Positives = 88/149 (59%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M     I ++SDH  +EL+  V +H +    +V D+GP   +    YP +    A+ + +   +LGI++CGTG G+ MAANK KGI   +  D+ +A + RQH+DAN+L + +R V     ++IV+ FL A+FEGGRH  RV  I A E
  S:     1 MSTEKRIVLSSDHAAIELRQAVAEHAKSLGWEVEDIGPISPESTH-YPKHGKAAARKVASGDCALGIILCGTGQGIMMAANKVKGIRCGVASDTFSAKMIRQHNDANMLSIGARVVGEGLALEIVEAFLGAEFEGGRHGTRVDMIKAIE 148
>gi|51246639|ref|YP_066523.1| ribose 5-phosphate isomerase B [Desulfotalea psychrophila LSv54] >gi|50877676|emb|CAG37516.1| probable ribose 5-phosphate isomerase B [Desulfotalea psychrophila LSv54] (142 aa)
Score = 284, Expect = 2.6e-24, Identities = 58/139 (41%), Positives = 88/139 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH G ELK L+ K +      + D+G   LD +D YPDYA      +  + +  G+LICGTG+G+ +AAN+ + + AAL  D  TAA++R+H+DAN+LC+ +R + PE   +++  +L  +F GGRH +R+ K 
  S:     3 IIIASDHGGYELKELLKKKIVALGHTIEDVGCDSLDSVD-YPDYAQRAVDALVEHGDR-GVLICGTGIGMSIAANRNRSVRAALCHDEYTAAMSREHNDANILCMGARVLSPERAQQVLHTWLTTEFVGGRHLQRITKF 139
>gi|162447075|ref|YP_001620207.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Acholeplasma laidlawii PG-8A] >gi|161985182|gb|ABX80831.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Acholeplasma laidlawii PG-8A] (146 aa)
Score = 284, Expect = 2.7e-24, Identities = 61/144 (42%), Positives = 86/144 (59%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
            I I +DH G   K+ +I++L ++   V+D G   +D +D YPDYA  +++ +      +G+L+CGTG+G+ +AANK KGI AA V D  TA LAR+H+ ANV+    R     E+  IVD +L A  E  RH  RV KI A E
  S:     2 KIGIGADHAGFNRKTEIIEYLTKKGYDVVDFGAHSVDRVD-YPDYAKTVSEAVVNKEVEVGLLVCGTGIGMSIAANKVKGIRAAHVFDELTARLAREHNHANVIAFGGRNQTTSESKIIVDAYLNAH-EESRHQHRVDKIAAIE 143
>gi|25028874|ref|NP_738928.1| ribose-5-phosphate isomerase B [Corynebacterium efficiens YS-314] >gi|23494161|dbj|BAC19128.1| putative sugar phosphate isomerase [Corynebacterium efficiens YS-314] (157 aa)
Score = 284, Expect = 2.7e-24, Identities = 57/144 (39%), Positives = 85/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYER 150
           +Y+ +DH G E K+ + +HL+    +VID G    DP DDYP +    A     +P SLGI++ G+G G  +AANK KG   AL    +TA LAR+H++AN++ +  R    EE ++IVD FL  ++    RH +R+  +  YER
  S:     3 VYLGADHAGFETKNAIAEHLKAHGHEVIDCGAHTYDPDDDYPAFCIEAANRTVNDPGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETARLAREHNNANLIGIGGRMHSTEEALEIVDAFLDQEWSNAERHQRRIDILSDYER 147
>gi|194426832|ref|ZP_03059385.1| ribose 5-phosphate isomerase B [Escherichia coli B171] >gi|194415168|gb|EDX31437.1| ribose 5-phosphate isomerase B [Escherichia coli B171] (149 aa)
Score = 284, Expect = 2.9e-24, Identities = 64/146 (43%), Positives = 84/146 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AA K  GI A +  +  +A L+RQH+D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAAKKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQWR 148
>gi|193885237|pdb|2VVR|A Chain A, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate >gi|193885238|pdb|2VVR|B Chain B, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate >gi|193885239|pdb|2VVR|C Chain C, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate >gi|193885240|pdb|2VVR|D Chain D, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate >gi|193885241|pdb|2VVR|E Chain E, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate >gi|193885242|pdb|2VVR|F Chain F, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate Isomerase B From E. Coli Soaked With Ribose 5-Phosphate (149 aa)
Score = 284, Expect = 3.0e-24, Identities = 64/146 (43%), Positives = 85/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I    DH G  LK  ++ HL ++ ++VID G T      DYP YA  +A  +       GILICGTGVG+ +AANK  GI A +  +  +A L+RQ++D NVL   SR V  E    IVD +L AQ+EGGRH +RV  I A E+ +
  S:     4 IAFGCDHVGFILKHEIVAHLVERGVEVIDKG-TWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQNNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRR 148
>gi|57241939|ref|ZP_00369879.1| sugar-phosphate isomerase [Campylobacter upsaliensis RM3195] >gi|57017131|gb|EAL53912.1| sugar-phosphate isomerase [Campylobacter upsaliensis RM3195] (144 aa)
Score = 284, Expect = 3.0e-24, Identities = 59/143 (41%), Positives = 89/143 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +   +YIASDH G ELK+ +    ++ ++  IDLG  +    D Y D+A LL  T + +  S GILICG+G+G+ +AAN+ K I  AL  +S +A LAR+H+DANVL    R V  +  + +++ F++  F+ GRH KR+ KI
  S:     2 LRERLYIASDHAGYELKTKLCAFFKEVQIPFIDLGTNDEKSCD-YSDFAHLL--TSKIDEKSFGILICGSGIGISIAANRHKNIRCALCNESLSARLARKHNDANVLAFGGRLVGFDLAVDMIENFIKTPFDEGRHMKRIQKI 141
>gi|86739870|ref|YP_480270.1| ribose-5-phosphate isomerase B [Frankia sp. CcI3] >gi|86566732|gb|ABD10541.1| ribose 5-phosphate isomerase [Frankia sp. CcI3] (162 aa)
Score = 283, Expect = 3.3e-24, Identities = 59/144 (40%), Positives = 80/144 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYER 150
           +++ SDH G  LK  + + L +     +D GP E DP DDYP +    A      P S+GI+I G+G G  +AANK  G+ AAL    +TA LARQH+DANVL L +R       +   + FL   F G  RH +R+  + AYER
  S:     3 VHLGSDHAGFHLKEALAERLVELGHAPVDHGPVEYDPDDDYPPFVLAAAAATAVEPGSMGIVIGGSGNGEAIAANKVAGVRAALAWSEQTATLARQHNDANVLSLGARMYTVTAALTFAEVFLTTPFSGEQRHVRRLRMLSAYER 147
>gi|71893927|ref|YP_279373.1| ribose-5-phosphate isomerase B [Mycoplasma hyopneumoniae J] >gi|71852054|gb|AAZ44662.1| ribose 5-phosphate isomerase B [Mycoplasma hyopneumoniae J] (144 aa)
Score = 283, Expect = 3.3e-24, Identities = 56/137 (40%), Positives = 84/137 (61%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I SDH G + K  +I++L+ Q  +V DLGP   + +  Y  Y   LA  +  NP  +GI ICGTG+G+  A N+ K I AA V     A LA+ H++ANV+ LS RF   +E+I  + +FL+ ++EGGRH +R+ ++
  S:     7 ITSDHAGFKRKEEIIEYLKNQGFEVNDLGPKNEESVS-YAVYGNKLANFLLENPEQIGIAICGTGLGMSYALNRFKKIRAARVTCENDAYLAKLHNNANVIALSGRFNSKDESISFIKKFLETEYEGGRHQERIDEL 142
>gi|30023349|ref|NP_834980.1| ribose-5-phosphate isomerase B [Bacillus cereus ATCC 14579] >gi|29898910|gb|AAP12181.1| Ribose 5-phosphate isomerase [Bacillus cereus ATCC 14579] (147 aa)
Score = 283, Expect = 3.3e-24, Identities = 58/143 (40%), Positives = 83/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + IASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GIL+CGTG+G+ +AANK  GI  ALV D+ +A   R+H+D N+L +  R +       I   +L   +EGGRH  RVGKI  YE
  S:     3 VVIASDHGGMNIRKELVNLLEELNIEYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSAKATREHNDTNMLAMGERVIGAGLARDIAKIWLTTDYEGGRHENRVGKIKTYE 145
>gi|163783332|ref|ZP_02178325.1| ribose 5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] >gi|159881440|gb|EDP74951.1| ribose 5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] (148 aa)
Score = 283, Expect = 3.4e-24, Identities = 60/145 (41%), Positives = 88/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + SDH G  LK  + + L ++  +VID G T  +    YP +A  ++  +Q+     GIL+CGTG+G+ + ANK +GI AAL  +   A ++R H+DANVLCL  R +  +  + IV+ +L+  FEGGRH+KRV  I   ERE
  S:     3 IAVGSDHAGFPLKERIKEFLLEEGHEVIDFGTTS-EESTHYPLFARDVSLAVQSGEADRGILVCGTGIGMSITANKFRGIRAALCFNEYMARMSRLHNDANVLCLGDRVIGEDLALAIVEVWLKTPFEGGRHAKRVELIANIERE 146
>gi|169351562|ref|ZP_02868500.1| hypothetical protein CLOSPI_02342 [Clostridium spiroforme DSM 1552] >gi|169291784|gb|EDS73917.1| hypothetical protein CLOSPI_02342 [Clostridium spiroforme DSM 1552] (147 aa)
Score = 283, Expect = 3.6e-24, Identities = 57/146 (39%), Positives = 85/146 (58%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            I +A DH G  LK++++++L+    +V D G    +  D YPDYA   A  +       GI++CGTG+GV + ANK KGI  AL  D  +A   R H+D N+L +  R +     ++IV  +L  Q+EGGRH +R+ K++AYE E
  S:     2 KIAVACDHGGFRLKNVLVEYLKDTGYEVEDFGCYNEESCD-YPDYAGKAALAVAKGTCDKGIVVCGTGIGVSITANKVKGIRCALCHDVFSAKATRAHNDTNMLAMGQRVIGEGLALEIVKAWLDGQYEGGRHDQRIAKMMAYEGE 146
>gi|72080905|ref|YP_287963.1| ribose-5-phosphate isomerase B [Mycoplasma hyopneumoniae 7448] >gi|71914029|gb|AAZ53940.1| ribose 5-phosphate isomerase B [Mycoplasma hyopneumoniae 7448] (144 aa)
Score = 283, Expect = 3.6e-24, Identities = 53/137 (38%), Positives = 83/137 (60%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I SDH G + K  ++++L+ Q  +V DLGP   + +  Y  Y   LA  +  NP  +GI ICGTG+G+  A N+ K I AA +     A  A+ H++ANV+ LS RF   +E+I  + +FL+ ++EGGRH +R+ ++
  S:     7 ITSDHAGFKRKEEIVEYLKNQGFEVNDLGPKNEESVS-YAVYGNKLANFLLENPEQIGIAICGTGLGMSYALNRFKKIRAARITSENDAYFAKLHNNANVIALSGRFNSKDESISFIKKFLETEYEGGRHQERIDEL 142
>gi|13357562|ref|NP_077836.1| galactoside O-acetyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971165|ref|ZP_02553442.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282015|ref|ZP_02689682.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308162|ref|ZP_02690837.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762378|ref|YP_001752086.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11279026|pir||E82945 galactoside O-acetyltransferase UU006 [imported] - Ureaplasma urealyticum >gi|6898950|gb|AAF30411.1|AE002100_4 galactoside O-acetyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827955|gb|ACA33217.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902742|gb|EDT49031.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676015|gb|EDT87920.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701070|gb|EDU19352.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 6 str. ATCC 27818] (154 aa)
Score = 283, Expect = 3.9e-24, Identities = 57/150 (38%), Positives = 92/150 (61%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTM--QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           M   IY  +DH   E+K  +I HL+Q+  Q+ID G        DY  YA  +A  +      +S+GIL+CGTG+G+ +AA+K  G   ALV +  +A LA++H++AN++ + +R     + +K++D+FL ++F G RH KR+  I  YE+E+
  S:     1 MIKKIYFGNDHAAYEIKDQIITHLKQKGYQIIDEGAQAALGSVDYSTYALKVANDVVNDTKNDSIGILLCGTGIGMNIAASKVHGTRVALVYNESSAKLAKEHNNANIITIGARENSLNQILKMIDDFLTSKFLGERHQKRLDIIAKYEKEQ 152
>gi|58584455|ref|YP_198028.1| 3-demethylubiquinone-9 3-methyltransferase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418771|gb|AAW70786.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Wolbachia endosymbiont strain TRS of Brugia malayi] (402 aa)
Score = 283, Expect = 4.0e-24, Identities = 62/143 (43%), Positives = 85/143 (59%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKI 145
           M+  I IASDH G ELKS +  +LE    +V+D G T      DYPDYA  +A+ +       GILICGTG+G+ + AN+ KGI A L    +   LAR+H +ANVLCL +RF        IV +FL+ +F +  RH +R+ K+
  S:    12 MSDIISIASDHAGYELKSEIKSYLETLGCKVLDRGCTAEQKCVDYPDYAVKIAEDIINKKADYGILICGTGLGMSIVANRFKGIHAVLCNSVEITKLAREHGNANVLCLGARFTASGLAKDIVKQFLETEFSKESRHKRRLDKL 155
>gi|157825537|ref|YP_001493257.1| ribose-5-phosphate isomerase B [Rickettsia akari str. Hartford] >gi|157799495|gb|ABV74749.1| ribose-5-phosphate isomerase B [Rickettsia akari str. Hartford] (144 aa)
Score = 283, Expect = 4.0e-24, Identities = 61/141 (43%), Positives = 89/141 (63%)
  Q:     5 HPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASDH+G ELKS +I +LEQ+ L+V D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  +  TA  A+ H+DAN+L L ++ +  +    I+D+FL  +FEGGRH+ R+ KI
  S:     4 YNIVIASDHSGYELKSEIINYLEQKSLKVCDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNMLTAENAKAHNDANILILGAKTIDHKIVFDIIDKFLTTKFEGGRHNVRLLKI 143
>gi|194016282|ref|ZP_03054896.1| ribose 5-phosphate isomerase B [Bacillus pumilus ATCC 7061] >gi|194011755|gb|EDW21323.1| ribose 5-phosphate isomerase B [Bacillus pumilus ATCC 7061] (149 aa)
Score = 283, Expect = 4.1e-24, Identities = 57/145 (39%), Positives = 86/145 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + IASDH G  ++  + + +++ K++ ID+G        DYPDYAF +A  +       GILICGTG+G+ ++ANK KGI  AL  D+ +A   R+H+D NVL +  R + P    +I   +L  +F  GRH+ R+GKI  YE +
  S:     3 VAIASDHGGTNIREEIKQLMDELKIEYIDMGCECGSGSVDYPDYAFPVANMVANGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREIAHIWLTTEFTAGRHAVRIGKIADYEEK 147
>gi|116252293|ref|YP_768131.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 3841] >gi|115256941|emb|CAK08035.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 3841] (149 aa)
Score = 283, Expect = 4.2e-24, Identities = 58/149 (38%), Positives = 86/149 (57%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M   + I ++SDH  ++L+  +  H+  Q    +D+GPT  +    YP +    A+ + +     GI++CGTG G+ MAANK +GI   +  D  +A + RQH+DAN+L +  R V     + IVD FL A+FEGGRH+ RVG I A E
  S:     1 MPATNRIALSSDHAAIQLRQAIAGHVVAQGWIAVDIGPTTPES-THYPQHGEAAARLVASGDCRFGIILCGTGQGIMMAANKVRGIRCGVCADPFSARMIRQHNDANMLSIGVRVVGEGLALDIVDAFLTARFEGGRHATRVGMIEALE 148
>gi|126653454|ref|ZP_01725550.1| ribose-5-phosphate isomerase B [Bacillus sp. B14905] >gi|126589810|gb|EAZ83943.1| ribose-5-phosphate isomerase B [Bacillus sp. B14905] (145 aa)
Score = 282, Expect = 4.4e-24, Identities = 59/144 (40%), Positives = 87/144 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I I+SDH G  L+  +++ L++  +   D GP   D +D YPDYA  ++  +       GILICGTG+G+ +AANK  GI  ALV D  +A   R H+D+NVL +  R + P    +IV  +L+ +FEGGRH++R+ KI   E+
  S:     3 IAISSDHGGNNLRREIMQLLDELHISYEDFGPQSADSVD-YPDYAKPVSDGVANGKFDKGILICGTGIGMSIAANKVNGIRCALVHDVFSAKATRCHNDSNVLAMGERVIGPGLAREIVQTWLETEFEGGRHTRRIEKITELEQ 145
>gi|124523801|ref|ZP_01697713.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Bacillus coagulans 36D1] >gi|124495327|gb|EAY43046.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Bacillus coagulans 36D1] (146 aa)
Score = 282, Expect = 4.4e-24, Identities = 60/145 (41%), Positives = 86/145 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + +ASDH G  LK  +   L+   +   D G  + +   DYPDYA  +A+ +        ILICGTG+G+C++ANK KGI  ALV D  +A   R H+D+NVL +  R + P    +IV E+L   FEGGRH++R+ KI  YE++
  S:     3 VALASDHGGKHLKQEIAGLLQDLGVAYEDFG-CDCEGSVDYPDYALPVAEKVAKGEFDRAILICGTGIGMCISANKVKGIRCALVHDVFSAKATRAHNDSNVLAMGERVIGPGLACEIVKEWLGTPFEGGRHARRIEKIAQYEQK 146
>gi|157694088|ref|YP_001488550.1| ribose-5-phosphate isomerase B [Bacillus pumilus SAFR-032] >gi|157682846|gb|ABV63990.1| ribose-5-phosphate isomerase B [Bacillus pumilus SAFR-032] (149 aa)
Score = 282, Expect = 4.5e-24, Identities = 57/145 (39%), Positives = 86/145 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + IASDH G  ++  + + +++ K++ ID+G        DYPDYAF +A  +       GILICGTG+G+ ++ANK KGI  AL  D+ +A   R+H+D NVL +  R + P    +I   +L  +F  GRH+ R+GKI  YE +
  S:     3 VAIASDHGGTNIREEIKQLMDELKIEYIDMGCECGSGSVDYPDYAFPVANMVVNGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREIAHIWLTTEFTAGRHAVRIGKIAEYEEK 147
>gi|167755049|ref|ZP_02427176.1| hypothetical protein CLORAM_00553 [Clostridium ramosum DSM 1402] >gi|167705099|gb|EDS19678.1| hypothetical protein CLORAM_00553 [Clostridium ramosum DSM 1402] (147 aa)
Score = 282, Expect = 4.7e-24, Identities = 56/147 (38%), Positives = 87/147 (59%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
            I +A DH GL LK+++  +LE     V D G    D  D YPDYA   A+ + +     G+++CGTG+GV + ANK KGI  AL  D  +A   R H+D N++ +  R +     ++I+  +L+ ++EGGRH +R+ K++AYE E+
  S:     2 KIAMACDHGGLRLKNVLKDYLEANGYIVEDFGTYSEDSCD-YPDYAGKAAKAVASGSCDRGVVVCGTGIGVSITANKVKGIRCALCHDVFSAKATRAHNDTNMIAMGQRVIGEGLALEILTAWLEGKYEGGRHDQRIAKMMAYEGEE 147
>gi|117923486|ref|YP_864103.1| ribose-5-phosphate isomerase [Magnetococcus sp. MC-1] >gi|117607242|gb|ABK42697.1| ribose-5-phosphate isomerase [Magnetococcus sp. MC-1] (148 aa)
Score = 281, Expect = 5.7e-24, Identities = 59/145 (40%), Positives = 91/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQ-KLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I+ A DH   ELK  ++ +L ++ +++++DLG      +D YPDYA  L + + A+    G+L+CGTG+G+ +AAN+  GI AAL  D+ TA L R+H+DANVL L  R   P    +++D +L   + GGRH +R+ KI +  RE
  S:     3 IFFACDHGASELKQHLMAYLAKRDRVELVDLGCDGTTSVD-YPDYAATLCKAVLASAGDRGVLLCGTGIGISIAANRFAGIRAALCHDAYTARLCREHNDANVLVLGGRTTGPAVAEEMLDLWLDTPYAGGRHQRRLDKIESNARE 147
>gi|153852643|ref|ZP_01994080.1| hypothetical protein DORLON_00053 [Dorea longicatena DSM 13814] >gi|149754285|gb|EDM64216.1| hypothetical protein DORLON_00053 [Dorea longicatena DSM 13814] (159 aa)
Score = 281, Expect = 5.7e-24, Identities = 55/147 (37%), Positives = 90/147 (61%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           N  I IA+DH+ +++K+ ++++LE    +V++ G    +  + YP++   +   + +     GI ICGTG G+ +AANK  GI A +  D  TA +A++H+DANV+   +R +  E    IVDE+L A+FEGGRH+ RV  I+  E+
  S:     9 NMKIGIANDHSAVDMKNEIVEYLESLGHEVVNYGTDSYESCN-YPEFGEKIGNAVASGEVEQGIAICGTGAGISLAANKVNGIRAVVCSDPYTARMAKEHNDANVIAFGARVIGIETAKCIVDEWLNAKFEGGRHATRVDMIMDVEK 154
>gi|71756095|ref|XP_828962.1| ribose 5-phosphate isomerase [Trypanosoma brucei TREU927] >gi|70834348|gb|EAN79850.1| ribose 5-phosphate isomerase, putative [Trypanosoma brucei] (155 aa)
Score = 281, Expect = 6.3e-24, Identities = 58/147 (39%), Positives = 92/147 (62%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQ--QKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           M   + I +DH G  +   +++++ +  ++ + + +GP  L+ +D YPDYA  +A+ +      +GIL+CG+G+G+ +AANK  GI AAL  D  TA +ARQH+DANV+CL  R   P    +I+  FLQ  + G  RH++R+ KI A E
  S:     1 MTRKVAIGADHIGFPIHESIVRYVREAGEEFEPVYIGPHSLERVD-YPDYALNVARMVARGEADVGILVCGSGIGMSIAANKVPGIRAALCFDHYTAVMARQHNDANVVCLGERTTGPAVLREIIMTFLQTPYSGEDRHTQRLEKIKAAE 149
>gi|163762333|ref|ZP_02169398.1| Galactose-6-phosphate isomerase [Bacillus selenitireducens MLS10] >gi|160357072|gb|EDP83720.1| Galactose-6-phosphate isomerase [Bacillus selenitireducens MLS10] (150 aa)
Score = 281, Expect = 6.5e-24, Identities = 56/143 (39%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I SDH G  LK  +I  +++   +++D+G    D +D Y D+    A+ +       GI+ICGTG+G+ ++ANK KGI  ALV D  TA   R+H+D NVL +  R + P    +I   +L  +FEGGRH +R+ K++ YE
  S:     3 IVIGSDHAGYHLKGAIIDVVKELGHEIVDVGTDSPDSVD-YADFGLQAAEMVANKEADRGIVICGTGIGMSISANKVKGIRCALVHDLFTAKATREHNDTNVLAMGERVIGPGLAQEIAKTWLTTEFEGGRHERRIMKVMNYE 144
>gi|88607843|ref|YP_505227.1| ribose 5-phosphate isomerase B [Anaplasma phagocytophilum HZ] >gi|88598906|gb|ABD44376.1| ribose 5-phosphate isomerase B [Anaplasma phagocytophilum HZ] (143 aa)
Score = 281, Expect = 6.7e-24, Identities = 55/143 (38%), Positives = 86/143 (60%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   ++++SDH G+EL+  +  +L     +V D G    +   DYPDY   + +  + +  S G+LICGTG+G+ +AAN+ K I AAL   +  A L+R+H+DANVLC  SR++ P+    ++  F+   F GGRH+ RV K+
  S:     1 MVKRVFLSSDHAGVELRLFLSAYLRDLGCEVFDCGCDPKEHSVDYPDYVHDVVR--EVSDTSFGVLICGTGIGMSIAANRHKNIRAALCSSTMLAKLSREHNDANVLCFGSRYIDPDTAQSVLYTFMTTAFLGGRHAVRVQKL 141
>gi|15611588|ref|NP_223239.1| ribose-5-phosphate isomerase B [Helicobacter pylori J99] >gi|4155066|gb|AAD06102.1| RIBOSE 5-PHOSPHATE ISOMERASE [Helicobacter pylori J99] (151 aa)
Score = 281, Expect = 7.0e-24, Identities = 60/143 (41%), Positives = 83/143 (58%)
  Q:     3 MNHP-----IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           MN P     ++I SDH GL L   V   LE ++ ++    PT      DYPDYA L+ Q +  N  S GIL+C TG+G+ M AN+ KGI AAL +D+  A + R H++ANVLCL  +         I++ F   +FE GRH  R+ K+
  S:     1 MNKPLNTAQVFIGSDHAGLHLAEFVKHFLEDKRFKIQAFLPT---TRVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVAESILEAFFSTEFEQGRHVLRIQKL 145
>gi|170718713|ref|YP_001783903.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Haemophilus somnus 2336] >gi|168826842|gb|ACA32213.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Haemophilus somnus 2336] (157 aa)
Score = 281, Expect = 7.2e-24, Identities = 56/137 (40%), Positives = 83/137 (60%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I SDH GL LK+ +I+ LE+Q   ++DLG    +   DYP YA  +A  ++ N   +GILICGTGVG+ +AANK  GI  AL  D  TA + R+H++ N++   +  +  E+ I +   +L   ++GGRH KR+
  S:     3 TIAIGSDHIGLALKTFLIEKLEKQGHNLLDLGAVSQER-TDYPIYAEKVAYAVKRNVADVGILICGTGVGISIAANKISGIRCALCSDELTALMCREHNNCNIIAFGANIISSEKAISLATLWLNTPYDGGRHQKRL 138
>gi|38234367|ref|NP_940134.1| ribose-5-phosphate isomerase B [Corynebacterium diphtheriae NCTC 13129] >gi|38200630|emb|CAE50326.1| Putative ribose/galactose isomerase [Corynebacterium diphtheriae] (157 aa)
Score = 280, Expect = 7.8e-24, Identities = 57/144 (39%), Positives = 87/144 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ++K+++  HL+ +  +VID G    D LDDYP Y    A  +  +P SLGI++ G+G G  +AANK KG   AL    +TA LAR+H++A ++ L  R    EE + IVD FL  ++ +  RH +R+  +  YER
  S:     3 VYLGADHAGFDMKNIIADHLKAKGHEVIDCGAHTYDALDDYPAYCIEAASRVVNDPGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETARLAREHNNAQLIGLGGRMHSEEEALAIVDAFLDQEWSKEERHQRRIDILCEYER 147
>gi|169628664|ref|YP_001702313.1| carbohydrate-phosphate isomerase [Mycobacterium abscessus] >gi|169240631|emb|CAM61659.1| Hypothetical carbohydrate-phosphate isomerase [Mycobacterium abscessus] (159 aa)
Score = 280, Expect = 7.9e-24, Identities = 58/146 (39%), Positives = 87/146 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYEREK 152
           +Y+ +DH G ELK  +I+HL  +  + +D G  ELDP DDYP +    A+   A+P SLGI++ G+G G  +AANK  G   AL    +TA LAR+H++A ++ +  R     E + IVD FL A++ E  RH +R+  +  YE  +
  S:     3 VYVGADHAGYELKQKIIEHLRGRGHEPVDCGAFELDPQDDYPAFCIDAARRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSLETAVLAREHNNAQLIGIGGRMHTVPEALAIVDAFLAAKWSEEPRHQRRIDILAEYETTR 149
>gi|148272639|ref|YP_001222200.1| ribose-5-phosphate isomerase B [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830569|emb|CAN01504.1| putative ribose 5-phosphate isomerase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (162 aa)
Score = 280, Expect = 8.4e-24, Identities = 58/143 (40%), Positives = 86/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQAN----PNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           I+IA+DH GL+    +  HL      V+D GPT  D LDDYP +    A+ + A+      +LG++  G+G G  +AANK +G+ AALV +  TA LARQH+DANV+ + +R    EE    +D F+   F    RH++R+ ++  YE
  S:     3 IHIATDHAGLDFSRYLTGHLTDAGHDVVDHGPTSYDALDDYPSFCIRAARAVVADQRDGATALGVVFGGSGNGEQIAANKVEGVRAALVWNLSTAVLARQHNDANVISIGARQHTVEEATAFIDAFIAEPFSAEERHARRIAQLAEYE 150
>gi|67159081|ref|ZP_00419815.1| Ribose/galactose isomerase [Azotobacter vinelandii AvOP] >gi|67084328|gb|EAM03814.1| Ribose/galactose isomerase [Azotobacter vinelandii AvOP] (157 aa)
Score = 279, Expect = 1.0e-23, Identities = 59/148 (39%), Positives = 90/148 (60%)
  Q:     3 MNHP--IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           MN P  + I  D  G ELK L+ +H+E    ++ D G    DP+  YPD A  +A  + A  + LG+LICGTG+G+ ++ANK +GI AA   D+ +A  AR+ +DA ++ + +R + PE    IV  FL+++FE GR   +V +I A E+
  S:     1 MNEPFSVAIGCDEAGFELKELLKRHIEDLGYRLKDFGCYSTDPVL-YPDIATAVATAISAGQHRLGVLICGTGIGMAISANKIQGIRAAQAHDTYSAERARKSNDAQIVSIGARVIGPELAKNIVKSFLESEFEAGRSGPKVERIKAVEK 149
>gi|77979015|ref|ZP_00834437.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia intermedia ATCC 29909] (151 aa)
Score = 279, Expect = 1.0e-23, Identities = 60/144 (41%), Positives = 84/144 (58%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
            I +  DH G  LK+ ++ HL+ + ++VID G    +  D YP YA  +A+ + +     G+LICGTGVG+ + ANK  GI A +  +  +A L+RQH++ NVL   SR V  E    IVD +L A+FEGGRH  RV  I   E
  S:     3 SIALGCDHVGFILKADIVAHLQTRGIKVIDKGWWSTERTD-YPRYANEVAEAVTSGEVDGGVLICGTGVGISITANKHPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVGLELAKMIVDAWLDAEFEGGRHQTRVDAITEVE 145
>gi|163789220|ref|ZP_02183662.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] >gi|159875435|gb|EDP69497.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] (136 aa)
Score = 279, Expect = 1.0e-23, Identities = 54/132 (40%), Positives = 78/132 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRH 138
           I I +DH G + K  V+KHLE +   + + G   LD +D YPD+   +A+ +      LGILICG+  GV M ANK + + A +   S+   L R H++AN++C+ +RF    + IK+VD FL   FEGGRH
  S:     3 ISIGNDHAGPDYKQAVVKHLETKGYTITNYGTDTLDSVD-YPDFVHPVAKDVNDGNADLGILICGSANGVAMTANKYQNVRAGVCWTSEITELTRLHNNANIICIPARFTSIPQAIKMVDTFLNTAFEGGRH 133
>gi|54023294|ref|YP_117536.1| ribose-5-phosphate isomerase B [Nocardia farcinica IFM 10152] >gi|54014802|dbj|BAD56172.1| putative ribose 5-phosphate isomerase [Nocardia farcinica IFM 10152] (157 aa)
Score = 279, Expect = 1.0e-23, Identities = 58/144 (40%), Positives = 84/144 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYER 150
           +Y+ +DH G ELK+ V  HLEQ   +V+D G  E D LDDYP +    A+   A+P SLG++  G+G G  +AANK  G   AL    +TA LAR+H++A ++ +  R    EE + IVD FL   +    RH +R+  +  YE+
  S:     3 VYLGADHAGFELKNHVKAHLEQAGHEVVDCGALEYDALDDYPAFCIEAARRTVADPGSLGLVFGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGIGGRMHSTEEALAIVDAFLATPWSNEERHQRRIDILAEYEK 147
>gi|163943006|ref|YP_001647890.1| ribose-5-phosphate isomerase B [Bacillus weihenstephanensis KBAB4] >gi|163865203|gb|ABY46262.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus weihenstephanensis KBAB4] (147 aa)
Score = 279, Expect = 1.1e-23, Identities = 57/143 (39%), Positives = 83/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + +ASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GIL+CGTG+G+ +AANK  GI  ALV D+ +A   R+H+D N+L +  R +       I   +L   +EGGRH  RVGKI  YE
  S:     3 VVVASDHGGMNIRKELVSLLEELNIEYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSAKATREHNDTNMLAMGERVIGAGLARDIAKIWLITDYEGGRHENRVGKIKTYE 145
>gi|46906743|ref|YP_013132.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47093122|ref|ZP_00230898.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|153200999|ref|ZP_01943045.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|167013924|ref|ZP_02276457.1| hypothetical protein LmonFS_02704 [Listeria monocytogenes FSL J1-194] >gi|167216734|ref|ZP_02286370.1| hypothetical protein LmonocFSL_03909 [Listeria monocytogenes FSL J1-175] >gi|167453207|ref|ZP_02319430.1| hypothetical protein LmonocytoFSL_03491 [Listeria monocytogenes FSL J2-064] >gi|46880008|gb|AAT03309.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47018495|gb|EAL09252.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|133736270|gb|EBA37968.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (149 aa)
Score = 279, Expect = 1.1e-23, Identities = 61/143 (42%), Positives = 92/143 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I IA+DH G +LK  +  HL +    V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGGRH+ R+ K+   E
  S:     3 IAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELE 143
>gi|89889726|ref|ZP_01201237.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Flavobacteria bacterium BBFL7] >gi|89517999|gb|EAS20655.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Flavobacteria bacterium BBFL7] (143 aa)
Score = 279, Expect = 1.2e-23, Identities = 53/139 (38%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G + K  ++  L+++  QV + G   LD +D YPD+A  + Q + ++   LGI+ICG+  GV M  NK + +  A+    + A LAR+H++AN++C+ +RF    + I +V+ FL  +F GGRH+ RV KI
  S:     3 ISIGNDHAGPDYKQAIVDMLKKRGHQVTNHGTDTLDSVD-YPDFAHKVGQDVDSHTVDLGIVICGSAQGVSMTVNKYQNVRGAVCWSKEIAGLAREHNNANIICIPARFTSIPQAIAMVETFLDTEFAGGRHANRVNKI 140
>gi|58696984|ref|ZP_00372466.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila simulans] >gi|58698677|ref|ZP_00373568.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534808|gb|EAL58916.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|58536770|gb|EAL60016.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila simulans] (391 aa)
Score = 279, Expect = 1.2e-23, Identities = 60/139 (43%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKI 145
           + IASDH+G ELKS +  +LE    +V+D G T      DYPDYA  + + + +   + GILICGTG+G+   AN+ +GI AAL    + A LAR+H +ANVLCL + F        IV +FL+ +F +  RH KR+ K+
  S:     5 VSIASDHSGYELKSEIKPYLEALGYRVVDQGCTAQQKCVDYPDYAVKVVEDITSKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNANVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKL 144
>gi|149184441|ref|ZP_01862759.1| ribose 5-phosphate isomerase [Erythrobacter sp. SD-21] >gi|148831761|gb|EDL50194.1| ribose 5-phosphate isomerase [Erythrobacter sp. SD-21] (149 aa)
Score = 278, Expect = 1.4e-23, Identities = 56/139 (40%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH  +ELK+ +   L +Q  +V DLGP E +   DYPD+ + LA  +       GI +CG+G+G+ M+ N+  G+  ALV +  +AALAR+H+DAN + L +R    +     V  FL+ +F GGRH +RV K+
  S:     7 IALASDHAAIELKAALRDWLIEQGHEVADLGP-ETNESVDYPDFGYKLAGVVADGTAERGIALCGSGIGISMSVNRNPGVRCALVSEPLSAALAREHNDANCIALGARLTAVDMAKACVTAFLETEFAGGRHQRRVDKL 144
>gi|19553619|ref|NP_601621.1| ribose-5-phosphate isomerase B [Corynebacterium glutamicum ATCC 13032] >gi|62391263|ref|YP_226665.1| ribose-5-phosphate isomerase B [Corynebacterium glutamicum ATCC 13032] >gi|145296404|ref|YP_001139225.1| ribose-5-phosphate isomerase B [Corynebacterium glutamicum R] >gi|21325194|dbj|BAB99816.1| Ribose 5-phosphate isomerase RpiB [Corynebacterium glutamicum ATCC 13032] >gi|41326603|emb|CAF21085.1| POSSIBLE PHOSPHOPENTOSE ISOMERASE [Corynebacterium glutamicum ATCC 13032] >gi|140846324|dbj|BAF55323.1| hypothetical protein [Corynebacterium glutamicum R] (157 aa)
Score = 278, Expect = 1.6e-23, Identities = 56/144 (38%), Positives = 84/144 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYER 150
           +Y+ +DH G E K+ + +HL+    +VID G    D  DDYP +    A     +P SLGI++ G+G G  +AANK KG   AL    +TA LAR+H++AN++ +  R    EE + IVD FL+ ++    RH +R+  +  YER
  S:     3 VYLGADHAGFETKNAIAEHLKAHGHEVIDCGAHTYDAEDDYPAFCIEAASRTVNDPGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETARLAREHNNANLIGIGGRMHSEEEALAIVDAFLEQEWSNAERHQRRIDILADYER 147
>gi|120405007|ref|YP_954836.1| ribose-5-phosphate isomerase B [Mycobacterium vanbaalenii PYR-1] >gi|119957825|gb|ABM14830.1| ribose 5-phosphate isomerase [Mycobacterium vanbaalenii PYR-1] (157 aa)
Score = 277, Expect = 1.6e-23, Identities = 55/144 (38%), Positives = 85/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +++HL+    + +D G    D  DDYP +    AQ   A+P SLGI++ G+G G  +AANK  G   AL    +TA+LAR+H++A ++ +  R    EE + IVD FL  ++ E  RH +R+  +  YE+
  S:     3 VYVGADHAGYELKQTIVEHLKATGHEPVDCGAFTYDAEDDYPAFCIAAAQKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSPETASLAREHNNAQLIGIGGRMHSTEEALAIVDAFLTTKWSEAPRHQRRIDILAEYEK 147
>gi|56416762|ref|YP_153836.1| ribose 5-phosphate isomerase [Anaplasma marginale str. St. Maries] >gi|56387994|gb|AAV86581.1| ribose 5-phosphate isomerase [Anaplasma marginale str. St. Maries] (146 aa)
Score = 277, Expect = 1.6e-23, Identities = 58/139 (41%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +++ASDH G++L+ L+  +L     +V D G    D   DYPD    +   +  +  S G+LICGTG+G+ +AAN+ K I AAL  D   A LAR+H+DANVLC  +R+V P+    ++  FL  +F GGRH+ RV K+
  S:     7 VFVASDHAGVQLRLLLGAYLGDLGCEVADCGCDVGDDAADYPDCVPGVVDCV--SDTSFGVLICGTGIGMSIAANRNKWIRAALCHDPTFARLAREHNDANVLCFGARYVEPDVAKSVLYTFLTTKFLGGRHAARVKKL 143
>gi|184200751|ref|YP_001854958.1| ribose 5-phosphate isomerase B [Kocuria rhizophila DC2201] >gi|183580981|dbj|BAG29452.1| ribose 5-phosphate isomerase B [Kocuria rhizophila DC2201] (170 aa)
Score = 277, Expect = 1.7e-23, Identities = 62/144 (43%), Positives = 93/144 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDY---AFLLAQTMQANP-NSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYER 150
           ++IA+DH GL+L   +++ L +   ++ID GP E DP DDYP +   A L  +  +AN  +SLGI++ G+G G  MAANK +GI AALV +  TA LAR+H+DA V+ +  R    +E +++   FL   F G  RH +R+ ++  YER
  S:     3 VHIATDHAGLDLSHHLMQKLTEHGYEMIDHGPQEYDPADDYPAFCISAALGVREDRANGLDSLGIVLGGSGNGEQMAANKVEGIRAALVWNQDTAKLAREHNDAQVMAIGGRQHETDEALQLALTFLAEPFSGDERHVRRIAQLGEYER 151
>gi|116621323|ref|YP_823479.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] >gi|116224485|gb|ABJ83194.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] (166 aa)
Score = 277, Expect = 1.9e-23, Identities = 60/145 (41%), Positives = 84/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G  LK  +   LE   LQV D+G  E  P D YPD A  +A+ +     + G++I G G+G CMAANK  GI AAL  D  +A   R+H+D+NVL L +R +   +  +++  +L+  F GGRH  RV KI+  E++
  S:    16 IAIGSDHGGFRLKEALKPLLEGLGLQVRDVGVNEEKPAD-YPDIAHAVAKLVAGGTAARGVIIDGAGIGSCMAANKVPGIRAALCYDKASAKNGREHNDSNVLTLGARLLTQTQAEEVLRTWLETPFAGGRHQARVQKIMDVEQQ 159
>gi|118618997|ref|YP_907329.1| ribose-5-phosphate isomerase B [Mycobacterium ulcerans Agy99] >gi|118571107|gb|ABL05858.1| ribose/galactose isomerase RpiB [Mycobacterium ulcerans Agy99] (159 aa)
Score = 277, Expect = 2.0e-23, Identities = 58/144 (40%), Positives = 85/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH GLELK  +I+HL+    + ID G    D  DDYP +    AQ   A+P SLGI++ G+G G  +AANK  G   ALV   +TA+LAR+H++A ++ +  R     E + IVD FL   + +  RH +R+  +  YER
  S:     3 VYLGADHAGLELKQQIIEHLKATGHEPIDCGAFTYDAEDDYPAFCIAAAQRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALVWSEQTASLAREHNNAQLIGIGGRMHTVAEALAIVDAFLSTPWSKAERHQRRIDILSEYER 147
>gi|76556233|emb|CAD48942.1| ribose-5-phosphate isomerase 3 [Propionibacterium freudenreichii subsp. shermanii] (160 aa)
Score = 277, Expect = 2.1e-23, Identities = 57/143 (39%), Positives = 85/143 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I + SDH G +LK  + ++L+ +  +VID+G    + +D YP Y    A+ +     +  I++CGTGVG+ ++ANK  GI  A+  D   A ++R H+DAN L L  R V      +IVD +L   FEGGRH++RVG+I A E
  S:     3 IAMGSDHAGFDLKEHLKEYLQGKGHEVIDVGTHSTESVD-YPIYGAAAARKVADGEAATAIVVCGTGVGIGISANKVHGIRCAITSDVYAARMSRAHNDANALALGGRVVADGLAEEIVDVWLATDFEGGRHARRVGEITALE 144
>gi|167040551|ref|YP_001663536.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter sp. X514] >gi|166854791|gb|ABY93200.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter sp. X514] (153 aa)
Score = 276, Expect = 2.2e-23, Identities = 55/139 (39%), Positives = 89/139 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I + SDH G +LK ++ +HL+ + + V+D+G  + +P+D YPD A  LA+ + +     GILICGTG+G+ + ANK  G+ AA+  D  +A  AR+ +DA ++ +    V PE   K+VD +L+++F+GGR   +V KI
  S:     4 IILGSDHFGFDLKEVIKEHLQSKGIAVVDIGVYDKNPVD-YPDIAVALAERVASGEFERGILICGTGIGMAIVANKVPGVRAAVCHDVYSAERARKSNDAQIMTMGGVIVGPELAKKLVDVWLESEFQGGRSLPKVEKI 141
>gi|167772380|ref|ZP_02444433.1| hypothetical protein ANACOL_03757 [Anaerotruncus colihominis DSM 17241] >gi|167665483|gb|EDS09613.1| hypothetical protein ANACOL_03757 [Anaerotruncus colihominis DSM 17241] (146 aa)
Score = 276, Expect = 2.7e-23, Identities = 59/141 (41%), Positives = 80/141 (56%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           +A+DH G  LK  V   L++Q++   D G T      DY D A      + +      +L CGTG+G+ MAANK KGI AA   D  +A   R H+DANVLC+  R + P   I+++D FL  +FEGGRH +R+ KI A E
  S:     5 LAADHGGFALKEEVKAWLDEQQIPYKDFG-THDGASCDYADMAAPACDAVISGDCDKALLFCGTGIGISMAANKIKGIRAACCSDYFSAKYTRLHNDANVLCMGGRVIGPGAAIELIDVFLHTEFEGGRHQRRIDKIAALE 144
>gi|167760124|ref|ZP_02432251.1| hypothetical protein CLOSCI_02496 [Clostridium scindens ATCC 35704] >gi|167662249|gb|EDS06379.1| hypothetical protein CLOSCI_02496 [Clostridium scindens ATCC 35704] (146 aa)
Score = 276, Expect = 2.7e-23, Identities = 57/143 (39%), Positives = 88/143 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I +DH  +++K  +  +L++   +V++ G  + +  + YP+Y   +A+ + +    LGILICGTGVG+ +AANK KGI AA+  +  TA L+RQH++ N+L   +R V  E    IV  +L A+FEGGRH  RV  I+  E
  S:     3 IGIGNDHAAVDMKFEIADYLKELGYEVVNYGTDKKESCN-YPEYGEAVARAVASKEVDLGILICGTGVGISLAANKVKGIRAAVCSEPATARLSRQHNNTNILAFGARIVGMELAKDIVKAWLDAEFEGGRHQTRVDMIMEIE 144
>gi|167729722|emb|CAO80634.1| ribose 5-phosphate isomerase B, also acts as allose 6-phosphate isomerase [Candidatus Cloacamonas acidaminovorans] (150 aa)
Score = 276, Expect = 2.7e-23, Identities = 59/144 (40%), Positives = 82/144 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I IASDH G E+K  +     +  ++ +D G    + +D YPD  F  A+ +       GILICG+G+G+ + ANK KGI AAL  ++  A L+R H+DAN+L L+ RF      I+I   +L   FEGGRH  R+ KI   ER
  S:    10 IAIASDHAGFEMKEAIKNAFPE--IEFVDFGTHNTESMD-YPDTGFPAAKAVAEKQCEKGILICGSGIGMSITANKVKGIRAALCGNTDVARLSRLHNDANILVLAGRFTAIPYAIEITKVWLNTPFEGGRHLNRINKIQQGER 150
>gi|126738195|ref|ZP_01753916.1| ribose 5-phosphate isomerase B [Roseobacter sp. SK209-2-6] >gi|126720692|gb|EBA17397.1| ribose 5-phosphate isomerase B [Roseobacter sp. SK209-2-6] (149 aa)
Score = 275, Expect = 3.0e-23, Identities = 55/145 (37%), Positives = 84/145 (57%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M  +  I I+SDH  + L+  + +H+  +  +V D+GP   +    YP +    A+ + +     GI++CGTG G+ MAANK KGI   +  D+ +A + R+H+DAN+L + +R V       IVD FL A+FEGGRH+ RV  I
  S:     1 MTTSKRIVISSDHADIPLRQAIAEHVAAKGWEVTDIGPVTAESTH-YPKHGKEAAERVASGECQFGIIVCGTGQGIMMAANKVKGIRCGVCSDTFSARMIREHNDANMLSIGARVVGKGLAFDIVDAFLDAKFEGGRHATRVDMI 144
>gi|160934460|ref|ZP_02081847.1| hypothetical protein CLOLEP_03333 [Clostridium leptum DSM 753] >gi|156867133|gb|EDO60505.1| hypothetical protein CLOLEP_03333 [Clostridium leptum DSM 753] (148 aa)
Score = 275, Expect = 3.1e-23, Identities = 55/143 (38%), Positives = 87/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I + +DH G  LK  V  +LE++ +   D G T+ +   +Y  YA+ +AQ++ +     G+L CGTG+G+ +AANK KGI AA+  +   A + R+H+DAN+L +  R +  +  +K+ D FL   FEGGRH +R+ +I A E
  S:     2 IALGADHGGYRLKEAVKAYLEEKGIPYKDFG-TDSEESVNYGPYAYRVAQSIVSGECEKGVLCCGTGIGISIAANKVKGIRAAVCTNEFCAEMTRRHNDANILAMGGRVIDEKTAVKLADIFLNTPFEGGRHLERIQQIAAIE 143
>gi|189424992|ref|YP_001952169.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacter lovleyi SZ] >gi|189421251|gb|ACD95649.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacter lovleyi SZ] (149 aa)
Score = 275, Expect = 3.2e-23, Identities = 60/146 (41%), Positives = 86/146 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I SDH G ELK  +I  L+ + ++V D G    D +D YP++A  +A  +       GI+ICGTG+G+ +AANK  GI AALV   + A LA+QH++AN+L L  R +  E     V  +L A +EG RH +R+ KI   E++ 
  S:     3 IAIGSDHGGFELKQALIPFLQGRDIEVADAGTYSTDSVD-YPEFAEAVALLVVHGEADAGIVICGTGIGISIAANKLPGIRAALVTTPQMAELAKQHNNANILALGGRILSLETAEACVAAWLDAVYEGDRHQRRLDKITTIEKKS 147
>gi|73667026|ref|YP_303042.1| ribose/galactose isomerase [Ehrlichia canis str. Jake] >gi|72394167|gb|AAZ68444.1| Ribose/galactose isomerase [Ehrlichia canis str. Jake] (149 aa)
Score = 275, Expect = 3.4e-23, Identities = 58/145 (40%), Positives = 86/145 (59%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M +   ++I+SDH G+EL+ ++  +L      V D G  E     DYPDY   +   +  +  + GILICGTG+G+ + AN+ + I AAL  + + A LAR+H+DANVLCL +R +  E+   IV  FL  +F  GRH +R+ KI
  S:     1 MLVMQKVFISSDHAGVELRLVIKLYLNNLGYIVEDYGCVESGVPVDYPDYVQNVVDCVINDSLAFGILICGTGIGMSIVANRHRKIRAALCYNVEVARLAREHNDANVLCLGARHISYEDAQSIVYNFLTTKFSEGRHVQRIIKI 145
>gi|168334499|ref|ZP_02692665.1| ribose-5-phosphate isomerase B [Epulopiscium sp. 'N.t. morphotype B'] (151 aa)
Score = 275, Expect = 3.5e-23, Identities = 58/143 (40%), Positives = 87/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I +DH  + LK+ + K+L+++ ++VID+G    D   DYP  A  +++ + +     GILICGTGVG+ +AANK  GI A +  +  +A L+ +H++ N+L L SR V  E    IV E+L A +EGGRH KR+  I   E
  S:     3 IAIGNDHVAVALKNYITKYLQEKNIEVIDVGTNNNDR-TDYPIPAAKVSELVTSGVADRGILICGTGVGISIAANKIHGIRAVVCSEPYSAKLSVEHNNTNILALGSRVVADELAKMIVSEWLDASYEGGRHQKRIDMITQLE 144
>gi|15645199|ref|NP_207369.1| ribose-5-phosphate isomerase B [Helicobacter pylori 26695] >gi|2313693|gb|AAD07641.1| galactosidase acetyltransferase (lacA) [Helicobacter pylori 26695] (151 aa)
Score = 275, Expect = 3.6e-23, Identities = 57/139 (41%), Positives = 80/139 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           ++I SDH GL L   V + LE +  ++    PT      DYPDYA L+ Q +  N  S GIL+C TG+G+ M AN+ KGI AAL +D+  A + R H++ANVLCL  +         I++ F   +FE GRH  R+ K+
  S:    10 VFIGSDHAGLHLAEFVQRFLEDKDFKIQAFLPT---MRVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVVESILEAFFSTEFEQGRHVLRIQKL 145
>gi|88658472|ref|YP_507448.1| ribose 5-phosphate isomerase B [Ehrlichia chaffeensis str. Arkansas] >gi|88599929|gb|ABD45398.1| ribose 5-phosphate isomerase B [Ehrlichia chaffeensis str. Arkansas] (148 aa)
Score = 274, Expect = 3.7e-23, Identities = 57/140 (40%), Positives = 84/140 (60%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I+I+SDH G+EL+ ++  +L      V D G  E     DYPDY   +   +  N    GILICGTG+G+ + AN+ + I AAL  + + A LAR+H++ANVLCL +R++   E   IV +F+  +F  GRH +R+ KI
  S:     6 KIFISSDHAGIELRLVIKLYLSNLGYVVEDYGCMESSIAVDYPDYVQNVVDCV-INTLGFGILICGTGIGMSIVANRHRKIRAALCYNVEVAKLAREHNNANVLCLGARYINHGEAQSIVYQFITTKFSEGRHVQRIAKI 144
>gi|126736597|ref|ZP_01752337.1| ribose 5-phosphate isomerase B [Roseobacter sp. CCS2] >gi|126713910|gb|EBA10781.1| ribose 5-phosphate isomerase B [Roseobacter sp. CCS2] (148 aa)
Score = 274, Expect = 3.9e-23, Identities = 55/146 (37%), Positives = 87/146 (59%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPT--ELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           N  + ++SDH  +E++  +  H+  +  + +D+GPT  E  P   YP +    A+ + ++  + GI++CGTG G+ MAANK KGI   +  D  +A + R+H+DAN+L + +R +     +KIVD FL   F GGRH+ RV  I A E
  S:     3 NKRVVLSSDHAAIEMRQQIADHITAKGWEAVDIGPTTPESTP---YPAHGEAAARRVASSDCTFGIILCGTGQGIMMAANKVKGIRCGVCSDVFSAQMIREHNDANMLAMGARVIDNATALKIVDAFLFTDFGGGRHATRVDMIKALE 147
>gi|187251524|ref|YP_001876006.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Elusimicrobium minutum Pei191] >gi|186971684|gb|ACC98669.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Elusimicrobium minutum Pei191] (150 aa)
Score = 274, Expect = 4.0e-23, Identities = 57/144 (39%), Positives = 88/144 (61%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
            I +ASDH G  L+  VI  ++    +VID G  E   +D + D+A   AQ + +     G+ ICG+GVG+C++ANK KG  A++  D+ +AA   +H+D N+LCL +R + P    +IV++FL A+F+G  R  +R+ KII  E
  S:     2 KIALASDHAGFSLRETVINKIKDLGHEVIDFGTFECSSVD-FSDFAVKGAQAVVSKQAEKGVFICGSGVGMCISANKVKGTRASVAHDTYSAAQGVEHEDMNILCLGARVIGPSIAEEIVEKFLNAKFQGLERQVRRLNKIIDIE 145
>gi|116626060|ref|YP_828216.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] >gi|116229222|gb|ABJ87931.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] (145 aa)
Score = 274, Expect = 4.0e-23, Identities = 56/144 (38%), Positives = 84/144 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I I +DH G  LK  + + L Q   +V+D G T  D   DYPD+A  +A+ +    +  GIL+C TG+G+ MAANK  G+ AA           R+H+DANVL L ++++  +  I+++  FL  +F GGRH++RV KI   E+
  S:     3 IAIGADHAGFSLKEKLRQKLAQDGHEVVDFG-TASDASCDYPDFAQPVARDVAQGRSDRGILVCSTGIGMAMAANKIDGVRAAPAQSDDEVKFTREHNDANVLTLGAKYLDEDRAIELIHIFLNTEFAGGRHARRVAKIAQLEK 145
>gi|16799573|ref|NP_469841.1| hypothetical protein lin0498 [Listeria innocua Clip11262] >gi|16412938|emb|CAC95730.1| lin0498 [Listeria innocua] (149 aa)
Score = 274, Expect = 4.2e-23, Identities = 60/139 (43%), Positives = 91/139 (65%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IA+DH G +LK  V  HL +   +V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ +AANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGGRH  R+ K+
  S:     3 IAIAADHGGFQLKEKVRAHLIESGYKVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSIAANKIKGVRAAVVSDTFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHMTRLAKL 139
>gi|149178884|ref|ZP_01857463.1| ribose 5-phosphate epimerase (pentose phosphate) [Planctomyces maris DSM 8797] >gi|148842296|gb|EDL56680.1| ribose 5-phosphate epimerase (pentose phosphate) [Planctomyces maris DSM 8797] (151 aa)
Score = 274, Expect = 4.7e-23, Identities = 57/145 (39%), Positives = 88/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I +ASDH G   K+ ++  L Q      D GP + + +D YPDYA  +A+ +       GILICGTG+G+C+ ANK  G+ A    D  TA ++R H+D+NVLCLS+  +      ++++ +L+ +FEGGRH++R+ K+   E E
  S:     3 IAVASDHRGFATKAKILTLLNQLGHVAFDYGPEDGESVD-YPDYAVKVAKAIGEKAIDRGILICGTGMGMCIVANKFPGVRATPCHDDITAQMSRLHNDSNVLCLSADLLGDRLVNRMIEIWLKEEFEGGRHARRLEKLHKVEEE 146
>gi|32476635|ref|NP_869629.1| ribose 5-phosphate epimerase (pentose phosphate) [Rhodopirellula baltica SH 1] >gi|32447181|emb|CAD77007.1| ribose 5-phosphate epimerase (pentose phosphate) [Rhodopirellula baltica SH 1] (157 aa)
Score = 273, Expect = 4.8e-23, Identities = 55/147 (37%), Positives = 89/147 (60%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M   + +ASDH G+ +K+ +++ L+++  +V D G    DP+D YPD+A  +A+ ++      GILICGTG+G+ + ANK  G+ AA   D     ++R+H+D NVLCL    +      ++V  +L+  FE GRH++RV KI A +
  S:     1 MTIKVGLASDHRGVHIKARLLQTLQREGFEVCDEGTDSTDPVD-YPDFAIRVAEQIRDGRLDRGILICGTGIGMAIVANKFHGVRAASCYDEVIVEMSRRHNDVNVLCLPGDLIGERPVDELVLMWLRTDFECGRHAQRVDKITAID 146
>gi|41408383|ref|NP_961219.1| ribose-5-phosphate isomerase B [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118466601|ref|YP_880936.1| ribose-5-phosphate isomerase B [Mycobacterium avium 104] >gi|81413869|sp|Q73XM4|RPIB_MYCPA Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|41396739|gb|AAS04602.1| Rpi [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167888|gb|ABK68785.1| ribose 5-phosphate isomerase [Mycobacterium avium 104] (159 aa)
Score = 273, Expect = 4.8e-23, Identities = 58/144 (40%), Positives = 82/144 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ SDH G ELK  +I HLEQ   Q ID G    D  DDYP +    A    A+P+SLGI++ G+G G  +AANK  G   AL    +TA LAR+H++A ++ +  R     E + IVD F+   + +  RH +R+  +  YER
  S:     3 VYLGSDHAGFELKQQIIAHLEQSGHQPIDCGAFSYDADDDYPAFCIAAATRTVADPDSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAQLAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAPRHQRRIDILAEYER 147
>gi|168333893|ref|ZP_02692131.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Epulopiscium sp. 'N.t. morphotype B'] (142 aa)
Score = 273, Expect = 5.3e-23, Identities = 60/139 (43%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKI 145
           I I SDH G  LK  +I HL+++ +   D+G  + +   DYPDYA  +A  + +     GILICGTG+G+ + ANK KGI  AL  D  +A   R+H+DANVL    R + P   + IVDEFL   F    RH +R+ KI
  S:     2 IAIGSDHGGFALKQEIIAHLKERGIDFADVGCYD-EQSTDYPDYAKKVADMVLSKEAETGILICGTGIGISITANKIKGIRCALCHDIFSAKATREHNDANVLAFGGRIIGPGLALAIVDEFLNTPFSNDPRHIRRISKI 140
>gi|167768295|ref|ZP_02440348.1| hypothetical protein CLOSS21_02851 [Clostridium sp. SS2/1] >gi|167709819|gb|EDS20398.1| hypothetical protein CLOSS21_02851 [Clostridium sp. SS2/1] (305 aa)
Score = 273, Expect = 5.7e-23, Identities = 62/142 (43%), Positives = 83/142 (58%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKI 145
           N  I I SDH G  LK  VIKHLE++   V D G    +  D YP YA  +A  ++      GILICGTG+G+ + ANK KGI AAL  D+ +A   R+H+DAN+L + +R V     + IVD FL+ +F    RH +R+  I
  S:   162 NKMIGIGSDHGGYALKQAVIKHLEEKGYAVKDYGCYSEESCD-YPVYAKAVANAVKDGEVKQGILICGTGIGISITANKIKGIRAALCSDTFSAHATREHNDANILAMGARVVGEGLALDIVDTFLETEFSNDERHIRRINMI 303
>gi|183983787|ref|YP_001852078.1| ribose/galactose isomerase RpiB [Mycobacterium marinum M] >gi|183177113|gb|ACC42223.1| ribose/galactose isomerase RpiB [Mycobacterium marinum M] (159 aa)
Score = 273, Expect = 5.8e-23, Identities = 57/144 (39%), Positives = 84/144 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH GLELK  +I+HL+    + ID G    D  DDYP +    AQ   A+P SLGI++ G+G G  +AANK  G   AL    +TA+LAR+H++A ++ +  R     E + IVD FL   + +  RH +R+  +  YER
  S:     3 VYLGADHAGLELKQQIIEHLKATGHEPIDCGAFTYDAEDDYPAFCIAAAQRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSEQTASLAREHNNAQLIGIGGRMHTVAEALAIVDAFLSTPWSKAERHQRRIDILSEYER 147
>gi|42520230|ref|NP_966145.1| 3-demethylubiquinone-9 3-methyltransferase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42409968|gb|AAS14079.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila melanogaster] (391 aa)
Score = 273, Expect = 6.0e-23, Identities = 59/139 (42%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKI 145
           + IASDH G ELKS +  +LE    +V+D G T      DYP+YA  + + + +   + GILICGTG+G+   AN+ +GI AAL    + A LAR+H +ANVLCL + F        IV +FL+ +F +  RH KR+ K+
  S:     5 VSIASDHAGYELKSEIKPYLEALGYRVVDQGCTAKQKCVDYPNYAVKVVEDITSKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNANVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKL 144
>gi|190570641|ref|YP_001974999.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia pipientis] >gi|190356913|emb|CAQ54291.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia pipientis] (388 aa)
Score = 272, Expect = 6.8e-23, Identities = 61/150 (40%), Positives = 87/150 (57%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYEREK 152
           M+  I +ASDH G ELKS +  +LE     VID G T      DYPDYA  + + +     + GILICGTG+G+   AN+ +GI AAL    + A LAR+H +AN+LCL + F        IV +FL+ +F +  RH +R+ K+    ++K
  S:     1 MSDVISVASDHAGYELKSEIKAYLETLDYTVIDRGCTAEQKSVDYPDYAAEVVEDITNKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNANILCLGAGFTASGLAKDIVKQFLETEFSKESRHKERLDKLSNISKKK 151
>gi|15606395|ref|NP_213775.1| ribose 5-phosphate isomerase B [Aquifex aeolicus VF5] >gi|2983605|gb|AAC07175.1| ribose 5-phosphate isomerase B [Aquifex aeolicus VF5] (154 aa)
Score = 272, Expect = 7.3e-23, Identities = 58/136 (42%), Positives = 82/136 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I SDH G  LK  + + L+ +  +VID+G T       YP YA  + + +++     GILICGTG+G+ + ANK +GI AAL  +   A ++R H+DANVLCL  R +  E  + IV  +L+  FEGGRH KR+
  S:     3 IAIGSDHAGFPLKEKIKEFLKGEGHKVIDVG-THAQESTHYPIYAKEVVRAIRSGKAERGILICGTGIGMSITANKFRGIRAALCTNEYMARMSRLHNDANVLCLGERVLGVELALSIVKVWLETPFEGGRHLKRL 137
>gi|83592695|ref|YP_426447.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83575609|gb|ABC22160.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] (158 aa)
Score = 272, Expect = 7.4e-23, Identities = 55/140 (39%), Positives = 82/140 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKII 146
           I + +DH G ELK L+  HL  Q  +V D+G    DP+D YPD A  +AQ +       GIL+CGTG GVC++ANK  G++A  V D  TA  AR  ++A ++   +  + P     + D F+ A+F+GG  +K+V K++
  S:     9 IVVGADHLGRELKDLLRDHLTAQGYEVCDMGTATSDPVD-YPDVALPVAQAIAKGDFDRGILVCGTGAGVCVSANKVPGVIAVQVSDPYTAERARASNNAQIITFGALTIGPATAKALTDIFMAAEFQGGGSAKKVQKML 147
>gi|167465225|ref|ZP_02330314.1| ribose-5-phosphate isomerase B [Paenibacillus larvae subsp. larvae BRL-230010] (153 aa)
Score = 272, Expect = 7.5e-23, Identities = 61/143 (42%), Positives = 86/143 (60%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYERE 151
           + +DH G  LK ++I  +E    +V+DLG    D   DYPDYA  +   + +     GILICGTG+G+ +AANK  GI  ALV D  +A   R+H+D+NVL +  R V P    +IV  +L+ +F GG RH+ RVGK+ A E +
  S:     6 LGADHAGYRLKDVLIPFIESLGHEVVDLG-CSCDSSVDYPDYALEVCDHVISGIADKGILICGTGIGMSIAANKVPGIRCALVHDLFSAQATREHNDSNVLAMGERVVGPGVAQEIVRIWLETEFSGGERHANRVGKVKAIEEK 148
>gi|85373958|ref|YP_458020.1| ribose 5-phosphate isomerase [Erythrobacter litoralis HTCC2594] >gi|84787041|gb|ABC63223.1| ribose 5-phosphate isomerase [Erythrobacter litoralis HTCC2594] (148 aa)
Score = 272, Expect = 7.6e-23, Identities = 54/145 (37%), Positives = 85/145 (58%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M     I IASDH  +ELK+ +   L +Q  +V DLGP   D +D YPD+ + LA  +       G+ +CG+G+G+ M+ N+   +  ALV +  +AAL+R+H+DANV+ + +R    +     +  FL+ +F GGRH +RV K+
  S:     1 MATRMKIAIASDHAAVELKAELRDWLIEQGHEVADLGPDTTDSVD-YPDFGYKLAGVVADGTAERGVALCGSGIGISMSVNRNPAVRCALVGEPLSAALSREHNDANVIAMGARLTGSDMAKACLTAFLETEFGGGRHQRRVDKL 144
>gi|153812521|ref|ZP_01965189.1| hypothetical protein RUMOBE_02920 [Ruminococcus obeum ATCC 29174] >gi|149831446|gb|EDM86534.1| hypothetical protein RUMOBE_02920 [Ruminococcus obeum ATCC 29174] (153 aa)
Score = 271, Expect = 8.2e-23, Identities = 61/139 (43%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKI 145
           I +  DH G ELK  +IK+LE+  ++  D G    D  D YP YA  +A  +Q      GILICGTG+G+ + ANK KGI AAL  D  +A   R H++AN+L +  R V P   +KIVD FL   F E  RH +R+ +I
  S:     2 IALGCDHGGYELKQEIIKYLEENNIEYKDFGCDSTDSTD-YPIYAKRVAIAIQNGDCEKGILICGTGIGISITANKFKGIRAALCSDCFSAEATRLHNNANILAMGGRVVGPGLAVKIVDTFLNTPFSEEERHIRRIKQI 140
>gi|167211503|ref|ZP_02281810.1| hypothetical protein LmonL_04289 [Listeria monocytogenes LO28] (130 aa)
Score = 271, Expect = 8.7e-23, Identities = 56/130 (43%), Positives = 84/130 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG 136
           I IA+DH G +LK  +  HL +    V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+H+++NVLCL  R +     + ++D +L A+FEGG
  S:     3 IAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGG 130
>gi|167628998|ref|YP_001679497.1| ribose 5-phosphate isomerase b [Heliobacterium modesticaldum Ice1] >gi|167591738|gb|ABZ83486.1| ribose 5-phosphate isomerase b [Heliobacterium modesticaldum Ice1] (156 aa)
Score = 271, Expect = 9.3e-23, Identities = 60/143 (41%), Positives = 87/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQ------KLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I SDH G  +K  +   L ++      K +VID G    + +D YP++   +A+ +       GI+ICGTG+G+ +AANK  GI AAL  D+ +A +AR+H+DANVL L +R + P     IV  FL + F GGRH++RV  + A E
  S:     3 IAIGSDHGGFRMKEDIGAFLAEEIELAGVKPEVIDKGTFSEESVD-YPEFGVKVAKAVVEGEADFGIVICGTGIGISIAANKVPGIRAALCGDTFSARMAREHNDANVLALGARVIGPGLARDIVAAFLSSAFAGGRHARRVDMLRAIE 150
>gi|67458878|ref|YP_246502.1| ribose-5-phosphate isomerase B [Rickettsia felis URRWXCal2] >gi|75536681|sp|Q4UM83|Y486_RICFE Putative sugar phosphate isomerase RF_0486 >gi|67004411|gb|AAY61337.1| Ribose-5-phosphate isomerase [Rickettsia felis URRWXCal2] (145 aa)
Score = 271, Expect = 9.4e-23, Identities = 61/141 (43%), Positives = 89/141 (63%)
  Q:     5 HPIYIASD-HTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I IASD H+G ELKS +I +LEQ+ L+V D G      +D YPDYA  +   +      +GILI  TG+G+ +AAN++  I AAL  +  TA  A+ H+DAN+L L ++ +  +    I+D+FL  +FEGGRH+ R+ KI
  S:     4 YNIVIASDDHSGYELKSEIINYLEQKSLKVYDCGTNNTQTVD-YPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCHNMLTAENAKAHNDANILILGAKTIDYKIVFDIIDKFLTTKFEGGRHNVRLLKI 144
>gi|153165768|ref|ZP_01926459.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|133728126|gb|EBA29824.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] (149 aa)
Score = 271, Expect = 9.9e-23, Identities = 60/143 (41%), Positives = 91/143 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I IA+DH G +LK  +  HL +    V D G   L+ +D +P+YA  +   + A  NSLG+L CGTG+G+ MAANK KG+ AA+V D+ +A + R+ +++NVLCL  R +     + ++D +L A+FEGGRH+ R+ K+   E
  S:     3 IAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVD-FPEYAAKVGHFV-ATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRQNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELE 143
>gi|50119805|ref|YP_048972.1| ribose-5-phosphate isomerase B [Pectobacterium atrosepticum SCRI1043] >gi|49610331|emb|CAG73775.1| ribose 5-phosphate isomerase [Erwinia carotovora subsp. atroseptica SCRI1043] (152 aa)
Score = 270, Expect = 1.1e-22, Identities = 57/146 (39%), Positives = 91/146 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLG--PTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I +D   ++LK+ +  +L+Q+ L V D    PT  +P+  YPD A+ LA  ++   +  GIL+CGTG+G+C+ ANK  GI AA   D+ +A  AR+ ++A V+ L +R + PE   +I+  +L A+FEGG  + +V KI  YE ++
  S:     4 IAIGADSAAIDLKNTITDYLQQKGLTVTDYSYDPTGENPI--YPDVAYTLAHAIKDGKHQRGILLCGTGIGMCIVANKVNGIRAAQCHDTYSAQRARKSNNAQVIALGARVIGPELAKEIIGAWLDAEFEGGGSAPKVEKIGYYEHQE 149
>gi|87200253|ref|YP_497510.1| ribose-5-phosphate isomerase [Novosphingobium aromaticivorans DSM 12444] >gi|87135934|gb|ABD26676.1| ribose-5-phosphate isomerase [Novosphingobium aromaticivorans DSM 12444] (145 aa)
Score = 270, Expect = 1.1e-22, Identities = 55/139 (39%), Positives = 83/139 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH  ++LKS + ++L     +V DLGP   D +D YPDY + LA  +       G+ +CG+G+G+ +A N+      ALV +  +AALAR+H+DANV+ + +R    +     +D FL  +F GGRH+ RV K+
  S:     3 IAIASDHAAVDLKSTLREYLIDLGHEVADLGPETADRVD-YPDYGYKLASVVAEGIADFGVALCGSGIGISIAVNRNPACRCALVSEPLSAALAREHNDANVIAMGARLTGEDMAKACLDAFLSTEFGGGRHAGRVEKL 140
>gi|87306380|ref|ZP_01088527.1| ribose 5-phosphate epimerase (pentose phosphate) [Blastopirellula marina DSM 3645] >gi|87290559|gb|EAQ82446.1| ribose 5-phosphate epimerase (pentose phosphate) [Blastopirellula marina DSM 3645] (153 aa)
Score = 270, Expect = 1.1e-22, Identities = 55/144 (38%), Positives = 92/144 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I I SDH G+ ++  +I+ L++   +V D+G  +   +D YPD A  ++Q++ A     GILICG+G+G+ + ANK  G+ AA   D  TA ++R+H++ NVLCLS+  +      ++V+ +L  +FEGGRH++R+ KI  +E+
  S:     3 IAIGSDHRGVGVRHSIIELLKRLGHEVQDVGAFDCGSVD-YPDIAATVSQSVAAEEVDRGILICGSGIGMAIVANKVPGVRAATCHDDLTAEMSRRHNNVNVLCLSADMLGERLIDRMVEIWLTTEFEGGRHARRIEKISEFEK 145
>gi|88804562|ref|ZP_01120082.1| ribose 5-phosphate isomerase B, putative [Robiginitalea biformata HTCC2501] >gi|88785441|gb|EAR16610.1| ribose 5-phosphate isomerase B, putative [Robiginitalea biformata HTCC2501] (143 aa)
Score = 270, Expect = 1.3e-22, Identities = 55/142 (38%), Positives = 86/142 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAY 148
           I I +DH G E K  ++  L+   ++VI+ G    D +D Y D+   +A  + +    LGI++CG+G G CM ANK + I AAL  + +  +LAR+H++AN+L L +RF+   + +++V  FL   FEGGRH +R+ KI  Y
  S:     3 IAIGNDHAGTEYKLAIVGLLKSMDIEVINHGTDGTDGVD-YADFIHPVATDVASGEADLGIVVCGSGNGACMTANKHQEIRAALCWNKEIVSLAREHNNANILGLPARFLAIPQALEMVRTFLDTPFEGGRHQRRIEKIPCY 143
>gi|46579991|ref|YP_010799.1| ribose 5-phosphate isomerase, putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602597|ref|YP_966997.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46449407|gb|AAS96058.1| ribose 5-phosphate isomerase, putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562826|gb|ABM28570.1| ribose-5-phosphate isomerase [Desulfovibrio vulgaris subsp. vulgaris DP4] (147 aa)
Score = 270, Expect = 1.3e-22, Identities = 59/140 (42%), Positives = 77/140 (55%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           M   +++ SDH G  LK  ++  L      V DLGP      D YP YA  +   + A   +LGILICGTG+G+ MAAN+  GI AAL      A   RQH++ANVLCL  R   P   +++   FL   FEGGRH +R+
  S:     1 MARKVFVGSDHAGFALKQSIVDSLRNAGHDVEDLGPESAVSCD-YPHYAQKVCDRVLAE-EALGILICGTGIGMSMAANRIPGIRAALCTCEFHARATRQHNNANVLCLGERVTGPGVALELARLFLDTDFEGGRHQRRI 138
>gi|34541372|ref|NP_905851.1| ribose 5-phosphate isomerase B, putative [Porphyromonas gingivalis W83] >gi|188995552|ref|YP_001929804.1| putative ribose 5-phosphate isomerase B [Porphyromonas gingivalis ATCC 33277] >gi|34397689|gb|AAQ66750.1| ribose 5-phosphate isomerase B, putative [Porphyromonas gingivalis W83] >gi|188595232|dbj|BAG34207.1| putative ribose 5-phosphate isomerase B [Porphyromonas gingivalis ATCC 33277] (145 aa)
Score = 270, Expect = 1.3e-22, Identities = 59/139 (42%), Positives = 79/139 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G ELK  V   L +Q +   D G    + +D YPD+A  L   ++    + GI ICG+G G+ M  NK   + AAL    + A LARQH+DANVL L +RF+  E+   I+  +L+  FEGGRH  R+ KI
  S:     4 IGICSDHAGYELKERVKAWLAEQGITTKDFGCHSSESVD-YPDFAHPLGSAIERGELNRGISICGSGNGISMVMNKYPHVRAALCWTEEIARLARQHNDANVLSLPARFISDEQAKAILKIYLETPFEGGRHKARIDKI 141
>gi|109947937|ref|YP_665165.1| ribose-5-phosphate isomerase B [Helicobacter acinonychis str. Sheeba] >gi|109715158|emb|CAK00166.1| ribose 5-phosphate isomerase B [Helicobacter acinonychis str. Sheeba] (153 aa)
Score = 269, Expect = 1.4e-22, Identities = 59/143 (41%), Positives = 82/143 (57%)
  Q:     3 MNHP-----IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           MN P     ++I SDH GL L   V   LE ++ ++    PT      DYPDYA L+ Q +  N  S GIL+C TG+G+ M AN+ KGI AAL +D+  A + R H++ANVLCL  +         I++ F   +FE  RH  R+ K+
  S:     1 MNKPLNIAQVFIGSDHAGLHLAEFVQHFLEDKQFKIQAFLPT---ARVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVVESILEAFFSTEFEQDRHVLRIQKL 145
>gi|171910463|ref|ZP_02925933.1| Glycine hydroxymethyltransferase [Verrucomicrobium spinosum DSM 4136] (748 aa)
Score = 269, Expect = 1.5e-22, Identities = 53/139 (38%), Positives = 86/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I +DH GLE+K  ++  L  +   V DLG T      DYPD+A  +   + +   S G+L+C TG+G+ + AN+  GI AALV +  TA + R+H+++NV+CL+      ++ ++IV+ F+   FEGGRH++RV K+
  S:   193 VAIGTDHGGLEMKDAIVARLRSKGYPVSDLG-THGKGSVDYPDFAEAVCHRVLSGEVSAGVLVCTTGIGMSITANRHPGIQAALVHNVATAKVTREHNNSNVVCLAGATTSLDDAVEIVETFVSTPFEGGRHARRVDKM 330
>gi|188527579|ref|YP_001910266.1| ribose-5-phosphate isomerase B [Helicobacter pylori Shi470] >gi|188143819|gb|ACD48236.1| ribose-5-phosphate isomerase B [Helicobacter pylori Shi470] (151 aa)
Score = 269, Expect = 1.5e-22, Identities = 60/143 (41%), Positives = 81/143 (56%)
  Q:     3 MNHP-----IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           MN P     I+I SDH GL L   V   LE +  ++    P       DYPDYA L+ Q +  N  S GIL+C TG+G+ M AN+ KGI AAL +D+  A + R H++ANVLCL  +         I++ F   +FE GRH  R+ K+
  S:     1 MNKPLKPSQIFIGSDHAGLHLAKFVQHFLEDKDFKIQAFLPAMRV---DYPDYAKLVCQRVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVVESILEAFFSTEFEQGRHVLRIQKL 145
>gi|195952747|ref|YP_002121037.1| ribose 5-phosphate isomerase B [Hydrogenobaculum sp. Y04AAS1] >gi|195932359|gb|ACG57059.1| ribose 5-phosphate isomerase B [Hydrogenobaculum sp. Y04AAS1] (148 aa)
Score = 269, Expect = 1.6e-22, Identities = 59/145 (40%), Positives = 87/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH G +LK  + +H+  +  ++ID G T      DYP YA  +A  ++      GILICG+G+G+ ++ANK KGI AAL ++   A ++ + ++ANVLCL  R +  E    IVD +  A FEGGRH +R+  I ++E E
  S:     3 IAIGSDHAGFDLKEALKEHIISKGHELIDCG-THSKESTDYPLYAKEVALHIKNQKADRGILICGSGLGMSISANKIKGIRAALCLNEYMARMSVKDNNANVLCLGGRVIGVELAKSIVDAWFDAHFEGGRHERRLRIISSFEEE 146
>gi|78223818|ref|YP_385565.1| ribose/galactose isomerase [Geobacter metallireducens GS-15] >gi|78195073|gb|ABB32840.1| Ribose/galactose isomerase [Geobacter metallireducens GS-15] (150 aa)
Score = 269, Expect = 1.6e-22, Identities = 57/144 (39%), Positives = 80/144 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYER 150
           I IA+DH G  +K  +   L +   ++ D G   LDP DDYPD+   LAQ +       GI  C +GVG  +AANK  G  AAL+ D  +A    +HDD N++CL S  V   ++ ++V  FL A F G  RH +R+ K+ A E+
  S:     3 IGIAADHGGFTMKERMAAALREAGYELTDFGAERLDPDDDYPDFVIPLAQAVGEGKLDRGIAFCSSGVGASIAANKVPGARAALIHDDYSAHQGVEHDDMNIICLGSLVVGYAQSWELVRAFLAATFSGAERHRRRLAKVAALEQ 147
>gi|154498793|ref|ZP_02037171.1| hypothetical protein BACCAP_02784 [Bacteroides capillosus ATCC 29799] >gi|150272183|gb|EDM99387.1| hypothetical protein BACCAP_02784 [Bacteroides capillosus ATCC 29799] (144 aa)
Score = 269, Expect = 1.6e-22, Identities = 56/143 (39%), Positives = 82/143 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I + SDH G  LK  +  +L+ + +   D G    +  D YPD+    A+ + +     GI++C TG+G+ + ANK KGI  AL  D  +A L R+H++AN+L L+  F  P E   IV  FL  +FEGGRH +RV K++A E
  S:     2 IALGSDHGGFALKQHIKTYLDSRGIAWKDFGCDSTESCD-YPDFGAAAAKAVASGECEKGIVVCTTGIGISITANKVKGIRCALCRDVLSAELTRKHNNANMLALAGGFTGPFEAEHIVSAFLDTEFEGGRHERRVNKMMALE 143
>gi|42523484|ref|NP_968864.1| ribose 5-phosphate isomerase B [Bdellovibrio bacteriovorus HD100] >gi|39575690|emb|CAE79857.1| ribose 5-phosphate isomerase B [Bdellovibrio bacteriovorus HD100] (158 aa)
Score = 269, Expect = 1.6e-22, Identities = 60/139 (43%), Positives = 89/139 (64%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTM---------------QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           +Y+  DH GL+LK  V+  L    +Q  D+G    D +D YPDYA  + + +               Q  P +LG+LICG+G G+ + ANK   I AAL  ++  A L+R+H++AN+LCLS RF  P++ +K++  FL   F GGRH +RV K+
  S:     3 VYVGCDHAGLDLKLKVMAALPD--IQWKDMGTHSADSVD-YPDYADQVCREVVKVELQNQKNNLIDSQKGP-ALGLLICGSGQGMAIRANKFPQIRAALCWNTDIARLSREHNNANILCLSERFTSPDDAVKMLQTFLSTSFAGGRHQQRVDKL 152
>gi|94497534|ref|ZP_01304103.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Sphingomonas sp. SKA58] >gi|94422951|gb|EAT07983.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Sphingomonas sp. SKA58] (145 aa)
Score = 268, Expect = 1.8e-22, Identities = 56/139 (40%), Positives = 82/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH  +ELK+ + + L  +   V DLGP   D +D YPDY + LA  + +     GI +CG+G+G+ +A N+      ALV +  +AAL+R+H+DANVL + +R    +     V  FL  +F GGRH+ RV K+
  S:     3 IAIASDHAAVELKAELAQWLRAEGHLVEDLGPATADRVD-YPDYGYKLATAIASGAADRGIALCGSGIGISIAVNRNPACRCALVGEPLSAALSREHNDANVLAMGARLTGVDMAKACVTAFLTTEFGGGRHAGRVDKL 140
>gi|145223168|ref|YP_001133846.1| ribose-5-phosphate isomerase B [Mycobacterium gilvum PYR-GCK] >gi|145215654|gb|ABP45058.1| ribose 5-phosphate isomerase [Mycobacterium gilvum PYR-GCK] (157 aa)
Score = 268, Expect = 1.8e-22, Identities = 53/144 (36%), Positives = 85/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +++HL     + +D G    D  DDYP +    A+   A+P SLGI++ G+G G  +AANK  G   AL   ++TA LAR+H++A ++ +  R    +E + IVD FL A++ E  RH +R+  +  +E+
  S:     3 VYVGADHAGYELKQAIVEHLAATGHEPVDCGAFAYDAEDDYPAFCIAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSTETATLAREHNNAQLVGIGGRMHSTDEALAIVDAFLAAKWSEAPRHQRRIDILAEFEK 147
>gi|32474019|ref|NP_867013.1| ribose-5-phosphate isomerase B [Rhodopirellula baltica SH 1] >gi|32444556|emb|CAD74555.1| ribose 5-phosphate epimerase (pentose phosphate) [Rhodopirellula baltica SH 1] (172 aa)
Score = 268, Expect = 2.1e-22, Identities = 60/144 (41%), Positives = 87/144 (60%)
  Q:     6 PIYIA--SDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE-GGRHSKRVGKIIAYE 149
           PI +A   DH G  LK LV++    Q   +ID G T+ +   DYPD+A  +A+ + +     G+LICG+GVGV +AANK  GI AA+  D+ +A    +HDD NVLC+  R +  E   +I+  FL A++    RH +R+ KI+A E
  S:    25 PIRLAVGGDHAGFALKQLVVERFGSQVTSLIDCG-TDDETSCDYPDFAVEVAERINSGEADRGLLICGSGVGVSVAANKITGIRAAICHDTYSARQGVEHDDMNVLCIGGRIIGSELAFEIISSFLNAKYTPEERHQRRLDKILALE 170
>gi|111018386|ref|YP_701358.1| ribose-5-phosphate isomerase B [Rhodococcus sp. RHA1] >gi|110817916|gb|ABG93200.1| probable ribose 5-phosphate isomerase [Rhodococcus sp. RHA1] (157 aa)
Score = 268, Expect = 2.1e-22, Identities = 56/144 (38%), Positives = 86/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYER 150
           +Y+ +DH G E K+ +I+HL     + +D G    D LDDYP +    A+ + A+  SLGI++ G+G G  +AANK KG   AL    +TA LARQH++A ++ L  R    EE++ IVD FL A++    RH +R+  +  +E+
  S:     3 VYLGADHAGFERKNEIIEHLTAAGHETVDCGAHVYDALDDYPAFCIETARRVVADEGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETAQLARQHNNAQLIGLGGRMHSLEESLAIVDAFLAAEWSNEERHQRRIDILSEFEK 147
>gi|58177643|pdb|2BES|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177644|pdb|2BES|B Chain B, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177645|pdb|2BES|C Chain C, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177646|pdb|2BES|D Chain D, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177647|pdb|2BES|E Chain E, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177648|pdb|2BET|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177649|pdb|2BET|B Chain B, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177650|pdb|2BET|C Chain C, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177651|pdb|2BET|D Chain D, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177652|pdb|2BET|E Chain E, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. (172 aa)
Score = 268, Expect = 2.1e-22, Identities = 56/144 (38%), Positives = 83/144 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +I+HL+Q   + ID G    D  DDYP +    A    A+P SLGI++ G+G G  +AANK  G   AL    +TAALAR+H++A ++ +  R     E + IVD F+   + +  RH +R+  +  YER
  S:    16 VYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYER 160
>gi|66045808|ref|YP_235649.1| ribose/galactose isomerase [Pseudomonas syringae pv. syringae B728a] >gi|63256515|gb|AAY37611.1| Ribose/galactose isomerase [Pseudomonas syringae pv. syringae B728a] (153 aa)
Score = 268, Expect = 2.1e-22, Identities = 57/151 (37%), Positives = 84/151 (55%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           M    P+ I  D  G ELK L+ +H+E     V D G     P+  YPD A  +A  + A    LG+L+CGTG+G+ ++ANK  GI AA   D+ +A  AR+ +DA +L + +R +  E    IV  FL+++FE  R   +V +I A ER+
  S:     1 MNTPFPVAIGCDEAGYELKELLKRHIESLGYPVTDFGTHSAAPVL-YPDIALAVATAINAGQQRLGVLVCGTGIGMAISANKVFGIRAAQAHDTYSAERARKSNDAQILSIGARVIGTELAKSIVKSFLESEFEAARSGAKVERINAIERD 150
>gi|40889814|pdb|1USL|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889815|pdb|1USL|B Chain B, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889816|pdb|1USL|C Chain C, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889817|pdb|1USL|D Chain D, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889818|pdb|1USL|E Chain E, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. (170 aa)
Score = 268, Expect = 2.2e-22, Identities = 56/144 (38%), Positives = 83/144 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +I+HL+Q   + ID G    D  DDYP +    A    A+P SLGI++ G+G G  +AANK  G   AL    +TAALAR+H++A ++ +  R     E + IVD F+   + +  RH +R+  +  YER
  S:    14 VYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYER 158
>gi|15841989|ref|NP_337026.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis CDC1551] >gi|13882264|gb|AAK46840.1| carbohydrate-phosphate isomerase, putative [Mycobacterium tuberculosis CDC1551] (159 aa)
Score = 268, Expect = 2.3e-22, Identities = 56/144 (38%), Positives = 83/144 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +I+HL+Q   + ID G    D  DDYP +    A    A+P SLGI++ G+G G  +AANK  G   AL    +TAALAR+H++A ++ +  R     E + IVD F+   + +  RH +R+  +  YER
  S:     3 VYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYER 147
>gi|31793646|ref|NP_856139.1| ribose-5-phosphate isomerase B [Mycobacterium bovis AF2122/97] >gi|57116993|ref|YP_177884.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Rv] >gi|121638348|ref|YP_978572.1| ribose-5-phosphate isomerase B [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662300|ref|YP_001283823.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Ra] >gi|148823665|ref|YP_001288419.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis F11] >gi|167969789|ref|ZP_02552066.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Ra] >gi|194544651|ref|YP_002079680.1| hypothetical protein TBCG_02406 [Mycobacterium tuberculosis C] >gi|81421932|sp|Q7TYI9|RPIB_MYCBO Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|81704009|sp|Q79FD7|RPIB_MYCTU Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|7446848|pir||H70865 probable isomerase - Mycobacterium tuberculosis (strain H37RV) >gi|193506599|pdb|2VVO|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506600|pdb|2VVO|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506601|pdb|2VVO|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506602|pdb|2VVO|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506603|pdb|2VVO|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506604|pdb|2VVP|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506605|pdb|2VVP|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506606|pdb|2VVP|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506607|pdb|2VVP|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506608|pdb|2VVP|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506609|pdb|2VVQ|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506610|pdb|2VVQ|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506611|pdb|2VVQ|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506612|pdb|2VVQ|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506613|pdb|2VVQ|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|31619239|emb|CAD97353.1| PROBABLE ISOMERASE [Mycobacterium bovis AF2122/97] >gi|41353707|emb|CAE55493.1| PROBABLE ISOMERASE [Mycobacterium tuberculosis H37Rv] >gi|121493996|emb|CAL72473.1| Ribose-5-phosphate isomerase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124601658|gb|EAY60668.1| hypothetical protein TBCG_02406 [Mycobacterium tuberculosis C] >gi|134150755|gb|EBA42800.1| hypothetical isomerase [Mycobacterium tuberculosis str. Haarlem] >gi|148506452|gb|ABQ74261.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Ra] >gi|148722192|gb|ABR06817.1| hypothetical isomerase [Mycobacterium tuberculosis F11] (162 aa)
Score = 267, Expect = 2.4e-22, Identities = 56/144 (38%), Positives = 83/144 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +I+HL+Q   + ID G    D  DDYP +    A    A+P SLGI++ G+G G  +AANK  G   AL    +TAALAR+H++A ++ +  R     E + IVD F+   + +  RH +R+  +  YER
  S:     6 VYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYER 150
>gi|168702040|ref|ZP_02734317.1| ribose-5-phosphate isomerase B [Gemmata obscuriglobus UQM 2246] (151 aa)
Score = 267, Expect = 2.4e-22, Identities = 56/144 (38%), Positives = 89/144 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           + + +DH GL ++  V+  L +   +V DLG +    +D YPDYA  +A+ + A     G+LIC TG G+C+AANK  GI A    D   A L+R+H+D+N+LCL++  +  ++  +I+  +L   FEGGRH++R  K+ AYE+
  S:     3 VAVGNDHRGLCVRPRVLGLLAELGHEVHDLGASGPAGVD-YPDYAIPVAEEVAAGKADRGVLICATGHGMCIAANKVHGIRAVNSRDVIDAELSRRHNDSNILCLAADLLGEDQIERIIRAWLLTDFEGGRHTRRREKVDAYEK 145
>gi|68535613|ref|YP_250318.1| ribose-5-phosphate isomerase B [Corynebacterium jeikeium K411] >gi|68263212|emb|CAI36700.1| ribose 5-phosphate isomerase [Corynebacterium jeikeium K411] (157 aa)
Score = 267, Expect = 2.7e-22, Identities = 55/144 (38%), Positives = 84/144 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFL-QAQFEGGRHSKRVGKIIAYER 150
           IY+ +DH G E+K+++  HL  +  +V+D G    D  DDYP +    A+++  +  SLGI++ G+G G  +AANK  G   AL    +TA LAR+H++A ++ L  R    EE + IVD F+ Q   E  RH +R+  +  YER
  S:     3 IYLGADHAGFEMKNVIKDHLTSKGFEVVDCGAHTYDANDDYPAFCIAAAKSVVEDEGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGLGGRMHSEEEALAIVDAFVTQPWSEAERHQRRIDILAEYER 147
>gi|94265532|ref|ZP_01289280.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] >gi|93453973|gb|EAT04319.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] (141 aa)
Score = 267, Expect = 2.8e-22, Identities = 55/136 (40%), Positives = 78/136 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           + +  DH G  LK  V + L     ++ D G  E   +D YPD A  L + +       GILICGTG+G+ MAAN+   I AAL  +  +A ++R+H+DANVLCL +R + P     IVD +L  +F GGRH +R+
  S:     3 VALGCDHGGFALKETVAQRLRAASCEIEDCGVMEATAVD-YPDIASRLCRLVADGVCQRGILICGTGIGMSMAANRYTAIRAALCHEPFSARMSREHNDANVLCLGARVIGPGLAAAIVDAWLAGEFAGGRHLQRI 137
>gi|88711639|ref|ZP_01105727.1| ribose 5-phosphate isomerase B, putative [Flavobacteriales bacterium HTCC2170] >gi|88710580|gb|EAR02812.1| ribose 5-phosphate isomerase B, putative [Flavobacteriales bacterium HTCC2170] (156 aa)
Score = 267, Expect = 2.9e-22, Identities = 54/139 (38%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G E K  +I  L+   ++V + G    D +D YPD+   +A+ ++    + GI+ICG+G G  M ANK + I  AL  + +   LAR+H+DAN+L L +RF+   + +++V  FL  +FEGGRH +R+ KI
  S:    16 ISIGNDHAGTEYKLAIIGLLKSMNIEVSNYGTDGTDSVD-YPDFVHPVAKDVEEGKVNYGIIICGSGNGASMTANKHQKIRCALCWNKEIVQLAREHNDANILSLPARFLSLAQALEMVKVFLNTKFEGGRHERRIEKI 153
>gi|84494311|ref|ZP_00993430.1| ribose-5-phosphate isomerase B [Janibacter sp. HTCC2649] >gi|84383804|gb|EAP99684.1| ribose-5-phosphate isomerase B [Janibacter sp. HTCC2649] (155 aa)
Score = 267, Expect = 3.0e-22, Identities = 56/146 (38%), Positives = 84/146 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYEREK 152
           ++I  DH   EL+  +I  L  +  +V + GP +LDPLDDYP +    A+ +  +  SLG+++ G+G G  MAANK  G+ AAL  + + A LAR+H++A V+ +  R    EE   +V  FL   F G  RH +R+  + AYE  K
  S:     3 VHIGGDHAAYELQQDLIAFLGTEGHEVTNHGPFDLDPLDDYPVFVLRAAEAVATDEGSLGVVLGGSGNGEQMAANKVAGVRAALCYNDELAQLAREHNNAQVISIGGRMNTVEEARSMVRTFLATPFSGEERHQRRIDMVSAYEDTK 149
>gi|148263937|ref|YP_001230643.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Geobacter uraniireducens Rf4] >gi|146397437|gb|ABQ26070.1| ribose-5-phosphate isomerase [Geobacter uraniireducens Rf4] (149 aa)
Score = 266, Expect = 3.1e-22, Identities = 58/145 (40%), Positives = 84/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I SDH GL LK  + K L ++ +   D G    D +D YPD+   +A+ + +     GIL+CGTG+G+ + ANK   + AALV DS  A +A++H++AN+L L  R +       +V  +L A FEGGRH  R+ KI   E+E
  S:     2 IAIGSDHGGLSLKEALKKLLAERGISFEDCGTDNGDSVD-YPDFGVKVARKVSSGEVEKGILVCGTGIGMSIVANKFPRVRAALVTDSFMAQMAKEHNNANILVLGGRVLDENAARTMVATWLDATFEGGRHQARLDKIEDIEKE 145
>gi|56552096|ref|YP_162935.1| ribose 5-phosphate isomerase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543670|gb|AAV89824.1| ribose 5-phosphate isomerase [Zymomonas mobilis subsp. mobilis ZM4] (157 aa)
Score = 266, Expect = 3.4e-22, Identities = 54/139 (38%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + IASDH   ELKS +I  L++   +V DLGP E   +D YPDY + LA  +       GI +CG+G+G+ +A N+      AL+ D+ TA LAR+H++ANV+ + +R +  E     +  FL   F G RH +R+ K+
  S:    13 LVIASDHAAFELKSTLITWLKELGHEVEDLGPHENHSVD-YPDYGYKLAVAIAEKTADFGIALCGSGIGISIAVNRHPAARCALITDNLTARLAREHNNANVIAMGARLIGIETAKDCISAFLATPFGGERHVRRIDKL 150
>gi|150015438|ref|YP_001307692.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|149901903|gb|ABR32736.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium beijerinckii NCIMB 8052] (147 aa)
Score = 266, Expect = 3.4e-22, Identities = 56/139 (40%), Positives = 81/139 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G +LK  +  +L++  ++ ID+G    D +D YP  A  +A  +       GIL CGTG+G+ + ANK KG+ AALV D  TA   R+H+D+NVLCL  R +  E  + IVD +L  +F G  H  R+ +I
  S:     2 IAIGADHGGYKLKEFIKGYLDKNSVEYIDVGTFSEDSID-YPQIAMDVANRVSIGDCEKGILCCGTGIGMSIVANKIKGVRAALVGDCFTAKATREHNDSNVLCLGGRVIGEELALMIVDIWLSTEFIGKHHVNRLNQI 139
>gi|196254255|ref|ZP_03152810.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium thermocellum DSM 4150] >gi|196196326|gb|EDX91268.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium thermocellum DSM 4150] (148 aa)
Score = 266, Expect = 3.6e-22, Identities = 57/146 (39%), Positives = 88/146 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I +DH G  LK  + +HL++   +V+D G    +   DYP YA ++A  +       GILICGTGVG+ +AANK  GI A +  +  +A L++QH++ N+L L +R V  E    IV+E+L A++E GRH++R+  I   E+ +
  S:     3 IGIGNDHVGYALKLEIAEHLKKLGHEVVDFGHHSTER-TDYPIYAKMVADAVTEKKVDCGILICGTGVGMAIAANKVGGIRAVVCSEPYSAKLSKQHNNTNILTLGARVVGSELAKMIVEEWLGAEYEAGRHARRLEMIEEMEKRQ 147
>gi|91201531|emb|CAJ74591.1| strongly similar to ribose-5-phosphate isomerase [Candidatus Kuenenia stuttgartiensis] (155 aa)
Score = 266, Expect = 3.9e-22, Identities = 62/145 (42%), Positives = 84/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           I I SDH GL LK   I H ++ + Q+ID+G    +P+D YPDYA  + + +       GILIC +GVG  +AANK  GI A L  D+ +A    +HDD N+L L +  V  +  I++V  FL A F G  RH +RVGKI   E+ 
  S:     8 IAIGSDHAGLWLKKSFIAHFDKPEYQLIDVGTYSTEPVD-YPDYAEAVGRKLLDGSADRGILICCSGVGASVAANKIPGIRAGLCHDTYSAHQGVEHDDMNILVLGACIVGLKLAIELVQSFLGATFNGEERHKRRVGKIQFIEKR 152
>gi|86131088|ref|ZP_01049687.1| ribose 5-phosphate isomerase B [Cellulophaga sp. MED134] >gi|85818499|gb|EAQ39659.1| ribose 5-phosphate isomerase B [Dokdonia donghaensis MED134] (143 aa)
Score = 265, Expect = 4.4e-22, Identities = 51/139 (36%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G   K++++K L++    V + G    D +D YPD+   +A  ++      GI+ICG+G G+ M  NK +G+ AAL    + A LAR+H++ANV+ + +R+    + +++V  F+  +FEGGRH +RV KI
  S:     3 ISIGNDHAGPSYKNVIVKFLKEAGHTVSNYGTDTPDSVD-YPDFGHPVATDVEEGKADFGIVICGSGNGIAMTVNKHQGVRAALCWIKEIAILAREHNNANVIAIPARYTSEMQALEMVKAFITTEFEGGRHQRRVDKI 140
>gi|94264508|ref|ZP_01288295.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] >gi|93455067|gb|EAT05294.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] (141 aa)
Score = 265, Expect = 4.5e-22, Identities = 55/136 (40%), Positives = 78/136 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           + +  DH G  LK  V + L     ++ D G  E   +D YPD A  L + +       GILICGTG+G+ MAAN+   I AAL  +  +A ++R+H+DANVLCL +R + P     IVD +L  +F GGRH +R+
  S:     3 VALGCDHGGFALKETVAQRLRAASCEIEDCGVMEATAVD-YPDIASRLCRLVADGVCQRGILICGTGIGMSMAANRYTAIRAALCHEPFSARMSREHNDANVLCLGARVIGPGLAAAIVDVWLAGEFAGGRHLQRI 137
>gi|42525868|ref|NP_970966.1| ribose 5-phosphate isomerase B [Treponema denticola ATCC 35405] >gi|41815918|gb|AAS10847.1| ribose 5-phosphate isomerase B [Treponema denticola ATCC 35405] (150 aa)
Score = 265, Expect = 4.6e-22, Identities = 51/145 (35%), Positives = 87/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I   SDH+G+ LK ++++H+  +  + +D G  +     +Y ++   +A+ +++     G+++CG+GVG+ +AANK  G+ AA   +  TA LA +H D N + +    V PEE   IVD FL A+FEGG +++RV  + A ER+
  S:     3 IGFGSDHSGVALKHILMEHVRNKGYECVDYGAADSKVPANYAEFGLKVAEAIKSQEVEKGVMVCGSGVGISLAANKVPGVRAAACSEPCTAKLAVEHSDINAVAMGVCIVGPEEAKMIVDAFLDARFEGGVYTERVDTLSAIERK 147
>gi|149921256|ref|ZP_01909712.1| ribose 5-phosphate isomerase B [Plesiocystis pacifica SIR-1] >gi|149817916|gb|EDM77378.1| ribose 5-phosphate isomerase B [Plesiocystis pacifica SIR-1] (155 aa)
Score = 265, Expect = 5.0e-22, Identities = 55/137 (40%), Positives = 84/137 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVI-DLGPTELDPLDDYPDYAFLLAQTM------QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVG 143
            ++ SDH G+EL+ +++  L + ++ V+ + GP       DYP+ A  LAQ +          +  G+L+CGTG GV M ANK  G+ A +V D  +A + R H+DA VLCL  R +  E   +++  F+ A FEGGRH++RVG
  S:     3 FHVGSDHGGVELRKVLVAALAEWEIPVLAEYGPAAPGEKADYPNVARELAQAVLRDRGQGGGEDVFGLLVCGTGQGVAMTANKVPGVRAGVVSDVFSAKMIRAHNDAQVLCLGERVLGTELAKQLLRAFIDAPFEGGRHARRVG 146
>gi|146298780|ref|YP_001193371.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Flavobacterium johnsoniae UW101] >gi|146153198|gb|ABQ04052.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Flavobacterium johnsoniae UW101] (143 aa)
Score = 265, Expect = 5.2e-22, Identities = 53/139 (38%), Positives = 77/139 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I +DH G E K  ++  LE +  +V + G T+ D   DYPD+   +A  +       GI+ICG+G G+ M  NK   + A L    + A L R H+DAN++ + +RF    + ++IV+ FL   FEGGRH  RV KI
  S:     3 ISIGNDHAGPEYKKSIVAMLEARGYEVTNYG-TDTDASVDYPDFGHPVANDVSEGKADFGIVICGSGNGIAMTVNKHPKVRAGLCWTKEIAYLTRLHNDANIVSIPARFTSIHQAVEIVETFLDTAFEGGRHQNRVNKI 140
>gi|78357163|ref|YP_388612.1| ribose-5-phosphate isomerase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78219568|gb|ABB38917.1| ribose-5-phosphate isomerase [Desulfovibrio desulfuricans G20] (146 aa)
Score = 264, Expect = 5.3e-22, Identities = 56/140 (40%), Positives = 79/140 (56%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           M   + I SDH G  LK L++  L +    V D+GP   +  D YP +A  + + +     + GILICGTG+G+ MAAN+  GI AAL      A   R H++ANVLCL  R   P   +++   FL+ +FEGGRH +R+
  S:     1 MAKQVIIGSDHAGFSLKELLVSELTKSGYDVHDMGPATAESCD-YPLFAQKVCERV-LQQKAQGILICGTGIGMSMAANRIDGIRAALCTTEFHARATRLHNNANVLCLGERVTGPGVALELARLFLETEFEGGRHQRRI 138
>gi|138896947|ref|YP_001127400.1| ribose 5-phosphate epimerase (pentose phosphate) [Geobacillus thermodenitrificans NG80-2] >gi|134268460|gb|ABO68655.1| Ribose 5-phosphate epimerase (pentose phosphate) [Geobacillus thermodenitrificans NG80-2] (124 aa)
Score = 264, Expect = 5.3e-22, Identities = 49/106 (46%), Positives = 69/106 (65%)
  Q:    46 DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           DYPDYA  +A+ +       GILICGTG+G+ +AANK KG+  AL  D  +A L R H+D+N+L +  R + P    +I   +L+ +FEGGRH++R+GKI  YE E
  S:    17 DYPDYALPVAEKVARGEFDRGILICGTGIGMTIAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIGPGLAREIAKAWLETEFEGGRHARRIGKIADYENE 122
>gi|78222814|ref|YP_384561.1| ribose-5-phosphate isomerase [Geobacter metallireducens GS-15] >gi|78194069|gb|ABB31836.1| ribose-5-phosphate isomerase [Geobacter metallireducens GS-15] (148 aa)
Score = 264, Expect = 6.3e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + SDH GLELK  +   L ++ + V D G    + +D YPD+   +A+ + A     GIL CGTG+G+ + ANK   + AAL  D   A +A++H++AN+L L  R +      ++V  +L A FEGGRH  R+ KI A E+E
  S:     2 ILVGSDHGGLELKEAIKLLLTERGITVEDCGTDNGNSVD-YPDFGIKVARKISAGEAEKGILFCGTGIGMSIVANKFPNVRAALATDPFMARMAKEHNNANILVLGGRVLDEATAREMVCVWLDATFEGGRHQGRLDKIAALEKE 145
>gi|88608285|ref|YP_506112.1| ribose 5-phosphate isomerase B [Neorickettsia sennetsu str. Miyayama] >gi|88600454|gb|ABD45922.1| ribose 5-phosphate isomerase B [Neorickettsia sennetsu str. Miyayama] (152 aa)
Score = 264, Expect = 6.4e-22, Identities = 55/143 (38%), Positives = 86/143 (60%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKI 145
           MN  + I +DH G  LK+++I     +    +D G   LD + DYPD+A  ++  +       GILICG+G+G+ + AN+ K + AAL  D + A +AR+H+DANVLCL+ R +     ++IV+ F+ ++F    RH KR+ KI
  S:     1 MNVRVSIGADHAGFALKAVLIDFFRARGCLPVDRGAYCLD-VSDYPDFAKSVSLDVSDGRVDFGILICGSGIGMSITANRYKKVRAALCYDVRAAKMAREHNDANVLCLAGRDLTVSRCLEIVEAFVSSKFSCEERHKKRIEKI 143
>gi|172041062|ref|YP_001800776.1| ribose 5-phosphate isomerase [Corynebacterium urealyticum DSM 7109] >gi|171852366|emb|CAQ05342.1| ribose 5-phosphate isomerase [Corynebacterium urealyticum DSM 7109] (157 aa)
Score = 264, Expect = 6.6e-22, Identities = 55/144 (38%), Positives = 85/144 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           IY+ +DH G ++K+L+  HL+    +VID G    D  DDYP +    A+ + A+  SLGI++ G+G G  +AANK  G   AL    +TA LAR+H++A ++ L  R    EE + IVD F+  ++ E  RH +R+  +  YE+
  S:     3 IYLGADHAGFDMKNLIADHLKAAGHEVIDCGAHTYDANDDYPAFCIEAARRVVADEGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGLGGRMHSEEEALAIVDAFIAQEWSEAERHQRRIDILAEYEK 147
>gi|71894407|ref|YP_278515.1| ribose-5-phosphate isomerase B [Mycoplasma synoviae 53] >gi|71851195|gb|AAZ43804.1| ribose 5-phosphate isomerase B [Mycoplasma synoviae 53] (147 aa)
Score = 263, Expect = 7.5e-22, Identities = 57/143 (39%), Positives = 83/143 (58%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGP-TELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           MN  I +ASDH G ELK  + KH +    +++DLG  + LD  ++Y      LA  M  N    GI ICGTG+G+  A N+   I AA V  ++ A LA+ H+DANVL   +R V  ++  ++++ ++   FEGGRH KR+  I
  S:     1 MNKVIPLASDHAGFELKERLEKHFQALGYKIVDLGAKSNLDSDNNYALAGHDLAHYMLENKCEFGIGICGTGLGISYALNRHNHIRAARVTSNEDAHLAKLHNDANVLVFGARQVSFDQAKEMIENYINTTFEGGRHLKRINDI 144
>gi|189218214|ref|YP_001938856.1| Ribose 5-phosphate isomerase RpiB [Methylokorus infernorum V4] >gi|161075833|gb|ABX56664.1| ribose 5-phosphate isomerase B [Verrucomicrobiae bacterium V4] >gi|189185072|gb|ACD82257.1| Ribose 5-phosphate isomerase RpiB [Methylacidiphilum infernorum V4] (148 aa)
Score = 263, Expect = 7.8e-22, Identities = 61/143 (42%), Positives = 80/143 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDY---AFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I + SDH G   K  V   L++  L+VID G    DP  DYPDY   A LL    QA+     I+  G+G G  M ANK KGI  A   + ++A L R H+DAN + +  R +  E  +KIV  FL+  FEGGRH  R+ K++ YE
  S:     3 IALGSDHAGFNYKEKVKNFLKESCLEVIDCGTFAPDPPVDYPDYVRPAALLVAQGQAD---RAIVFGGSGNGEAMVANKVKGIRCAYCFNEESARLGRLHNDANAISIGQRLIPEEMALKIVKIFLETPFEGGRHIPRIKKMMEYE 145
>gi|115377127|ref|ZP_01464341.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] >gi|115365836|gb|EAU64857.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] (108 aa)
Score = 263, Expect = 8.5e-22, Identities = 52/107 (48%), Positives = 69/107 (64%)
  Q:    46 DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           DYPD+A  +A+ + +   +LG+L+CGTG+G+ +AANK +G+ AAL      A +AR H+DANVLCL  R V       I+D FL   FEGGRH KRV KI   E E+
  S:     2 DYPDFALKVARAVASGEYALGVLVCGTGIGMSIAANKQRGVRAALCSTEFEARMARAHNDANVLCLGQRVVGAGVARSILDAFLATPFEGGRHEKRVQKIRDAEAER 108
>gi|62423980|ref|ZP_00379133.1| COG0698: Ribose 5-phosphate isomerase RpiB [Brevibacterium linens BL2] (157 aa)
Score = 262, Expect = 9.0e-22, Identities = 57/143 (39%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTM----QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           +++ +DH G E K ++  HL     +VID G  E D LDDYP +    AQ +     A   +LG++I G+G G  +AANK KG   AL  ++ TA LAR+H++A ++ + +R     E+I IVD FL   F G  RH +R+  +  YE
  S:     3 VHLGTDHAGFEFKEVLKAHLGDSGYEVIDHGALEYDALDDYPAFCIAAAQAVVDDQAAGVEALGVVIGGSGNGEQIAANKVKGARTALAWNTDTAKLAREHNNAQIVSVGARQHTEAESIAIVDAFLSEPFSGEERHERRIRIMDEYE 150
>gi|50954589|ref|YP_061877.1| ribose-5-phosphate isomerase B [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951071|gb|AAT88772.1| ribose 5-phosphate isomerase [Leifsonia xyli subsp. xyli str. CTCB07] (162 aa)
Score = 262, Expect = 9.5e-22, Identities = 58/143 (40%), Positives = 86/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTM----QANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE-GGRHSKRVGKIIAYE 149
           I+IA+DH GL+    +  HL Q   +VID GP E DP+DDYP +    A+ +    QA   +LG++  G+G G  +AANK  G  AALV +  TA LARQH+DANV+ + +R     E  + ++ F+   F    RH +R+ ++  +E
  S:     3 IHIATDHAGLDFSKHLQAHLAQAGHEVIDHGPAEYDPIDDYPAFCVNAAKGVVRDQQAGIEALGVVFGGSGNGEQIAANKVIGARAALVWNESTALLARQHNDANVISIGARQHTVAEATRFIELFIAEPFSLEERHLRRIAQLAEFE 150
>gi|149277682|ref|ZP_01883822.1| ribose-5-phosphate isomerase B [Pedobacter sp. BAL39] >gi|149231370|gb|EDM36749.1| ribose-5-phosphate isomerase B [Pedobacter sp. BAL39] (179 aa)
Score = 262, Expect = 9.8e-22, Identities = 61/143 (42%), Positives = 82/143 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           + + SDH G   K +  + L  +  +V+DLG    +   DYPD+A  +A  +Q      GIL+CG+ VGV +AANK KGI A +  D+ +A  A +HDD NVLCL  R V P    +IV  FL+A F    RH KR+ KI A E
  S:    34 VILGSDHAGYRYKQMFSELLTTEGYEVLDLGAFN-EEASDYPDHAEDVAVALQEGKGDRGILVCGSAVGVSIAANKFKGIRAGVCHDTYSAHQAVEHDDVNVLCLGERVVGPALAKEIVLSFLKASFTNETRHVKRLAKITAIE 176
>gi|145619443|ref|ZP_01775492.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Geobacter bemidjiensis Bem] >gi|144944180|gb|EDJ79256.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Geobacter bemidjiensis Bem] >gi|197088834|gb|ACH40105.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacter bemidjiensis Bem] (151 aa)
Score = 262, Expect = 1.2e-21, Identities = 55/145 (37%), Positives = 84/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + SDH GLELK+ +   L+Q+ +   DLG    D +D YPD+   +++ +       GIL+C TG+G+ + ANK  G+ AAL  D   A +A++H++AN+L L  R +  E   ++V  +L   F  GRH  R+ KI A ER+
  S:     2 IVLGSDHGGLELKNEIKNLLDQRGIPCEDLGTHNGDSVD-YPDFGVAVSRRVSEGSAEKGILVCSTGIGMSIVANKFPGVRAALATDVFMATMAKEHNNANILVLGGRVLKTELAREMVAAWLDTAFAAGRHQGRLDKIAAVERQ 145
>gi|167747414|ref|ZP_02419541.1| hypothetical protein ANACAC_02134 [Anaerostipes caccae DSM 14662] >gi|167652776|gb|EDR96905.1| hypothetical protein ANACAC_02134 [Anaerostipes caccae DSM 14662] (273 aa)
Score = 261, Expect = 1.2e-21, Identities = 61/142 (42%), Positives = 83/142 (58%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKI 145
           N  I I SDH G  LK  VIKHLE++   V D G    +  D YP YA  +A+ +  +    GILICGTG+G+ + ANK KGI AAL  D+ +A   R+H++AN+L L +R       + IVD FL+ +F    RH +R+  I
  S:   130 NEMIGIGSDHGGYALKQAVIKHLEEKGHAVKDYGCYSEESCD-YPVYAKAVAEGILKDEVKQGILICGTGIGISITANKIKGIRAALCGDTFSARATREHNNANILALGARVTGEGLALDIVDTFLETKFSNDERHIRRINMI 271
>gi|91202679|emb|CAJ72318.1| strongly similar to ribose 5-phosphate isomerase B, also acts on allose (allose 6-phosphate isomerase) [Candidatus Kuenenia stuttgartiensis] (169 aa)
Score = 261, Expect = 1.3e-21, Identities = 54/144 (37%), Positives = 82/144 (56%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
            I IASDH G + K  +   L++    V D G +      DYPD+    A ++       GILICGTG+G+ + ANK +G+ A L  +  T  ++R+H+DANVLC+ +  +  E   + V  +L+  FEGGRH++R+ KI+  E
  S:    21 KIAIASDHRGYDFKERIKVTLKELGHSVTDFGTSSKSESVDYPDFGMKAALSVGHGECDRGILICGTGIGMSLVANKVRGVRATLCHNLYTVEMSRRHNDANVLCIGADIIDEELLEQKVKLWLETPFEGGRHARRLEKIVELE 164
>gi|126701103|ref|YP_001090000.1| ribose-5-phosphate isomerase 2 [Clostridium difficile 630] >gi|145952634|ref|ZP_01801643.1| hypothetical protein CdifQ_04004010 [Clostridium difficile QCD-32g58] >gi|168697769|ref|ZP_02730046.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-37x79] >gi|168714960|ref|ZP_02747237.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-63q42] >gi|168726404|ref|ZP_02758681.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-76w55] >gi|168730150|ref|ZP_02762427.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-97b34] >gi|196124987|ref|ZP_03116736.1| ribose-5-phosphate isomerase 2 [Clostridium difficile ATCC 43255] >gi|196162313|ref|ZP_03122874.1| ribose-5-phosphate isomerase 2 [Clostridium difficile CIP 107932] >gi|115252540|emb|CAJ70383.1| ribose-5-phosphate isomerase 2 [Clostridium difficile 630] (150 aa)
Score = 261, Expect = 1.3e-21, Identities = 52/145 (35%), Positives = 83/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I +  DH G  LK  +I +LE + ++ +D G        DYP Y  ++A ++       GIL CGTG+G+ +AANK  GI  A+V D  +A +++ H+DAN+L L  R +     ++IV+ ++   FEG RH++RV  I + E +
  S:     3 IGLGCDHGGYNLKKEIISYLESKGIECVDYGTNNATDSVDYPVYGEIVANSVINKEVDYGILCCGTGIGISLAANKVPGIRCAVVSDVFSAKMSKAHNDANMLSLGERVLGKGLALEIVEAWINTDFEGDRHARRVNMIKSIEEK 147
>gi|119717705|ref|YP_924670.1| ribose-5-phosphate isomerase B [Nocardioides sp. JS614] >gi|119538366|gb|ABL82983.1| ribose 5-phosphate isomerase [Nocardioides sp. JS614] (162 aa)
Score = 261, Expect = 1.5e-21, Identities = 59/143 (41%), Positives = 84/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQA----NPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           +++  DH GL+LK  + + L     + +D GP   D LDDYP +    A  +        +SLG++I G+G G  MAANK  GI  ALV   +TA LARQH+DANV+ +  R    E+  + V+ FL   F G  RH +R+G++ AYE
  S:     3 VHLGCDHAGLDLKDHLSRWLTDHGYEPVDHGPFAYDALDDYPVFCLRAAAAVAEERAAGRDSLGVVIGGSGNGEQMAANKVHGIRCALVWSEETAVLARQHNDANVVSVGGRMHSLEDMTRFVEIFLAEPFSGEERHVRRIGQLAAYE 150
>gi|152967465|ref|YP_001363249.1| ribose-5-phosphate isomerase B [Kineococcus radiotolerans SRS30216] >gi|151361982|gb|ABS04985.1| ribose 5-phosphate isomerase [Kineococcus radiotolerans SRS30216] (162 aa)
Score = 260, Expect = 1.7e-21, Identities = 56/144 (38%), Positives = 79/144 (54%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYER 150
           +++ +DH G ELK  ++ HL +Q   V+D G    D  DDYP +    A  +  +P SLGI+I G+G G  +AAN   GI  AL     TA LAR+H+DA V+ + +R    EE   + D FL   F    RH +R+  + AY R
  S:     3 VHVGTDHAGFELKEHLVAHLREQGHDVVDHGAPVYDAADDYPPFVLRAAAGVAGDPGSLGIVIGGSGNGEQIAANVVPGIRCALAWSVDTARLAREHNDAQVVGIGARMHTLEEATLLADTFLATPFSNDPRHVRRIEMLDAYAR 147
>gi|111221302|ref|YP_712096.1| ribose-5-phosphate isomerase B [Frankia alni ACN14a] >gi|111148834|emb|CAJ60512.1| Ribose/galactose isomerase [Frankia alni ACN14a] (140 aa)
Score = 260, Expect = 1.9e-21, Identities = 56/117 (47%), Positives = 72/117 (61%)
  Q:    34 IDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYER 150
           +D GP E DP DDYP +    A+   A P+SLGI+I G+G G  +AANK  G+ AALV   +TA LARQH+DANVL L +R     E +   + FL   F G  RH +R+  + AYER
  S:     8 VDHGPVEYDPDDDYPPFVLAAARATAAEPDSLGIVIGGSGNGEAIAANKVVGVRAALVWSEQTATLARQHNDANVLSLGARMHTVSEALAFAEVFLTTPFSGEQRHVRRLRMLSAYER 125
>gi|167378300|ref|XP_001734751.1| ribose-5-phosphate isomerase B, putative [Entamoeba dispar SAW760] >gi|165903600|gb|EDR29074.1| ribose-5-phosphate isomerase B, putative [Entamoeba dispar SAW760] (146 aa)
Score = 259, Expect = 2.4e-21, Identities = 54/139 (38%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I SDH G  LK +V K+L ++ ++V D+G    +  D YPD+A  +A+ +       GIL+CG+G+G+ +AANK  GI  AL  D  TA + R+H+DAN++   +R +  +    +VD FL   F+G +H+ RV KI
  S:     3 VIIGSDHAGFPLKEIVKKYLIEKGIKVDDMGTYSTERCD-YPDFAEKVAREVLKTGKK-GILVCGSGIGISIAANKINGIRCALCHDHYTAVMCRRHNDANIIAFGARVIGSDIATDMVDAFLSTPFDGMQHTARVEKI 139
>gi|159897020|ref|YP_001543267.1| ribose-5-phosphate isomerase B [Herpetosiphon aurantiacus ATCC 23779] >gi|159890059|gb|ABX03139.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Herpetosiphon aurantiacus ATCC 23779] (149 aa)
Score = 258, Expect = 2.7e-21, Identities = 59/145 (40%), Positives = 85/145 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYERE 151
           I + +DH GL LK  VI+ +++   +V+D G T+     DYPD+A  +   + +     GI ICG+GVGV +AANK KG+ A L  D+ +A    +HDD NVLCL  R + P    +IV  FL A F    R ++R+ K+IA E +
  S:     5 IAVGTDHGGLILKQAVIEEVQRLGHEVLDFG-TDSPASVDYPDFAAAVGNAVVSGQAERGIAICGSGVGVTVAANKIKGVRACLCHDTYSAHQGVEHDDLNVLCLGGRVIGPALAGEIVQAFLSATFHNEARFTRRLDKVIALENQ 149
>gi|116748378|ref|YP_845065.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Syntrophobacter fumaroxidans MPOB] >gi|116697442|gb|ABK16630.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Syntrophobacter fumaroxidans MPOB] (161 aa)
Score = 258, Expect = 2.8e-21, Identities = 54/145 (37%), Positives = 81/145 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE-GGRHSKRVGKIIAYERE 151
           + IA+DH G ELK  +++ L      V+D G    DP DD+PDY   LA+ +       G+ +CG+GVG  +AANK  G  AAL+ D  +A    + DD N++CL  R V  E   +++  FL+A++    R  +R+ K+ A E E
  S:     3 VGIAADHGGFELKRQLVEELAATGHDVVDFGARRFDPADDFPDYVVPLARAVVERTVERGLAVCGSGVGASIAANKVPGARAALITDVYSARQGVEDDDMNMMCLGGRVVGVELAKELLRAFLKARYRPAERFERRLAKVAALEDE 148
>gi|15827780|ref|NP_302043.1| ribose-5-phosphate isomerase B [Mycobacterium leprae TN] >gi|81537014|sp|Q9CBY1|RPIB_MYCLE Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|13093332|emb|CAC30434.1| possible phosphopentose isomerase [Mycobacterium leprae] (162 aa)
Score = 258, Expect = 2.9e-21, Identities = 55/144 (38%), Positives = 82/144 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK  +I+HL+Q   Q ID G    D  D+YP +    A    A+P SLGI++ G+G G  +AANK  G   AL    +TA LAR+H++A ++ +  R     E + IVD F+   + E  RH +R+  +  +ER
  S:     6 VYLGADHAGYELKRQIIEHLKQSGHQPIDCGAFSYDVDDEYPAFCITAATRTVADPGSLGIVLGGSGNGEQIAANKVVGARCALAWSVETARLAREHNNAQLIGIGGRMHTVAEALTIVDAFVTTPWSEAQRHQRRIDILAEFER 150
>gi|67471315|ref|XP_651609.1| ribose 5-phosphate isomerase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56468369|gb|EAL46223.1| ribose 5-phosphate isomerase, putative [Entamoeba histolytica HM-1:IMSS] (146 aa)
Score = 258, Expect = 3.1e-21, Identities = 53/139 (38%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + I SDH G  LK +V K+L ++ ++V D+G    +  D YPD+A  +A+ +       GIL+CG+G+G+ +AANK  G+  AL  D  TA + R+H+DAN++   +R +  +    +VD FL   F+G +H+ RV KI
  S:     3 VIIGSDHAGFPLKEIVKKYLIEKGIKVNDMGTYSTERCD-YPDFAEKVAREV-VKTGKKGILVCGSGIGISIAANKINGVRCALCHDHYTAVMCRRHNDANIIAFGARVIGSDIATDMVDVFLSTPFDGMQHTARVEKI 139
>gi|191164243|ref|ZP_03026111.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacter sp. M21] >gi|190994714|gb|EDV70174.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacter sp. M21] (151 aa)
Score = 257, Expect = 3.8e-21, Identities = 55/143 (38%), Positives = 83/143 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I + SDH GLELK+ +   L+++ +   DLG    D +D YPD+   +A+ +       GIL+CGTG+G+ + ANK  G+ AAL  D   A +A++H++AN+L L  R +  E   ++V  +L   F  GRH  R+ KI A E
  S:     2 ILLGSDHGGLELKNEIKNLLDERGIPCEDLGTHNGDSVD-YPDFGERVARRVSEGSAEKGILVCGTGIGMSIVANKFPGVRAALATDVFMATMAKEHNNANILVLGGRVLKTELAREMVAAWLDTAFAAGRHQGRLDKIAAVE 143
>gi|154483812|ref|ZP_02026260.1| hypothetical protein EUBVEN_01516 [Eubacterium ventriosum ATCC 27560] >gi|149735303|gb|EDM51189.1| hypothetical protein EUBVEN_01516 [Eubacterium ventriosum ATCC 27560] (150 aa)
Score = 256, Expect = 5.0e-21, Identities = 49/136 (36%), Positives = 82/136 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I +DH  +E+K+ +  +LE++  +V+D G    +  + YP Y   +A  +       G+LICGTGVG+ ++ANK  GI A +  +  +A L++QH++ N++   +R +  E    IVDE+L A++EGGRH  R+
  S:     3 IGIGNDHVAVEMKNEIKAYLEEKGHEVVDFGTNSSERCN-YPVYGEAVANAIVNGEVDCGVLICGTGVGISLSANKVNGIRACVCSEPYSARLSKQHNNTNIIAFGARVIGIELAKMIVDEWLNAEYEGGRHQVRI 137
>gi|183221739|ref|YP_001839735.1| ribose-5-phosphate isomerase B (phosphoriboisomerase B) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911814|ref|YP_001963369.1| Ribose-5-phosphate isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776490|gb|ABZ94791.1| Ribose-5-phosphate isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167780161|gb|ABZ98459.1| Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (145 aa)
Score = 255, Expect = 6.2e-21, Identities = 56/143 (39%), Positives = 85/143 (59%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   I IA+DH G  LK  + K LE+   +++D G    + +D YP       + + +N     I +CGTG+G  +AAN+ KGI AAL  D  TA ++R+H++ANVL L  R +  +  ++IV ++++  FEGGRH KR+G I
  S:     1 MKEKIGIATDHGGFALKEFLRKSLEET-YEMVDYGTKSEESVD-YPTIIGDACRKVLSNEVPRLIALCGTGIGASIAANRMKGIRAALCHDEFTAEMSRRHNNANVLVLGGRVLGTDLALRIVKKWIETDFEGGRHQKRLGLI 141
>gi|110004112|emb|CAK98451.1| hypothetical laca/rpib family transmembrane protein [Spiroplasma citri] (143 aa)
Score = 255, Expect = 7.3e-21, Identities = 62/140 (44%), Positives = 94/140 (67%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I I +DHTG+++K  ++KHL +QK ++I+LG   ++ + DY D    + + +    NS+GI+ICGTG+G+ +AANK KGI AAL  ++  A LAR+H++ANVL L +R +  +  I IVD FL   F+ GRH+ RV K+
  S:     2 KIVIGNDHTGIDMKKAIVKHLIEQKHEIINLGTDSIEAV-DYSDIGQAVGERVIKEKNSVGIIICGTGIGISIAANKVKGIRAALCNETVLAKLAREHNNANVLALGARVIANQNAIWIVDMFLNTTFDSGRHALRVEKL 140
>gi|149173848|ref|ZP_01852477.1| ribose 5-phosphate isomerase B [Planctomyces maris DSM 8797] >gi|148847378|gb|EDL61712.1| ribose 5-phosphate isomerase B [Planctomyces maris DSM 8797] (153 aa)
Score = 254, Expect = 8.4e-21, Identities = 50/139 (35%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH G   K  +I++L ++  QV D+G    + +D YPD+    A+ +     + GI++ G+G G  +AAN+ KG+  A+  + K+A LA  H++AN++ +  R V   +  +I+D +L   FEGGRH++R+ K+
  S:    14 IVIASDHAGYRYKRRIIEYLTKEGYQVEDMGTDSTESVD-YPDFIMPAARAVAEGKYTRGIVLGGSGNGEAIAANRIKGVRCAVCWNEKSARLASMHNNANMISIGERMVSLHDVYEIIDIWLSTPFEGGRHARRIEKL 151
>gi|110599123|ref|ZP_01387364.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Geobacter sp. FRC-32] >gi|110550118|gb|EAT63303.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Geobacter sp. FRC-32] (148 aa)
Score = 254, Expect = 8.6e-21, Identities = 56/145 (38%), Positives = 85/145 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + SDH GL LK  + K L ++ +   D G    D +D YPD+   +A+ +       GIL+CGTG+G+ + ANK   + AA+V DS  A +A++H++AN+L L  R +  +   ++V  +L A FEGGRH  R+ KI   E+E
  S:     2 IALGSDHGGLALKVEIKKLLLERGIPFEDCGTDNGDSVD-YPDFGEKVARKVSKGEVEKGILVCGTGIGMSIVANKFPHVRAAIVTDSFMARMAKEHNNANILVLGGRVLDNDGAREMVSTWLDAAFEGGRHQGRLDKIALIEKE 145
>gi|148261115|ref|YP_001235242.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Acidiphilium cryptum JF-5] >gi|146402796|gb|ABQ31323.1| ribose-5-phosphate isomerase [Acidiphilium cryptum JF-5] (150 aa)
Score = 254, Expect = 8.7e-21, Identities = 50/145 (34%), Positives = 80/145 (55%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M  N  + + +DH G ELK  + +        VID G      +D YPD A  ++  ++A     G+L+CG+G+G+ +AAN+  G+  A   D+  A L+R H++AN+L L +R       +  ++ FL  +FEGGRH KR+ K+
  S:     1 MSENMTLVVGADHAGFELKDRLAEAARAAGWAVIDCGTNSAASVD-YPDIAHEVSMRIEAGSARFGLLVCGSGIGMAIAANRHTGVRCAQAHDATEARLSRMHNNANILALGARLTGEMVALDALNAFLTTEFEGGRHEKRLAKL 144
>gi|196164019|ref|ZP_03124550.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-23m63] (150 aa)
Score = 254, Expect = 9.5e-21, Identities = 51/145 (35%), Positives = 83/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I +  DH G  LK  +I +LE + ++ +D G        DYP Y  ++A ++       GIL CGTG+G+ +AANK  GI  A+V D  +A +++ H++AN+L L  R +     ++IV+ ++   FEG RH++RV  I + E +
  S:     3 IGLGCDHGGYNLKKEIISYLEGKGIECVDYGTNNATDSVDYPVYGEVVANSVINKDVDYGILCCGTGIGISLAANKVPGIRCAVVSDVFSAKMSKAHNNANMLSLGERVLGKGLALEIVEAWINTDFEGDRHARRVNMIKSIEEK 147
>gi|39996706|ref|NP_952657.1| ribose 5-phosphate isomerase B, putative [Geobacter sulfurreducens PCA] >gi|39983587|gb|AAR34980.1| ribose 5-phosphate isomerase B, putative [Geobacter sulfurreducens PCA] (148 aa)
Score = 254, Expect = 9.8e-21, Identities = 55/145 (37%), Positives = 83/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I + SDH GLELK  V + L ++     D G    + +D YPD+   +A+ +       GIL+CGTG+G+ + ANK   + AAL  D+  A +A++H++AN+L L  R +      ++V  +L   +EGGRH  R+ KI A ERE
  S:     2 IVVGSDHGGLELKEAVKRLLAERGETFEDCGTDNGNSVD-YPDFGIKVARRVSNGEAGKGILLCGTGIGMSIVANKFPRVRAALATDAFMARMAKEHNNANILVLGGRVLEEAVAREMVIAWLDGVYEGGRHQGRLDKIAALERE 145
>gi|169826586|ref|YP_001696744.1| putative sugar phosphate isomerase ywlF [Lysinibacillus sphaericus C3-41] >gi|168991074|gb|ACA38614.1| Putative sugar phosphate isomerase ywlF [Lysinibacillus sphaericus C3-41] (127 aa)
Score = 253, Expect = 1.1e-20, Identities = 52/125 (41%), Positives = 76/125 (60%)
  Q:    26 LEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           L++  +   D GP   D +D YPDYA  ++  +       GILICGTG+G+ +AANK KGI  ALV D  +A   R H+D+N+L +  R + P    +IV  +L+ +FEGGRH++R+ KI   E+
  S:     4 LDELHISYEDFGPQSADSVD-YPDYAKPVSDGVANGEFDKGILICGTGIGMSIAANKVKGIRCALVHDVFSAKATRCHNDSNILAMGERVIGPGLAREIVQTWLETEFEGGRHTRRIEKITELEQ 127
>gi|167649028|ref|YP_001686691.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caulobacter sp. K31] >gi|167351458|gb|ABZ74193.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caulobacter sp. K31] (148 aa)
Score = 253, Expect = 1.2e-20, Identities = 56/139 (40%), Positives = 79/139 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH  +ELK+ + + L  +   V DLG      +D YPDY + LA  + A     GI +CG+G+G+ +A N+      ALV D  +A L R H+DANV+ L +R V  +     V +FL+ +F GGRH  RV K+
  S:     3 IAIASDHAAIELKAELAEWLTGEGHDVADLGSDGAARVD-YPDYGYELAAYIAAGWAERGIALCGSGIGISIAVNRNPACRCALVNDPVSATLGRAHNDANVIALGARLVGLDVAKACVAKFLETEFAGGRHGPRVEKL 140
>gi|163793210|ref|ZP_02187186.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [alpha proteobacterium BAL199] >gi|159181856|gb|EDP66368.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [alpha proteobacterium BAL199] (153 aa)
Score = 253, Expect = 1.3e-20, Identities = 54/139 (38%), Positives = 79/139 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I +ASDH GL LK+ +I  L++    V+DLG T      DYPDY + +A  +       G+ ICG+G+G+C+AAN+   + A    D  +A L+R+H+DANV+    R +  E   + +  FLQ  F G RH  RV K+
  S:     6 IALASDHAGLALKTTLIDELKRLGHVVVDLG-THSGASVDYPDYGYRIAAALADGKADRGVAICGSGIGICIAANRFAWVRAVNCHDVTSARLSREHNDANVIAFGERVIGVEVAKEALRVFLQTPFAGDRHVARVNKL 143
>gi|160881863|ref|YP_001560831.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium phytofermentans ISDg] >gi|160430529|gb|ABX44092.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium phytofermentans ISDg] (142 aa)
Score = 253, Expect = 1.3e-20, Identities = 56/136 (41%), Positives = 79/136 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRV 142
           I +  DH G +L   VI +LE++K+   + G T+     DYP +   +A  +       GILICGTG+G+ MAANK  G+ AAL  D  +A   RQH++ANVLC+  R V P   +KIV+ FL  +F    RH +R+
  S:     2 IALGCDHGGYDLMQEVIAYLEEKKVPYKNFG-TDSKASCDYPVFGKNVAMAVANKECEFGILICGTGIGISMAANKVAGVRAALCHDCFSAEATRQHNNANVLCMGGRVVGPGLALKIVEIFLNTEFSNDDRHIRRI 137
>gi|154340579|ref|XP_001566246.1| ribose 5-phosphate isomerase, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134063565|emb|CAM39747.1| ribose 5-phosphate isomerase, putative [Leishmania braziliensis] (156 aa)
Score = 252, Expect = 1.4e-20, Identities = 58/150 (38%), Positives = 86/150 (57%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKL--QVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQ-FEGGRHSKRVGKIIAYEREK 152
           M+  + +  DH   ++   ++  +    +  +VI +GP+    +D YPDYA  + + +       GIL+CGTG+G+ +AANK  GI AAL  D  TA L RQH++ANVLCL +R    E    I+  FL A+  + GRH  R+ KI   ERE+
  S:     1 MSKRVALGCDHAAYDIHQEIMDMITTTGVVSKVIYMGPSSASSVD-YPDYAAQVCEAILKGEADTGILVCGTGIGMSIAANKFSGIRAALCNDHVTAQLCRQHNNANVLCLGARTCGREILRDIIITFLTAEPSKEGRHGSRIAKITEIEREQ 152
>gi|37521257|ref|NP_924634.1| ribose 5-phosphate epimerase [Gloeobacter violaceus PCC 7421] >gi|35212253|dbj|BAC89629.1| ribose 5-phosphate epimerase [Gloeobacter violaceus PCC 7421] (154 aa)
Score = 252, Expect = 1.5e-20, Identities = 55/146 (37%), Positives = 84/146 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           + I SDH   ELK  +   L + +    D+G    +  D YP  A  +A+ +Q      GIL+CGTG+G+ +AANK  GI AAL  D  TA ++R+H+DANVL +  R + PE    +++ +L  +F G RH +R+ +I ++E  K
  S:     3 LVIGSDHGAYELKEELKTWLGEHEYAFEDVGTYNGERCD-YPLVAQSVAEKIQRGEADRGILLCGTGIGISIAANKFDGIRAALAHDHYTARMSREHNDANVLAMGGRVLGPEVAKDVLETWLSTEFGGERHQRRLDQIQSFEAPK 147
>gi|47459205|ref|YP_016067.1| ribose-5-phosphate isomerase B [Mycoplasma mobile 163K] >gi|47458534|gb|AAT27856.1| ribose 5-phosphate isomerase [Mycoplasma mobile 163K] (148 aa)
Score = 252, Expect = 1.5e-20, Identities = 51/134 (38%), Positives = 76/134 (56%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           +ASDH G +LK  + K+L ++ L   DLG         Y ++   L + +  NPN  GI ICGTG+G+  A N+ K +  A +   + A LA+QH++ANVL    R    E+  K++DEF+  +FE GRH  R+
  S:     8 LASDHAGYKLKEEIKKYLIEKGLPYTDLGTNSETESVSYSEFGKKLGKYVHENPNDYGIGICGTGLGMSYAVNRFKNVRGARIHSVEDAHLAKQHNNANVLIFGGRQQKIEDIKKMIDEFINTEFEKGRHLDRI 141
>gi|148554052|ref|YP_001261634.1| ribose-5-phosphate isomerase [Sphingomonas wittichii RW1] >gi|148499242|gb|ABQ67496.1| ribose-5-phosphate isomerase [Sphingomonas wittichii RW1] (152 aa)
Score = 251, Expect = 2.0e-20, Identities = 53/143 (37%), Positives = 83/143 (58%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   I IASDH   ++K+ + + L  +  +V+DLGP     +D YPDY + LA+ + A   + GI +CG+G+G+ ++ N+      ALV +  +A L R+H+DANV+ L +R +  E+    V  FL   F G RH +RV K+
  S:     1 MAETIAIASDHAAFDMKAALTEWLRAEGHEVLDLGPDSAASVD-YPDYGYRLAEAIAAGEAARGIALCGSGIGISISVNRHPAARCALVNEVLSARLCREHNDANVIALGARLIGIEQAKACVSAFLSTGFAGDRHQRRVDKL 142
>gi|85708545|ref|ZP_01039611.1| ribose 5-phosphate isomerase [Erythrobacter sp. NAP1] >gi|85690079|gb|EAQ30082.1| ribose 5-phosphate isomerase [Erythrobacter sp. NAP1] (159 aa)
Score = 251, Expect = 2.1e-20, Identities = 55/139 (39%), Positives = 85/139 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF--EG---GRHSKRVGKI 145
           I IASDH   +LK+ + + L  +  +V DLGP E + +D YPDY + LA+ +       GI +CG+G+G+ ++ N+   +  ALV +  +AALAR+H++AN + L +R +  E     V  FL  +F  EG   GRH +RV K+
  S:     3 IAIASDHAATDLKASLAEWLMDEGHEVADLGPEEGESVD-YPDYGYKLAEVVADGTAQFGIALCGSGIGISISVNRHPALRCALVSEPLSAALAREHNNANCIALGARLIGIEMAKSCVATFLNTEFADEGDPAGRHQRRVAKL 145
>gi|182420264|ref|ZP_02951493.1| ribose 5-phosphate isomerase B [Clostridium butyricum 5521] >gi|182375859|gb|EDT73451.1| ribose 5-phosphate isomerase B [Clostridium butyricum 5521] (149 aa)
Score = 249, Expect = 2.9e-20, Identities = 66/145 (45%), Positives = 90/145 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I +  DH G ELK+ +IK+LE +K ++ D G    D   DYPD A  +A+ + A     GILICGTG+G+ +AANK  GI AAL  D+ +A   RQH++AN+L +  R V     + IV  FL ++FEG RHSKR+ KI A E +
  S:     3 IAVGCDHGGFELKNEIIKYLESEKYEIKDFGTYSTDSC-DYPDIAQPVAEAVAAKEFDFGILICGTGIGIGIAANKVPGIRAALCSDTFSAHATRQHNNANILTMGQRVVGTGLALDIVKTFLSSEFEGDRHSKRINKITAIEEK 146
>gi|167842058|ref|ZP_02468742.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Burkholderia thailandensis MSMB43] (162 aa)
Score = 249, Expect = 3.1e-20, Identities = 54/149 (36%), Positives = 85/149 (57%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           M+    + I  D    ELK ++ +HL +  + V D G  E +P+  YP+ AF +A+ + A      +L+CGTG+G+ +AANK + I AA   D+ +A  A + +DA ++ + +R V PE    IVD++L A F+GGR   +V  I  YE
  S:     1 MRQAMKLAIGCDEAAFELKEIIKQHLLKLGVDVTDFGTYEAEPVH-YPNIAFAVAEKVAAGEYERAVLLCGTGIGMAIAANKVRSIRAAQCHDTYSADRASKSNDAQIITIGARVVGPELAKAIVDKWLGAHFDGGRSIPKVNLIREYE 148
>gi|28572526|ref|NP_789306.1| ribose-5-phosphate isomerase B [Tropheryma whipplei TW08/27] >gi|28410658|emb|CAD67044.1| ribose 5-phosphate isomerase B [Tropheryma whipplei TW08/27] (155 aa)
Score = 249, Expect = 3.5e-20, Identities = 56/147 (38%), Positives = 85/147 (57%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPN----SLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYE 149
           M+  +++A+DH G E    ++  L  +  QV+  G    DP DDYP +    A+ +  +      SLG++I G+G G  +AANK KG  AAL  +  TA LAR H++ANV+ + +R    +E  +IV  FL+  F E  RH +R+  I +YE
  S:     1 MSGRVHLATDHAGYEFSKGLLNFLADEHYQVVHHGAVNCDPEDDYPSFCIAAAEAVVRDITDGIPSLGVVIGGSGNGEQIAANKVKGARAALAWNECTARLARAHNNANVVAIGARMHAHDEGFRIVLAFLREPFSEDSRHIRRIDAISSYE 152
>gi|91200385|emb|CAJ73431.1| fusion protein similar to hydrolase/phosphatase (n-terminal) and ribose-5-phosphate isomerase (C-terminal) [Candidatus Kuenenia stuttgartiensis] (376 aa)
Score = 248, Expect = 3.8e-20, Identities = 52/146 (35%), Positives = 84/146 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYEREK 152
           I +ASDH G +LK  ++  L+    +V D G  +L+  DDYPD+   +++ +     S G+ ICG+GVG C+AANK  G+ +AL+ DS +A    + D+ N++CL  R        ++V  F+ A+F+   R  +R+ K+   ER K
  S:   229 IGVASDHGGFDLKVKLVALLKTAGYEVKDFGAYQLNTDDDYPDFVIPMSEAVANGEISRGVAICGSGVGACIAANKIAGVRSALITDSFSARQGVEDDNMNIMCLGGRITGSALAGELVQIFINARFKNEERFLRRLNKVSVLERNK 375
>gi|192809069|ref|ZP_03037744.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus sp. Y412MC10] >gi|192801740|gb|EDV78245.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus sp. Y412MC10] (154 aa)
Score = 248, Expect = 4.2e-20, Identities = 58/143 (40%), Positives = 82/143 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYE 149
           I + +DH G+ LK  +++ +     +V DLG    D +D YPDYA  + + + +     GILICGTG+G+ +AANK  GI  AL  D  +A   R+H+D+NV+ L  R V P    +IV  +L   F +G RH  RV KI A E
  S:     3 IALGTDHAGIRLKEEIVEVIRGLGHEVEDLGCGCSDSVD-YPDYALPVCEKVVSGEADRGILICGTGIGMSIAANKVPGIRCALTHDVFSAKATREHNDSNVIALGERVVGPGLAAEIVSAWLTTDFSQGERHVGRVNKIKAIE 145
>gi|94969836|ref|YP_591884.1| ribose-5-phosphate isomerase B [Acidobacteria bacterium Ellin345] >gi|94551886|gb|ABF41810.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Acidobacteria bacterium Ellin345] (149 aa)
Score = 248, Expect = 4.3e-20, Identities = 55/146 (37%), Positives = 82/146 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYEREK 152
           + +++DH G+ +  +VI  L +   +V+DLG  + +  DDYPD A  +   +       GILICG+GVG  +AANK KGI A L  D  +A    +HD+ NVLCL  R +  E  + +V  F+ A+F    RH +R+ KI   E  +
  S:     3 VAVSADHAGVPMNEVVIAELRKLGHEVLDLGTHDPNSGDDYPDRAADITAAVLNQGCERGILICGSGVGASVAANKIKGIRAGLCHDHYSAHQGVEHDNMNVLCLGGRVIGTETALDLVRAFVSAKFTNEERHLRRLHKIAVMEGSR 149
>gi|26553520|ref|NP_757454.1| ribose 5-phosphate and galactose-6-phosphate isomerase [Mycoplasma penetrans HF-2] >gi|26453526|dbj|BAC43858.1| ribose 5-phosphate and galactose-6-phosphate isomerase [Mycoplasma penetrans HF-2] (158 aa)
Score = 248, Expect = 4.8e-20, Identities = 63/144 (43%), Positives = 89/144 (61%)
  Q:     6 PIYIASDHTGLELKSLVIKHLE-QQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
            +YI SDH G ++K  +  + E  + L  +DLG    D   DYPDYA  + + +  +  S GI ICGTG+G+C+A NK KGI AA V  +  A LAR+H++ NV+ LS RF   E+N++I+ +F  + FE GRH KR+ KI   E
  S:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
>gi|157093011|gb|ABV22160.1| ribose/galactose isomerase [Perkinsus chesapeaki] (176 aa)
Score = 247, Expect = 5.4e-20, Identities = 55/151 (36%), Positives = 91/151 (60%)
  Q:     1 MQMNHPIYIASDHTGLELKS----LVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPN----SLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           +Q    +   SDH G++LK+     V   L+  +  + D+G    D +D YPD+A    +T+ +  +    +LG++ICG+G+G+ M+ANK KGI  AL   +  A  +R H++ANVL +  R    E   +I+  ++   FEGGRH KR+ K++A E++
  S:    18 LQNGLKLVFGSDHAGIDLKNEMIDFVKNTLKAPEGSITDVGTYTHDSVD-YPDFAEKTCKTLLSTSDDTSKALGVVICGSGLGISMSANKCKGIRCALCSSNYDARYSRLHNNANVLAMGGRTTGVEVAREILATYINTDFEGGRHQKRIDKMMALEQK 175
>gi|103486284|ref|YP_615845.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Sphingopyxis alaskensis RB2256] >gi|98976361|gb|ABF52512.1| ribose-5-phosphate isomerase [Sphingopyxis alaskensis RB2256] (150 aa)
Score = 246, Expect = 6.9e-20, Identities = 50/139 (35%), Positives = 79/139 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IA+DH   ELK+L+   L ++  +V DLG    D +D YPDY + L   +       G+ +CG+G+G+ ++ N+      ALV +  +A LAR+H+DANV+ + +R    +     +D FL   F G RH++RV K+
  S:     3 IAIAADHAAYELKALLADWLREKGHEVEDLGTNGPDSVD-YPDYGYRLGGAIADGRADRGVALCGSGIGISISVNRNPAARCALVSEPLSAKLAREHNDANVIAMGARLTGIDMAKACLDAFLTTDFAGDRHARRVDKL 140
>gi|160894644|ref|ZP_02075419.1| hypothetical protein CLOL250_02195 [Clostridium sp. L2-50] >gi|156863578|gb|EDO57009.1| hypothetical protein CLOL250_02195 [Clostridium sp. L2-50] (170 aa)
Score = 246, Expect = 7.2e-20, Identities = 56/136 (41%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRV 142
           I +  DH G  L   VIKHLE++ L+  + G    + +D YP YA  +A  +       GILICGTG+G+ + ANK  GI AAL  D  +A   R+H+DAN+L + +R   P   +KIVD FL   F    RH +R+
  S:    30 IALGCDHGGYGLMQDVIKHLEERGLEYKNYGCYSEESVD-YPVYAKKVAHAVADGECERGILICGTGIGISITANKVPGIRAALCGDCFSAQATREHNDANILAMGARVTGPGLALKIVDTFLDTPFSNDERHIRRI 165
>gi|189485316|ref|YP_001956257.1| ribose-5-phosphate isomerase B [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287275|dbj|BAG13796.1| ribose-5-phosphate isomerase B [uncultured Termite group 1 bacterium phylotype Rs-D17] (149 aa)
Score = 246, Expect = 7.3e-20, Identities = 56/144 (38%), Positives = 84/144 (58%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
             +DH   E+++ V ++ +    ++ D G    D   DYPDYA  +A+ + +     GILICGTG+G+ +AANK KGI+AA+  +  TA LA +H+ ANVLCL SR     E  + +  FL   FE  RH +R+ KI   E+++
  S:     5 FGTDHAAAEVRNKVKEYFQSAGYEIEDFGFCG-DGSCDYPDYAVKVAEAVISKKADRGILICGTGIGMSIAANKMKGIIAAVCWNEDTAKLAVRHNGANVLCLGSRTATLSELCQRIKIFLGTPFE-ERHLQRIRKIEEIEKQQ 146
>gi|28493364|ref|NP_787525.1| ribose-5-phosphate isomerase B [Tropheryma whipplei str. Twist] >gi|28476405|gb|AAO44494.1| ribose 5-phosphate isomerase B [Tropheryma whipplei str. Twist] (155 aa)
Score = 246, Expect = 7.8e-20, Identities = 56/147 (38%), Positives = 84/147 (57%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPN----SLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYE 149
           M+  +++A+DH G E    ++  L  +  QV+  G    DP DDYP +    A+ +  +      SLG++I G+G G  +AANK KG  AAL  +  TA LAR H++ANV+ + +R    +E  +IV  FL+  F E  RH +R+  I  YE
  S:     1 MSGRVHLATDHAGYEFSKGLLNFLADEHYQVVHHGAVNCDPEDDYPSFCIAAAEAVVRDITDGIPSLGVVIGGSGNGEQIAANKVKGARAALAWNECTARLARAHNNANVVAIGARMHAHDEGFRIVLAFLREPFSEDSRHIRRIDAISLYE 152
>gi|167218462|ref|ZP_02288098.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J1-175] (112 aa)
Score = 245, Expect = 8.9e-20, Identities = 48/104 (46%), Positives = 67/104 (64%)
  Q:    46 DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           DYP  A  +++ +       GIL+CGTG+G+ +AANK KGI  ALV D+ +A   R+H+D NVL L +R + P     IV  +L+  +EGGRH+ RVG+I AYE
  S:     2 DYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYE 105
>gi|53716279|ref|YP_106366.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 23344] >gi|53721288|ref|YP_110273.1| ribose 5-phosphate isomerase [Burkholderia pseudomallei K96243] >gi|76818470|ref|YP_336948.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1710b] >gi|121598130|ref|YP_990413.1| ribose 5-phosphate isomerase [Burkholderia mallei SAVP1] >gi|124382139|ref|YP_001024907.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10229] >gi|126442535|ref|YP_001061460.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 668] >gi|126446178|ref|YP_001079249.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10247] >gi|126458171|ref|YP_001074402.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1106a] >gi|134280673|ref|ZP_01767383.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 305] >gi|161360228|ref|ZP_02106092.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1106b] >gi|167002059|ref|ZP_02267849.1| ribose 5-phosphate isomerase B [Burkholderia mallei PRL-20] >gi|167722246|ref|ZP_02405482.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei DM98] >gi|167741244|ref|ZP_02414018.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 14] >gi|167818421|ref|ZP_02450101.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 91] >gi|167826807|ref|ZP_02458278.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 9] >gi|167896873|ref|ZP_02484275.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 7894] >gi|167905259|ref|ZP_02492464.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei NCTC 13177] >gi|167913562|ref|ZP_02500653.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 112] >gi|167921501|ref|ZP_02508592.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei BCC215] >gi|194315271|ref|YP_002011493.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 10399] >gi|194503177|ref|YP_002032753.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1655] >gi|194509555|ref|YP_002022086.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei Pasteur 52237] >gi|194517295|ref|YP_002053005.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei S13] >gi|194521580|ref|YP_002057115.1| ribose 5-phosphate isomerase [Burkholderia mallei FMH] >gi|194530806|ref|YP_002066326.1| ribose 5-phosphate isomerase [Burkholderia mallei JHU] >gi|194568844|ref|YP_002103848.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 406e] >gi|194577327|ref|YP_002112207.1| ribose 5-phosphate isomerase [Burkholderia mallei 2002721280] >gi|52211702|emb|CAH37700.1| putative ribose 5-phosphate isomerase [Burkholderia pseudomallei K96243] >gi|52422249|gb|AAU45819.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 23344] >gi|76582943|gb|ABA52417.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1710b] >gi|121225928|gb|ABM49459.1| ribose 5-phosphate isomerase [Burkholderia mallei SAVP1] >gi|124290159|gb|ABM99428.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10229] >gi|126222026|gb|ABN85531.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 668] >gi|126231939|gb|ABN95352.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1106a] >gi|126239032|gb|ABO02144.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10247] >gi|134247695|gb|EBA47779.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 305] >gi|147745590|gb|EDK52669.1| ribose 5-phosphate isomerase [Burkholderia mallei FMH] >gi|147754816|gb|EDK61880.1| ribose 5-phosphate isomerase [Burkholderia mallei JHU] >gi|148025024|gb|EDK83193.1| ribose 5-phosphate isomerase [Burkholderia mallei 2002721280] >gi|157809315|gb|EDO86485.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 406e] >gi|157937123|gb|EDO92793.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei Pasteur 52237] >gi|160696987|gb|EDP86957.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 10399] >gi|169652095|gb|EDS84788.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei S13] >gi|184213245|gb|EDU10288.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1655] (164 aa)
Score = 245, Expect = 9.3e-20, Identities = 54/145 (37%), Positives = 82/145 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLE--QQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + I  D     LK  + +HL     +L+++D G    D    YPD A  +AQ + A      IL+CGTG+GV ++ANK  GI AA   D+ +A  AR+ +DA ++ + +R +  E    IVD +L+A+F+GGR   +V +I  YER 
  S:     3 VAIGCDEAAYALKESIKRHLRATHPELELVDFGTHSADEAVLYPDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDAQIVTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYERR 149
>gi|67642816|ref|ZP_00441568.1| COG0698: Ribose 5-phosphate isomerase RpiB [Burkholderia mallei GB8 horse 4] >gi|161374197|ref|ZP_02113746.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1710a] >gi|167848322|ref|ZP_02473830.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei B7210] (162 aa)
Score = 244, Expect = 1.2e-19, Identities = 54/142 (38%), Positives = 81/142 (57%)
  Q:     9 IASDHTGLELKSLVIKHLE--QQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I  D     LK  + +HL     +L+++D G    D    YPD A  +AQ + A      IL+CGTG+GV ++ANK  GI AA   D+ +A  AR+ +DA ++ + +R +  E    IVD +L+A+F+GGR   +V +I  YER
  S:     3 IGCDEAAYALKESIKRHLRATHPELELVDFGTHSADEAVLYPDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDAQIVTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYER 146
>gi|189182951|ref|YP_001936736.1| ribose-5-phosphate isomerase [Orientia tsutsugamushi str. Ikeda] >gi|189179722|dbj|BAG39502.1| ribose-5-phosphate isomerase [Orientia tsutsugamushi str. Ikeda] (149 aa)
Score = 244, Expect = 1.2e-19, Identities = 56/145 (38%), Positives = 85/145 (58%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQK----LQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M  ++ I IASD    ELK+ + +HL +Q+      V+DLG      +D YPD A LL  T+  N    GILIC TG+G+ +AAN+   I AAL  +   A  +R H++AN+L + ++       I ++ +F+  +FEGGRH  R+ K+
  S:     1 MVSSNIIAIASDQKEYELKTKICQHLSEQERFISFSVLDLGGNNNQQVD-YPDIANLLCDTIINNRAKYGILICTTGIGMSIAANRHSDIRAALCFNEYMAEQSRLHNNANILIIGAKVSNFRSVINMISKFITTKFEGGRHLTRLEKL 148
>gi|167564901|ref|ZP_02357817.1| ribose 5-phosphate isomerase B [Burkholderia oklahomensis EO147] >gi|167572103|ref|ZP_02364977.1| ribose 5-phosphate isomerase B [Burkholderia oklahomensis C6786] (164 aa)
Score = 244, Expect = 1.4e-19, Identities = 54/145 (37%), Positives = 82/145 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLE--QQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + I  D     LK  + +HL     +++++D G    D    YPD A  +AQ + A      IL+CGTG+GV ++ANK  GI AA   D+ +A  AR+ +DA +L + +R +  E    IVD +L+A+F+GGR   +V +I  YER 
  S:     3 VAIGCDEAAYALKESIKRHLRATHPEVELLDFGTHSADEAVLYPDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDAQILTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYERR 149
>gi|115522599|ref|YP_779510.1| ribose 5-phosphate isomerase B [Rhodopseudomonas palustris BisA53] >gi|115516546|gb|ABJ04530.1| ribose-5-phosphate isomerase [Rhodopseudomonas palustris BisA53] (120 aa)
Score = 244, Expect = 1.4e-19, Identities = 47/105 (44%), Positives = 66/105 (62%)
  Q:    46 DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           DYP YA  + Q + +N  S G L CG+GVG+ +AANK  G+   +  +  +A +AR+H++AN+L L  R V  E  + IVD FL A+FE GRH +R+  I A ER
  S:    12 DYPTYASRVGQAVASNEGSFGFLFCGSGVGISIAANKVPGVRCVVCSEPYSALMARRHNNANILALGQRVVGVELALLIVDTFLNAEFEEGRHQRRLAMISAIER 116
>gi|92112886|ref|YP_572814.1| ribose-5-phosphate isomerase B [Chromohalobacter salexigens DSM 3043] >gi|91795976|gb|ABE58115.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Chromohalobacter salexigens DSM 3043] (148 aa)
Score = 244, Expect = 1.4e-19, Identities = 53/145 (36%), Positives = 87/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRH-SKRVGKIIAYERE 151
           I I SDH G  LK+ V++++E    +VID+G  +  P+D +PD A  +A  + +   + G+++CGTGVG  +AANK +GI AA+  D  +A    +HDD NV+C+ ++ V P     ++  +L+A+F       +RV K+ A E +
  S:     3 IVIGSDHAGYRLKASVVEYVESLGHEVIDVGSHDDTPVD-FPDIAKQMAGKVTSGEAARGLMVCGTGVGASIAANKIRGIRAAVCHDIHSAHQCVEHDDVNVMCIGAQIVGPWLANDLIKAYLEAEFSTSEEFRRRVEKLHAMEND 147
>gi|29726866|pdb|1O1X|A Chain A, Crystal Structure Of Ribose-5-Phosphate Isomerase Rpib (Tm1080) From Thermotoga Maritima At 1.90 A Resolution (155 aa)
Score = 243, Expect = 1.6e-19, Identities = 61/139 (43%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH   ELK  V  +L  + ++V D G    + +D YPDYA  + Q++ +N    GIL+ GTG+G  +AAN+ +GI AAL +    A LAR H++AN+L L  R +  E    IVD FL   F+GGRH +R+ KI
  S:    15 IAIASDHAAFELKEKVKNYLLGKGIEVEDHGTYSEESVD-YPDYAKKVVQSILSNEADFGILLXGTGLGXSIAANRYRGIRAALCLFPDXARLARSHNNANILVLPGRLIGAELAFWIVDTFLSTPFDGGRHERRIRKI 152
>gi|148284395|ref|YP_001248485.1| ribose-5-phosphate isomerase [Orientia tsutsugamushi str. Boryong] >gi|146739834|emb|CAM79750.1| ribose-5-phosphate isomerase [Orientia tsutsugamushi Boryong] (160 aa)
Score = 243, Expect = 1.6e-19, Identities = 56/145 (38%), Positives = 85/145 (58%)
  Q:     1 MQMNHPIYIASDHTGLELKSLVIKHLEQQK----LQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M  ++ I IASD    ELK+ + +HL +Q+      V+DLG      +D YPD A LL  T+  N    GILIC TG+G+ +AAN+   I AAL  +   A  +R H++AN+L + ++       I ++ +F+  +FEGGRH  R+ K+
  S:    12 MVSSNIIAIASDQKEYELKTKICQHLSEQERFISFSVLDLGGNNNQQVD-YPDIANLLCDTIINNRARYGILICTTGIGMSIAANRHSDIRAALCFNEYMAEQSRLHNNANILIIGAKVSNFRSVINMISKFITTKFEGGRHLTRLEKL 159
>gi|23005395|ref|ZP_00048235.1| COG0698: Ribose 5-phosphate isomerase RpiB [Magnetospirillum magnetotacticum MS-1] (131 aa)
Score = 243, Expect = 1.7e-19, Identities = 47/108 (43%), Positives = 68/108 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSR 114
           ++IA+DH G ELK+ +++HL      V+D G    D  DDYP + F   + + A P SLG++I G+G G  +AANK  G+ AAL  + +TA L RQH+DANV+   +R
  S:     3 VHIAADHAGYELKTHLVEHLGAAGHDVVDHGAHTYDAQDDYPSFCFAAGEAVAAEPGSLGVVIGGSGNGEQIAANKVVGVRAALAWNLETARLGRQHNDANVVRXWAR 110
>gi|164688898|ref|ZP_02212926.1| hypothetical protein CLOBAR_02546 [Clostridium bartlettii DSM 16795] >gi|164602102|gb|EDQ95567.1| hypothetical protein CLOBAR_02546 [Clostridium bartlettii DSM 16795] (150 aa)
Score = 243, Expect = 1.8e-19, Identities = 49/136 (36%), Positives = 79/136 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I +  DH G  LK  + K+L  + ++ +D G        DYP Y   +A+ + A     GI+ CGTG+G+ +AANK  GI  A+V D+ +A +++ H++AN+L L  R +     ++IV+ +L  +FEG RH +RV
  S:     3 IGLGCDHGGYNLKLEIKKYLGTKGIECVDFGTNNDTESVDYPIYGQKVAEAVVAKEVDYGIVCCGTGIGISLAANKVPGIRCAVVSDTFSAKMSKAHNNANMLSLGERVLGKGLALEIVEAWLNTEFEGDRHLRRV 138
>gi|154483321|ref|ZP_02025769.1| hypothetical protein EUBVEN_01024 [Eubacterium ventriosum ATCC 27560] >gi|149735831|gb|EDM51717.1| hypothetical protein EUBVEN_01024 [Eubacterium ventriosum ATCC 27560] (154 aa)
Score = 242, Expect = 2.0e-19, Identities = 48/136 (35%), Positives = 82/136 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLD----DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I    DH  ++LK+ +I+++ ++  + +D G    +  +    DYP+    + + +       G+L+CGTG+G+ +AANK  G++AA+  +  +A L +QH++ANV+   +R V  E    I+DEF  A+FEGGRH  RV
  S:     3 IGFGCDHAAIDLKNELIEYMTEKGYECVDYGTGYDENGEIIKCDYPNKGREVGEAVVRKDVDYGVLMCGTGIGISVAANKVPGVIAAVCSEPYSAKLTKQHNNANVIAFGARVVGVELAKMILDEFFGAEFEGGRHQARV 142
>gi|16123503|ref|NP_406816.1| ribose-5-phosphate isomerase B [Yersinia pestis CO92] >gi|22124748|ref|NP_668171.1| ribose-5-phosphate isomerase B [Yersinia pestis KIM] >gi|45440191|ref|NP_991730.1| ribose-5-phosphate isomerase B [Yersinia pestis biovar Microtus str. 91001] >gi|51595129|ref|YP_069320.1| ribose-5-phosphate isomerase B [Yersinia pseudotuberculosis IP 32953] >gi|108808782|ref|YP_652698.1| ribose-5-phosphate isomerase B [Yersinia pestis Antiqua] >gi|108810906|ref|YP_646673.1| ribose-5-phosphate isomerase B [Yersinia pestis Nepal516] >gi|145600265|ref|YP_001164341.1| ribose-5-phosphate isomerase B [Yersinia pestis Pestoides F] >gi|153950679|ref|YP_001402246.1| ribose-5-phosphate isomerase B [Yersinia pseudotuberculosis IP 31758] >gi|153997603|ref|ZP_02022703.1| ribose 5-phosphate isomerase B [Yersinia pestis CA88-4125] >gi|162420741|ref|YP_001605516.1| ribose-5-phosphate isomerase B [Yersinia pestis Angola] >gi|165925839|ref|ZP_02221671.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936740|ref|ZP_02225307.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. IP275] >gi|166010133|ref|ZP_02231031.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212918|ref|ZP_02238953.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399243|ref|ZP_02304767.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421636|ref|ZP_02313389.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423807|ref|ZP_02315560.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469367|ref|ZP_02334071.1| ribose 5-phosphate isomerase B [Yersinia pestis FV-1] >gi|170025637|ref|YP_001722142.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Yersinia pseudotuberculosis YPIII] >gi|186894142|ref|YP_001871254.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Yersinia pseudotuberculosis PB1/+] >gi|21957567|gb|AAM84422.1|AE013686_5 ribose 5-phosphate isomerase B [Yersinia pestis KIM] >gi|45435047|gb|AAS60607.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Microtus str. 91001] >gi|51588411|emb|CAH20019.1| ribose 5-phosphate isomerase B, also acts on allose (allose 6-phosphate isomerase) [Yersinia pseudotuberculosis IP 32953] >gi|108774554|gb|ABG17073.1| ribose-5-phosphate isomerase [Yersinia pestis Nepal516] >gi|108780695|gb|ABG14753.1| ribose-5-phosphate isomerase [Yersinia pestis Antiqua] >gi|115348982|emb|CAL21942.1| ribose 5-phosphate isomerase B [Yersinia pestis CO92] >gi|145211961|gb|ABP41368.1| ribose-5-phosphate isomerase [Yersinia pestis Pestoides F] >gi|149289240|gb|EDM39320.1| ribose 5-phosphate isomerase B [Yersinia pestis CA88-4125] >gi|152962174|gb|ABS49635.1| ribose 5-phosphate isomerase B [Yersinia pseudotuberculosis IP 31758] >gi|162353556|gb|ABX87504.1| ribose 5-phosphate isomerase B [Yersinia pestis Angola] >gi|165915389|gb|EDR33999.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. IP275] >gi|165922451|gb|EDR39628.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991040|gb|EDR43341.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205705|gb|EDR50185.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960555|gb|EDR56576.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051747|gb|EDR63155.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057977|gb|EDR67723.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752171|gb|ACA69689.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Yersinia pseudotuberculosis YPIII] >gi|186697168|gb|ACC87797.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Yersinia pseudotuberculosis PB1/+] (151 aa)
Score = 241, Expect = 2.8e-19, Identities = 48/145 (33%), Positives = 87/145 (60%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
            I I  D   +E+K+ ++  L+ + + V+D    +      YPD A  +A  ++A  +  GILICGTG+G+ ++ANK  G+ AA   D+ +A  AR+ ++A ++CL +R + PE    +++ +L A+F+GG  +++V +I  YE+
  S:     3 SIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKHERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKTLIEAWLDAEFDGGGSTEKVERIRYYEQ 147
>gi|87310177|ref|ZP_01092309.1| ribose 5-phosphate isomerase B [Blastopirellula marina DSM 3645] >gi|87287167|gb|EAQ79069.1| ribose 5-phosphate isomerase B [Blastopirellula marina DSM 3645] (145 aa)
Score = 241, Expect = 2.8e-19, Identities = 48/143 (33%), Positives = 81/143 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I +ASDH G   K  ++++L++   +  D G    +  D YPD+    AQ +       GI++ G+G G  +AAN+ +G+  A     +TA L R+H++ANV+ +  R +     ++IVD +L  +FEGGRH +R+ K+  +E
  S:     3 IVVASDHAGFHYKQAILEYLQKLGHEAADYGTFSAESCD-YPDFIMPAAQAVADGKFERGIVLGGSGNGEAIAANRIRGVRCAYCWSVETAQLGRRHNNANVIAMGERLIELPLALEIVDAWLAGEFEGGRHQRRIEKLDVFE 144
>gi|153004888|ref|YP_001379213.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Anaeromyxobacter sp. Fw109-5] >gi|152028461|gb|ABS26229.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter sp. Fw109-5] (161 aa)
Score = 241, Expect = 3.0e-19, Identities = 53/143 (37%), Positives = 81/143 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           + IA+DH G+ L +++   L     +V+DL P +  P DDYPD+A  + + +++     G+L+CG+GVGV +AANK  GI A    D+ +A    +HD  NVL L +R V      +I+  FL A+  G  RH +R+ K    E
  S:     3 VAIAADHAGVALAAMLRAELAVLGHEVVDLTPRDQGPEDDYPDHAVSVGEAIRSGRAERGVLVCGSGVGVAIAANKLPGIYAGACHDTYSAHQGVEHDAMNVLALGARVVGEALAREILGAFLGARPSGEERHRRRISKTRGIE 146
>gi|187604000|ref|ZP_02990211.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Exiguobacterium sp. AT1b] >gi|187484062|gb|EDU22055.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Exiguobacterium sp. AT1b] (146 aa)
Score = 240, Expect = 3.2e-19, Identities = 64/143 (44%), Positives = 87/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I +DH G  LK  ++  LE+   +  D G    D + DYPD A  +A+ + A     GILICGTG+G+ +AANK KGI AALV DS +A   RQH+D+N++ +  R + P   + +V  +L   FEGGRHS RV K+ AYE
  S:     3 IAIGADHGGFNLKKEIVALLEELGHEYKDFGTHSADSI-DYPDVAIPVAEAVAAGEFDRGILICGTGIGIGIAANKVKGIRAALVHDSFSAKATRQHNDSNIMTMGERVIGPGLALDLVTTWLDTDFEGGRHSNRVDKMSAYE 144
>gi|116327140|ref|YP_796860.1| ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116332203|ref|YP_801921.1| ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116119884|gb|ABJ77927.1| Ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125892|gb|ABJ77163.1| Ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (145 aa)
Score = 240, Expect = 3.4e-19, Identities = 56/140 (40%), Positives = 82/140 (58%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I IASDH G ELK  +   L ++ L++ID G T+ +   DYP       + + +      I +CGTG+G  +AAN+ KGI AAL  D  TA ++++H++ANVL L  R V  E  + IV  ++   FEGGRH +RV ++
  S:     3 KIGIASDHGGFELKEFLRDSLSRE-LEIIDYG-TKNETSVDYPIVISEACKKVLSKEVEGLIALCGTGIGASIAANRMKGIRAALCHDQFTAEMSKRHNNANVLVLGGRIVGKELALNIVRTWVNTVFEGGRHERRVNQL 140
>gi|76556229|emb|CAD48940.1| ribose-5-phosphate isomerase 1 [Propionibacterium freudenreichii subsp. shermanii] (148 aa)
Score = 240, Expect = 3.6e-19, Identities = 52/136 (38%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I + SDH G ELK  +  +L+ +   VID+G    + +D YP Y    A+ + A      I++CGTG+G+ MAA K  GI  A+V +  +A ++R H+DAN L L +R +      +IVD +    F GGRH +RV
  S:     3 IAMGSDHAGFELKEHLKGYLQGKGHDVIDVGTHSTESVD-YPVYGAGAARKVAAGEADRAIVVCGTGLGIGMAAGKVPGIRCAIVSEVYSAQMSRLHNDANALALGARVIGTGVAEEIVDVWTTTDFLGGRHGRRV 137
>gi|148377379|ref|YP_001256255.1| ribose-5-phosphate isomerase B [Mycoplasma agalactiae PG2] >gi|148291425|emb|CAL58809.1| Ribose-5-phosphate isomerase [Mycoplasma agalactiae PG2] (148 aa)
Score = 240, Expect = 3.9e-19, Identities = 50/140 (35%), Positives = 80/140 (57%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPN-SLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            + +ASDH G +LK+ +  ++     + +DLGP +      Y +    LA  +  N + S GI +CGTG+G+  A N+  GI AA V   + A LA+ H++ANVL +  R V  E+   ++DE++   +EGGRH  R+ +I
  S:     5 KVVLASDHGGCDLKNEIKDYVSNLGYETVDLGPEDSSKSISYAEQGHKLANYLLDNKDVSFGIGLCGTGLGISYALNRHNGIRAARVTSVEDANLAKLHNNANVLVMGGRQVNIEQAKAMIDEYINTAYEGGRHQARIDQI 145
>gi|24213069|ref|NP_710550.1| ribose 5-phosphate isomerase B [Leptospira interrogans serovar Lai str. 56601] >gi|45656221|ref|YP_000307.1| ribose 5-phosphate isomerase B [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24193764|gb|AAN47568.1|AE011224_7 Ribose 5-phosphate isomerase B [Leptospira interrogans serovar Lai str. 56601] >gi|45599455|gb|AAS68944.1| ribose 5-phosphate isomerase B [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (145 aa)
Score = 239, Expect = 4.8e-19, Identities = 53/140 (37%), Positives = 80/140 (57%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
            I IASDH G ELK  + K L  + L+++D G  +   +D YP       + + +      I +CGTG+G  +AAN+  GI AAL  D  TA ++++H++ANVL L  R +  E  + IV  ++   FEGGRH +RV ++
  S:     3 KIGIASDHGGFELKEFLRKSLAGE-LEIVDYGTKDESSVD-YPIVISAACKKVLSKEVEGLIALCGTGIGASIAANRMSGIRAALCHDQFTAEMSKRHNNANVLVLGGRIIGKELALNIVRTWINTSFEGGRHERRVNQL 140
>gi|118726922|ref|ZP_01575536.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] >gi|118663651|gb|EAV70298.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] (152 aa)
Score = 239, Expect = 5.0e-19, Identities = 53/146 (36%), Positives = 83/146 (56%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
            I I  D  G + K ++   L ++ L V D G    DP+  YPD A  +A+++    +  GILICGTG+G+ +AANK  GI AA+  DS +   +R+ ++A ++ L +R +  E    +VD +L+ +F GG    +V KI+ YE E
  S:     2 SIAIGCDEAGFQFKEVIKNLLLEKGLDVEDFGVYNTDPVL-YPDIAVAVAKSISEGKHERGILICGTGIGMAIAANKVPGIRAAVCHDSFSTERSRKSNNAQIMALGARVIGIELAKLLVDLWLECEFGGGGSEAKVNKIMEYENE 146
>gi|160900016|ref|YP_001565598.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Delftia acidovorans SPH-1] >gi|160365600|gb|ABX37213.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Delftia acidovorans SPH-1] (157 aa)
Score = 239, Expect = 5.2e-19, Identities = 53/145 (36%), Positives = 82/145 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + I  D    +LK+ V +HL  Q  +V D G  + +P+  YPD    +AQ +    +  G+L+CGTG+G+ +AANK  GI AA   D+ +A  A + +DA ++ L SR +  E    IVD FL ++F+GG  + +V  I  +ER 
  S:     3 LAIGCDEAACDLKNAVKQHLLAQGHEVADFGTHDGEPVL-YPDIGIAVAQAIVQGRHERGVLLCGTGIGMAIAANKVAGIRAAQAHDTYSAERASRSNDAQIITLGSRVIGVELAKAIVDRFLASRFDGGSSALKVDAITGFERS 146
>gi|167838696|ref|ZP_02465555.1| ribose 5-phosphate isomerase B [Burkholderia thailandensis MSMB43] (164 aa)
Score = 238, Expect = 6.9e-19, Identities = 52/144 (36%), Positives = 81/144 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLE--QQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           + I  D     LK  + +HL     ++++ D G    D    YPD A  +AQ +     +  IL+CGTG+GV ++ANK  GI AA   D+ +A  AR+ +DA ++ + +R +  E    IVD +L+A+F+GGR   +V +I  YER
  S:     3 VAIGCDEAAYALKESIKRHLRAAHPEVELTDFGTHSADEAVLYPDIAIEVAQRVATGEFARAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDAQIITMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYER 148
>gi|121534887|ref|ZP_01666706.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Thermosinus carboxydivorans Nor1] >gi|121306486|gb|EAX47409.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Thermosinus carboxydivorans Nor1] (146 aa)
Score = 237, Expect = 8.3e-19, Identities = 61/145 (42%), Positives = 89/145 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           + I SDH G  LK  + + LE++K+   D G    D + DYPD +  +AQ +       GI+ICGTG+GV +AANK KGI AAL  D  +A ++R+H+DAN+L +  R + P     IV ++L  +F GGRH++RV +I + E E
  S:     3 VAIGSDHGGFRLKEEIKRFLEEEKIAYRDFGTYSTDSV-DYPDISRSVAQAVATGECDRGIIICGTGIGVSIAANKIKGIRAALCHDVYSAQMSREHNDANILTMGERVIGPGLARAIVAKWLATEFAGGRHARRVCQIASLEEE 146
>gi|91787354|ref|YP_548306.1| ribose-5-phosphate isomerase [Polaromonas sp. JS666] >gi|91696579|gb|ABE43408.1| ribose-5-phosphate isomerase [Polaromonas sp. JS666] (149 aa)
Score = 237, Expect = 8.8e-19, Identities = 51/141 (36%), Positives = 80/141 (56%)
  Q:     9 IASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I  D    +LK  + KH+     +V D G  +  P+  YPD AF +A+ +        +L+CGTG+G+ ++ANK KG+ AA   D+ +A  A + +DA ++ + +R V PE    IVD +L++ F+GGR   +V  I AYE
  S:     5 IGCDEAAYDLKQTLKKHMIDAGHEVTDFGTHDAQPVL-YPDVAFAVAEQVAGGAYERALLLCGTGIGMAISANKVKGVRAAQCHDTYSAERASRSNDAQIITIGARVVGPELAKSIVDAWLRSGFDGGRSQPKVDLIQAYE 144
>gi|196229686|ref|ZP_03128550.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chthoniobacter flavus Ellin428] >gi|196226012|gb|EDY20518.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chthoniobacter flavus Ellin428] (218 aa)
Score = 236, Expect = 1.1e-18, Identities = 55/146 (37%), Positives = 77/146 (52%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I SDH G E K  +I+ L     +V D G    DP+D YP Y    AQ + +     GI++ G+G G  + ANK +GI  AL     TA  A+ H+DAN + +  R +  E  ++IV  +L  +FEGGRH  R+  I A E  +
  S:     3 IAIGSDHAGFEYKGKIIELLTTLGHEVRDFGTHSADPVD-YPLYIAPTAQAVASGECERGIVLGGSGNGEQITANKVRGIRCALCFSLDTARWAKLHNDANCIAIGQRTIPGELALEIVKTWLNTEFEGGRHVARLNGIAAVENSQ 147
>gi|160902694|ref|YP_001568275.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Petrotoga mobilis SJ95] >gi|160360338|gb|ABX31952.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Petrotoga mobilis SJ95] (144 aa)
Score = 236, Expect = 1.1e-18, Identities = 63/139 (45%), Positives = 84/139 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I IASDH G E+K  +  +L ++K  +IDLG T  +   DYPDYA  L + +       GI ICGTG+G+ +A NK KG+  AL +    A  AR+H+DANVL L+ R +  +  I  V +FL   FEGGRH +RV KI
  S:     3 IAIASDHAGYEMKEQLKNYLLEKKFNIIDLG-TNSNASVDYPDYAKKLGEKVTKGEADFGIGICGTGIGMSIAVNKVKGVRGALCLYPSMAEYARKHNDANVLVLAGRLMGIDLAIWTVVKFLSTDFEGGRHKRRVDKI 140
>gi|71421473|ref|XP_811811.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi strain CL Brener] >gi|70876518|gb|EAN89960.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi] (159 aa)
Score = 235, Expect = 1.3e-18, Identities = 52/147 (35%), Positives = 86/147 (58%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDL--GPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           M   + I +DH    +   +I ++++   + + +  GP   + +D YPD+A  +A+ +       G+L CG+G+G+ +AANK  G+ AAL  D  TAA++R H+DAN++C+  R    E   +I+  FLQ  F G  RH++R+ KI A E
  S:     1 MTRRVAIGTDHPAFAIHENLILYVKEAGDEFVPVYCGPKTAESVD-YPDFASRVAEMVARKEVEFGVLACGSGIGMSIAANKVPGVRAALCYDHYTAAISRIHNDANIVCVGERTTGVEVIREIIITFLQTPFSGEERHARRIEKIRAIE 149
>gi|170741319|ref|YP_001769974.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Methylobacterium sp. 4-46] >gi|168195593|gb|ACA17540.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Methylobacterium sp. 4-46] (148 aa)
Score = 235, Expect = 1.4e-18, Identities = 53/145 (36%), Positives = 83/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE-GGRHSKRVGKIIAYERE 151
           + I SDH G  LK  VI H+     ++ID+G  +  P+D +PD A  +A+ + +     G+++CGTGVG  +AANK KGI AA+  D  +A    +HDD NV+C+ ++ V P     ++  +L A+F       +RV K+ A + E
  S:     3 LVIGSDHAGWMLKGAVIDHVRSLGHELIDVGSFDEHPVD-FPDIAREVARKVTSGEADRGLMVCGTGVGASIAANKMKGIRAAVCHDVHSAHQCVEHDDVNVMCIGAQIVGPWLAKDLIAAYLTAEFSTDADFRRRVEKLHAMDAE 147
>gi|169188286|ref|ZP_02848432.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Paenibacillus sp. JDR-2] >gi|169004935|gb|EDS51790.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Paenibacillus sp. JDR-2] (152 aa)
Score = 235, Expect = 1.4e-18, Identities = 56/145 (38%), Positives = 80/145 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKIIAYERE 151
           I I +DH G  LK  ++  L     ++ DLG  +     DYPDYA  +A  + +     GILICGTG+G+ +AANK  GI  ALV D  +A   R+H+D NVL +  R + P    +IV  +++  F  G RH  RV K+   E++
  S:     3 IAIGADHAGYRLKDEIVPFLLSLGHEIEDLG-CDCSQSVDYPDYALPVADRVASGQADRGILICGTGIGMSIAANKVPGIRCALVHDMFSAQATREHNDTNVLAMGERIIGPGLAQEIVRIWMETPFSSGERHVGRVRKVKEIEQQ 147
>gi|171915887|ref|ZP_02931357.1| ribose 5-phosphate isomerase B [Verrucomicrobium spinosum DSM 4136] (144 aa)
Score = 233, Expect = 2.1e-18, Identities = 51/139 (36%), Positives = 73/139 (52%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G   K  +   L+    +V D G    DP+D YP Y    A+ +       GI++ G+G G  + ANK +G+  +L     TA  AR+H+DANVL +  R + PE  ++IV  +L+ +F  GRH  RV  I
  S:     3 ISIGSDHAGFAYKEKIKAFLQSLGHEVQDFGTYSADPVD-YPTYVRPAAEAVAKGEADRGIVLGGSGNGEAIVANKVRGVRCSLCWSHDTARWAREHNDANVLAIGERTISPELALEIVKIWLETEFTAGRHLARVQAI 140
>gi|110634856|ref|YP_675064.1| ribose-5-phosphate isomerase B [Mesorhizobium sp. BNC1] >gi|110285840|gb|ABG63899.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Mesorhizobium sp. BNC1] (148 aa)
Score = 232, Expect = 2.7e-18, Identities = 52/135 (38%), Positives = 74/135 (54%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKR 141
           I I SDH G  LK+ +I H+E    +VID+G    DP+D +PD A  L   +       G+++CGTGVG  +AANK  GI AA+  D  +A    +HDD NVLC+ ++ V       +V  +L A+F      +R
  S:     3 IIIGSDHAGYPLKADIISHIESLGHEVIDVGCHSTDPVD-FPDIAQDLTDKLLKGEGDRGLMVCGTGVGAAIAANKRAGIRAAVGHDVYSAHQCVEHDDVNVLCIGAQIVGAWLARDLVSAYLSAEFSTSEEFRR 136
>gi|77956589|ref|ZP_00820678.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia bercovieri ATCC 43970] (151 aa)
Score = 232, Expect = 3.3e-18, Identities = 48/147 (32%), Positives = 84/147 (57%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
            I I  D   +++K+ ++  L+ + + V+D    +      YPD A  +AQ ++   +  GILICGTG+G+ + ANK  GI AA   D  +A  AR+ ++A ++CL +R +  E    +VD +L+  F+GG  +++V +I  YE+ +
  S:     3 SIAIGCDDAAIDMKNQILAFLQNKNITVVDYSCDQQREPTIYPDIAVQVAQAIKDGKHERGILICGTGIGMSITANKVLGIRAAQCHDPFSAQRARKSNNAQIICLGARVIGVELAKTLVDTWLECDFDGGSSTEKVERISYYEQRQ 149
>gi|16264105|ref|NP_436897.1| ribose-5-phosphate isomerase B [Sinorhizobium meliloti 1021] >gi|15140230|emb|CAC48757.1| putative ribose-5-phosphate isomerase [Sinorhizobium meliloti 1021] (148 aa)
Score = 231, Expect = 3.7e-18, Identities = 47/127 (37%), Positives = 74/127 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF 133
           I I SDH G  LK+ +I H+     +V D G  + +P+D +PD A ++  ++       G+++CGTGVG  +AANK KGI AA+  D  +A  + +HDD NV+C+ ++ V       +V  +L A+F
  S:     3 IVIGSDHAGFHLKATIIDHVTSLGHEVYDAGSYDANPVD-FPDIAKMVTSSIIEGKADRGLMVCGTGVGASIAANKVKGIRAAVCHDVHSAHQSVEHDDVNVMCIGAQIVGAWLARDLVAAYLAAEF 128
>gi|157871860|ref|XP_001684479.1| ribose 5-phosphate isomerase, putative [Leishmania major] >gi|68127548|emb|CAJ05599.1| ribose 5-phosphate isomerase, putative [Leishmania major] (172 aa)
Score = 231, Expect = 4.1e-18, Identities = 52/121 (42%), Positives = 73/121 (60%)
  Q:    32 QVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQ-FEGGRHSKRVGKIIAYEREK 152
           +V+ +GP+  D   DYPDYA  + + +       GIL+CGTG+G+ +AANK +GI AAL  D  TA L+RQH++A++LC+  R    E    I+  FL  +    GRHS RV KI   E E+
  S:    32 KVMYMGPSS-DTSVDYPDYAAQVCEAILKGEADAGILVCGTGIGMSIAANKFRGIRAALCYDHVTAQLSRQHNNAHILCIGVRTSGMEIIRDIITTFLTTEPLAEGRHSNRVDKITVIEEEQ 152
>gi|115376051|ref|ZP_01463297.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] >gi|115366966|gb|EAU65955.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] (160 aa)
Score = 231, Expect = 4.1e-18, Identities = 52/143 (36%), Positives = 80/143 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           I +A+DH G ELK+ +++ LE     ++D G    +P+D YPD A  + + ++       ILICG+GVG  +A NK  G+   L  D+ +A    +HDD NVL L +R +      ++   FL A+F G  RH +R+ K+ A E
  S:     3 IALAADHAGFELKNWLLRALEGAGHTLVDKGTYSTEPVD-YPDCAQAVGEALRGGDVDRAILICGSGVGASIAVNKMPGVRGGLCHDTYSAHQGVEHDDMNVLVLGARVIGLALAEELARAFLAARFSGEERHKRRLSKVHALE 145
>gi|18309308|ref|NP_561242.1| galactose-6-phosphate isomerase subunit LacA [Clostridium perfringens str. 13] >gi|81768111|sp|Q8XNK7|LACA_CLOPE Galactose-6-phosphate isomerase subunit lacA >gi|18143984|dbj|BAB80032.1| galactose-6-phosphate isomerase [Clostridium perfringens str. 13] (142 aa)
Score = 231, Expect = 4.2e-18, Identities = 47/136 (34%), Positives = 80/136 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           + I +D  G+ELK+++  +L +   +VID      +  +D+ +    + + +  N  SLGI   G G G  M A K KGI+AA V D ++A + R+H++++++ + S+ V  E  + IV EFL+A ++GGRH  RV
  S:     3 VVIGADKEGMELKNMIKCYLLENNFEVIDKSE---EASEDFVESTVAITKDVLENKGSLGIAFDGYGAGSFMVATKIKGIIAAEVSDERSAYMTREHNNSSIITIGSKIVGSELALNIVKEFLEASYDGGRHQIRV 135
>gi|108800565|ref|YP_640762.1| ribose-5-phosphate isomerase B [Mycobacterium sp. MCS] >gi|119869704|ref|YP_939656.1| ribose-5-phosphate isomerase B [Mycobacterium sp. KMS] >gi|126436181|ref|YP_001071872.1| ribose-5-phosphate isomerase B [Mycobacterium sp. JLS] >gi|108770984|gb|ABG09706.1| ribose 5-phosphate isomerase [Mycobacterium sp. MCS] >gi|119695793|gb|ABL92866.1| ribose 5-phosphate isomerase [Mycobacterium sp. KMS] >gi|126235981|gb|ABN99381.1| ribose 5-phosphate isomerase [Mycobacterium sp. JLS] (162 aa)
Score = 230, Expect = 4.6e-18, Identities = 54/144 (37%), Positives = 83/144 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYER 150
           +Y+ +DH G ELK ++I+HL     + +D G  + D  DDYP +    A+   A+P SLGI++ G+G G  +AANK  G   AL    +TA LAR+H++A ++ L  R     + + IVD FL   + +  RH +R+  +  YER
  S:     6 VYLGADHAGYELKQVIIEHLRSTGHEPVDCGAFDYDADDDYPAFCIAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGLGGRMHSEADALAIVDAFLATPWSKAERHQRRIDILSEYER 150
>gi|150015297|ref|YP_001307551.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|149901762|gb|ABR32595.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium beijerinckii NCIMB 8052] (164 aa)
Score = 230, Expect = 4.9e-18, Identities = 64/145 (44%), Positives = 88/145 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  DH GLELK+ +IK LE +K ++ D G        DYPD A  +A+ + A     GILICGTG+G+ +AANK  GI AAL  D+ +A   R+H++AN+L +  R V     + IV  F+ A+FEG RH KR+ KI   E++
  S:    18 IAIGCDHGGLELKNEIIKFLESEKHEIKDFGTYSTGSC-DYPDIALPVAEAVAAKEYEFGILICGTGIGIGIAANKVPGIRAALCSDTFSAHATREHNNANILTMGQRVVGAGLALDIVKTFISAKFEGDRHQKRIDKISDIEKK 161
>gi|71403000|ref|XP_804346.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi strain CL Brener] >gi|70867270|gb|EAN82495.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi] >gi|110984574|gb|ABH03202.1| ribose 5-phosphate isomerase [Trypanosoma cruzi strain CL Brener] (159 aa)
Score = 230, Expect = 5.0e-18, Identities = 52/147 (35%), Positives = 85/147 (57%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDL--GPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEG-GRHSKRVGKIIAYE 149
           M   + I +DH    +   +I ++++   + + +  GP   + +D YPD+A  +A+ +       G+L CG+G+G+ +AANK  G+ AAL  D  TAA++R H+DAN++C+  R    E   +I+  FLQ  F G  RH +R+ KI A E
  S:     1 MTRRVAIGTDHPAFAIHENLILYVKEAGDEFVPVYCGPKTAESVD-YPDFASRVAEMVARKEVEFGVLACGSGIGMSIAANKVPGVRAALCHDHYTAAMSRIHNDANIVCVGERTTGVEVIREIIITFLQTPFSGEERHVRRIEKIRAIE 149
>gi|146092218|ref|XP_001470236.1| ribose 5-phosphate isomerase [Leishmania infantum] >gi|134085030|emb|CAM69431.1| ribose 5-phosphate isomerase, putative [Leishmania infantum] (172 aa)
Score = 230, Expect = 5.0e-18, Identities = 51/121 (42%), Positives = 73/121 (60%)
  Q:    32 QVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQ-FEGGRHSKRVGKIIAYEREK 152
           +V+ +GP+  D   DYPDYA  + + +       GIL+CGTG+G+ +AANK +GI AAL  D  TA L+RQH++A++LC+  R    E    I++ FL  +    GRH  RV KI   E E+
  S:    32 KVMYMGPSS-DTSVDYPDYAAQVCEAILKGEADTGILVCGTGIGMSIAANKFRGIRAALCYDHVTAQLSRQHNNAHILCIGVRTSGMEVIRDIIETFLTTEPLAEGRHGNRVDKITVIEEEQ 152
>gi|77962834|ref|ZP_00826650.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia mollaretii ATCC 43969] (151 aa)
Score = 230, Expect = 5.4e-18, Identities = 48/147 (32%), Positives = 84/147 (57%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
            I I  D   +++K+ ++  L+ + + V+D    +      YPD A  +AQ ++   +  GILICGTG+G+ + ANK  GI AA   D  +A  AR+ ++A ++CL +R +  E    +VD +L   F+GG  +++V +I  YE+++
  S:     3 SIAIGCDDAAIDMKNQILAFLQNRGMTVVDYSCDQQRESTLYPDIAIQVAQAIKDGKHERGILICGTGIGMSITANKVLGIRAAQCHDPFSAQRARKSNNAQIICLGARVIGIELAKTLVDTWLDCDFDGGGSTEKVERISYYEQQQ 149
>gi|121282034|gb|ABM53588.1| putative ribose-5-phosphate isomerase B [uncultured bacterium CBNPD1 BAC clone 2089] (181 aa)
Score = 230, Expect = 5.6e-18, Identities = 54/146 (36%), Positives = 81/146 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK 152
           I I +DH G ELK  ++  L     +V D G    + +D YP     + + ++     LGI++ G+G G  +AANK +G+ AAL     TA +AR H++ANVL + +R V      +IV  FL  +FEGGRH +RV ++   E E+
  S:    35 IAIGADHAGFELKQHLVAFLGAAGHKVDDFGTHSTESVD-YPPICAAVGRAVRDGKADLGIVLGGSGQGEQLAANKVRGVRAALCNCLYTAKMARSHNNANVLSMGARVVGVGLAEEIVTTFLATEFEGGRHERRVTQLAEIEEEE 179
>gi|118406893|gb|AAO39418.2| ribose-5-phosphate isomerase [Mycoplasma hominis] (155 aa)
Score = 230, Expect = 5.7e-18, Identities = 52/143 (36%), Positives = 74/143 (51%)
  Q:     3 MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQA------NPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           M   + I SDH G + K  + K LE +   V   G    +  D Y D A  L   +        N N   +  CG+G+G+ M  NK KGI AA V +   + LA+ H++ANVLC+  R +   E  KI   +   +FEGGRH +R+ K+
  S:     1 MKTTVKITSDHAGYDAKINLAKRLENEGYNVELFGSKTNNNSDSYADAAIELVNEIHKDGNPDENKNVKYVAFCGSGIGIEMTLNKFKGIRAARVTNENESHLAKLHNNANVLCMGGRLLEGNEVEKIFHSWENTEFEGGRHLERIKKL 149
>gi|167746182|ref|ZP_02418309.1| hypothetical protein ANACAC_00884 [Anaerostipes caccae DSM 14662] >gi|167654175|gb|EDR98304.1| hypothetical protein ANACAC_00884 [Anaerostipes caccae DSM 14662] (149 aa)
Score = 230, Expect = 5.9e-18, Identities = 48/145 (33%), Positives = 83/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVID--LGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I +  D    +LK  + KHLE    +V+D  +GP E++    YPD A    + + +N    GIL+CGTG+G+ M ANK  GI AA+  D  +   +   +D NV+C+ +R + P+  + ++D ++   F+ G  +++V +I  YE++
  S:     3 ISLGCDEAAFDLKEAIKKHLEDAGHEVVDNGVGPGEVEL---YPDVAVRTCEKVTSNECDRGILVCGTGIGMAMTANKVPGIRAAVCHDPFSTERSILSNDGNVMCMGARVIAPQLALYLLDIWMGLTFKDGPSTEKVERITYYEKQ 146
>gi|83592670|ref|YP_426422.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83575584|gb|ABC22135.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] (148 aa)
Score = 229, Expect = 7.3e-18, Identities = 51/143 (35%), Positives = 76/143 (53%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           I I  D    +LK  +   +  Q  +V D G  +  P+  YPD A  LA  + A     G+L+CGTG+G+ + ANK KGI AA   D+ +A  AR  +DA ++ + +R + PE    IV  FL  +F  G  + ++ +I AYE
  S:     3 IAIGCDEAAYDLKETLTSFITAQGHEVTDFGTFDRKPVL-YPDIAHALATEVAAGTQDRGVLLCGTGIGMAITANKVKGIRAAQCHDTYSAERARLSNDAQIITMGARVIGPELAKAIVRTFLSNEFVNGSSTPKIERITAYE 144
>gi|188996948|ref|YP_001931199.1| ribose 5-phosphate isomerase B [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932015|gb|ACD66645.1| ribose 5-phosphate isomerase B [Sulfurihydrogenibium sp. YO3AOP1] (148 aa)
Score = 228, Expect = 9.2e-18, Identities = 60/144 (41%), Positives = 90/144 (62%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I I SDH G   K  + ++L+ +K +VID G    +P+ DYP +   + +++Q+     GI+ICGTG+G+ +AANK KG+ AAL  +   A +AR H+DANVL L  R +  +  + I+D FL+  FEGGRH +RV  I+  E+
  S:     3 IAIGSDHGGFFYKEKIKEYLKSKKYEVIDKGTYSPEPV-DYPYFGEEVGKSVQSGEADRGIIICGTGIGISIAANKIKGVRAALCTNEFMARMARSHNDANVLALGQRVIGLDHALAIIDVFLETPFEGGRHERRVKLILDIEK 145
>gi|19746841|ref|NP_607977.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS8232] >gi|21911195|ref|NP_665463.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS315] >gi|28896569|ref|NP_802919.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes SSI-1] >gi|50914993|ref|YP_060965.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10394] >gi|71904290|ref|YP_281093.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS6180] >gi|94989271|ref|YP_597372.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS9429] >gi|94993160|ref|YP_601259.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS2096] >gi|139474418|ref|YP_001129134.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes str. Manfredo] >gi|81371602|sp|Q5X9Y1|LACA2_STRP6 Galactose-6-phosphate isomerase subunit lacA 2 >gi|81652992|sp|Q7CMS1|LACA2_STRP8 Galactose-6-phosphate isomerase subunit lacA 2 >gi|81763111|sp|Q8NZD7|LACA2_STRP3 Galactose-6-phosphate isomerase subunit lacA 2 >gi|84029328|sp|Q48RC2|LACA2_STRPM Galactose-6-phosphate isomerase subunit lacA 2 >gi|19749080|gb|AAL98476.1| galactosidase acetyltransferase [Streptococcus pyogenes MGAS8232] >gi|21905407|gb|AAM80266.1| putative galactosidase acetyltransferase [Streptococcus pyogenes MGAS315] >gi|28811823|dbj|BAC64752.1| putative galactosidase acetyltransferase [Streptococcus pyogenes SSI-1] >gi|50904067|gb|AAT87782.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10394] >gi|71803385|gb|AAX72738.1| galactose-6-phosphate isomerase LacA subunit [Streptococcus pyogenes MGAS6180] >gi|94542779|gb|ABF32828.1| galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS9429] >gi|94546668|gb|ABF36715.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS2096] >gi|134272665|emb|CAM30934.1| galactose-6-phosphate isomerase LacA subunit 2 [Streptococcus pyogenes str. Manfredo] (142 aa)
Score = 228, Expect = 9.8e-18, Identities = 47/137 (34%), Positives = 80/137 (58%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I +D  G ELK ++  +L++ K +V+D+   E+    D+ D    +A+ + A+ ++LGI+I   GVG  M A K KG++AA V D ++A + R H++A ++ L S    P     I+  F++ +++GGRH  RV
  S:     2 AIIIGADKAGQELKEVIKDYLKEGKYEVVDVSENEVR---DFVDTTLAVAKEVNASEDNLGIVIDAYGVGSFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKYDGGRHQVRV 135
>gi|56965373|ref|YP_177105.1| ribose 5-phosphate isomerase B [Bacillus clausii KSM-K16] >gi|56911617|dbj|BAD66144.1| ribose 5-phosphate isomerase B [Bacillus clausii KSM-K16] (153 aa)
Score = 227, Expect = 1.3e-17, Identities = 49/144 (34%), Positives = 81/144 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I I SDH   ELK  +  ++  +   V+D G    + +D YPD +F +   +       GILICGTG+GV +AA K  GI AAL  D+ +A  A+  ++A +L + ++ + PE   K+++ +L A F GG  ++++ +I   E+
  S:     3 IAIGSDHNAFELKEELKTYMIDEGYDVVDYGCHSCEAVD-YPDVSFRVGNDIMKGEIDRGILICGTGIGVAIAAGKVPGIRAALCHDTYSAERAQLSNNAQILTMGAKVIGPEAAKKVLNAYLGASFAGGPSARKIQQIAEQEQ 145
>gi|73661836|ref|YP_300617.1| putative ribose 5-phosphate isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494351|dbj|BAE17672.1| putative ribose 5-phosphate isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (148 aa)
Score = 225, Expect = 1.9e-17, Identities = 52/135 (38%), Positives = 74/135 (54%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSK 140
            I I +DH G +LK  V  H+E     V D G  +    D YPD A  + +++Q   N  GILICGTG+GV + ANK KGI AAL  D  +A  A+  ++A +L + ++ +  E   K V+ +L   +EGG   K
  S:     2 KIAIGADHNGYDLKEAVKAHVEHLGHVVEDFGCHQCAETD-YPDVAAEVGKSIQQGENERGILICGTGIGVAITANKIKGIRAALAHDYYSAERAQLSNNAQILTMGAQIIGVEVAKKNVEAYLNVSWEGGSQRK 135
>gi|94991216|ref|YP_599316.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10270] >gi|94995131|ref|YP_603229.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10750] >gi|94544724|gb|ABF34772.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10270] >gi|94548639|gb|ABF38685.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10750] (142 aa)
Score = 225, Expect = 2.1e-17, Identities = 46/137 (33%), Positives = 80/137 (58%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I +D  G ELK ++  +L++ K +V+D+   E+    D+ D    +A+ + A+ ++LGI+I   GVG  M A K KG++AA V D ++A + R H+++ ++ L S    P     I+  F++ +++GGRH  RV
  S:     2 AIIIGADKAGQELKEVIKDYLKEGKYEVVDVSENEVR---DFVDTTLAVAKEVNASEDNLGIVIDAYGVGSFMVATKIKGMVAAEVSDERSAYMTRGHNNSRIITLGSEISAPGIAKNIIKGFVEGKYDGGRHQVRV 135
>gi|16802390|ref|NP_463875.1| hypothetical protein lmo0345 [Listeria monocytogenes EGD-e] >gi|153173155|ref|ZP_01928988.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|153194992|ref|ZP_01939790.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|167013787|ref|ZP_02276320.1| hypothetical protein LmonFS_01839 [Listeria monocytogenes FSL J1-194] >gi|167216611|ref|ZP_02286247.1| hypothetical protein LmonocFSL_02809 [Listeria monocytogenes FSL J1-175] >gi|16409723|emb|CAC98424.1| lmo0345 [Listeria monocytogenes] >gi|127634595|gb|EBA23975.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|133731112|gb|EBA32810.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] (148 aa)
Score = 224, Expect = 2.3e-17, Identities = 49/136 (36%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G ELK  +I  L+++ ++  D G  E D    YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR   +V
  S:     3 IAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFE-DEKVLYPSIAEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKV 137
>gi|16799440|ref|NP_469708.1| hypothetical protein lin0363 [Listeria innocua Clip11262] >gi|46906585|ref|YP_012974.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47091483|ref|ZP_00229280.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|153165499|ref|ZP_01926318.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|153200815|ref|ZP_01942885.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|167213691|ref|ZP_02283998.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL R2-503] >gi|167453057|ref|ZP_02319280.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J2-064] >gi|16412792|emb|CAC95596.1| lin0363 [Listeria innocua] >gi|46879850|gb|AAT03151.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47020160|gb|EAL10896.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|133728280|gb|EBA29978.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|133736415|gb|EBA38113.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (148 aa)
Score = 224, Expect = 2.4e-17, Identities = 48/136 (35%), Positives = 78/136 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G ELK  +I  L+++ ++  D G  E + +  YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR   +V
  S:     3 IAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFENEKVL-YPSIAEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKV 137
>gi|167342685|ref|ZP_02288615.1| hypothetical protein LmonocyFSL_02673 [Listeria monocytogenes FSL J1-208] (136 aa)
Score = 224, Expect = 2.6e-17, Identities = 49/131 (37%), Positives = 76/131 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGR 137
           I I  D  G ELK  +I HL+++ ++  D G  E D    YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR
  S:     3 IAIGCDEMGYELKQTLIAHLKEKNIEFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDIWLDSDFSGGR 132
>gi|167403476|ref|ZP_02308304.1| hypothetical protein LmonocytFSL_02471 [Listeria monocytogenes FSL J2-003] (148 aa)
Score = 224, Expect = 2.8e-17, Identities = 49/136 (36%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G ELK  +I  L+++ ++  D G  E D    YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR   +V
  S:     3 IAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKV 137
>gi|47096676|ref|ZP_00234262.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153178371|ref|ZP_01931775.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] >gi|153185191|ref|ZP_01935797.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153189682|ref|ZP_01937199.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|47014930|gb|EAL05877.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126942122|gb|EBA19867.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127766583|gb|EBA26916.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|133733672|gb|EBA35370.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] (148 aa)
Score = 223, Expect = 3.2e-17, Identities = 49/136 (36%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G ELK  +I  L+++ ++  D G  E D    YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR   +V
  S:     3 IAIGCDEMGYELKQTLIARLKEKNIEFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKV 137
>gi|168264983|ref|ZP_02686948.1| hypothetical protein LmonFSL_01202 [Listeria monocytogenes FSL J2-071] (145 aa)
Score = 223, Expect = 3.4e-17, Identities = 49/136 (36%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G ELK  +I  L+++ ++  D G  E D    YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR   +V
  S:     3 IAIGCDEMGYELKQTLIARLKEKNIEFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKV 137
>gi|15675731|ref|NP_269905.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes M1 GAS] >gi|71911451|ref|YP_283001.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS5005] >gi|81533356|sp|Q99Y12|LACA2_STRP1 Galactose-6-phosphate isomerase subunit lacA 2 >gi|13622950|gb|AAK34626.1| galactosidase acetyltransferase [Streptococcus pyogenes M1 GAS] >gi|71854233|gb|AAZ52256.1| galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS5005] (142 aa)
Score = 223, Expect = 3.7e-17, Identities = 46/137 (33%), Positives = 79/137 (57%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I +D  G ELK ++  +L++ K +V+D+   E+    D+ D    + + + A+ ++LGI+I   GVG  M A K KG++AA V D ++A + R H++A ++ L S    P     I+  F++ +++GGRH  RV
  S:     2 AIIIGADKAGQELKEVIKDYLKEGKYEVVDVSENEVR---DFVDTTLAVVKEVNASDDNLGIVIDAYGVGSFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKYDGGRHQVRV 135
>gi|163784627|ref|ZP_02179462.1| ribose-5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] >gi|159880102|gb|EDP73771.1| ribose-5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] (106 aa)
Score = 222, Expect = 4.0e-17, Identities = 44/106 (41%), Positives = 67/106 (63%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCL 111
            + I SDH G +LK ++  HLE++  +VID G    + +D YP Y   +A+ + +     GI+ICGTG+G+ ++ANK KGI AAL  +   A +A +H++ANVL L
  S:     2 KVAIGSDHAGYDLKEVIKNHLEKKGFEVIDKGAFSKERVD-YPVYGEAVAEAVASGKAEKGIVICGTGIGISISANKVKGIRAALCTNEYMARMAIRHNNANVLAL 106
>gi|153893344|ref|ZP_02014088.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Opitutaceae bacterium TAV2] >gi|151580585|gb|EDN44394.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Opitutaceae bacterium TAV2] (146 aa)
Score = 222, Expect = 4.1e-17, Identities = 54/141 (38%), Positives = 72/141 (51%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLD-DYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIA 147
           I I SDH G   K  + + L  +   V D G     P   DYPD+    A+ +       GI++ G+G G  + AN+ KGI   L  + + A   R H+D NVL L  R V  EE +KIV  +L  +FEGGRH  R+ KI A
  S:     6 IAIGSDHAGFAYKEKIKEALLSEGHTVRDFGT--YSPASCDYPDFIRPTAEAVARGEFERGIVLGGSGNGEAIVANRIKGIRCGLCWNEQVAVWNRSHNDGNVLSLGERTVTLEEALKIVRVWLATEFEGGRHLPRIQKIDA 145
>gi|116871721|ref|YP_848502.1| ribose 5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740599|emb|CAK19719.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] (148 aa)
Score = 222, Expect = 5.0e-17, Identities = 49/136 (36%), Positives = 76/136 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G ELK  +I  L+++ +   D G  E D    YP  A  +A  ++ N    GILICGTG+G+ + ANK  GI AA + DS +A  AR+ +DA+++ + +  + P   + ++D +L + F GGR   +V
  S:     3 IAIGCDEMGYELKQTLITRLKEKNIAFTDFGSFE-DEKVLYPSIAEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKV 137
>gi|182416005|ref|YP_001821071.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Opitutus terrae PB90-1] >gi|177843219|gb|ACB77471.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Opitutus terrae PB90-1] (145 aa)
Score = 221, Expect = 5.6e-17, Identities = 48/139 (34%), Positives = 71/139 (51%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G   K  +   L     +V D G T  D   DYPD+   +A+ +       GI++ G+G G  + AN+ +G+   L  + + A   R H+D NVL +  R +   E I+I   +L  +FEGGRH+ R+ KI
  S:     6 IAIGSDHAGFAYKEALRAALTADGHKVRDFG-TYSDAACDYPDFIRPVAEAVARGEFERGIVLGGSGNGEAIVANRVRGVRCGLCWNEQVAKWNRSHNDGNVLSIGQRTISEAEAIQIARVWLATEFEGGRHAARIAKI 143
>gi|15965978|ref|NP_386331.1| ribose-5-phosphate isomerase B [Sinorhizobium meliloti 1021] >gi|15075248|emb|CAC46804.1| Putative ribose 5-phosphate isomerase B [Sinorhizobium meliloti 1021] (145 aa)
Score = 221, Expect = 5.7e-17, Identities = 51/128 (39%), Positives = 76/128 (59%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQK-LQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE 134
           I I +D  G  L  ++  HL ++  L+V DL  T       Y D +  LAQT+ A  N  GILICGTG+GVC++ANK  GI AAL  D+ +A  A + ++A ++ + +R + PE    IVD +L ++F+
  S:     3 IAIGADSAGKPLLDVIAAHLAKRSDLEVKDLSQTGY-----YADLSRDLAQTITAGENERGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTWLASEFD 126
>gi|160914943|ref|ZP_02077157.1| hypothetical protein EUBDOL_00951 [Eubacterium dolichum DSM 3991] >gi|158433483|gb|EDP11772.1| hypothetical protein EUBDOL_00951 [Eubacterium dolichum DSM 3991] (149 aa)
Score = 221, Expect = 6.2e-17, Identities = 54/145 (37%), Positives = 80/145 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF-EGGRHSKRVGKIIAYERE 151
           I +A DH G + K +V   L +   +V D G      +D Y D+A   A+ + +     GI+ICGTG+GV + ANK KGI  AL  D  +A L R H+D+N+L + +R +  E   +IV  +++  F E  RH +R+ KI   E E
  S:     5 IAVACDHGGYDYKEIVKDLLLEMGHEVKDFGCPSTQSVD-YTDFAAPCAKAVASKEYDRGIVICGTGIGVSITANKVKGIRCALCSDPVSAQLTRLHNDSNMLAMGARIIGVEMMKEIVRVWVETPFSEDERHIRRIKKISELENE 149
>gi|53802779|ref|YP_112583.1| ribose 5-phosphate isomerase B [Methylococcus capsulatus str. Bath] >gi|53756540|gb|AAU90831.1| ribose 5-phosphate isomerase B [Methylococcus capsulatus str. Bath] (142 aa)
Score = 220, Expect = 8.5e-17, Identities = 50/136 (36%), Positives = 69/136 (50%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I IASDH G + K  +   L     +V+D G    D   DYP +    AQ + A     GI++ G+G G  + AN+ KG       + +TA L R H+DAN + +  R V  +   KIV+ FL   FEGGRH  R+
  S:     3 IGIASDHAGFDYKERLRAWLASLGHEVVDYGCFS-DERTDYPTWIRPCAQAVAAGEVERGIVLGGSGNGEAIVANRVKGCRCGYCFNEETAYLTRWHNDANCIAIGQRIVTLDMAKKIVETFLSTGFEGGRHIPRI 137
>gi|186457310|ref|ZP_02967621.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [bacterium Ellin514] >gi|184205896|gb|EDU02944.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [bacterium Ellin514] (151 aa)
Score = 219, Expect = 9.8e-17, Identities = 49/139 (35%), Positives = 75/139 (53%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I SDH G + K  +   L+Q   +V D G T  D   DYP +    A  +       GI++ G+G G  + AN+ KG+  AL  + ++A L RQH++AN++ +  R +  E   +IV  +L   FEGGRH +R+ +I
  S:     3 IAIGSDHAGFQYKEQIKDFLKQLGHEVRDFG-TNSDASVDYPLFIRPTALAVADGECERGIVLGGSGNGEAIVANRVKGVRCALCWNVESARLGRQHNNANMISIGQRMMTIETAFQIVQTWLDTPFEGGRHQRRIEEI 140
>gi|150375896|ref|YP_001312492.1| ribose-5-phosphate isomerase B [Sinorhizobium medicae WSM419] >gi|150030443|gb|ABR62559.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Sinorhizobium medicae WSM419] (148 aa)
Score = 218, Expect = 1.3e-16, Identities = 48/135 (35%), Positives = 74/135 (54%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKR 141
           I I SDH G  LK+ +I H+     +V D G  +  P+D +PD A  +  ++       G+++CGTGVG  +AANK KGI AA+  D  +A  + +HDD NV+C+ ++ V       +V  +L A+F      +R
  S:     3 IVIGSDHAGFPLKATIIDHIVSLGHEVHDAGSYDPSPVD-FPDIAKTVTSSIIDGKADRGLMVCGTGVGASIAANKVKGIRAAVCHDVHSAHQSVEHDDVNVMCIGAQIVGAWLAKDLVAAYLAAEFSTDEDFRR 136
>gi|160933921|ref|ZP_02081308.1| hypothetical protein CLOLEP_02783 [Clostridium leptum DSM 753] >gi|156866594|gb|EDO59966.1| hypothetical protein CLOLEP_02783 [Clostridium leptum DSM 753] (149 aa)
Score = 218, Expect = 1.3e-16, Identities = 49/136 (36%), Positives = 77/136 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  D  G  LK ++I  L+++ ++V D G  + D +  YP+ A  +A  +       GILICGTG+G+ MAANK KGI AA+  D  +   +R+ +DA ++C+ +R + PE    +V  +L   F GG  + +V
  S:     3 IAIGCDEAGCGLKHIIIDLLQKEGIEVTDEGCRD-DEVVLYPNIAERVANIVADGEADRGILICGTGIGMAMAANKVKGIRAAVCHDPFSTERSRKSNDAQIMCMGARVIGPELAKMLVKLWLTCDFAGGGSAPKV 137
>gi|167766845|ref|ZP_02438898.1| hypothetical protein CLOSS21_01353 [Clostridium sp. SS2/1] >gi|167711599|gb|EDS22178.1| hypothetical protein CLOSS21_01353 [Clostridium sp. SS2/1] (150 aa)
Score = 218, Expect = 1.3e-16, Identities = 46/145 (31%), Positives = 82/145 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I +  D    +LK  + +HL++   +VID G  E + ++ YPD A    + +       GIL+CGTG+G+ M ANK  GI AA+  D  +   +   +DANV+C+ +R + P+  + ++D ++   F+ G  + +V +I+ Y++E
  S:     3 ISLGCDEAAYQLKETIKQHLQEAGHEVIDNGVGEGE-VELYPDVAVRTCKKVTDGTCDRGILVCGTGIGMAMTANKVPGIRAAVCHDPFSTERSILSNDANVMCMGARVIAPQLALYLLDIWMGLTFKNGPSTPKVERIMEYQKE 146
>gi|149190854|ref|ZP_01869118.1| ribose-5-phosphate isomerase B [Vibrio shilonii AK1] >gi|148835314|gb|EDL52287.1| ribose-5-phosphate isomerase B [Vibrio shilonii AK1] (148 aa)
Score = 217, Expect = 1.5e-16, Identities = 50/145 (34%), Positives = 83/145 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDD--YPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  D   ++LK  +  HL  + ++ +D G   +DP +   YPD A  ++  + A  +  GI++CGTG+GV + ANK  GI AAL  D+ +A  AR+ +DA ++ + SR +  E    I+D +L ++F  G  + +V +I   E+E
  S:     2 IAIGCDDAAVDLKECLKAHLAAKGIEYVDYG---IDPENASLYPDIAKEVSLAVSAGKHERGIILCGTGIGVSIVANKVPGIRAALCHDTFSAERARKSNDAQIITMGSRVIGSELAKAILDTWLDSEFSDGPSTPKVNRIKEIEKE 145
>gi|167757590|ref|ZP_02429717.1| hypothetical protein CLORAM_03140 [Clostridium ramosum DSM 1402] >gi|167702587|gb|EDS17166.1| hypothetical protein CLORAM_03140 [Clostridium ramosum DSM 1402] (151 aa)
Score = 217, Expect = 1.8e-16, Identities = 48/136 (35%), Positives = 78/136 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQ-KLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I +DH  +E K+++ +++E +   +VI+ G T+     +YP     +A  +       GI+ICGTGVG+ +AANK  GI      +  +A L+R+H++ N+L   +R V  E    IVD +L  ++EGGRH  R+
  S:     3 IGIGNDHVAVEYKNVIREYIEAKYGYEVINYG-TDSSERFNYPVSGEAVANAVVNGEVDKGIVICGTGVGISLAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVGIELAKMIVDAWLTGEYEGGRHQVRI 138
>gi|167755422|ref|ZP_02427549.1| hypothetical protein CLORAM_00936 [Clostridium ramosum DSM 1402] >gi|167704361|gb|EDS18940.1| hypothetical protein CLORAM_00936 [Clostridium ramosum DSM 1402] (150 aa)
Score = 216, Expect = 2.1e-16, Identities = 48/136 (35%), Positives = 78/136 (57%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQ-KLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I +DH  +E K+++ +++E +   +VI+ G T+     +YP     +A  +       GI+ICGTGVG+ +AANK  GI      +  +A L+R+H++ N+L   +R V  E    IVD +L  ++EGGRH  R+
  S:     3 IGIGNDHVAVEYKNVIREYIEAKYGYEVINYG-TDSSERFNYPVSGEAVANAVVNGEVDKGIVICGTGVGISLAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVGIELAKMIVDAWLTGEYEGGRHQVRI 138
>gi|150397350|ref|YP_001327817.1| ribose-5-phosphate isomerase B [Sinorhizobium medicae WSM419] >gi|150028865|gb|ABR60982.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Sinorhizobium medicae WSM419] (145 aa)
Score = 216, Expect = 2.4e-16, Identities = 50/128 (39%), Positives = 75/128 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQK-LQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFE 134
           I I +D  G  L  ++  HL  +  L+V DL  +       Y D +  LAQT+ A  N  GILICGTG+GVC++ANK  GI AAL  D+ +A  A + ++A ++ + +R + PE    IVD +L ++F+
  S:     3 IAIGADSAGKPLLDVIAAHLATKSGLEVKDLSQSGY-----YADLSRDLAQTITAGENERGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTWLASEFD 126
>gi|148927499|ref|ZP_01810995.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [candidate division TM7 genomosp. GTL1] >gi|147887153|gb|EDK72625.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [candidate division TM7 genomosp. GTL1] (151 aa)
Score = 215, Expect = 3.2e-16, Identities = 47/135 (34%), Positives = 82/135 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYA-----FLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEEN--IKIVDEFLQAQF-EGGRHSKR 141
           I++ SDH G  LK  V  +L +    V D+G   LDP DD+P++A      ++ +  + +P +  IL+CG G G+ MAAN+ +GI A+++ D+  A + R  +D+N+LCL +  +  +E     I++ +L   F +  R+ +R
  S:     3 IFLGSDHRGFHLKEKVFAYLSKHNYDVEDIGDKVLDPNDDFPEFAQAATLKVIGEDEKNDPRA--ILLCGGGQGMAMAANRFRGIRASVIHDANEAKMTRNDNDSNILCLPADQLEDDEEALYGIIETWLNTPFAKAARYVRR 143
>gi|36958662|gb|AAQ87130.1| Ribose 5-phosphate isomerase [Rhizobium sp. NGR234] (145 aa)
Score = 212, Expect = 7.2e-16, Identities = 52/144 (36%), Positives = 80/144 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLE-QQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYER 150
           I I +D  G  L  ++  HL  +  ++V DL          Y D +  LA+T+ A  N  GILICGTG+GVC++ANK  GI AAL  D+ +A  A + ++A ++ + +R + PE    IVD +L A+F+   +    G + A +R
  S:     3 IAIGADSAGKPLLDVIAAHLAGRSDVEVKDLSQAGF-----YADLSEHLAKTITAGENDRGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTWLAAEFD--PYGPSAGNVQAIDR 140
>gi|88799496|ref|ZP_01115073.1| ribose 5-phosphate isomerase B [Reinekea sp. MED297] >gi|88777806|gb|EAR09004.1| ribose 5-phosphate isomerase B [Reinekea sp. MED297] (141 aa)
Score = 211, Expect = 9.4e-16, Identities = 46/139 (33%), Positives = 76/139 (54%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + +A DH G   K  + K L ++ + V D G    +P+D YPD     A+ +  N    GI++ G+G    + AN+ +GI  A+V + +TA L+  H + N++ +  R +   + + IVD +L A F GGRH +R+ KI
  S:     3 VALACDHAGFYYKESIRKALLERGVSVQDFGAHSEEPVD-YPDIVRPAAEAVARNDCQRGIIVGGSG-NEAIVANRIRGIRCAVVWNLRTAELSMAHGNCNMIAIGQRMMTETDALAIVDHWLAATFAGGRHQRRIDKI 139
>gi|167747860|ref|ZP_02419987.1| hypothetical protein ANACAC_02589 [Anaerostipes caccae DSM 14662] >gi|167652682|gb|EDR96811.1| hypothetical protein ANACAC_02589 [Anaerostipes caccae DSM 14662] (149 aa)
Score = 210, Expect = 1.0e-15, Identities = 46/145 (31%), Positives = 77/145 (53%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I  D    ELK  + K LE+     +D G  E      YPD A    + + +     GIL+CGTG+G+ M ANK  GI AA+  D  +   +   +D NV+C+ +R + P+  + ++D ++  +F+ G  +++V +I  YE++
  S:     3 ISIGCDEAAYELKEAIKKRLEETGHTYVDNG-VEAGETALYPDVAVKTCERVASGECDRGILVCGTGIGMAMTANKVPGIRAAVCHDPFSTERSILSNDGNVMCMGARVIAPQLALYLLDIWMGLEFKDGPSTEKVERITYYEKQ 146
>gi|152969679|ref|YP_001334788.1| ribose-5-phosphate isomerase B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954528|gb|ABR76558.1| ribose-5-phosphate isomerase B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (152 aa)
Score = 210, Expect = 1.1e-15, Identities = 44/145 (30%), Positives = 79/145 (54%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           I I +D      +  ++ +L    + V D    +      YPD A  +A +++   +  GILICGTG+G+ + ANK  G+ AA   D+ +A  AR+ ++A ++ L +R +  E   KI+  +L++++EGG  + +V +I  YE +
  S:     4 IAIGADDAAYAFRDSIVAYLNGLGINVADYSSDKRQGSTVYPDVAHAVAMSIKQGEHERGILICGTGIGMSIVANKVPGVRAAQCHDTFSAERARKSNNAQIITLGARVIGAELGKKIIQAWLESEYEGGGSAPKVERIDYYEHQ 148
>gi|89209942|ref|ZP_01188336.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] >gi|89160594|gb|EAR80248.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] (158 aa)
Score = 209, Expect = 1.3e-15, Identities = 50/148 (33%), Positives = 82/148 (55%)
  Q:     4 NHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYA-FLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
           N    I SD+ G  LK ++ + LE + L+  D+G         YP+ A  ++ +  ++N    GILICGTG+G+ + ANK   I AA+  D  +A  AR  +D NV+ + +R + P    KI+ E+L  +F+ GR + ++ +I  YE +
  S:     6 NKQYVIGSDNAGYPLKEIIKELLESEGLEYEDVGVDSDQDKTIYPEIAERVVNRIKKSNYEKEGILICGTGIGMAITANKFSRIYAAVCHDVYSAERARLSNDTNVITMGARVIGPVLAKKIIREWLSLEFKPGRSTPKLKQIKKYENQ 154
>gi|187604384|ref|ZP_02990593.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Exiguobacterium sp. AT1b] >gi|187483630|gb|EDU21625.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Exiguobacterium sp. AT1b] (171 aa)
Score = 208, Expect = 1.7e-15, Identities = 50/136 (36%), Positives = 75/136 (55%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           I I  DH   ++K  ++++LE Q  +VID G  + +    YP Y   +A+ +  N    GI+ICGTGVG+  +ANK +G+ A LV D  TA +AR+  DANV+ +  R        +IVD FL   +     SK++
  S:     3 IAIGCDHIVTDIKDEMVQYLEAQGHEVIDCGTYDFERTH-YPIYGRRVAEQVVTNEAERGIVICGTGVGITTSANKVQGVRAPLVRDVTTAKMARKQLDANVIGIGGRITGLGLMQEIVDVFLSTPYVETEESKQL 137
>gi|24379889|ref|NP_721844.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus mutans UA159] >gi|125909|sp|P26423|LACA_STRMU Galactose-6-phosphate isomerase subunit lacA >gi|24377865|gb|AAN59150.1|AE014981_7 galactose-6-phosphate isomerase, subunit LacA [Streptococcus mutans UA159] >gi|153673|gb|AAA26904.1| galactosidase acetyltransferase (142 aa)
Score = 208, Expect = 2.0e-15, Identities = 49/137 (35%), Positives = 75/137 (54%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I SD  G  LK ++   L+    +V+D+  TE   LD + D    +   +Q N  +LGI I   G G  M A K KG++AA V D ++A + R H++A ++ L +  V  E    IV +F++A+++GGRH  RV
  S:     2 AIIIGSDAAGKRLKDVIKTFLKDNNHEVLDV--TERKDLD-FVDSTLAVVHEVQKNDKNLGIAIDAYGAGSFMVATKVKGMIAAEVSDERSAYMTRGHNNARIITLGAEIVGDELAKNIVKDFVEAKYDGGRHQIRV 135
>gi|150383798|ref|ZP_01922512.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Victivallis vadensis ATCC BAA-548] >gi|150259775|gb|EDM97004.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Victivallis vadensis ATCC BAA-548] (572 aa)
Score = 207, Expect = 2.5e-15, Identities = 47/139 (33%), Positives = 75/139 (53%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGG-RHSKRVGKI 145
           + IA+DH G   K  +   LE +  +VID GP EL+  DDYPD+    A+ +        IL+C +GVG+ + AN+  G+ AA+  D++ A  +R H+ +NVL L    +       +V+ +    F G  RH +R+ K+
  S:    14 VAIATDHGGFAQKPELAAFLEAKGCKVIDCGPFELNQGDDYPDFGAPAARAVARGEADCAILVCRSGVGMGIVANRFHGVRAAIARDAEVAKKSRVHNCSNVLVLPGDDLDFAAMKPVVEAWFSTPFSGDERHVRRLAKV 153
>gi|169177797|ref|ZP_02839310.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Arthrobacter chlorophenolicus A6] >gi|169014274|gb|EDS60836.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Arthrobacter chlorophenolicus A6] (498 aa)
Score = 206, Expect = 2.8e-15, Identities = 45/102 (44%), Positives = 65/102 (63%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDY----AFLLAQTMQANPNSLGILICGTGV-GVCMAANKAKGILAALVVDSKTAALARQHDDANV 108
           ++IA+DH G+EL + ++ HL  +   V+D GP   D  DDYP +    A  +    QA  ++LGI++ G+G   V   ANK KG+ AAL  +  TA LAR+H+DANV
  S:   342 VHIATDHAGMELSAHLVSHLTAKGYDVVDHGPKAYDAQDDYPSFCINAALAVVADQQAGVHALGIVLGGSGQRRVPPPANKVKGVRAALAWNLSTATLAREHNDANV 448
>gi|193214774|ref|YP_001995973.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chloroherpeton thalassium ATCC 35110] >gi|193088251|gb|ACF13526.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chloroherpeton thalassium ATCC 35110] (219 aa)
Score = 204, Expect = 4.7e-15, Identities = 47/139 (33%), Positives = 79/139 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           + + SDHTG+ELK  + + L ++  +VID+G T+ +   +  DYAF + + ++    + G++I GTGV   M  NK  G+ AA+  +  TA  AR   DANVL L ++ +  +  + I + F    FEG ++  R+ K+
  S:    66 VALGSDHTGVELKDALRQMLSEKNFRVIDMG-TDTNTHCELLDYAFSIGEAVRHKRAAFGVMIDGTGVESAMMLNKFPGVRAAMCHNEFTARAARTRIDANVLTLGAKTLGEDIALSIAETFFDTAFEGVQNQPRLNKL 203
>gi|172058700|ref|YP_001815160.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Exiguobacterium sibiricum 255-15] >gi|171991221|gb|ACB62143.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Exiguobacterium sibiricum 255-15] (146 aa)
Score = 204, Expect = 4.7e-15, Identities = 58/143 (40%), Positives = 86/143 (60%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYE 149
           + I +DH G +LK+ + + L++  +   D G    + + DYPD A  +A+ +       GILICGTG+G+ +AANK KGI AALV D+ +A   RQH+++N+L +  R + P     I   +L+ +FEGGRH  RV KI  YE
  S:     3 VAIGADHGGFKLKAELNELLQELGIDYTDFGTYSSESI-DYPDVAIPVAEAVANGEFDRGILICGTGIGIGIAANKVKGIRAALVHDTFSAKATRQHNNSNILTMGERVIGPGLARDIAKIWLETEFEGGRHENRVCKISDYE 144
>gi|29376376|ref|NP_815530.1| galactose-6-phosphate isomerase subunit LacA [Enterococcus faecalis V583] >gi|81436879|sp|Q833U3|LACA_ENTFA Galactose-6-phosphate isomerase subunit lacA >gi|29343839|gb|AAO81600.1| galactose-6-phosphate isomerase, LacA subunit [Enterococcus faecalis V583] (142 aa)
Score = 204, Expect = 5.4e-15, Identities = 44/136 (32%), Positives = 79/136 (58%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
           + + SD  G++LK+ + ++L Q+K++VID   +     +D+ +    +A  +  +  SLGI+  G G G  M A K KG++ A + D ++A +AR+H++A ++ + ++ V  E    I+ EFL   + GGRH  RV
  S:     3 VILGSDLDGIKLKAEMKQYLLQEKVEVIDKSES---ASEDFIEATLAVAHEVLKDTESLGIVFDGYGAGSFMTAAKIKGMIVAELSDERSAYMAREHNNARMITVGAKIVGTELAKNIIKEFLTGHYAGGRHQIRV 135
>gi|22538069|ref|NP_688920.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus agalactiae 2603V/R] >gi|25011957|ref|NP_736352.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus agalactiae NEM316] >gi|76786951|ref|YP_330485.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus agalactiae A909] >gi|77405046|ref|ZP_00782146.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae H36B] >gi|77412191|ref|ZP_00788512.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae CJB111] >gi|77414255|ref|ZP_00790416.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae 515] >gi|81453045|sp|Q8DXC0|LACA_STRA5 Galactose-6-phosphate isomerase subunit lacA >gi|81455812|sp|Q8E344|LACA2_STRA3 Galactose-6-phosphate isomerase subunit lacA 2 >gi|84029330|sp|Q3JZ18|LACA_STRA1 Galactose-6-phosphate isomerase subunit lacA >gi|22534973|gb|AAN00793.1|AE014278_20 galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae 2603V/R] >gi|24413499|emb|CAD47577.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562008|gb|ABA44592.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae A909] >gi|77159707|gb|EAO70857.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae 515] >gi|77161768|gb|EAO72758.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae CJB111] >gi|77176340|gb|EAO79109.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae H36B] (141 aa)
Score = 203, Expect = 6.5e-15, Identities = 46/137 (33%), Positives = 73/137 (53%)
  Q:     6 PIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRV 142
            I I +D  G+ELK ++ +HL     ++IDL     D   D+ D    +   +    ++LGI++   GVG  M A K KG++AA V D ++A + R H++A ++ L S  V P     IV+ F+   ++ GRH  RV
  S:     2 TIIIGADAHGVELKEVIRQHLTSLGKEIIDL----TDTSKDFVDNTLAIVAKVNQKEDNLGIMVDAYGVGPFMVATKVKGMIAAEVSDERSAYMTRAHNNARMITLGSEIVGPGVAKHIVEGFVDGTYDAGRHQIRV 134
>gi|52424438|ref|YP_087575.1| RpiB protein [Mannheimia succiniciproducens MBEL55E] >gi|52306490|gb|AAU36990.1| RpiB protein [Mannheimia succiniciproducens MBEL55E] (150 aa)
Score = 203, Expect = 7.6e-15, Identities = 46/139 (33%), Positives = 74/139 (53%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I  D     LK  ++KHL++  ++  D G  E D +  YPD A  +A  +        IL CGTG+G+C+ ANK  GI AA+  D  +   +R+ +DA ++CL  R +  E    ++D + + +F GG  + +V +I
  S:     3 IAIGCDEAAYRLKVEIMKHLDELGIEYDDFGAGEGDVVL-YPDVAEAVAVAVAEGKYQRAILTCGTGIGMCITANKVPGIRAAVCYDVFSTERSRKSNDAQIMCLGERVIGVELAKSLIDVWFKCEFAGGGSAPKVKRI 140
>gi|167767575|ref|ZP_02439628.1| hypothetical protein CLOSS21_02094 [Clostridium sp. SS2/1] >gi|167710867|gb|EDS21446.1| hypothetical protein CLOSS21_02094 [Clostridium sp. SS2/1] (150 aa)
Score = 202, Expect = 8.1e-15, Identities = 47/139 (33%), Positives = 79/139 (56%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQK-LQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKI 145
           I I  D     LK ++I HL  +  +++ D G  E   +  YPD A ++A+ + +     GIL+CGTG+G+C+ ANK  GI AA+  D  +   +R+ ++A ++C+  R + PE    +VD +L+  F GG  + +V +I
  S:     3 IAIGCDEAAYSLKKIIIDHLSNRDDVELKDFG-AEAGEVVLYPDVAKVVAEAVASGEFERGILVCGTGIGMCITANKIPGIRAAVCHDPFSTERSRKSNNAQIMCMGERVIGPELAKYLVDIWLKCDFAGGGSTPKVNRI 141
>gi|75764688|ref|ZP_00744108.1| Ribose 5-phosphate isomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487825|gb|EAO51621.1| Ribose 5-phosphate isomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] (104 aa)
Score = 201, Expect = 1.2e-14, Identities = 41/99 (41%), Positives = 61/99 (61%)
  Q:     7 IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDD 105
           + IASDH G+ ++  ++  LE+  ++ IDLG        DYPD+AF  A+ +       GIL+CGTG+G+ +AANK  GI  ALV D+ +A   R+H+D
  S:     3 VVIASDHGGMNIRKELVSLLEELNIEYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSAKATREHND 101