>gi|13508337|ref|NP_110287.1| F0F1 ATP synthase subunit beta [Mycoplasma pneumoniae M129] >gi|2493024|sp|Q50331|ATPB_MYCPN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|1209766|gb|AAC43659.1| ATP synthase beta chain >gi|1673912|gb|AAB95892.1| ATP synthase beta chain [Mycoplasma pneumoniae M129] (475 aa)
Score = 2493, Expect = 0.0e+00, Identities = 475/475 (100%), Positives = 475/475 (100%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK 475
           MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK
  S:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK 475
>gi|12045261|ref|NP_073072.1| F0F1 ATP synthase subunit beta [Mycoplasma genitalium G37] >gi|2506209|sp|P47639|ATPB_MYCGE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|3844991|gb|AAC71627.1| ATP synthase F1, beta subunit [Mycoplasma genitalium G37] >gi|166078639|gb|ABY79257.1| ATP synthase F1, beta subunit [synthetic Mycoplasma genitalium JCVI-1.0] (476 aa)
Score = 2302, Expect = 0.0e+00, Identities = 432/469 (92%), Positives = 453/469 (96%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           +KKEN+TYGKVHQVIGPVVDVIF+ES QLPR+YDCLSV+L   ELFLEA QLIGDDIVRCIALGPTEGLARN KVTNYNHPIEVPVGKNVLGRMFNVLG+PIDGKE LPKKP+L IHR PP+FD+Q NT++IFETGIKVIDLLTPY RGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKT LVFGQMNEPPGARMRVALTALTMAEYFRDHDNQ+VLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA EMG+LQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDP++VGINHYKVALGVQNILQRFAELQDIIAILGIDEL+DEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYV L+DT+QSFKEIL+GKHD LPEQAFF+VGTIQEAVEKAKRL +
  S:     2 IKKENLTYGKVHQVIGPVVDVIFSESKQLPRVYDCLSVQLKKSELFLEATQLIGDDIVRCIALGPTEGLARNVKVTNYNHPIEVPVGKNVLGRMFNVLGEPIDGKEPLPKKPKLSIHRNPPAFDEQPNTVDIFETGIKVIDLLTPYVRGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTVLVFGQMNEPPGARMRVALTALTMAEYFRDHDNQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAIEMGKLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPSVVGINHYKVALGVQNILQRFAELQDIIAILGIDELSDEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVSLNDTVQSFKEILEGKHDHLPEQAFFYVGTIQEAVEKAKRLNQ 470
>gi|31544510|ref|NP_853088.1| F0F1 ATP synthase subunit beta [Mycoplasma gallisepticum R] >gi|461567|sp|P33253|ATPB_MYCGA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|44302|emb|CAA45551.1| adenosinetriphosphatase [Mycoplasma gallisepticum] >gi|31541355|gb|AAP56656.1| AtpD [Mycoplasma gallisepticum R] (471 aa)
Score = 1899, Expect = 0.0e+00, Identities = 367/463 (79%), Positives = 409/463 (88%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           +YGKV+QV+GPVVDV+F +   LP+IYDCL +     +L LE AQLIGDDI RCIA+GPTEGLARN KVT+ N PI VPVG  VLGRMFNV+G+PID K+ +     ++ IHR  PSF DQSN LEIFETGIKVIDLL PYA+GGKIGLFGGAGVGKTVLVQELIHNIA  H GLSVFAGVGERTREGNDLYYEMI+GGVIDKTALVFGQMNEPPGARMRVALT LTMAEYFRD +NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA EMG LQERI STK+GSITSVQAIYVPADDLTDPAP+TTFTHLDAKTVLDRNIA+LGIFPA+NPL+STSRLLDP++VGI HY+ A  VQ ILQ+F ELQDIIAILGIDEL++EDK+ V RAR+IRNFLSQPFFVAEKFSG  GKYVP+S+TI+ F EI++GKHDDLPEQAFF+VG+I EA+E+AK L +
  S:     6 SYGKVYQVVGPVVDVVFEKQDDLPKIYDCLIIDEPNMKLHLEVAQLIGDDIARCIAMGPTEGLARNVKVTSTNQPISVPVGTEVLGRMFNVIGEPIDEKKPIDASVKRMSIHRPAPSFADQSNELEIFETGIKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSVFAGVGERTREGNDLYYEMIEGGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDVNNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAEEMGSLQERITSTKSGSITSVQAIYVPADDLTDPAPSTTFTHLDAKTVLDRNIASLGIFPAVNPLDSTSRLLDPSVVGIQHYQTARKVQMILQKFLELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSGNKGKYVPISETIKGFSEIVEGKHDDLPEQAFFYVGSIDEAIERAKTLTR 469
>gi|1361451|pir||B64244 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - Mycoplasma genitalium (382 aa)
Score = 1854, Expect = 0.0e+00, Identities = 350/376 (93%), Positives = 366/376 (97%)
  Q:    94 MFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           MFNVLG+PIDGKE LPKKP+L IHR PP+FD+Q NT++IFETGIKVIDLLTPY RGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKT LVFGQMNEPPGARMRVALTALTMAEYFRDHDNQ+VLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA EMG+LQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDP++VGINHYKVALGVQNILQRFAELQDIIAILGIDEL+DEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYV L+DT+QSFKEIL+GKHD LPEQAFF+VGTIQEAVEKAKRL +
  S:     1 MFNVLGEPIDGKEPLPKKPKLSIHRNPPAFDEQPNTVDIFETGIKVIDLLTPYVRGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTVLVFGQMNEPPGARMRVALTALTMAEYFRDHDNQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAIEMGKLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPSVVGINHYKVALGVQNILQRFAELQDIIAILGIDELSDEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVSLNDTVQSFKEILEGKHDHLPEQAFFYVGTIQEAVEKAKRLNQ 376
>gi|77964181|gb|ABB13426.1| ATP synthase subunit beta [Clostridium paradoxum] (465 aa)
Score = 1777, Expect = 0.0e+00, Identities = 334/466 (71%), Positives = 389/466 (83%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           M  +N+  GKV Q+IGPV+D+ F+ S  LP + + + +   G ++  E AQ IGDD VRCIA+  T+GL R     +  + I VPVG+  LGR+FNVLG P+D K E+   P+LPIHR  PSF+DQ    EI ETGIKV+DL+ PYA+GGKIGLFGGAGVGKTVL+ ELI+NIAKEH GLSVF+GVGERTREGNDLY+EMI  GVIDKT LV+GQMNEPPGARMRVALT LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R IAALGI+PA++PL+STSR+LDPNIVG  HY+VA GVQ++LQR+ ELQDIIAILG+DEL+DEDK+IV RAR+I+ FLSQPF VAE+F+G+AGKYVPL +TI+ F+EIL+GKHDDLPE AF +VGTI EAVEKAK+
  S:     1 MPDKNV--GKVVQIIGPVLDIKFS-SDNLPNLLNAIEIYHEGRKIVAEVAQHIGDDTVRCIAMSSTDGLVRGIDAIDTGNAISVPVGRKTLGRIFNVLGDPVDNKPEVEDAPKLPIHRPAPSFEDQETATEILETGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELINNIAKEHGGLSVFSGVGERTREGNDLYHEMIDSGVIDKTTLVYGQMNEPPGARMRVALTGLTMAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQIAALGIYPAVDPLDSTSRILDPNIVGREHYEVARGVQSVLQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFSVAEQFTGMAGKYVPLKETIRGFREILEGKHDDLPESAFLYVGTIDEAVEKAKK 463
>gi|81846246|sp|Q8EWY8.1|ATPB_MYCPE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|26453520|dbj|BAC43852.1| ATP synthase subunit beta [Mycoplasma penetrans HF-2] (778 aa)
Score = 1771, Expect = 0.0e+00, Identities = 336/451 (74%), Positives = 385/451 (85%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQE 459
           G ++Q+ GPVVDV F  + Q+P I DCL VKL   ++L LE A L GDD+ RCI++G TEGL R  +V N  +PI  PVG  VLGRMFNV+G+PID K  +P+K +  PIH+KPPSFD+QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVLVQELIHNIA  H GLS+FAGVGERTREGNDLY+EMI GGVI++TALVFGQMNEPPGARMRVALTALTMAE+FR+++ QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERI STK+GSITSVQA+YVPADDLTDPAP+TTF HLDAKTVLDR IA+LGI+PAINPLES+SR+LDP+IVGI HYKVA  VQ ILQ+F ELQDIIAILGIDEL++EDK+ V RAR+IRNFLSQPFFVAEKFS  +GKYV   DTI  F EI++GK DD+PEQ F +VG I +
  S:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
>gi|160914778|ref|ZP_02076992.1| hypothetical protein EUBDOL_00785 [Eubacterium dolichum DSM 3991] >gi|158433318|gb|EDP11607.1| hypothetical protein EUBDOL_00785 [Eubacterium dolichum DSM 3991] (466 aa)
Score = 1768, Expect = 0.0e+00, Identities = 336/460 (73%), Positives = 386/460 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ QVIGPVVD+ F E  +LP +   + + L  ++ L +E +Q  GDD VRCIA+G T+GL R  +  +   PI VPVGK VLGRMFNVLG+ IDG  ++    +LPIHR  P+FD+Q  + E+ ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELIHNIAKEH G+SV  GVGERTREGND+Y+EM   GV+DKT LV+GQMNE PGARMRV LT LTMAE+FRDHD+QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITSVQAIYVPADDLTDPAPAT FTHLDAKTVLDR+IAALGI+PA++PLES+SR+LDP +VG  HY+VA GVQ ILQR+ ELQDIIAILG+DEL++EDKIIV RARR+RNFLSQPF VAE FSGI G YV   DTI+SFKE+L GK+DDLPEQAF FV TI++AVEKAK L+
  S:     6 GKIVQVIGPVVDITF-EDGELPALLTAIEIPLKDQDSLVVEVSQHTGDDRVRCIAMGSTDGLVRGMEAIDTGAPISVPVGKEVLGRMFNVLGREIDGLGKVEAATKLPIHRAAPTFDEQQTSAEMLETGIKVIDLLCPYAKGGKIGLFGGAGVGKTVLIQELIHNIAKEHGGMSVVTGVGERTREGNDMYHEMKDSGVLDKTVLVYGQMNESPGARMRVGLTGLTMAEHFRDHDHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKNGSITSVQAIYVPADDLTDPAPATAFTHLDAKTVLDRDIAALGIYPAVDPLESSSRILDPLVVGEEHYEVARGVQEILQRYKELQDIIAILGMDELSEEDKIIVNRARRVRNFLSQPFHVAEVFSGIKGCYVSREDTIRSFKELLAGKYDDLPEQAFMFVATIEDAVEKAKTLE 465
>gi|110004066|emb|CAK98405.1| atp synthase beta chain protein [Spiroplasma citri] (465 aa)
Score = 1764, Expect = 0.0e+00, Identities = 339/460 (73%), Positives = 384/460 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GKV QV+GPVVDV FTE   LP +Y+ ++V   G +L LE  Q IGDD VR IALGPTEG+ R   V +   PI VPVG+ VLGRMFNVLG+ ID K +   K   PIHR+ PS+++Q  T  I ETGIKV+DLL P+A+GGKIGLFGGAGVGKTVLVQELI+N+AK H G+SVFAGVGERTREGNDLYYEMI+ GVIDKTALVFGQMNE PGARMRVALT LT+AEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVP+DDLTDPAPATTF HLDAK VLDR IAALGI+PA++PL S+SRLLDP +VG  HY+VA GVQ ILQ+F ELQ IIAILG+DEL+DEDK+ V RAR+IRNFLSQ FFVAEKFSG  GKYVP+ +TI++FKEIL GK+DDLPEQAF +VGTI E V+ A+ LK
  S:     5 GKVVQVLGPVVDVRFTEE-YLPELYNAITVNNNGTKLVLEVVQHIGDDTVRAIALGPTEGMVRGMDVIDTKAPITVPVGEEVLGRMFNVLGEAIDEKPQPKTKLMRPIHREAPSYEEQQTTAAILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLVQELINNVAKAHGGISVFAGVGERTREGNDLYYEMIEAGVIDKTALVFGQMNETPGARMRVALTGLTIAEYFRDDKNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSIQAVYVPSDDLTDPAPATTFAHLDAKVVLDREIAALGIYPAVDPLGSSSRLLDPLVVGEEHYEVARGVQEILQKFKELQSIIAILGMDELSDEDKLAVARARKIRNFLSQSFFVAEKFSGKTGKYVPVVETIRAFKEILTGKYDDLPEQAFLYVGTIDEVVKVAEALK 463
>gi|161723286|ref|NP_757448.2| F0F1 ATP synthase subunit beta [Mycoplasma penetrans HF-2] (489 aa)
Score = 1755, Expect = 0.0e+00, Identities = 335/451 (74%), Positives = 381/451 (84%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQE 459
           G ++Q+ GPVVDV F  + Q+P I DCL VKL   ++L LE A L GDD+ RCI++G TEGL R  +V N  +PI  PVG  VLGRMFNV+G+PID K    K    PIH+KPPSFD+QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVLVQELIHNIA  H GLS+FAGVGERTREGNDLY+EMI GGVI++TALVFGQMNEPPGARMRVALTALTMAE+FR+++ QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERI STK+GSITSVQA+YVPADDLTDPAP+TTF HLDAKTVLDR IA+LGI+PAINPLES+SR+LDP+IVGI HYKVA  VQ ILQ+F ELQDIIAILGIDEL++EDK+ V RAR+IRNFLSQPFFVAEKFS  +GKYV   DTI  F EI++GK DD+PEQ F +VG I +
  S:    11 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 461
>gi|164688908|ref|ZP_02212936.1| hypothetical protein CLOBAR_02556 [Clostridium bartlettii DSM 16795] >gi|164602112|gb|EDQ95577.1| hypothetical protein CLOBAR_02556 [Clostridium bartlettii DSM 16795] (463 aa)
Score = 1753, Expect = 0.0e+00, Identities = 328/457 (71%), Positives = 382/457 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GK+  ++G V+DV F     LP + + L +KL  +E+  E AQ IGDD VRCIA+  T+GL R  +V +   PI VPVG   LGR+FNVLG+P+DG E     P+ PIHR  P F++ + + EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+N+AK+H G+SVF+GVGERTREGNDLY+EM + GV++KTALVFGQMNEPPGARMRVAL+ LTMAEYFRD +NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDAKTVL R+IA+LGI+PA++PLESTSR+LDPNIVG  HY VA GVQ+ILQR+ ELQDIIAILG+DEL DEDK+IV RAR+I+ FLSQPF V E+F+GI GKYVP+ +TI+ FKEIL+GKHDDLPE AF FVGTI EAVEK K
  S:     5 GKIVSIVGVVLDVKFENEQSLPNLLNALVIKLGDQEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVIDTGKPIAVPVGDKTLGRIFNVLGEPVDGFEAPKDAPRDPIHRPAPEFNEIAGSAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNVAKQHGGISVFSGVGERTREGNDLYFEMKESGVLNKTALVFGQMNEPPGARMRVALSGLTMAEYFRDKENQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKQGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLSRSIASLGIYPAVDPLESTSRVLDPNIVGEEHYAVARGVQSILQRYKELQDIIAILGMDELGDEDKLIVARARKIQRFLSQPFTVGEQFTGIPGKYVPVKETIRGFKEILEGKHDDLPESAFLFVGTIDEAVEKGK 461
>gi|196164031|ref|ZP_03124562.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-23m63] (464 aa)
Score = 1750, Expect = 0.0e+00, Identities = 326/457 (71%), Positives = 383/457 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GKV Q++G V+DV F     LP + + L +KL  +E+  E AQ IGDD VRCIA+  T+GL R  +V +   PI VPVG   LGR+FNVLGKP+DGK      P+LPIHR  P++D+   T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAK+H G+SVF+GVGERTREGNDLY EM + GVI+KTALVFGQMNEPPGARMRVALT LTMAE+FRD   QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDAKTVL R I++LGI+PA++PLESTSR+LDP+IVG  HY+VA GVQ+ILQR+ ELQDIIAILG+DEL+DEDK+IV RAR+I+ FLSQ F VAE+F+G  G+YVP+ +T++ FKEIL+GKHDDLPE AF FVGTI++AV+KAK
  S:     5 GKVVQIVGAVLDVKFDSEQSLPNLLNALVIKLGDKEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVVDTGGPISVPVGDETLGRIFNVLGKPVDGKPAPKSAPKLPIHRPAPAYDELETTAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKQHGGISVFSGVGERTREGNDLYGEMSESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLSRQISSLGIYPAVDPLESTSRILDPSIVGKEHYEVARGVQSILQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQSFTVAEQFTGNPGQYVPVKETVRGFKEILEGKHDDLPESAFLFVGTIEDAVKKAK 461
>gi|126701091|ref|YP_001089988.1| F0F1 ATP synthase subunit beta [Clostridium difficile 630] >gi|145952622|ref|ZP_01801631.1| hypothetical protein CdifQ_04003998 [Clostridium difficile QCD-32g58] >gi|168697757|ref|ZP_02730034.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-37x79] >gi|168714972|ref|ZP_02747249.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-63q42] >gi|168726392|ref|ZP_02758669.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-76w55] >gi|168730162|ref|ZP_02762439.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-97b34] >gi|196124975|ref|ZP_03116724.1| F0F1 ATP synthase subunit beta [Clostridium difficile ATCC 43255] >gi|196162325|ref|ZP_03122886.1| F0F1 ATP synthase subunit beta [Clostridium difficile CIP 107932] >gi|123066472|sp|Q180W5.1|ATPB_CLOD6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|115252528|emb|CAJ70371.1| ATP synthase beta chain [Clostridium difficile 630] (464 aa)
Score = 1749, Expect = 0.0e+00, Identities = 326/457 (71%), Positives = 382/457 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GKV Q++G V+DV F     LP + + L +KL  +E+  E AQ IGDD VRCIA+  T+GL R  +V +   PI VPVG   LGR+FNVLGKP+DGK      P+LPIHR  P++D+   T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAK+H G+SVF+GVGERTREGNDLY EM + GVI+KTALVFGQMNEPPGARMRVALT LTMAE+FRD   QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDAKTVL R I++LGI+PA++PLESTSR+LDP+IVG  HY+VA GVQ+ILQR+ ELQDIIAILG+DEL+DEDK+IV RAR+I+ FLSQ F VAE+F+G  G+YVP+ +T++ FKEIL+GKHDDLPE AF FVGTI++AV KAK
  S:     5 GKVVQIVGAVLDVKFDSEQSLPNLLNALVIKLGDKEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVVDTGGPISVPVGDETLGRIFNVLGKPVDGKPAPKSAPKLPIHRPAPAYDELETTAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKQHGGISVFSGVGERTREGNDLYGEMSESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLSRQISSLGIYPAVDPLESTSRILDPSIVGKEHYEVARGVQSILQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQSFTVAEQFTGNPGQYVPVKETVRGFKEILEGKHDDLPESAFLFVGTIEDAVRKAK 461
>gi|47459043|ref|YP_015905.1| F0F1 ATP synthase subunit beta [Mycoplasma mobile 163K] >gi|81828479|sp|Q6KI82|ATPB_MYCMO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|47458372|gb|AAT27694.1| ATP synthase beta chain [Mycoplasma mobile 163K] (470 aa)
Score = 1738, Expect = 0.0e+00, Identities = 332/460 (72%), Positives = 384/460 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q++GP+VDV F E+ QLP++ + L+++    ++ LE AQ IG+D+VR IA+  TEGL RN +V +   PI VPVGKNVL  MFNV+G+ ID +   P   +  IHRK PS+++Q+ T EI ETGIKVIDLL PY +GGKIGLFGGAGVGKTVLVQELI+NIA  H GLSVFAGVGERTREGNDLYYEM   GV+DKTALVFGQMNEPPGARMRVAL+ LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GSITS+QA+YVPADDLTDPAPATTF HLDA+TVLDRNIA+LGI+PAI+PL S SR+L  +IVG  HYK+A  VQ ILQ+F ELQDIIAILG+DEL+DEDK IV RAR+IRNFLSQPF VAEKFSGI G +V LSDT++SF++ILDGK+DDL E AF +VGTI+EA  K K LK
  S:     5 GKIIQILGPIVDVKFNEN-QLPKLLNALTIEFEKTKITLEVAQHIGNDVVRTIAMSSTEGLVRNLEVIDTEAPISVPVGKNVLSHMFNVIGENIDNQSIDPNTEKWSIHRKAPSYEEQTATSEILETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELINNIAVHHGGLSVFAGVGERTREGNDLYYEMKASGVLDKTALVFGQMNEPPGARMRVALSGLTMAEYFRDELNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTRKGSITSIQAVYVPADDLTDPAPATTFIHLDAQTVLDRNIASLGIYPAIDPLASASRMLSADIVGEEHYKIAREVQRILQKFKELQDIIAILGMDELSDEDKNIVYRARKIRNFLSQPFHVAEKFSGIKGTFVKLSDTLRSFRDILDGKYDDLDESAFLYVGTIEEA--KQKHLK 461
>gi|15828737|ref|NP_326097.1| F0F1 ATP synthase subunit beta [Mycoplasma pulmonis UAB CTIP] >gi|81855822|sp|Q98QU5|ATPB1_MYCPU ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|14089679|emb|CAC13439.1| ATP SYNTHASE BETA CHAIN [Mycoplasma pulmonis] (475 aa)
Score = 1734, Expect = 0.0e+00, Identities = 335/465 (72%), Positives = 387/465 (83%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           M ++N+  GK+ Q++GPVVD+ F    ++P IY+ L +     +   E AQ IGD++VR I++  T GL+R  +V +   PI VPVGK VL RMFNVLG+ ID K E+  K    IH   PS+++Q+++ EI ETGIKVIDLL PY++GGKIGLFGGAGVGKTVLVQELI+NIA +H GLSVFAGVGERTREGNDLY+EMI  GV+DKT LVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDAKTVL+RNIAALGI+PAI+PL S+SR+LDP I+G  HY VAL VQNILQRF ELQDIIAILGI EL++EDK +V RAR+IRNFLSQPF VAEKFSG  GK+VPL +TI+SFKEIL+GKHD+LPE AF +VG+I EA+EKAK
  S:     1 MSQKNV--GKIVQILGPVVDISFA-GQKIPAIYNNLELVFENNKYNFEVAQHIGDEVVRTISMVSTNGLSRGLEVIDTGAPIMVPVGKEVLSRMFNVLGQTIDNKGEIEAKEFRSIHASAPSYEEQNDSSEILETGIKVIDLLVPYSKGGKIGLFGGAGVGKTVLVQELINNIATQHGGLSVFAGVGERTREGNDLYHEMIASGVLDKTTLVFGQMNEPPGARMRVALTGLTMAEYFRDKFKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLERNIAALGIYPAIDPLASSSRMLDPLIIGNEHYLVALEVQNILQRFKELQDIIAILGIGELSEEDKKLVFRARKIRNFLSQPFTVAEKFSGKKGKFVPLKETIRSFKEILEGKHDNLPEDAFLYVGSIDEAIEKAK 462
>gi|193216472|ref|YP_001999714.1| ATP synthase beta subunit [Mycoplasma arthritidis 158L3-1] >gi|193001795|gb|ACF07010.1| ATP synthase beta subunit [Mycoplasma arthritidis 158L3-1] (503 aa)
Score = 1727, Expect = 0.0e+00, Identities = 336/459 (73%), Positives = 381/459 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL---AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPID-GKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G + Q++G V+DV F E ++ PRI + L V L         LE AQ IG+D VR IA+  T GL R  KV +   PI VPVGK VL RMFNVLG+PID G  E   K  +PIHR PPS+++Q +TLEIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVFAGVGERTREGNDLY+EM   GV+DKTALVFGQMNEPPGARMR   TALTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TSVQAIYVPADDLTDPAPATTFTHLDAKTVLDR+IAALGI+PAI+PL S SR++DPN++G+ HY +A  VQNILQRF ELQDIIAILG+ EL++EDK IV RARRIRNFLSQPFFVAEKFSG AG+Y+ L+DTI+SF  IL GK+D+LPE+AF +VGTI + + KA+ L
  S:    36 GYISQILGAVIDVRF-EENKAPRILNALEVVLDDPNAPRQVLEVAQHIGNDTVRTIAMNLTIGLKRGMKVKDLGAPISVPVGKKVLSRMFNVLGEPIDTGAIEFNVK--MPIHRTPPSYEEQKSTLEIFETGIKVIDLLMPYVKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFAGVGERTREGNDLYHEMKASGVLDKTALVFGQMNEPPGARMRAPFTALTMAEYFRDTMGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSVTSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRDIAALGIYPAIDPLASNSRMMDPNVIGLEHYNIARKVQNILQRFKELQDIIAILGMHELSEEDKKIVARARRIRNFLSQPFFVAEKFSGYAGRYIKLADTIRSFAAILSGKYDNLPEEAFLYVGTIDDVIAKAQEL 495
>gi|150388193|ref|YP_001318242.1| F0F1 ATP synthase subunit beta [Alkaliphilus metalliredigens QYMF] >gi|172052470|sp|A6TK65.1|ATPB_ALKMQ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|149948055|gb|ABR46583.1| ATP synthase F1, beta subunit [Alkaliphilus metalliredigens QYMF] (464 aa)
Score = 1722, Expect = 0.0e+00, Identities = 321/458 (70%), Positives = 380/458 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           GK+ Q+IG VVD+ F+ S ++P +   ++++     + +E AQ IGDD  RC+A+  T+GL R  +  +   PI VPVG+  LGR+FNVLG+ +D  + +  K  LPIHR+ PSF++Q    EIFETGIKV+DL+ PYARGGK+GLFGGAGVGKTVL+ ELI+NIAKEH GLSVFAGVGERTREGNDLY+EMI+ GVIDKT+LV+GQMNEPPGARMRV LT LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SR+LDP  VG  HY+VA GVQ +LQR+ ELQDIIAILG+DEL+DEDK+ V RARR++ FLSQPFFVAE+F+G+AGKYVPL +TI+ FKEILDGKHDDLPE AF FVG+I EAVEKA +
  S:     7 GKLVQIIGAVVDIRFS-SEEIPALLSAITIQGPDGLVTVEVAQHIGDDTARCVAMRSTDGLVRGMEAIDTGAPITVPVGRETLGRIFNVLGEVVDEGKPVEAKMHLPIHREAPSFEEQEAATEIFETGIKVVDLIAPYARGGKVGLFGGAGVGKTVLIMELINNIAKEHGGLSVFAGVGERTREGNDLYHEMIESGVIDKTSLVYGQMNEPPGARMRVGLTGLTMAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVDPLDSNSRILDPATVGQEHYEVARGVQEVLQRYKELQDIIAILGMDELSDEDKLTVARARRVQRFLSQPFFVAEQFTGMAGKYVPLKETIRGFKEILDGKHDDLPESAFLFVGSIDEAVEKANK 463
>gi|193214200|ref|YP_001995399.1| ATP synthase F1, beta subunit [Chloroherpeton thalassium ATCC 35110] >gi|193087677|gb|ACF12952.1| ATP synthase F1, beta subunit [Chloroherpeton thalassium ATCC 35110] (465 aa)
Score = 1722, Expect = 0.0e+00, Identities = 327/462 (70%), Positives = 387/462 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ Q+IGPVVDV F +  QLP I D L V+   G EL LE  Q +G++ VR IA+  TEGL R  KV N  +PI+ PVG+NVLGRM NV+GKPIDG  E+       IHR  P+FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL+ EM + GVIDKTALVFGQMNEPPGAR RVALTAL++AEYFRD +N+DVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQAIYVPADDLTDPAPATTFTHLDA TVL R+IA LGI+PA++PL+STSR+LDPNI+G +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE+F+G+ GKYV L DTI++FKEI++G+HD LPE AF+ VGTI++A++KAK+L+ A
  S:     4 GKITQIIGPVVDVDFVDG-QLPSIMDALIVERPDGTELVLETQQHLGEERVRTIAMEATEGLVRGMKVVNTKNPIQTPVGENVLGRMLNVVGKPIDGLGEVHATKTYSIHRPSPAFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVALTALSIAEYFRDEENRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERIVSTKKGSITSVQAIYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIIGRDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLLVARARKVQRFLSQPFFVAEQFTGLEGKYVRLEDTIKAFKEIIEGRHDSLPENAFYLVGTIEDAIKKAKQLQNA 465
>gi|193211720|ref|YP_001997673.1| ATP synthase F1, beta subunit [Chlorobaculum parvum NCIB 8327] >gi|1168573|sp|P42465|ATPB_CHLVI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|560823|emb|CAA54200.1| ATPase beta-subunit [Prosthecochloris vibrioformis] >gi|193085197|gb|ACF10473.1| ATP synthase F1, beta subunit [Chlorobaculum parvum NCIB 8327] (462 aa)
Score = 1719, Expect = 0.0e+00, Identities = 324/459 (70%), Positives = 380/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L+V +  G +L LE  Q +G++ VR I++  T+GL R   V N   PI+ PVG  VLGRM NV+G+PIDGK  +P K   PIHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAKE SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD + +DVLLFIDNIFRFTQAG+EVSALLGRMPSAVGYQPTL TEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT FTHLDA TVL R IA LGI+PA++PL+STSR+LDPNI+G +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L DTI+ FKEI+ GKHD LPE AF+ VGTI+EAVEKAK+L
  S:     4 GKISQIIGPVVDVDFPEG-QLPSILDALTVTRQDGSKLVLETQQHLGEERVRTISMEGTDGLVRGMSVANTGRPIQAPVGAEVLGRMLNVVGEPIDGKGPVPSKKSYPIHRSAPKFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKEQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGAEVSALLGRMPSAVGYQPTLGTEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIIGNDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGKHDSLPENAFYLVGTIEEAVEKAKKL 462
>gi|14715606|gb|AAK72443.1|AF283808_8 ATP synthase beta subunit [Clostridium pasteurianum] (465 aa)
Score = 1716, Expect = 0.0e+00, Identities = 333/462 (72%), Positives = 383/462 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GKV QVIGPV+D+ F  S  LP IY+ L + +  + L  E  Q IGDD+VR I++ PT+GL R  K  +   PI VPVGK VLGR+FNVLGK ID   +L      PIHR PPSF++QS   E+FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GVIDKTALVFGQMNEPPGARMRVALT LTMAE FRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R+I+ LGI+PA++PLES+SR+LDPNIVG  HY+VA  V+ IL+R+ ELQDIIAILG+DEL++ED+ IV RARRI+ FLSQPF VAE+F+G+ GK+V +SDTI+ FKEIL+GK DDLPE AF FVGTI+EA EKAK + ++
  S:     6 GKVVQVIGPVIDIKFA-SENLPNIYNALEIGMGDKILIAEVEQHIGDDVVRAISMEPTDGLRRGAKAVDTEKPISVPVGKPVLGRLFNVLGKTIDEAGDLKDDEYYPIHRLPPSFEEQSVVPEMFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEKFRD-EGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKHGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSISELGIYPAVSPLESSSRILDPNIVGEEHYQVASKVKLILERYNELQDIIAILGVDELSEEDRAIVNRARRIQRFLSQPFSVAEQFTGMQGKFVSVSDTIKGFKEILEGKCDDLPEAAFLFVGTIEEAREKAKSMMES 465
>gi|158430153|pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|158430154|pdb|2QE7|E Chain E, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|158430155|pdb|2QE7|F Chain F, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|33329387|gb|AAQ10090.1| ATP synthase subunit beta [Bacillus sp. TA2.A1] (462 aa)
Score = 1705, Expect = 0.0e+00, Identities = 320/459 (69%), Positives = 386/459 (84%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G++ QV+GPVVD+ F ES QLP IY+ +++ +  G  L +EAA  +GD++VRC+A+  T+GL R  +  +   PI VPVGK  LGR+FNVLG+PID + E+  + + PIHR  P F++ S   EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI+N+A+EH GLSVFAGVGERTREGNDLY+EM   GVI KT++VFGQMNEPPGAR+RVALT LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QAIYVPADD TDPAPATTF HLDA T L+R +A +GI+PA++PL STSR+L P +VG  HY+VA GVQ +LQR+ +LQDIIAILG+DEL+DEDK+IV RAR+I+ FLSQPF VAE+F+G+ GKYVP+ +T++ FKEIL+GKHD+LPE+AF+ VGTI EAVEKAK+L
  S:     4 GRIIQVMGPVVDIQF-ESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
>gi|21675043|ref|NP_663108.1| F0F1 ATP synthase subunit beta [Chlorobium tepidum TLS] >gi|25452812|sp|Q8KAC9.1|ATPB2_CHLTE ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|21648279|gb|AAM73450.1| ATP synthase F1, beta subunit [Chlorobium tepidum TLS] (462 aa)
Score = 1704, Expect = 0.0e+00, Identities = 323/459 (70%), Positives = 379/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L+V +  G +L LE  Q +G++ VR IA+  T+GL R     N   PI+VPVG  VLGRM NV+G PIDGK  +P K    IHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFR+ + +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT FTHLDA TVL R IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L DTI+ FKEI+DG+HD+LPE AF+ VGTI+EAV KAK L
  S:     4 GKISQIIGPVVDVDFPEG-QLPSILDALTVTRQDGSKLVLETQQHLGEERVRTIAMEGTDGLVRGMSAVNTGKPIQVPVGGEVLGRMLNVVGDPIDGKGPVPAKKTYSIHRAAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFREEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGELQDRITSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIVGDDHYNTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIDGRHDNLPEAAFYLVGTIEEAVAKAKTL 462
>gi|158321580|ref|YP_001514087.1| F0F1 ATP synthase subunit beta [Alkaliphilus oremlandii OhILAs] >gi|172048246|sp|A8MJV9.1|ATPB_ALKOO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|158141779|gb|ABW20091.1| ATP synthase F1, beta subunit [Alkaliphilus oremlandii OhILAs] (464 aa)
Score = 1703, Expect = 0.0e+00, Identities = 316/457 (69%), Positives = 379/457 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GK+ Q+IGPV+D+ F+  + LP + + + ++    ++ +E +Q IGDD VRC+A+  T+GL R  +  +   PI VPVG+  LGR+FNV+G+P+D K  +  + + PIHR  PSF+DQ+ + EI ETGIKV+DL+ PY +GGKIGLFGGAGVGKTVL+ ELI+NIAKEH GLSVF+GVGERTREGNDLY EMI+ GVIDKTALV+GQMNEPPGARMRV LT LTMAE+FRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST+ GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I  LGI+PA++PL+S SR+LDP IVG  HY VA GVQ +LQR+ ELQDIIAILG+DEL+DEDK+ V RAR+I+ FLSQPF VAE+F+G+AGKYVPL +TI+ FKEIL+GKHDD+PE AF FVG+I EAVEKAK
  S:     7 GKLVQIIGPVIDIRFSREN-LPNLLNAIEIEGPDGKIVVEVSQHIGDDTVRCVAMKSTDGLVRGMEAKDTGGPITVPVGRATLGRIFNVIGEPVDEKGAVAAEAKAPIHRPAPSFEDQATSTEILETGIKVVDLIAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKEHGGLSVFSGVGERTREGNDLYNEMIESGVIDKTALVYGQMNEPPGARMRVGLTGLTMAEHFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQIVELGIYPAVDPLDSNSRVLDPAIVGDEHYSVARGVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFSVAEQFTGMAGKYVPLKETIRGFKEILEGKHDDIPESAFLFVGSIDEAVEKAK 462
>gi|78189967|ref|YP_380305.1| F0F1 ATP synthase subunit beta [Chlorobium chlorochromatii CaD3] >gi|118573520|sp|Q3AP13|ATPB_CHLCH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|78172166|gb|ABB29262.1| ATP synthase F1, beta subunit [Chlorobium chlorochromatii CaD3] (462 aa)
Score = 1703, Expect = 0.0e+00, Identities = 321/459 (69%), Positives = 379/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  +LP I D L+VK   G +L LE  Q +G++ VR +A+  T+GL R   V N    I+VPVG  VLGRM NV+G PIDG+  +  K    IHR  P F+D S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +N+DVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQ+RI STK GS+TSVQAIYVPADDLTDPAPAT FTHLDA TVL R+IA LGI+PA++PL+STSR+LDPN+VG +HY  A  V+ +LQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L DTI+ FKEI+ GKHD LPE AF+ VGTI+EA+EKAK L
  S:     4 GKISQIIGPVVDVDFPEG-RLPSILDALTVKREDGSKLVLETQQHLGEERVRTVAMESTDGLVRGMGVVNTGAAIQVPVGAEVLGRMLNVVGDPIDGRGPVNSKKTYSIHRSAPKFEDISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEENRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNVVGDDHYNTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGKHDKLPENAFYLVGTIEEAIEKAKTL 462
>gi|167755038|ref|ZP_02427165.1| hypothetical protein CLORAM_00542 [Clostridium ramosum DSM 1402] >gi|167705088|gb|EDS19667.1| hypothetical protein CLORAM_00542 [Clostridium ramosum DSM 1402] (468 aa)
Score = 1702, Expect = 0.0e+00, Identities = 319/459 (69%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+    GPV+D+ F   + LP +   + ++   E L +E AQ IGDD+VRC+A+GPT+G+ R     N  +PI VPVG   LGRMFNVLG+PIDGKE L     ++PIHR  P++ +Q    EI ETGIKV+DL+ P+ +GGKIGLFGGAGVGKTVL+QE I+NIA EH GLSVFAGVGER+REGNDLYYEM + GV+ KT LVFGQMNEPPGAR+RVALT LTMAE FRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PS  GYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDAK VLDR+IAALGI+PA++PL S+SR LDP +VG  HY+VA GVQ ILQRF ELQDIIAILG+DEL +EDK+ V RARR+RN+LSQPF VA +F+G+ GKYV ++DTI+ FKEIL+GKHDDLPEQAF  VGTI+EA+EKAK L
  S:     6 GKIISAKGPVIDIQFDGDNNLPALNTAIEIQNGDELLVVEVAQHIGDDVVRCVAMGPTDGVKRGMDALNTGNPISVPVGNETLGRMFNVLGQPIDGKEALGDSTKKMPIHRSAPTYAEQRTETEILETGIKVVDLICPFIKGGKIGLFGGAGVGKTVLIQEFINNIATEHGGLSVFAGVGERSREGNDLYYEMKESGVLSKTTLVFGQMNEPPGARLRVALTGLTMAEEFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRVPSQAGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDAKVVLDRSIAALGIYPAVDPLNSSSRALDPLVVGTEHYEVAHGVQQILQRFQELQDIIAILGMDELGEEDKLTVARARRVRNYLSQPFTVASQFTGMDGKYVRVADTIKGFKEILEGKHDDLPEQAFHNVGTIEEAIEKAKTL 465
>gi|189345587|ref|YP_001942116.1| ATP synthase F1, beta subunit [Chlorobium limicola DSM 245] >gi|189339734|gb|ACD89137.1| ATP synthase F1, beta subunit [Chlorobium limicola DSM 245] (462 aa)
Score = 1702, Expect = 0.0e+00, Identities = 323/459 (70%), Positives = 378/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLS-VKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L  V+  G  L LE  Q +G++ VR +A+  T+GL R   V N    I+VPVG  VLGRM NV+G+PIDGK  +  K    IHR  P F+D S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDLY+EM++ GVI+KTALVFGQMNEPPGAR RVALT L++AEYFRD +N+DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R+IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L +TI+ FKEI+ GKHD+LPE AF+ VGTI+EAVEKAK L
  S:     4 GKISQIIGPVVDVDFPEG-QLPSILDALYIVRPDGSRLVLETQQHLGEERVRTVAMESTDGLVRGLSVVNTGKSIQVPVGSEVLGRMLNVVGEPIDGKGAVNTKKTYSIHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLYHEMMESGVIEKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYNTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGKHDNLPENAFYLVGTIEEAVEKAKTL 462
>gi|194332903|ref|YP_002014763.1| ATP synthase F1, beta subunit [Prosthecochloris aestuarii DSM 271] >gi|194310721|gb|ACF45116.1| ATP synthase F1, beta subunit [Prosthecochloris aestuarii DSM 271] (462 aa)
Score = 1700, Expect = 0.0e+00, Identities = 324/459 (70%), Positives = 382/459 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L+V +  G +L LE  Q +GD+ VR IA+  TEGL R   V N   PI+VPVG+NVLGRM NV+G+PIDG  ++       IHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL+ EM + GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +++DVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTL TEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPATTFTHLDA TVL R+IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+I+ FLSQPFFVAE F+G++GKYV L DTI+ FKEI+ G+HD+LPE AF+ VGTI+EA+EKAK+L
  S:     4 GKISQIIGPVVDVDFPEG-QLPSILDALTVARPDGSKLVLETQQHLGDERVRAIAMEGTEGLVRGIPVINTGKPIQVPVGQNVLGRMLNVVGEPIDGMGDIDSDTTRSIHRSAPKFDELSTKSEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDVEHRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTEMGELQDRIVSTKDGSVTSVQAIYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKEILQRYKDLQDIIAILGMDELSDEDKLVVSRARKIQRFLSQPFFVAEAFTGLSGKYVKLEDTIKGFKEIIAGRHDNLPENAFYLVGTIEEAIEKAKKL 462
>gi|119355899|ref|YP_910543.1| F0F1 ATP synthase subunit beta [Chlorobium phaeobacteroides DSM 266] >gi|166201696|sp|A1BCJ2.1|ATPB_CHLPD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|119353248|gb|ABL64119.1| ATP synthase F1, beta subunit [Chlorobium phaeobacteroides DSM 266] (462 aa)
Score = 1700, Expect = 0.0e+00, Identities = 321/459 (69%), Positives = 380/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L++ +  G +L LE  Q +G++ VR +A+  T+GL R   VTN   PI+VPVG  VLGRM NV+G PIDG+  +       IHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +N+DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R+IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L +TI+ FKEI+ GKHD+LPE AF+ VGTI+EAV+KAK L
  S:     4 GKISQIIGPVVDVDFPEG-QLPSILDALTITRPDGTKLVLETQQHLGEERVRTVAMESTDGLIRGLSVTNTERPIQVPVGPEVLGRMLNVVGDPIDGRGSVHTSKTYSIHRSAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLDETIKGFKEIIAGKHDNLPESAFYLVGTIEEAVQKAKTL 462
>gi|187935792|ref|YP_001884711.1| ATP synthase F1, beta subunit [Clostridium botulinum B str. Eklund 17B] >gi|187723945|gb|ACD25166.1| ATP synthase F1, beta subunit [Clostridium botulinum B str. Eklund 17B] (463 aa)
Score = 1699, Expect = 0.0e+00, Identities = 324/459 (70%), Positives = 376/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GKV QVIGPVVD+ F +S  LP +Y+ +S+ +    L  E  Q +GDDIVR IA+  TEGL R     +    I VPVG  VLGR+FNVLGKPID   E+  +   PIHR  PSF DQ+   E+FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGER+REGNDLY+EM + GVIDKTALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDA TVL R+I  LGI+PA++PLES+SR+LDP +VG  HY VA  V+NIL+R+ ELQDIIAILG+DEL+DEDK +V RAR+++ FLSQPF V E+F+G+ GKYV + +TI+ FKEIL+GK+DDLPE AF F+G+++EAV+KAK L
  S:     6 GKVVQVIGPVVDIKF-DSDSLPNLYNAISIDMGERTLIAEVEQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDQVLGRLFNVLGKPIDNAGEVEAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDK-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPLESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKVQRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEEAVQKAKSL 462
>gi|188589828|ref|YP_001919898.1| ATP synthase F1, beta subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188500109|gb|ACD53245.1| ATP synthase F1, beta subunit [Clostridium botulinum E3 str. Alaska E43] (463 aa)
Score = 1699, Expect = 0.0e+00, Identities = 324/459 (70%), Positives = 376/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GKV QVIGPVVD+ F +S  LP +Y+ +S+ +    L  E  Q +GDDIVR IA+  TEGL R     +    I VPVG  VLGR+FNVLGKPID   E+  +   PIHR  PSF DQ+   E+FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGER+REGNDLY+EM + GVIDKTALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDA TVL R+I  LGI+PA++PLES+SR+LDP +VG  HY VA  V+NIL+R+ ELQDIIAILG+DEL+DEDK +V RAR+++ FLSQPF V E+F+G+ GKYV + +TI+ FKEIL+GK+DDLPE AF F+G+++EAV+KAK L
  S:     6 GKVVQVIGPVVDIKF-DSDSLPNLYNAISIDMGERTLIAEVEQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDKVLGRLFNVLGKPIDNAGEVEAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDK-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPLESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKVQRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEEAVQKAKSL 462
>gi|182420269|ref|ZP_02951498.1| ATP synthase F1, beta subunit [Clostridium butyricum 5521] >gi|182375864|gb|EDT73456.1| ATP synthase F1, beta subunit [Clostridium butyricum 5521] (463 aa)
Score = 1699, Expect = 0.0e+00, Identities = 325/460 (70%), Positives = 373/460 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GKV QVIGPV+D+ F +S  LP +Y+ + + +    L  E  Q +GDDIVR IA+  TEGL R  +  +   PI VPVGK VLGR+FNVLG PID    +  K   PIHR  PSF DQ+   E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGER+REGNDLY+EM   GVIDKTALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR PSAVGYQPTLATEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTFTHLDAKTVL R+I  LGI+PA++PLES+SR+LDP IVG  HYKVA  V+N+L+++ +LQDIIAILG+DEL DEDK +V RARRI+ FLSQPF V E+F+G+ GKYVP+ +TI+ FKEIL+GK+DDLPE AF F GTI++ +EKAK LK
  S:     6 GKVVQVIGPVIDIKF-DSDSLPNLYNSIHINMGEHTLVAEVEQHVGDDIVRAIAMEATEGLKRGMEAIDTGRPISVPVGKEVLGRLFNVLGNPIDNAGGVDAKESYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQKGGKTGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMKDSGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDK-GQDVLLFIDNIFRFTQAGSEVSALLGRTPSAVGYQPTLATEMGALQERITSTVNGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLSRSIVELGIYPAVDPLESSSRMLDPRIVGDEHYKVATEVKNVLEKYKQLQDIIAILGVDELGDEDKAVVARARRIQRFLSQPFTVGEQFTGMPGKYVPIKETIRGFKEILEGKYDDLPESAFLFAGTIEDVIEKAKTLK 463
>gi|110801467|ref|YP_699462.1| F0F1 ATP synthase subunit beta [Clostridium perfringens SM101] >gi|122956535|sp|Q0SQZ5.1|ATPB_CLOPS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|110681968|gb|ABG85338.1| ATP synthase F1, beta subunit [Clostridium perfringens SM101] (465 aa)
Score = 1697, Expect = 0.0e+00, Identities = 323/461 (70%), Positives = 386/461 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GKV QVIGPVVD+ F  + +LP I++ + +K+  G+ L  E  Q +GDDIVR IA+  TEGL R  +  +   PI VPVG+ VLGR+FNVLGKP+D   E+  + + PIHR  PSF++QS   ++FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGER+REGNDLYYEM++ GVI  TALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLATEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTF HLDAKTVL R+IA +GI+PA++PL+S+SR+LDP +VG  HY+VA  V++IL+R+ ELQDIIAILG+DELADEDK+IV RARRI+ FLSQPF VAE+F+G+ G+YVP+ +TI+ FKEIL+GKHD++PE AF FVGTI+E +EKA+ + +
  S:     6 GKVVQVIGPVVDIKFA-NDELPNIFNAIHIKMDDGKILVCEVEQHVGDDIVRTIAMEATEGLRRGVEAVDTGAPISVPVGECVLGRIFNVLGKPLDSGAEVNNEEKYPIHRPAPSFEEQSVVPQMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYYEMMESGVIKNTALVFGQMNEPPGARMRVALTGLTMAEYFRDQ-GQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTTHGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLSRSIAEIGIYPAVDPLDSSSRILDPRVVGEEHYEVASKVKHILERYKELQDIIAILGVDELADEDKLIVARARRIQKFLSQPFTVAEQFTGMQGRYVPIKETIRGFKEILEGKHDNVPESAFLFVGTIEEVLEKARTMAQ 465
>gi|145218847|ref|YP_001129556.1| F0F1 ATP synthase subunit beta [Prosthecochloris vibrioformis DSM 265] >gi|189081338|sp|A4SC45.1|ATPB_PROVI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|145205011|gb|ABP36054.1| ATP synthase F1, beta subunit [Prosthecochloris vibrioformis DSM 265] (462 aa)
Score = 1693, Expect = 0.0e+00, Identities = 320/459 (69%), Positives = 380/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D LS+ K  G ++ LE  Q +G++ VR +A+  T+GL R   V N   PI+ PVG+ VLGRM NV+G PIDG+  +  K    IHR  P F+D S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +N+DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R+IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G++GKYV L +TI+ FKEI+ GKHD+LPE AF+ VGTI+EA+EKAK L
  S:     4 GKISQIIGPVVDVDFPEG-QLPAILDALSIAKPDGTKIVLETQQHLGEERVRTVAMESTDGLIRGMAVENTGRPIQAPVGEGVLGRMLNVVGDPIDGRGPVDAKKTYSIHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKMILQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLSGKYVKLEETIKGFKEIIAGKHDNLPENAFYLVGTIEEAIEKAKTL 462
>gi|18311169|ref|NP_563103.1| F0F1 ATP synthase subunit beta [Clostridium perfringens str. 13] >gi|110800751|ref|YP_696866.1| F0F1 ATP synthase subunit beta [Clostridium perfringens ATCC 13124] >gi|168205576|ref|ZP_02631581.1| ATP synthase F1, beta subunit [Clostridium perfringens E str. JGS1987] >gi|168210117|ref|ZP_02635742.1| ATP synthase F1, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213709|ref|ZP_02639334.1| ATP synthase F1, beta subunit [Clostridium perfringens CPE str. F4969] >gi|168215816|ref|ZP_02641441.1| ATP synthase F1, beta subunit [Clostridium perfringens NCTC 8239] >gi|169344156|ref|ZP_02865138.1| ATP synthase F1, beta subunit [Clostridium perfringens C str. JGS1495] >gi|182623961|ref|ZP_02951749.1| ATP synthase F1, beta subunit [Clostridium perfringens D str. JGS1721] >gi|123148561|sp|Q0TNC4.1|ATPB_CLOP1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|20137355|sp|Q8XID4|ATPB_CLOPE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|18145852|dbj|BAB81893.1| ATP synthase beta subunit [Clostridium perfringens str. 13] >gi|110675398|gb|ABG84385.1| ATP synthase F1, beta subunit [Clostridium perfringens ATCC 13124] >gi|169297614|gb|EDS79714.1| ATP synthase F1, beta subunit [Clostridium perfringens C str. JGS1495] >gi|170662906|gb|EDT15589.1| ATP synthase F1, beta subunit [Clostridium perfringens E str. JGS1987] >gi|170711767|gb|EDT23949.1| ATP synthase F1, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714819|gb|EDT27001.1| ATP synthase F1, beta subunit [Clostridium perfringens CPE str. F4969] >gi|177910854|gb|EDT73208.1| ATP synthase F1, beta subunit [Clostridium perfringens D str. JGS1721] >gi|182382316|gb|EDT79795.1| ATP synthase F1, beta subunit [Clostridium perfringens NCTC 8239] (465 aa)
Score = 1693, Expect = 0.0e+00, Identities = 322/461 (69%), Positives = 385/461 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GKV QVIGPVVD+ F  + +LP I++ + +K+  G+ L  E  Q +GDDIVR IA+  TEGL R  +  +   PI VPVG+ VLGR+FNVLGKP+D   E+  + + PIHR  PSF++QS   ++FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGER+REGNDLYYEM++ GVI  TALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLATEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTF HLDAKTVL R+IA +GI+PA++PL+S+SR+LDP +VG  HY+VA  V++IL+R+ ELQDIIAILG+DELADEDK+IV RARRI+ FLSQPF VAE+F+G+ G+YVP+ +TI+ FKEIL+GKHD++PE AF F GTI+E +EKA+ + +
  S:     6 GKVVQVIGPVVDIKFA-NDELPNIFNAIHIKMDDGKILVCEVEQHVGDDIVRTIAMEATEGLRRGVEAVDTGAPISVPVGECVLGRIFNVLGKPLDSGAEVNNEEKYPIHRPAPSFEEQSVVPQMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYYEMMESGVIKNTALVFGQMNEPPGARMRVALTGLTMAEYFRDQ-GQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTTHGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLSRSIAEIGIYPAVDPLDSSSRILDPRVVGEEHYEVASKVKHILERYKELQDIIAILGVDELADEDKLIVARARRIQKFLSQPFTVAEQFTGMQGRYVPIKETIRGFKEILEGKHDNVPESAFLFAGTIEEVLEKARAMAQ 465
>gi|118445003|ref|YP_878996.1| F0F1 ATP synthase subunit beta [Clostridium novyi NT] >gi|171472992|sp|A0Q2Z4.1|ATPB_CLONN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118135459|gb|ABK62503.1| ATP synthase F1, beta subunit [Clostridium novyi NT] (464 aa)
Score = 1692, Expect = 0.0e+00, Identities = 318/459 (69%), Positives = 381/459 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QVIGPV+D+ F +S  LP IY+ + + +    L  E  Q IGDD+VR IA+  TEGL R  K  N   PI VPVG  +LGR+FNVLGK ID + E   +   PIHR  P+F++QS   E+FETGIKVIDL+ PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GVI+KTALVFGQMNEPPGARMRVALT LTMAEYFRD   Q+VLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+IA LGI+PA++PLESTSR+LDP ++G  HY VA+ V++IL+R+ ELQDIIAILG+DEL++EDK++V RAR+++ FLSQPF VAE+F+G+ GK+VP+ +T++ FKEI++GK+DD+PE AF FVG+I+EA+EKAK +
  S:     7 GRVVQVIGPVIDIKF-DSDCLPNIYNAIEIDMGDRILITEVEQHIGDDVVRTIAMESTEGLKRGMKAVNTEKPISVPVGSEILGRLFNVLGKTIDEEGEFKAEEYYPIHRPAPTFEEQSVEPEMFETGIKVIDLIAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDQ-GQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKHGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLESTSRILDPRVIGQEHYDVAINVKHILERYKELQDIIAILGVDELSEEDKLVVSRARKVQRFLSQPFTVAEQFTGMKGKFVPVKETVRGFKEIIEGKYDDVPEAAFLFVGSIEEALEKAKTM 463
>gi|150015308|ref|YP_001307562.1| F0F1 ATP synthase subunit beta [Clostridium beijerinckii NCIMB 8052] >gi|190358655|sp|A6LQH6.1|ATPB_CLOB8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|149901773|gb|ABR32606.1| ATP synthase F1, beta subunit [Clostridium beijerinckii NCIMB 8052] (463 aa)
Score = 1692, Expect = 0.0e+00, Identities = 323/459 (70%), Positives = 375/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GKV QVIGPV+D+ F +S  LP +Y+ + +K    EL  E  Q +GDDIVR IA+  TEGL R     +   PI VPVG+ VLGR+FNVLGKPID   ++  K + PIHR  PSF DQS   E+FETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+QELI+NIAK+H GLSVF GVGER+REGNDLY+EM + GVIDKTALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFR+TQAGSEVSALLGR PSAVGYQPTLATEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PLESTSR+LDP IVG  HYKVA  V+++L+++ +LQDIIAILG+DEL DEDK +V RARRI+ FLSQPF V E+F+G+ GKYVP+ +T++ FKEIL+GK+D+LPE AF F GTI + +EKAK+L
  S:     6 GKVVQVIGPVIDIKF-DSDSLPDLYNAIVIKAGDYELVAEVEQHVGDDIVRTIAMSATEGLKRGMDAVDTGAPISVPVGEEVLGRLFNVLGKPIDKCGDIEVKQEYPIHRPAPSFKDQSVEPEMFETGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKQHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDK-GQDVLLFIDNIFRYTQAGSEVSALLGRTPSAVGYQPTLATEMGALQERITSTVNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLESTSRILDPRIVGEEHYKVAADVKHVLEKYKQLQDIIAILGVDELGDEDKAVVARARRIQRFLSQPFTVGEQFTGLKGKYVPVKETVRGFKEILEGKYDELPESAFLFAGTIDDVIEKAKKL 462
>gi|169351551|ref|ZP_02868489.1| hypothetical protein CLOSPI_02331 [Clostridium spiroforme DSM 1552] >gi|169291773|gb|EDS73906.1| hypothetical protein CLOSPI_02331 [Clostridium spiroforme DSM 1552] (468 aa)
Score = 1692, Expect = 0.0e+00, Identities = 318/459 (69%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+    GPV+D+ F   + LP +   + ++   E L +E AQ IGDDIVRC+A+GPT+G+ R  +  +   PI VPVG   LGRMFNVLG+PIDGKE L     ++PIHR  P++  Q    EI ETGIKV+DL+ P+ +GGKIGLFGGAGVGKTVL+QE I+NIA +H GLSVFAGVGER+REGNDLYYEM + GV+ KT LVFGQMNEPPGAR+RVALT LTMAE FRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PS  GYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDAK VLDR+IAALGI+PA++PL S+SR LDP +VG  HY+VA GVQ ILQRF ELQDIIAILG+DEL +EDK+ V RARR+RN+LSQPF VA +F+G+ GKYV + DTI+ FKEIL+GKHDDLPEQAF  VGTI+EA+EKAK L
  S:     6 GKIISAKGPVIDIQFNSDNNLPALNTAIEIQNGEELLVVEVAQHIGDDIVRCVAMGPTDGVKRGMEAIDTRQPISVPVGNATLGRMFNVLGQPIDGKEALGDDVKKMPIHRSAPTYAQQRTETEILETGIKVVDLICPFIKGGKIGLFGGAGVGKTVLIQEFINNIATQHGGLSVFAGVGERSREGNDLYYEMKESGVLSKTTLVFGQMNEPPGARLRVALTGLTMAEEFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRVPSQAGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDAKVVLDRSIAALGIYPAVDPLNSSSRALDPLVVGKEHYEVAHGVQQILQRFQELQDIIAILGMDELGEEDKLTVARARRVRNYLSQPFTVASQFTGLDGKYVHIKDTIKGFKEILEGKHDDLPEQAFHNVGTIEEAIEKAKTL 465
>gi|160902211|ref|YP_001567792.1| F0F1 ATP synthase subunit beta [Petrotoga mobilis SJ95] >gi|190358699|sp|A9BFX3.1|ATPB_PETMO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|160359855|gb|ABX31469.1| ATP synthase F1, beta subunit [Petrotoga mobilis SJ95] (467 aa)
Score = 1690, Expect = 0.0e+00, Identities = 319/461 (69%), Positives = 377/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+  VIGPVVDV F E  QLP +YD L VK   +GEEL LE  QLIGDD  RC+A+  T+G+ R ++V N   PI+VPVG   LGRM N+LGKPID K ++  +   PIHR PPS ++Q  ++EI ETGIK IDLL P+ RGGKIG FGGAGVGKTVLV ELI NIAKEH G+SVFAGVGERTREGNDL+ EM + GVID TALVFGQMNEPPGAR RV LTALT++EYFRD   +DVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLA++MGQLQERI STK GSITSVQAIYVPADD TDPAPATTF HLDA   L R  + LG++PA++PL+STS++LDPN+VG +HY VA  V+ +LQR+ +LQDIIAILGI+EL++ED+ IV RARRI+ FL+QPFFVAE+F+  +GKYV + DTI+ FKEIL+GKHDDLPE AF+ VGTI+EAVEKAK++ +
  S:     6 GKIISVIGPVVDVKFPEG-QLPNVYDALKVKNEYSGEELILEVEQLIGDDTARCVAMDSTDGIRRGQEVINTLEPIKVPVGDTTLGRMVNLLGKPIDEKGDVEGEEYWPIHRDPPSLNEQDTSIEILETGIKCIDLLAPFPRGGKIGFFGGAGVGKTVLVMELIRNIAKEHQGISVFAGVGERTREGNDLWLEMQETGVIDSTALVFGQMNEPPGARFRVPLTALTISEYFRDRQKKDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLASDMGQLQERITSTKDGSITSVQAIYVPADDFTDPAPATTFAHLDANINLSRRQSELGLYPAVDPLDSTSKMLDPNVVGQDHYSVAREVKEVLQRYEDLQDIIAILGIEELSEEDRQIVNRARRIQRFLTQPFFVAERFTNYSGKYVNVEDTIKGFKEILEGKHDDLPESAFYMVGTIEEAVEKAKKMNE 467
>gi|168185932|ref|ZP_02620567.1| ATP synthase F1, beta subunit [Clostridium botulinum C str. Eklund] >gi|169295978|gb|EDS78111.1| ATP synthase F1, beta subunit [Clostridium botulinum C str. Eklund] (464 aa)
Score = 1690, Expect = 0.0e+00, Identities = 318/459 (69%), Positives = 381/459 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QVIGPV+D+ F +S  LP IY+ + + +    L  E  Q IGDD+VR IA+  TEGL R  K  N   PI VPVG  +LGR+FNVLGK ID + E   +   PIHR  P+F++QS   E+FETGIKVIDL+ PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GVI+KTALVFGQMNEPPGARMRVALT LTMAEYFRD   Q+VLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+IA LGI+PA++PLESTSR+LDP ++G  HY VA+ V++IL+R+ ELQDIIAILG+DEL++EDK++V RAR+++ FLSQPF VAE+F+G+ GK+VP+ +T++ FKEI++GK+DD+PE AF FVG+I+EA+EKAK +
  S:     7 GRVVQVIGPVIDIKF-DSDCLPNIYNAIEIDMGDRILITEVEQHIGDDVVRTIAMESTEGLKRGMKAVNTEKPISVPVGNEILGRLFNVLGKTIDEEGEFKAEEYYPIHRPAPTFEEQSVEPEMFETGIKVIDLVAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDQ-GQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKHGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLESTSRILDPRVIGQEHYDVAINVKHILERYKELQDIIAILGVDELSEEDKLVVSRARKVQRFLSQPFTVAEQFTGMKGKFVPVKETVRGFKEIIEGKYDDVPEVAFLFVGSIEEALEKAKTM 463
>gi|194335228|ref|YP_002017022.1| ATP synthase F1, beta subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194307705|gb|ACF42405.1| ATP synthase F1, beta subunit [Pelodictyon phaeoclathratiforme BU-1] (462 aa)
Score = 1689, Expect = 0.0e+00, Identities = 320/459 (69%), Positives = 380/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  +LP I D L+V  A G +L LE  Q +G++ VR +A+  T+GL R   VT+   PI+VPVG  VLGRM NV+G PIDG+  +  K    IHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD + +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R+IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ +LQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L +TI+ FKEI+ G+HD+LPE AF+ VGTI+EAVEKAK L
  S:     4 GKISQIIGPVVDVDFPEG-RLPSILDALTVTRADGTKLVLETQQHLGEERVRTVAMESTDGLVRGMNVTHTGKPIQVPVGLEVLGRMLNVVGDPIDGRGPVNTKKSYSIHRLAPRFDEISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGRHDNLPESAFYLVGTIEEAVEKAKTL 462
>gi|148377622|ref|YP_001256498.1| F0F1 ATP synthase subunit beta [Mycoplasma agalactiae PG2] >gi|148291668|emb|CAL59054.1| ATP synthase beta chain [Mycoplasma agalactiae PG2] (487 aa)
Score = 1689, Expect = 0.0e+00, Identities = 328/451 (72%), Positives = 370/451 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQE 459
           GKV Q++GPVVDV F +  QLP + + L +        LE AQ IGDD VR I++  T GL R   V +   PI VPVG  VLGRMF+VLG PID K+  P   ++PIH   PS+++QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVLVQELI+NIA+EH GLSVFAGVGERTREGNDLY EM+  GV++KTALVFGQMNEPPGARMRVALT LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIAST  GSITSVQA+YVPADDLTDPAPATTF HLDAKTVLDRNIAALGI+PA++PLES+SRLLD  ++G  HY+ A  V +ILQRF ELQDIIAILGI EL++EDK +V RARRIRNFLSQPFFVAEKFSG  GKYV   DT++SFKEILDGK+D  PE+ F +VG+I+E
  S:    18 GKVVQIVGPVVDVRFPKG-QLPSLLNALIINYGDNTYTLEVAQHIGDDTVRAISMVSTSGLPRGIDVYDTGAPISVPVGNKVLGRMFDVLGNPIDLKDA-PDAEKMPIHAPAPSYEEQSTESEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELINNIAREHGGLSVFAGVGERTREGNDLYNEMLASGVLEKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKEKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTNKGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLDRNIAALGIYPAVDPLESSSRLLDSLVIGQEHYETARRVVSILQRFKELQDIIAILGIGELSEEDKKVVARARRIRNFLSQPFFVAEKFSGKPGKYVKRDDTVRSFKEILDGKYDHCPEEFFLYVGSIEE 466
>gi|461565|sp|P35110|ATPB_CHLLI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|299279|gb|AAB25774.1| F-ATPase beta subunit [Chlorobium limicola] (462 aa)
Score = 1688, Expect = 0.0e+00, Identities = 319/459 (69%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L+V +  G +L LE  Q +G++ VR IA+  T+GL R     N   PI+VPVG+ VLGRM NV+G PIDGK  +  K    IHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAKE SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD + +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT FTHLDA TVL R IA LGI+PA++PL+STSR+LDPN++G +HY  A  V+ ILQR+ +LQDIIAILG+DEL+D+DK++V RAR+++ FLSQPFFVAE F+G+AGKYV L DTI+ FKEI+ G+HD+LPE AF+ VGTI+EAV K K L
  S:     4 GKISQIIGPVVDVDFAEG-QLPSILDALTVTRQDGSKLVLETQQHLGEERVRRIAMEGTDGLVRGMSAKNTGKPIQVPVGEEVLGRMLNVVGDPIDGKGPVLSKKSYSIHRTAPKFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKEQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGELQDRITSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDDDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGRHDNLPEAAFYLVGTIEEAVAKVKTL 462
>gi|153956279|ref|YP_001397044.1| F0F1 ATP synthase subunit beta [Clostridium kluyveri DSM 555] >gi|190358660|sp|A5N3H7.1|ATPB_CLOK5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|146349137|gb|EDK35673.1| AtpD [Clostridium kluyveri DSM 555] (464 aa)
Score = 1688, Expect = 0.0e+00, Identities = 322/462 (69%), Positives = 383/462 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GKV QVIGPVVD+ F E + LP IY+ +S++    ++  E AQ +GDDIVR I++  T+GL R     +   PI VPVGK VLGR+FN+LG+PID   E+      PIHR  PSF+DQS   E+FETGIKVIDL+ PY +GGKIGLFGGAGVGKTV++QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GVI+KTALVFGQMNEPPGARMRVALT LTMAE+FRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R+I+ +GI+PA++PL STSR+LDP +VG  HYKVA  V++IL+R++ELQDIIAILG+DEL++ED+++V RARRI+ FLSQPF VAE+F+G  GKYVP+ +TI+ FKEIL+GK+DDLPE AF F G+I E +E AK + K+
  S:     5 GKVVQVIGPVVDIKFDEEN-LPDIYNAISIESGNAKIITEVAQHLGDDIVRTISMESTDGLMRGMDALDIGAPISVPVGKPVLGRLFNMLGQPIDENGEVEADEYSPIHRPAPSFEDQSVKPEMFETGIKVIDLIAPYQKGGKIGLFGGAGVGKTVIIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMQESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRD-EGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGSLQERITSTKHGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSISEIGIYPAVDPLASTSRILDPRVVGEEHYKVASDVKHILERYSELQDIIAILGVDELSEEDRLVVIRARRIQRFLSQPFSVAEQFTGYEGKYVPIKETIRGFKEILEGKYDDLPETAFLFKGSIDEVIESAKNMVKS 464
>gi|167628982|ref|YP_001679481.1| F0F1 ATP synthase subunit beta [Heliobacterium modesticaldum Ice1] >gi|167591722|gb|ABZ83470.1| ATP synthase f1, beta subunit [Heliobacterium modesticaldum Ice1] (471 aa)
Score = 1687, Expect = 0.0e+00, Identities = 320/462 (69%), Positives = 379/462 (82%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELF---------LEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           + +GKV QVIGPVVD+ F    QLP IY+ + ++ A +E +         LEAAQ +G++ VRC+A+  T+GL R  K  +   PI VPVG  +LGRMFNVLG PID   ++  K   PIHRK P+F++   + E+ ETGIKVIDLL PYA+GGK+GLFGGAGVGKTVL+QELI+NIA E+SG SVFAGVGERTREGNDLY E  + G++   A+VFGQMNEPPGARMRVAL+ L MAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMGQLQERI STK GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP++VG  HY VA GVQ ILQR+ ELQDIIAILG+DEL+++DKI+V RAR+I+ FLSQPF VAE F+G  GK+VPL ++I+ FKEIL+GKHDDLPE AF+ VGTI+EAV KAK +
  S:     1 MNFGKVIQVIGPVVDIQFP-PGQLPEIYNAIKIRSADQENYQGSFEIDITLEAAQHLGNNAVRCVAMSSTDGLMRGMKALDTGAPISVPVGAEILGRMFNVLGDPIDEAGQVAAKEVWPIHRKAPTFENLEPSTEVLETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQELINNIAMEYSGYSVFAGVGERTREGNDLYNEFKESGILKNVAMVFGQMNEPPGARMRVALSGLVMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGQLQERITSTKNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRAIAELGIYPAVDPLDSTSRILDPHVVGDEHYSVARGVQKILQRYKELQDIIAILGMDELSEDDKIVVARARKIQRFLSQPFHVAEAFTGTPGKFVPLKESIRGFKEILEGKHDDLPESAFYMVGTIEEAVAKAKEM 470
>gi|83591194|ref|YP_431203.1| F0F1 ATP synthase subunit beta [Moorella thermoacetica ATCC 39073] >gi|118573697|sp|Q2RFX9|ATPB_MOOTA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|83574108|gb|ABC20660.1| ATP synthase F1, beta subunit [Moorella thermoacetica ATCC 39073] (462 aa)
Score = 1684, Expect = 0.0e+00, Identities = 317/459 (69%), Positives = 376/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QVIGPVVDV F  S +LP +Y+ +++K     + +EA Q +G++ VRC+AL  T+GL R  K  +   PI VPVG+  LGR+FNVLG+PID +  +    +LPIHR  PSF++Q  + E+ ETGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G SVF+GVGERTREGNDLY EM + GV++KTALVFGQMNEPPGAR+RV LT LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY+VA GVQ +LQR+ ELQDIIAILG+DEL++EDK+IV RAR+I+ FLSQPF VAE F+G  G YVPL +TI+ FKEIL+G+HD+LPEQAF+ VGTI EAV+K + L
  S:     4 GQVVQVIGPVVDVEFA-SDRLPDLYNAITIKTDKINITMEAMQHLGNNTVRCVALSSTDGLQRGMKAVDTGQPITVPVGRATLGRLFNVLGEPIDNQGPVETTERLPIHRPAPSFEEQQPSTEVLETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIAYEHGGFSVFSGVGERTREGNDLYLEMKESGVLEKTALVFGQMNEPPGARLRVGLTGLTMAEYFRDAEGQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRVLGEEHYQVARGVQQVLQRYKELQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFHVAEAFTGQPGVYVPLKETIRGFKEILEGRHDNLPEQAFYMVGTIDEAVKKGQEL 461
>gi|188587434|ref|YP_001918979.1| ATP synthase F1, beta subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352121|gb|ACB86391.1| ATP synthase F1, beta subunit [Natranaerobius thermophilus JW/NM-WN-LF] (475 aa)
Score = 1683, Expect = 0.0e+00, Identities = 317/460 (68%), Positives = 378/460 (82%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA----GE-----------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           +  GKV Q+IGP VD+ F E  +LP +Y+ + +K      GE           E+ LE AQ +GD++VRCIA+G T+G+ R  +  +   PI VPVG++ LGR+FN+ G  IDG+ E+  +   PIHR  P F+DQ  + EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTVL+QELI NIA EH G SVF+GVGERTREGNDL  EM + GVIDKTALVFGQMNEPPGARMRV LT LTMAEYFRD++ QDVLLFIDNIFRFTQAG EVSAL+GRMPSAVGYQPTL TEMG+LQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R+IA +GI+PA++PL S+SR+LDP IVG  HY VA GVQ +LQR+ ELQDIIAILG+DEL+DEDK+ V RAR+I+ FLSQPFFVAE+F+ + GKYVP+ +T++ F+EILDGKHDDLPE AF+ VGTI EAVEKA+
  S:     1 MNVGKVQQIIGPAVDIRF-EKGKLPELYNAIDIKAGLNDRGEPVSHEEGSRKIEVTLEVAQHLGDEVVRCIAMGSTDGIVRGMEAYDTGQPITVPVGRSTLGRVFNITGDTIDGQGEVEGEDYYPIHRDSPKFEDQETSTEILETGIKVLDLLVPYARGGKIGLFGGAGVGKTVLIQELIRNIAYEHGGFSVFSGVGERTREGNDLVLEMSESGVIDKTALVFGQMNEPPGARMRVGLTGLTMAEYFRDNEGQDVLLFIDNIFRFTQAGQEVSALMGRMPSAVGYQPTLQTEMGELQERITSTKKGSVTSIQAIYVPADDPTDPAPATTFAHLDASTYLERSIAEMGIYPAVDPLVSSSRILDPQIVGQEHYDVARGVQQVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFFVAEQFTNMPGKYVPVKETVRGFREILDGKHDDLPETAFYMVGTIDEAVEKAE 474
>gi|71894420|ref|YP_278528.1| F0F1 ATP synthase subunit beta [Mycoplasma synoviae 53] >gi|118573701|sp|Q4A604|ATPB_MYCS5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71851208|gb|AAZ43817.1| ATP synthase beta chain [Mycoplasma synoviae 53] (464 aa)
Score = 1683, Expect = 0.0e+00, Identities = 332/458 (72%), Positives = 379/458 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELF-LEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKP---QLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           GK+ Q++GPVVDV FT + +LP++ + L V+L  +E+F  E AQ IGDD VRCI++  T GL R   V +    I VPVGK VLGRMF+VLG PID   ELP +    +  IH   P+++ Q  T EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVLVQELI+NIA +H+GLSVF GVGERTREGNDLYYEM   GV+DKTALVFGQMNEPPGARMRVALT LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI ST++GSITSVQA+YVPADDLTDPAPATTF+HLDAKTVLDRN+AALGI+PAI+PLES+SRLLDP +VG  HYKVA  V NILQRF ELQDIIAILG+ EL++EDK IV RAR+IRNFLSQPF VAEKFSGI G YV LSDTI+SFKEIL+G  DD PE  F + G+I + + + K+
  S:     7 GKIIQILGPVVDVRFT-TGKLPKLLNALRVELPTKEVFTFEVAQHIGDDTVRCISMVSTNGLRRGLTVEDTGKAIMVPVGKQVLGRMFDVLGNPID---ELPLEEGGEKSSIHGPIPTYEQQKTTSEILETGIKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELINNIATQHNGLSVFTGVGERTREGNDLYYEMKAAGVLDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKQNQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTRSGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLDRNVAALGIYPAIDPLESSSRLLDPLVVGQEHYKVAQDVINILQRFKELQDIIAILGMGELSEEDKKIVARARKIRNFLSQPFTVAEKFSGIKGSYVKLSDTIRSFKEILNGNLDDYPEDIFRYAGSIDDVIARYKK 464
>gi|189499031|ref|YP_001958501.1| ATP synthase F1, beta subunit [Chlorobium phaeobacteroides BS1] >gi|189494472|gb|ACE03020.1| ATP synthase F1, beta subunit [Chlorobium phaeobacteroides BS1] (462 aa)
Score = 1682, Expect = 0.0e+00, Identities = 323/459 (70%), Positives = 374/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E   LP I D L+V +  G +L LE  Q +G++ VR I++  T+GL R   V N   PI+VPVG NVLGRM NV+G PIDGK  +  +    IHR  P FD  S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL+ EM + GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +N+DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL TEMG+LQ+RI ST  GS+TSVQAIYVPADDLTDPAPAT FTHLDA TVL R+IA LGI+PA++PL+STSR+LDPNIVG  HY  A  V+++LQR+ +LQDIIAILG+DEL+DEDK+ V RAR+I+ FLSQPFFVAE F+G+ GKYV L DTI+ F EI+DGKHDDLPE AF+ VGTI+EAVEKAK L
  S:     4 GKISQIIGPVVDVDFQEGG-LPAILDALTVARPDGTKLVLETQQHLGEERVRTISMDATDGLVRGMPVINTGKPIQVPVGPNVLGRMLNVVGDPIDGKGPVKSEKSYSIHRPTPKFDVLSTKSEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTEMGELQDRIVSTNKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDEHYNTAQAVKSLLQRYKDLQDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFFVAEAFTGLEGKYVKLEDTIKGFNEIIDGKHDDLPESAFYLVGTIEEAVEKAKTL 462
>gi|160881854|ref|YP_001560822.1| F0F1 ATP synthase subunit beta [Clostridium phytofermentans ISDg] >gi|190358661|sp|A9KK92.1|ATPB_CLOPH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|160430520|gb|ABX44083.1| ATP synthase F1, beta subunit [Clostridium phytofermentans ISDg] (472 aa)
Score = 1682, Expect = 0.0e+00, Identities = 317/460 (68%), Positives = 369/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+IG V+D+ F E  +LP IY+ + +K   G+ L +E AQ +GDD VRCIA+GPT+GL R         PI VPVG+N LGRMFNVLG PID KE        PIHRK P+F++QS   EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI NIA EH G SVF GVGERTREGNDLYYEMI  GVI+KT +VFGQMNEPPGARMRV LT LTMAEYFRD   +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL TEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+I  LGI+PA++PLESTSR+LDP +VG  HYKVA  VQ ILQR+ ELQDIIAILG+DEL+++DK++V RAR+I+ FLSQPF VAE+F+G+ G+YVP+++TIQ FKEI++GKHDD+PE  F   G I + + + K  K
  S:    13 GKITQIIGAVLDIKFAEG-KLPEIYEAIKIKKNDGDTLVVEVAQHLGDDTVRCIAMGPTDGLVRGMDAEGTGAPISVPVGENTLGRMFNVLGNPIDEKEAPKNVEYYPIHRKAPAFEEQSTQTEILETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELITNIATEHGGYSVFTGVGERTREGNDLYYEMIDSGVINKTTMVFGQMNEPPGARMRVGLTGLTMAEYFRDKSGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIVELGIYPAVDPLESTSRMLDPRVVGEEHYKVARDVQEILQRYKELQDIIAILGMDELSEDDKLLVARARKIQRFLSQPFHVAEQFTGLPGRYVPVAETIQGFKEIIEGKHDDIPESYFLNAGNIDDVLARVKANK 472
>gi|78185913|ref|YP_373956.1| F0F1 ATP synthase subunit beta [Pelodictyon luteolum DSM 273] >gi|78165815|gb|ABB22913.1| ATP synthase F1, beta subunit [Pelodictyon luteolum DSM 273] (482 aa)
Score = 1681, Expect = 0.0e+00, Identities = 316/459 (68%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L++ +  G  L LE  Q +G++ VR +A+  T+GL R   V N   PI+ PVG+ VLGRM NV+G PIDG+  +       IHR  P F+D S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +++DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDPN++G +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L D+I+ FKEI+ GKHD+LPE AF+ VGTI+EA+EKAK L
  S:    24 GKISQIIGPVVDVDFPEG-QLPSILDALTITRPDGSRLVLETQQHLGEERVRTVAMESTDGLIRGLSVANTGRPIQAPVGEGVLGRMLNVVGDPIDGRGPVNATKTYSIHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEHRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQSVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDSIKGFKEIIAGKHDNLPEGAFYLVGTIEEAIEKAKTL 482
>gi|167747404|ref|ZP_02419531.1| hypothetical protein ANACAC_02124 [Anaerostipes caccae DSM 14662] >gi|167652766|gb|EDR96895.1| hypothetical protein ANACAC_02124 [Anaerostipes caccae DSM 14662] (465 aa)
Score = 1680, Expect = 0.0e+00, Identities = 320/457 (70%), Positives = 367/457 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GK+ Q+IG V+D+ F++   LP I D + +    G +L +E +Q +GDD VRCIA+GPT+GL R  +      PI VPVG+  LGRMFNVLG PID K       + PIHRK P+F DQS   E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI NIA EH G SVF GVGERTREGNDLY+EM + GVIDKTA+VFGQMNEPPGARMRV LT LT+AE FRD   +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL TEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLESTSR+LDP IVG  HY+VA GVQ ILQR+ ELQDIIAILG+DEL+DE+K+IV+RAR+I+ FLSQPFFVAE+F+G  GKYV L+DTIQ FKEILDGKHDD+PE  F   G+I E VE+AK
  S:     7 GKITQIIGAVLDIKFSDG-HLPEINDAIDIMTKQGGKLVVEVSQHLGDDTVRCIAMGPTDGLVRGMEAVCTGGPISVPVGEQTLGRMFNVLGDPIDNKPAPENAKRQPIHRKAPAFKDQSTETEVLETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSVFTGVGERTREGNDLYHEMSESGVIDKTAMVFGQMNEPPGARMRVGLTGLTIAENFRDEGGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEMGALQERITSTKDGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAIVEQGIYPAVDPLESTSRILDPKIVGEEHYQVARGVQEILQRYKELQDIIAILGMDELSDEEKLIVDRARKIQRFLSQPFFVAEQFTGTVGKYVTLNDTIQGFKEILDGKHDDIPEGMFLNAGSIDEVVERAK 463
>gi|118573714|sp|Q3B6W8.2|ATPB1_PELLD ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) (462 aa)
Score = 1680, Expect = 0.0e+00, Identities = 316/459 (68%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  QLP I D L++ +  G  L LE  Q +G++ VR +A+  T+GL R   V N   PI+ PVG+ VLGRM NV+G PIDG+  +       IHR  P F+D S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD +++DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDPN++G +HY  A  V+ ILQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L D+I+ FKEI+ GKHD+LPE AF+ VGTI+EA+EKAK L
  S:     4 GKISQIIGPVVDVDFPEG-QLPSILDALTITRPDGSRLVLETQQHLGEERVRTVAMESTDGLIRGLSVANTGRPIQAPVGEGVLGRMLNVVGDPIDGRGPVNATKTYSIHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEHRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQSVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDSIKGFKEIIAGKHDNLPEGAFYLVGTIEEAIEKAKTL 462
>gi|169335794|ref|ZP_02862987.1| hypothetical protein ANASTE_02219 [Anaerofustis stercorihominis DSM 17244] >gi|169258532|gb|EDS72498.1| hypothetical protein ANASTE_02219 [Anaerofustis stercorihominis DSM 17244] (470 aa)
Score = 1678, Expect = 0.0e+00, Identities = 314/442 (71%), Positives = 368/442 (83%)
  Q:    27 SQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKE-ELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           + LP++ + + +   GEEL +E ++ IGD+ VRCIA+  T+GL R  +  +   PI VPVG   LGRM NVLG+PIDGKE +L      PIHR+ PSF++     EIFETGIKV+DL+ PY +GGKIGLFGGAGVGKTVL+QELI NIA EH GLSVFAGVGERTREGNDLYYEM + GV+DKT+L FGQMNEPPGARMRVALT LTMAE+FRD +NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK+GSITSVQA+YVPADDLTDPAPATTF HLDA TVLDR I+  GI+PA++PL STSR+LDP +VG  HY++A GVQ ILQR+ ELQDIIAILG++EL++EDK+IV RARRI  FLSQPF VAE+F+G+ G YVP+S+T++ FKEIL GKHDDLPE AF  VGTI +AVEKAK+L+
  S:    23 NDLPKLNEAIKIDNHGEELIIEVSEHIGDNTVRCIAMDTTDGLVRGMEAVSTGSPIMVPVGDKTLGRMVNVLGQPIDGKEMDLSDVKLSPIHREAPSFEEMQTVPEIFETGIKVVDLICPYTKGGKIGLFGGAGVGKTVLIQELISNIATEHGGLSVFAGVGERTREGNDLYYEMKESGVLDKTSLCFGQMNEPPGARMRVALTGLTMAEHFRDEENQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLDRAISEKGIYPAVDPLGSTSRILDPKVVGEEHYQIARGVQEILQRYKELQDIIAILGMEELSEEDKLIVGRARRIERFLSQPFHVAEQFTGLKGAYVPISETLRGFKEILQGKHDDLPEAAFLLVGTIDDAVEKAKQLQ 465
>gi|110598291|ref|ZP_01386566.1| ATP synthase F1, beta subunit [Chlorobium ferrooxidans DSM 13031] >gi|110340099|gb|EAT58599.1| ATP synthase F1, beta subunit [Chlorobium ferrooxidans DSM 13031] (462 aa)
Score = 1677, Expect = 0.0e+00, Identities = 316/459 (68%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IGPVVDV F E  +LP I D L++ +  G +L LE  Q +G++ VR +++  T+GL R   V N   PI+VPVG  VL RM NV+G+PIDG+  +       IHR  P FD+ S   E+FETGIKVIDLL PY+RGGK GLFGGAGVGKTVL+ ELI+NIAK+ SG SVFAGVGERTREGNDL++EM++ GVIDKTALVFGQMNEPPGAR RVALT L++AEYFRD + +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQ+RI STK GS+TSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDPNIVG +HY  A  V+ +LQR+ +LQDIIAILG+DEL+DEDK++V RAR+++ FLSQPFFVAE F+G+AGKYV L +TI+ FKEI+ GKHD+LPE AF+ VGTI+EA+EKAK L
  S:     4 GKISQIIGPVVDVDFPEG-RLPSILDALTITRPDGTKLVLETQQHLGEERVRTVSMESTDGLVRGTSVANTGMPIQVPVGPEVLSRMMNVVGEPIDGRGPVHTAKTYSIHRSAPKFDEISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGKHDNLPESAFYLVGTIEEAIEKAKTL 462
>gi|15896119|ref|NP_349468.1| F0F1 ATP synthase subunit beta [Clostridium acetobutylicum ATCC 824] >gi|20137589|sp|Q9Z687|ATPB_CLOAB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|15025911|gb|AAK80808.1|AE007784_5 FoF1-type ATP synthase beta subunit [Clostridium acetobutylicum ATCC 824] >gi|4323568|gb|AAD16426.1| ATP synthase subunit beta [Clostridium acetobutylicum] (466 aa)
Score = 1673, Expect = 0.0e+00, Identities = 322/462 (69%), Positives = 381/462 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QVIGPVVD+ F ++  LP IY+ + + +   ++L  E  Q +GDDIVR IA+  T+GL R  +  N   PI VPVG+NVLGR+FNVLG+ ID   ++      PIHR  P+F++QS   E+FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM   GVI+KTALVFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLA EMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R I+ LGI+PA++PLESTSR+LDP IVG  HY+VA  V++IL+R+ ELQDIIAILG+DEL+DED+++V RARR++ FLSQ F VAE+F+G+ G++VP+ DTI+SFKEILDGK DDLPE AF F GTI++  EKAK++ ++
  S:     6 GKIVQVIGPVVDIKF-DAENLPDIYNSIEIDMGDNKKLIAEVEQHVGDDIVRTIAMEGTDGLKRGMEAVNTGKPISVPVGENVLGRLFNVLGQTIDEAGDMNADKYYPIHRPAPTFEEQSVQPEMFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKDSGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDK-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLANEMGALQERITSTKQGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSREISNLGIYPAVSPLESTSRILDPRIVGEEHYEVANKVKHILERYQELQDIIAILGVDELSDEDRLLVGRARRVQRFLSQAFSVAEQFTGMKGQFVPVKDTIRSFKEILDGKCDDLPEAAFLFAGTIEDVKEKAKKMMES 466
>gi|83319730|ref|YP_424079.1| F0F1 ATP synthase subunit beta [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|118573698|sp|Q2ST34|ATPB_MYCCT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|83283616|gb|ABC01548.1| ATP synthase F1, beta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (476 aa)
Score = 1668, Expect = 0.0e+00, Identities = 319/467 (68%), Positives = 380/467 (81%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           K +    GK+ QV+GPVVDV F+E++ +P+IYD L V   G++L LE  Q IGD+IVR IA+GPTEGL R   V N N PI  PVG  VLGRMFNVLG PID K +L  K +LPIHR  P +++   T EI ETGIKVIDL+ P+ +GGK+GLFGGAGVGKT+L+QELI+NIAK H+G+SVFAGVGERTREGNDLY+E I+ GV++KT LVFGQMNEPPGARMRVALT LT+AEYFRD  N DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA+ VLDR+IA+LGI+PA++PL S+SR+LDP IVG  HY +AL VQ  LQ++ ELQ IIAILG+DEL++EDK+IV+RAR+IRNFLSQ FFV EKF+G  G +V +SDT++SFK IL+G+ D +PE  F +  TI   +EK  + K
  S:    10 KNKTQVIGKIIQVLGPVVDVKFSENN-IPKIYDALVVDNNGKKLVLEVEQNIGDEIVRTIAMGPTEGLRRGLDVINTNSPITAPVGNEVLGRMFNVLGDPIDEKPDLDVK-RLPIHRDAPIYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVGERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDKKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALKVQITLQKYQELQSIIAILGMDELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVSDTVRSFKSILNGEVDHVPETYFLYSSTIDNVIEKYNKDK 474
>gi|13357686|ref|NP_077960.1| F0F1 ATP synthase subunit beta [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762163|ref|YP_001752212.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920510|ref|ZP_02931798.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508849|ref|ZP_02958297.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701941|ref|ZP_02971583.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189081353|sp|B1AIB8.1|ATPB_UREP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81858619|sp|Q9PR15|ATPB_UREPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|11266603|pir||H82928 ATP synthase beta chain UU129 [imported] - Ureaplasma urealyticum >gi|6899088|gb|AAF30535.1|AE002114_2 ATP synthase beta chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827740|gb|ACA33002.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902985|gb|EDT49274.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675823|gb|EDT87728.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700692|gb|EDU18974.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (464 aa)
Score = 1668, Expect = 0.0e+00, Identities = 321/463 (69%), Positives = 376/463 (81%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +  GK++Q++GPVVDV F  S  LP I   L +   G +L LE +QL+GD+I RCIA+  T+GL R ++V N   PI +PVGK VLGRMFNV G PID ++  P   ++PIHR  PSF +Q+ ++EI ETGIKV+DLL P+A+GGKIGLFGGAGVGKTVL+QELIHNIAK H GLSVFAGVGERTREGNDLYYEM +  V+DKTALVFGQMNEPPGARMRVAL+ LTMAE FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA EMGQLQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDAK VLDR IA+LG++PAI+PL+STSRLLDP +VG+ HY VA  V  ILQRF ELQDIIAILG+DEL++ED+ +V RAR++RN+LSQP  VAEKFSG  G  V L DTI+ F++ILDG+ DD+ EQ F +VG I +  EKA + K
  S:     4 VKKGKINQILGPVVDVRFP-SEWLPEINTALELNNHGSKLVLEVSQLVGDNIARCIAMDTTDGLVRGQEVINTQKPITMPVGKQVLGRMFNVTGDPID-EQPAPTGKRMPIHRPAPSFAEQAESIEILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLMQELIHNIAKNHGGLSVFAGVGERTREGNDLYYEMAESDVLDKTALVFGQMNEPPGARMRVALSGLTMAEEFRDAFGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAFEMGQLQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKVVLDRAIASLGLYPAISPLQSTSRLLDPLVVGVKHYSVARRVIEILQRFMELQDIIAILGMDELSEEDRQLVMRARKVRNYLSQPSHVAEKFSGQPGLSVKLEDTIEGFRKILDGECDDIHEQHFLYVGKIDDVFEKAAKNK 464
>gi|167924983|ref|ZP_02512074.1| F0F1 ATP synthase subunit beta [Mycoplasma mycoides subsp. mycoides LC str. GM12] (475 aa)
Score = 1667, Expect = 0.0e+00, Identities = 318/467 (68%), Positives = 382/467 (81%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           KK+N + GKV QV+GPVVDV F+E++ +P+IYD L V   G++L LE  Q IGD+IVR IA+GPTEGL R   V N N PI  P G  VLGRMFNVLG PID K +L  K + PIH+  P +++   T EI ETGIKVIDL+ P+ +GGK+GLFGGAGVGKT+L+QELI+NIAK H+G+SVFAGVGERTREGNDLY+E I+ GV++KT LVFGQMNEPPGARMRVALT LT+AEYFRD  N DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA+ VLDR+IA+LGI+PA++PL S+SR+LDP IVG  HY +AL VQ  LQ++ +LQ IIAILG+DEL++EDK+IV+RAR+IRNFLSQ FFV EKF+G  G +V ++DT++SFK ILDG+ D +PE  F +  TI + +EK  + K
  S:     9 KKKNQSIGKVIQVLGPVVDVKFSENN-IPKIYDALIVDNNGKKLVLEVEQNIGDEIVRTIAMGPTEGLKRGLDVINTNSPITAPTGIEVLGRMFNVLGDPIDEKPDLDVKRE-PIHKDAPKYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVGERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDQKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALRVQIALQKYQDLQSIIAILGMDELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVNDTVRSFKSILDGEVDYIPETYFLYSSTIDDVIEKYNKDK 473
>gi|148322971|gb|EDK88221.1| F-type two-sector ATPase, F(1) beta subunit [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (462 aa)
Score = 1667, Expect = 0.0e+00, Identities = 316/461 (68%), Positives = 376/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G + Q+I  VVDV F +  +LP IY+ L VKL  +EL LE  Q +G+++VR +A+  T+GL R  +V +   PI VPVGK VLGR+ NVLG+P+D +  +  +  LPIHR+ P FDD     EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREG DLY EM + GVI KTALV+GQMNEPPGAR+RVALT LT+AE FRD D QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQP LATEMG LQERI STK+GSITSVQA+YVPADDLTDPAPATTF+HLDA TVL RNIA+LGI+PA++PL+STS+ L  ++VG  HY+VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK+ V RAR+I  F SQPF VAE+F+G+ GKYVP+ +TI+ F+EIL+GKHDD+PEQAF +VGTI+EAV KAK L K
  S:     4 GTITQIISAVVDVAFKD--ELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITVPVGKAVLGRILNVLGEPVDNQGPINAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKAKDLAK 462
>gi|50364930|ref|YP_053355.1| F0F1 ATP synthase subunit beta [Mesoplasma florum L1] >gi|81827328|sp|Q6F202|ATPB_MESFL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|50363486|gb|AAT75471.1| ATP synthase beta chain [Mesoplasma florum L1] (479 aa)
Score = 1665, Expect = 0.0e+00, Identities = 317/464 (68%), Positives = 377/464 (81%)
  Q:     5 NITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           N   G V Q++GPVVDV F+E + +P IYD L V   G EL LE  Q +GD++VR IA+GPTEGLA+   V N N PI  PVG +VLGRMFNV G  ID K E   K ++PIHR  P++++     EI ETGIKVIDL+ P+A+GGKIGLFGGAGVGKTVL+QELI+NIAK HSG+SVFAGVGERTREGNDLY+E I+ GV+DKT+LVFGQMNEPPGARMRVALT LT+AE+FRD  N DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTFTHLDAK VLDR+IA+LGI+PA++PL S+SR+LDP I+G  HY VALGVQ  LQ++ +LQ IIAILG+DEL+ EDK+IV+RAR+IRNFLSQ F+V EKF+G  G+YV +SDT++SFK ILDG+ DD+PE  F + GT ++ ++     K
  S:    13 NSANGFVFQILGPVVDVKFSEDN-IPMIYDALVVDNNGVELVLEVEQHMGDEVVRTIAMGPTEGLAKGLPVINTNAPILAPVGDDVLGRMFNVTGHAIDEKPEFTGK-RMPIHRDAPAYEELITNAEILETGIKVIDLMIPFAKGGKIGLFGGAGVGKTVLIQELINNIAKAHSGVSVFAGVGERTREGNDLYHEFIEAGVLDKTSLVFGQMNEPPGARMRVALTGLTIAEHFRDEKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTNKGSITSVQAVYVPADDLTDPAPATTFTHLDAKIVLDRSIASLGIYPAVDPLSSSSRMLDPEIIGEEHYNVALGVQGTLQKYQDLQSIIAILGMDELSAEDKLIVQRARKIRNFLSQSFYVGEKFTGRPGQYVKVSDTVRSFKMILDGEMDDIPEILFLYKGTAEDVIQAYNETK 474
>gi|19703700|ref|NP_603262.1| F0F1 ATP synthase subunit beta [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|81848278|sp|Q8RGE2|ATPB_FUSNN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|19713824|gb|AAL94561.1| ATP synthase beta chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (462 aa)
Score = 1665, Expect = 0.0e+00, Identities = 314/461 (68%), Positives = 376/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G + Q+I  VVD+ F +  +LP IY+ L VKL  +EL LE  Q +G+++VR +A+  T+GL R  +V +   PI +PVGK VLGR+ NVLG+P+D +  L  +  LPIHR+ P FDD     EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREG DLY EM + GVI KTALV+GQMNEPPGAR+RVALT LT+AE FRD D QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQP LATEMG LQERI STK+GSITSVQA+YVPADDLTDPAPATTF+HLDA TVL RNIA+LGI+PA++PL+STS+ L  ++VG  HY+VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK+ V RAR+I  F SQPF VAE+F+G+ GKYVP+ +TI+ F+EIL+GKHDD+PEQAF +VGTI+EAV K+K L K
  S:     4 GTITQIISAVVDIAFKD--ELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDLAK 462
>gi|167748908|ref|ZP_02421035.1| hypothetical protein ANACAC_03682 [Anaerostipes caccae DSM 14662] >gi|167651530|gb|EDR95659.1| hypothetical protein ANACAC_03682 [Anaerostipes caccae DSM 14662] (466 aa)
Score = 1664, Expect = 0.0e+00, Identities = 311/457 (68%), Positives = 378/457 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GK+ QV+GPVVDV F +   LP I D L+V+L G++L +EAAQ +G++IVRCI L  +EGL+++ +VT     I VPVG+  LGRMFNVLG+ IDGKE++  + Q  IHR PP+F++QS  +EI ETGIKVIDLL PYA+GGK+GLFGGAGVGKTVL+QELIHNIA EH G S+F GVGER+REGNDL+ EM + GVIDKTALVFGQMNEPPGARMRVA T LTMAEYFRD ++Q+VLLFIDNIFR+ QAGSEVSALLGRMPSAVGYQPTLA E+G+LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLESTSR+L+  +VG  HY+VA+ VQ +LQ++ ELQDII+ILG++EL ++DK+ V RAR+I+ FLSQPF VAE F+G+ GKYVP+S+TI+ FK I+ G+ D+ PE AFF VGTI E +EKAK
  S:     4 GKIVQVLGPVVDVEF-DGGYLPLIKDALTVELDGKKLVMEAAQHMGNNIVRCILLASSEGLSKDMEVTATGAGITVPVGRQTLGRMFNVLGQNIDGKEQVEGEEQWVIHRDPPTFEEQSPVVEILETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQELIHNIATEHGGYSIFTGVGERSREGNDLWTEMNESGVIDKTALVFGQMNEPPGARMRVAQTGLTMAEYFRDREHQNVLLFIDNIFRYVQAGSEVSALLGRMPSAVGYQPTLANEVGELQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESTSRILEAEVVGEEHYEVAMQVQELLQKYKELQDIISILGMEELDEDDKLAVYRARKIQKFLSQPFHVAENFTGMKGKYVPVSETIRGFKAIISGEMDEYPENAFFMVGTIDEVIEKAK 459
>gi|167750158|ref|ZP_02422285.1| hypothetical protein EUBSIR_01127 [Eubacterium siraeum DSM 15702] >gi|167656901|gb|EDS01031.1| hypothetical protein EUBSIR_01127 [Eubacterium siraeum DSM 15702] (465 aa)
Score = 1664, Expect = 0.0e+00, Identities = 313/460 (68%), Positives = 374/460 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G V Q+IG V+D+ F     LP + + + ++  G++L +E AQ IGDD VRCIA+G T+GL R     +    I+VPVG+  LGR+FN+LG+ +D K +   + +  IHR  PSF++Q  + ++ ETGIKV+DL+ PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK+H GLSVF GVGERTREGNDLY EM + GVI+KT LV+GQMNEPPGARMRVAL+ LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL RNI+++GIFPA++PL+STSR+L P IVG  HY+VA  VQ+ILQR+ ELQDIIAILG+DEL D DK+ V RAR+I+ FLSQPF VAE+F+G+ GKYVPL +TI+ FKEI++GKHDDLPE AF FVGTI EAVEKAK  K
  S:     6 GTVVQIIGAVLDIKFP-PEHLPNLLNAIEIEHEGKKLTVEVAQHIGDDTVRCIAMGSTDGLVRGLPAVDTGASIKVPVGRQTLGRIFNLLGEAVDNKPQPETEEKWEIHRPAPSFEEQEGSTQVLETGIKVVDLIAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKQHGGLSVFTGVGERTREGNDLYNEMTESGVIEKTTLVYGQMNEPPGARMRVALSGLTMAEYFRDKEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRNISSMGIFPAVDPLDSTSRILTPEIVGEEHYEVARQVQSILQRYNELQDIIAILGMDELDDNDKLTVSRARKIQRFLSQPFSVAEQFTGMKGKYVPLKETIRGFKEIIEGKHDDLPESAFLFVGTIDEAVEKAKNEK 464
>gi|89210203|ref|ZP_01188595.1| ATP synthase F1, beta subunit [Halothermothrix orenii H 168] >gi|89160276|gb|EAR79932.1| ATP synthase F1, beta subunit [Halothermothrix orenii H 168] (487 aa)
Score = 1663, Expect = 0.0e+00, Identities = 319/462 (69%), Positives = 378/462 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-----KLAGE-------------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           G+V QVIGPVVDV F     LP IY+ + +     K++ E              L  E    +GD+ VRC+A+  T+GL R  +  +   PI VPVG+ VLGR+FNVLG+PID +  +  + +LPIHR  PS+++Q  T E+FETGIKVIDLL PYA+GGK+GLFGGAGVGKTVL+QELIHNIA EH G SVF+GVGERTREGNDL+ E  +  ++DK ALVFGQMNEPPGARMRV LT LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLA ++GQLQERI STK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA  GI+PA++PL+STSR+L+P ++G  HYKVA  VQ +LQ++ +LQDIIAILG+DEL+DEDKIIV RARRI  FLSQPFFVAE+F+   GKYVP+ +TI+ FKEIL+GKHDDLPE+AF+ VGTI EAVEKAKR+K+ 
  S:     8 GRVVQVIGPVVDVEFP-GGHLPEIYNAIEIVGDNRKISQEGPHNEDNEPGEPIRLMAEVMHQLGDNRVRCVAMSSTDGLVRGMEARDLGEPITVPVGEEVLGRLFNVLGEPIDKQGPVDTEEKLPIHRPAPSYEEQETTTEVFETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQELIHNIAIEHGGYSVFSGVGERTREGNDLWLEFQEADILDKVALVFGQMNEPPGARMRVGLTGLTMAEYFRDKEGQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLAVDVGQLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAEKGIYPAVDPLDSTSRILEPGVIGEEHYKVARQVQEVLQQYKDLQDIIAILGMDELSDEDKIIVNRARRIERFLSQPFFVAEQFTNTPGKYVPIKETIRGFKEILEGKHDDLPEEAFYMVGTIDEAVEKAKRIKEG 486
>gi|171920630|ref|ZP_02931872.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178799|ref|ZP_02964594.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024161|ref|ZP_02996887.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039640|ref|ZP_02998345.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 8] >gi|188518551|ref|ZP_03004012.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524101|ref|ZP_03004181.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530858|ref|ZP_03005151.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568720|ref|ZP_03005474.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 2] >gi|188592533|ref|ZP_03005858.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 10] >gi|195867714|ref|ZP_03079715.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903354|gb|EDT49643.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209422|gb|EDU06465.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018792|gb|EDU56832.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997947|gb|EDU67044.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660096|gb|EDX53476.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660569|gb|EDX53825.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (464 aa)
Score = 1663, Expect = 0.0e+00, Identities = 320/463 (69%), Positives = 374/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +  GK++Q++GPVVDV F  S  LP I   L +   G +L LE +QL+GD+I RCIA+  T+GL R ++V N   PI +PVGK VLGRMFNV G PID ++  P   ++PIHR  PSF +Q+  +EI ETGIKV+DLL P+A+GGKIGLFGGAGVGKTVL+QELIHNIAK H GLSVFAGVGERTREGNDLYYEM +  V+DKTALVFGQMNEPPGARMRVAL+ LTMAE FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA EMGQLQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDAK VLDR IA+LG++PAI+PL+STSRLLDP +VG+ HY VA  V  ILQRF ELQDIIAILG+DEL++ED+ +V RAR++RN+LSQP  VAEKFSG  G  V L DTI+ F++ILDG+ DD+ EQ F +VG I +  EK  + K
  S:     4 VKKGKINQILGPVVDVRFP-SEWLPEINTALELNNHGSKLVLEVSQLVGDNIARCIAMDTTDGLVRGQEVINTEKPIMMPVGKQVLGRMFNVTGDPID-EQPAPTGKRMPIHRPAPSFAEQAEAIEILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLMQELIHNIAKNHGGLSVFAGVGERTREGNDLYYEMAESDVLDKTALVFGQMNEPPGARMRVALSGLTMAEEFRDAFGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAFEMGQLQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKVVLDRAIASLGLYPAISPLQSTSRLLDPLVVGVKHYSVARRVIEILQRFMELQDIIAILGMDELSEEDRQLVMRARKVRNYLSQPSHVAEKFSGQPGLSVKLEDTIEGFRKILDGECDDIHEQHFLYVGKIDDVFEKVAKSK 464
>gi|42561403|ref|NP_975854.1| F0F1 ATP synthase subunit beta [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81829344|sp|Q6MS94|ATPB_MYCMS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|42492901|emb|CAE77496.1| ATP SYNTHASE BETA CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (475 aa)
Score = 1660, Expect = 0.0e+00, Identities = 317/467 (67%), Positives = 380/467 (81%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           KK+N + GKV QV+G VVDV F+E+S +P+IYD L V   G++L LE  Q IGD+IVR IA+GPTEGL R   V N N PI  P G  VLGRMFNVLG PID K +L  K + PIH+  P +++   T EI ETGIKVIDL+ P+ +GGK+GLFGGAGVGKT+L+QELI+NIAK H+G+SVFAGVGERTREGNDLY+E I+ GV++KT LVFGQMNEPPGARMRVALT LT+AEYFRD  N DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA+ VLDR+IA+LGI+PA++PL S+SR+LDP IVG  HY +AL VQ  LQ++ +LQ IIAILG+DEL++EDK+IV+RAR+IRNFLSQ FFV EKF+G  G +V ++DT++SFK ILDG+ D +PE  F +   I + +EK  + K
  S:     9 KKKNQSIGKVIQVLGSVVDVKFSENS-IPKIYDALIVDNNGKKLVLEVEQNIGDEIVRTIAMGPTEGLKRGLDVINTNSPITAPTGMEVLGRMFNVLGDPIDEKPDLDVKRE-PIHKDAPKYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVGERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDQKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALRVQIALQKYQDLQSIIAILGMDELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVNDTVRSFKSILDGEVDYIPETYFLYSSIIDDVIEKYNKDK 473
>gi|34763442|ref|ZP_00144389.1| ATP synthase beta chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886883|gb|EAA24008.1| ATP synthase beta chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (462 aa)
Score = 1660, Expect = 0.0e+00, Identities = 314/461 (68%), Positives = 376/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G + Q+I  VVDV F +  +LP IY+ L VKL  +EL LE  Q +G+++VR +A+  T+GL R  +V +   PI +PVGK VLGR+ NVLG+P+D +  +  +  LPIHR+ P FDD     EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREG DLY EM + GVI KTALV+GQMNEPPGAR+RVALT LT+AE FRD D QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQP LATEMG LQERI STK+GSITSVQA+YVPADDLTDPAPATTF+HLDA TVL RNIA+LGI+PA++PL+STS+ L  ++VG  HY+VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK+ V RAR+I  F SQPF VAE+F+G+ GKYVP+ +TI+ F+EIL+GKHDD+PEQAF +VGTI+EAV K+K L K
  S:     4 GTITQIISAVVDVAFKD--ELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPINAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDLVK 462
>gi|187777253|ref|ZP_02993726.1| hypothetical protein CLOSPO_00805 [Clostridium sporogenes ATCC 15579] >gi|187774181|gb|EDU37983.1| hypothetical protein CLOSPO_00805 [Clostridium sporogenes ATCC 15579] (462 aa)
Score = 1659, Expect = 0.0e+00, Identities = 311/444 (70%), Positives = 368/444 (82%)
  Q:    25 ESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +S  LP +++ L +    +++  E  Q IGDD VR IA+  TEGL R  +V +   P+ VPVGK VLGR+FNVLG PID   E       PIHR  PSF++QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GV++KTALVFGQMNEPPGARMRVALT LTM+EYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R+IA LGI+PA++PLES+SR+LDP I+G  HY VA+ V+NIL+R+ ELQDIIAILGIDEL++EDK++V RARRI+ FLSQPF VAE+F+G+ GKYVP+ +T++ FKEIL+GKHD++PE AF F GT++E ++KA+ ++
  S:    20 DSENLPDLFNALEINAGDKKVIAEVEQHIGDDTVRAIAMESTEGLRRGMEVLDTGSPVSVPVGKEVLGRLFNVLGNPIDEVGEFTSNESYPIHRSAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQ-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPLESSSRMLDPRIIGEEHYDVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARRIQRFLSQPFTVAEQFTGMQGKYVPIKETVKGFKEILEGKHDNIPESAFLFQGTMEEVLKKAEEME 462
>gi|72080395|ref|YP_287453.1| F0F1 ATP synthase subunit beta [Mycoplasma hyopneumoniae 7448] >gi|118573699|sp|Q4A8V9|ATPB_MYCH7 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71913519|gb|AAZ53430.1| ATP synthase beta chain [Mycoplasma hyopneumoniae 7448] (471 aa)
Score = 1657, Expect = 0.0e+00, Identities = 316/466 (67%), Positives = 380/466 (81%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           K+EN+  G + Q+ GPV+DV F  +  +P I   L VK+  E +  E AQ +G+ IVR IA+  T  L++  +V +    I VPVGK VL RMFNVLG+PIDG + L    + PIH K P++ +Q  T EI  TGIKVIDLL P+ +GGKIGLFGGAGVGKTVLVQELI+NIA +H GLSVFAGVGER+REGNDLY+EM + GV+DKTALVFGQMNEPPGARMRVAL+ALTMAEYFRD++NQDVLLFIDNIFRFTQAGSEVS LLGR+PS VGYQPTL+TEMGQLQERI ST  GSITSVQA+YVPADD+TDPAPATTF+HLDAKTVLDR IAALGI+PA++PL S+SR L+PNIVG  HY VA  V  ILQRF ELQDIIAILG+DEL++ DK +V RARRIRNFLSQPFFVA+KFSGI G+++ + DT+ +F E+L GK+D++PE+AF +VGTI +A+EKAK++
  S:     3 KQENV--GHIVQIFGPVIDVQFP-NEHMPAILSALEVKINDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTGSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIKNPIHAKAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTIDQALEKAKKM 465
>gi|116490723|ref|YP_810267.1| F0F1 ATP synthase subunit beta [Oenococcus oeni PSU-1] >gi|116091448|gb|ABJ56602.1| F0F1-type ATP synthase, beta subunit [Oenococcus oeni PSU-1] (504 aa)
Score = 1656, Expect = 0.0e+00, Identities = 310/466 (66%), Positives = 382/466 (81%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++++  G V QVIGP+VDV F ++ +LP I + L V ++ G EL +E +  +GD +VR IA+  T+GL R  KV +   PIEVPVG+  LGR+FNVLG+P+DG + +P    + PIHR  P +D+ + + E+ ETGIKVIDLL PY RGGK GLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+YYEM   GV+  TA+V+GQMNEPPGARMRV LT LTMAE FRD + +DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PLESTS  L P+IVG +HY+VA  VQ+ LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+ FLSQPF VAE+F+G+ G+YVP+ DT++ FKEILDGKHDDLPE+AF  VGTI++AVEKAK+L+
  S:    36 EKDLAEGTVLQVIGPIVDVQFPDNKKLPDINNALKVQRIDGSELTIEVSIDLGDSVVRTIAMDSTDGLTRGMKVLDTGAPIEVPVGEATLGRVFNVLGEPVDGGDPIPNSVDRHPIHRSAPKYDELATSTEVLETGIKVIDLLEPYLRGGKTGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLKNTAMVYGQMNEPPGARMRVGLTGLTMAEDFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLESTSSALTPDIVGEDHYEVATQVQHFLQRYKELQDIISILGMDELSDEEKTIVNRARRIQFFLSQPFSVAEQFTGVPGQYVPVEDTVRGFKEILDGKHDDLPEEAFRNVGTIEQAVEKAKKLE 503
>gi|21684964|emb|CAD22547.1| F1F0-ATPase subunit beta [Oenococcus oeni] (504 aa)
Score = 1655, Expect = 0.0e+00, Identities = 310/466 (66%), Positives = 382/466 (81%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++++  G V QVIGP+VDV F ++ +LP I + L V ++ G EL +E +  +GD +VR IA+  T+GL R  KV +   PIEVPVG+  LGR+FNVLG+P+DG + +P    + PIHR  P +D+ + + E+ ETGIKVIDLL PY RGGK GLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+YYEM   GV+  TA+V+GQMNEPPGARMRV LT LTMAE FRD + +DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PLESTS  L P+IVG +HY+VA  VQ+ LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+ FLSQPF VAE+F+G+ G+YVP+ DT++ FKEILDGKHDDLPE+AF  VGTI++AVEKAK+L+
  S:    36 EKDLAEGTVLQVIGPIVDVQFPDNKKLPDINNALKVQRIDGSELTIEVSIDLGDSVVRTIAMDSTDGLTRGMKVLDTGAPIEVPVGEATLGRVFNVLGEPVDGGDPIPNSVDRHPIHRSAPKYDELATSAEVLETGIKVIDLLEPYLRGGKTGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLKNTAMVYGQMNEPPGARMRVGLTGLTMAEDFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLESTSSALTPDIVGEDHYEVATQVQHFLQRYKELQDIISILGMDELSDEEKTIVNRARRIQFFLSQPFSVAEQFTGVPGQYVPVEDTVRGFKEILDGKHDDLPEEAFRNVGTIEQAVEKAKKLE 503
>gi|121534927|ref|ZP_01666746.1| ATP synthase F1, beta subunit [Thermosinus carboxydivorans Nor1] >gi|121306526|gb|EAX47449.1| ATP synthase F1, beta subunit [Thermosinus carboxydivorans Nor1] (469 aa)
Score = 1654, Expect = 0.0e+00, Identities = 317/460 (68%), Positives = 373/460 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKE-ELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G+V QVIGPVVD+ F    QLP IY+  ++++ G+      +L  E  Q +GD  VRC+A+  T+GL R     +   PI+VPVGK  LGR+FNVLG+ +D  + E+  +   PIHR  PSF++Q  +  I ETGIKV+DL+ PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G SVFAGVGERTREGNDL+ EM + GVIDKTALV+GQMNEPPGARMRV LT LTMAEYFRD   QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++G LQERI STK GSITSVQA+YVPADDLTDPAPA TF HLDA TVL R IA LGI+PA++PL+STSR+LDPNI+G  HY+VA GVQ +LQR+ ELQDIIAILG++EL+DEDK+ V RAR+I+ FLSQPFFVAE F+G  GKYVPL +TI+ FKEIL GKHDDLPE AF+ VGTI EAVEKA+++K
  S:     4 GRVIQVIGPVVDIEFP-PEQLPAIYN--AIRIEGQNGDVKVKLTAEVMQHLGDSTVRCVAMSSTDGLVRGMTAVDTGAPIKVPVGKGTLGRVFNVLGETVDNDDREVIAEDYWPIHRPAPSFEEQETSTTILETGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGFSVFAGVGERTREGNDLWMEMRESGVIDKTALVYGQMNEPPGARMRVGLTGLTMAEYFRDVHGQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTKKGSITSVQAVYVPADDLTDPAPAATFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIIGQEHYEVARGVQEVLQRYKELQDIIAILGMEELSDEDKLTVARARKIQRFLSQPFFVAEAFTGTPGKYVPLKETIRGFKEILSGKHDDLPEAAFYMVGTIDEAVEKARKMK 467
>gi|71893408|ref|YP_278854.1| F0F1 ATP synthase subunit beta [Mycoplasma hyopneumoniae J] >gi|118573700|sp|Q4AAV7|ATPB_MYCHJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71851535|gb|AAZ44143.1| ATP synthase beta chain [Mycoplasma hyopneumoniae J] (471 aa)
Score = 1653, Expect = 0.0e+00, Identities = 315/466 (67%), Positives = 380/466 (81%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           K++N+  G + Q+ GPV+DV F  +  +P I   L VK+  E +  E AQ +G+ IVR IA+  T  L++  +V +    I VPVGK VL RMFNVLG+PIDG + L    + PIH K P++ +Q  T EI  TGIKVIDLL P+ +GGKIGLFGGAGVGKTVLVQELI+NIA +H GLSVFAGVGER+REGNDLY+EM + GV+DKTALVFGQMNEPPGARMRVAL+ALTMAEYFRD++NQDVLLFIDNIFRFTQAGSEVS LLGR+PS VGYQPTL+TEMGQLQERI ST  GSITSVQA+YVPADD+TDPAPATTF+HLDAKTVLDR IAALGI+PA++PL S+SR L+PNIVG  HY VA  V  ILQRF ELQDIIAILG+DEL++ DK +V RARRIRNFLSQPFFVA+KFSGI G+++ + DT+ +F E+L GK+D++PE+AF +VGTI +A+EKAK++
  S:     3 KQKNV--GHIVQIFGPVIDVQFP-NEHMPAILSALEVKINDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTGSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIKNPIHAKAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTIDQALEKAKKM 465
>gi|146296975|ref|YP_001180746.1| F0F1 ATP synthase subunit beta [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|189081328|sp|A4XKX0.1|ATPB_CALS8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|145410551|gb|ABP67555.1| ATP synthase F1, beta subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (467 aa)
Score = 1653, Expect = 0.0e+00, Identities = 319/462 (69%), Positives = 367/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           G V Q+IGPVVDV F ES  LP I + + +   G+ L  E AQ +G+D VRC+ALG T+GL R  K  +   PI+VPVG+  LGR+FNVLG+PID K E+      PIHR  PSF++Q   +EIFETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G S+F GVGERTREGNDL+ EM + GVI+KT LVFGQMNEPPGARMRVALT LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA E+G LQERI STK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR+LDP IVG  HY VA  VQ ILQR+ ELQDIIAILG+DEL++EDK+IV RAR+I+ FLSQPFFVAE F+G  G+YV L DTI+ FKEI++GK D +PEQ F+ VGTI E  E  ++  K 
  S:     6 GYVVQIIGPVVDVRF-ESGNLPAINNAIEIHFDGKTLVAEVAQHLGNDTVRCVALGSTDGLRRGVKAIDTGGPIKVPVGRGTLGRIFNVLGQPIDNKGEVQATDYWPIHRSAPSFEEQVPAVEIFETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGFSIFTGVGERTREGNDLWLEMNESGVIEKTVLVFGQMNEPPGARMRVALTGLTMAEYFRDVEGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLANEVGALQERITSTKRGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRIVGEEHYYVARTVQQILQRYKELQDIIAILGMDELSEEDKLIVYRARKIQRFLSQPFFVAEAFTGRPGRYVKLKDTIRGFKEIIEGKMDHIPEQYFYMVGTIDEVYENYEKDMKG 466
>gi|20807130|ref|NP_622301.1| F0F1 ATP synthase subunit beta [Thermoanaerobacter tengcongensis MB4] >gi|81848163|sp|Q8RC15|ATPB_THETN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|20515625|gb|AAM23905.1| F0F1-type ATP synthase beta subunit [Thermoanaerobacter tengcongensis MB4] (461 aa)
Score = 1652, Expect = 0.0e+00, Identities = 313/460 (68%), Positives = 373/460 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QVIGPVVD+ F     LP I + + + +   EL +E AQ IGD+ VRC+A+  T+GL R  +  +   PI VPVGK VLGRMFNVLG+PID   E+     +PIH+KPPSF++Q+   EI ETGIKVIDLLTPY +GGKIGLFGGAGVGKTVL+ ELI N+A EH G S+FAGVGER+REGN+L+ EM + GVIDKTA VFGQMNEPPGARMRV L  LT+AEYFRD ++QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R+IA +GI+PA++PL+STSR+L+P+IVG  HY VA  VQ ILQR+ ELQDIIAILG++EL +ED++IV RAR+I+ FLSQPFFVAE F+G  GKYVPL +TI+ FK+I++G+ DD+PE AF+ VGTI E  EKA+++K
  S:     4 GYITQVIGPVVDIRF--EGDLPPINNAIKIPMGDRELVVEVAQHIGDNTVRCVAMASTDGLRRGMECIDTGGPIMVPVGKGVLGRMFNVLGQPIDELGEVKDVKYMPIHKKPPSFEEQNPATEILETGIKVIDLLTPYPKGGKIGLFGGAGVGKTVLIMELIRNVAIEHGGYSIFAGVGERSREGNELWLEMHEAGVIDKTAFVFGQMNEPPGARMRVGLAGLTIAEYFRDEEHQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRSIAEMGIYPAVDPLDSTSRILEPHIVGEEHYYVARKVQEILQRYKELQDIIAILGMEELTEEDRLIVYRARKIQRFLSQPFFVAEAFTGTPGKYVPLKETIRGFKKIVEGEMDDIPEPAFYMVGTIDEVYEKAEKMK 461
>gi|54020006|ref|YP_115570.1| F0F1 ATP synthase subunit beta [Mycoplasma hyopneumoniae 232] >gi|81823562|sp|Q601Z5|ATPB_MYCH2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|53987179|gb|AAV27380.1| ATP synthase beta chain [Mycoplasma hyopneumoniae 232] (471 aa)
Score = 1651, Expect = 0.0e+00, Identities = 315/466 (67%), Positives = 379/466 (81%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           K+EN+  G + Q+ GPV+DV F  +  +P I   L VK+  E +  E AQ +G+ IVR IA+  T  L++  +V +    I VPVGK VL RMFNVLG+PIDG + L    + PIH   P++ +Q  T EI  TGIKVIDLL P+ +GGKIGLFGGAGVGKTVLVQELI+NIA +H GLSVFAGVGER+REGNDLY+EM + GV+DKTALVFGQMNEPPGARMRVAL+ALTMAEYFRD++NQDVLLFIDNIFRFTQAGSEVS LLGR+PS VGYQPTL+TEMGQLQERI ST  GSITSVQA+YVPADD+TDPAPATTF+HLDAKTVLDR IAALGI+PA++PL S+SR L+PNIVG  HY VA  V  ILQRF ELQDIIAILG+DEL++ DK +V RARRIRNFLSQPFFVA+KFSGI G+++ + DT+ +F E+L GK+D++PE+AF +VGTI +A+EKAK++
  S:     3 KQENV--GHIVQIFGPVIDVQFP-NEHMPAILSALEVKINDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTGSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIKNPIHANAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTIDQALEKAKKM 465
>gi|170759729|ref|YP_001785485.1| ATP synthase F1, beta subunit [Clostridium botulinum A3 str. Loch Maree] >gi|190358659|sp|B1KSS8.1|ATPB_CLOBM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|169406718|gb|ACA55129.1| ATP synthase F1, beta subunit [Clostridium botulinum A3 str. Loch Maree] (463 aa)
Score = 1650, Expect = 0.0e+00, Identities = 307/444 (69%), Positives = 368/444 (82%)
  Q:    25 ESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +S  LP +++ L +     ++  E  Q IGDD +R IA+  TEGL R  +  +    + VPVGK VLGR+FNVLGKPIDG  E   +   PIHR  PSF++QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GV++KTALVFGQMNEPPGARMRVALT LTM+EYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+I  LGI+PA++PLES+SR+LDP I+G  HY+VA+ V+NIL+R+ ELQDIIAILGIDEL++EDK++V RAR+I+ FLSQPF VAE+F+G+ GKYVP+ +T++ FKEIL+GKHD++PE AF F GTI++ ++KA++++
  S:    20 DSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRSAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQ-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQME 462
>gi|1929513|gb|AAB51466.1| ATP synthase subunit beta (462 aa)
Score = 1648, Expect = 0.0e+00, Identities = 311/459 (67%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QVIGPVVDV F  S +LP +Y+ +++K     + +EA Q +G++ VRC+AL  T+GL R  K  +   PI VPVG+  LGR+FNVLG+PID +  +    +LPIHR  PSF++Q  + E+ ETGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G SVF+GVGERTREGNDLY EM + GV++KTALVFGQMNEPPGAR+RV LT LTM EYFRD + QDVLLFIDNIFRF Q GSEVSALL RMPSAVGYQPTL TEMG LQERI STK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY+V  GVQ +LQR+ ELQDIIAILG+DEL+++DK+IV RAR+I+ FLSQPF VAE F+G  G YVPL +TI+ FKEIL+G+HD+LPEQAF+ VGTI EAV+K + L
  S:     4 GQVVQVIGPVVDVEFA-SDRLPDLYNAITIKTDKINITMEAMQHLGNNTVRCVALSSTDGLQRGMKAVDTGQPITVPVGRATLGRLFNVLGEPIDNQGPVETTERLPIHRPAPSFEEQQPSTEVLETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIAYEHGGFSVFSGVGERTREGNDLYLEMKESGVLEKTALVFGQMNEPPGARLRVGLTGLTMPEYFRDPEAQDVLLFIDNIFRFVQPGSEVSALLARMPSAVGYQPTLPTEMGPLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRVLGEEHYQVVRGVQQVLQRYKELQDIIAILGMDELSEDDKLIVARARKIQRFLSQPFHVAEAFTGQPGVYVPLKETIRGFKEILEGRHDNLPEQAFYMVGTIDEAVKKGQEL 461
>gi|125975091|ref|YP_001039001.1| F0F1 ATP synthase subunit beta [Clostridium thermocellum ATCC 27405] >gi|171769992|sp|A3DIM9.1|ATPB_CLOTH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|125715316|gb|ABN53808.1| ATP synthase F1, beta subunit [Clostridium thermocellum ATCC 27405] (464 aa)
Score = 1648, Expect = 0.0e+00, Identities = 313/467 (67%), Positives = 370/467 (79%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           M  EN+  G V Q+IGPV+D+ F E  +LP IY+ + +   G ++  E  Q  G+D VRC+++  T+GL R  K  +   PI+VPVGK VLGR+FNVLG+PIDGK ++     LPIHR+ P  D+Q    EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G SVF GVGER+REGNDL+ EM + GVI+KTALVFGQMNEPPG+RMRV LT LTMAEYFRD   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R+I   GI+PA++PL+STSR+LD  IVG  HY VA  VQ ILQR+ ELQDIIAILG+DEL++EDK+IV RAR+I+ FLSQPFFVAE ++G  GK+V + DTI+ FKEI++GK DD+PE AF+  GTI E  E+AK++
  S:     1 MATENV--GTVVQIIGPVIDIRF-ERGKLPSIYNAIKINSEGIDIVAEVMQYTGNDTVRCVSMNSTDGLKRGMKAVDTGEPIKVPVGKEVLGRVFNVLGEPIDGKGDVKATTYLPIHREAPGLDEQKPVTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSVFTGVGERSREGNDLWNEMNESGVIEKTALVFGQMNEPPGSRMRVGLTGLTMAEYFRDELGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRHIVEQGIYPAVDPLDSTSRVLDRRIVGDEHYTVARKVQEILQRYKELQDIIAILGLDELSEEDKLIVFRARKIQRFLSQPFFVAEAYTGYKGKFVRIKDTIRGFKEIIEGKMDDIPEAAFYMAGTIDEVYERAKKM 464
>gi|167768338|ref|ZP_02440391.1| hypothetical protein CLOSS21_02894 [Clostridium sp. SS2/1] >gi|167709862|gb|EDS20441.1| hypothetical protein CLOSS21_02894 [Clostridium sp. SS2/1] (467 aa)
Score = 1647, Expect = 0.0e+00, Identities = 313/455 (68%), Positives = 367/455 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEK 463
           GK+ QVIG V+D+ F  S  LP I D + ++   G +L +E AQ +GDD VRCIA+GPT+GL R  +      PI VPVG+  LGR+FNVLG PID K       +LPIHRK P F +QS   E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI NIA EH G SVF GVGERTREGNDLY EM + GVIDKTA+VFGQMNEPPGARMRV LT LT+AE FRD   +DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTL TEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ +GI+PA++PLESTSR+LDP +VG  HYKVA GVQ ILQ++ ELQDIIAILG+DEL++++K++V+RAR+++ FLSQPFFVAE+F+G  G+YV LSDTIQ FKEIL+GKHD++PE  F   GTI+E VE+
  S:     7 GKITQVIGAVLDIKFG-SDNLPEINDAIDIQTKDGGKLVVEVAQHLGDDTVRCIAMGPTDGLVRGMEAQATGGPISVPVGEATLGRIFNVLGDPIDNKPAPEGANRLPIHRKAPEFSEQSTETEVLETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSVFTGVGERTREGNDLYTEMSESGVIDKTAMVFGQMNEPPGARMRVGLTGLTIAEDFRDRGGKDVLLFIDNIFRFTQAGSEVSALLGRVPSAVGYQPTLQTEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAISEMGIYPAVDPLESTSRILDPKVVGEEHYKVARGVQEILQKYKELQDIIAILGMDELSEDEKLVVDRARKVQRFLSQPFFVAEQFTGKPGQYVSLSDTIQGFKEILEGKHDEIPEGMFLNAGTIEEVVER 461
>gi|153940743|ref|YP_001389519.1| F0F1 ATP synthase subunit beta [Clostridium botulinum F str. Langeland] >gi|170756277|ref|YP_001779784.1| ATP synthase F1, beta subunit [Clostridium botulinum B1 str. Okra] >gi|190358657|sp|B1IE34.1|ATPB_CLOBK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358658|sp|A7G9Q9.1|ATPB_CLOBL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152936639|gb|ABS42137.1| ATP synthase F1, beta subunit [Clostridium botulinum F str. Langeland] >gi|169121489|gb|ACA45325.1| ATP synthase F1, beta subunit [Clostridium botulinum B1 str. Okra] (463 aa)
Score = 1646, Expect = 0.0e+00, Identities = 307/444 (69%), Positives = 367/444 (82%)
  Q:    25 ESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +S  LP +++ L +     ++  E  Q IGDD +R IA+  TEGL R  +  +    + VPVGK VLGR+FNVLGKPIDG  E   +   PIHR  PSF++QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GV++KTALVFGQMNEPPGARMRVALT LTM+EYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I  LGI+PA++PLES+SR+LDP I+G  HY+VA+ V+NIL+R+ ELQDIIAILGIDEL++EDK++V RAR+I+ FLSQPF VAE+F+G+ GKYVP+ +T++ FKEIL+GKHD++PE AF F GTI++ ++KA++++
  S:    20 DSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFTSEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQ-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQME 462
>gi|196251785|ref|ZP_03150451.1| ATP synthase F1, beta subunit [Clostridium thermocellum DSM 4150] >gi|196198725|gb|EDX93556.1| ATP synthase F1, beta subunit [Clostridium thermocellum DSM 4150] (464 aa)
Score = 1646, Expect = 0.0e+00, Identities = 313/467 (67%), Positives = 369/467 (79%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           M  EN+  G V Q+IGPV+D+ F E  +LP IY+ + +   G ++  E  Q  G+D VRC+++  T+GL R  K  +   PI+VPVGK VLGR+FNVLG+PIDGK ++     LPIHR+ P  D+Q    EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G SVF GVGER+REGNDL+ EM + GVI KTALVFGQMNEPPG+RMRV LT LTMAEYFRD   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R+I   GI+PA++PL+STSR+LD  IVG  HY VA  VQ ILQR+ ELQDIIAILG+DEL++EDK+IV RAR+I+ FLSQPFFVAE ++G  GK+V + DTI+ FKEI++GK DD+PE AF+  GTI E  E+AK++
  S:     1 MATENV--GTVVQIIGPVIDIRF-ERGKLPSIYNAIKINSEGIDIVAEVMQYTGNDTVRCVSMNSTDGLKRGMKAVDTGEPIKVPVGKEVLGRVFNVLGEPIDGKGDVKATTYLPIHREAPGLDEQKPVTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSVFTGVGERSREGNDLWNEMNESGVIQKTALVFGQMNEPPGSRMRVGLTGLTMAEYFRDELGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRHIVEQGIYPAVDPLDSTSRVLDRRIVGDEHYTVARKVQEILQRYKELQDIIAILGLDELSEEDKLIVFRARKIQRFLSQPFFVAEAYTGYKGKFVRIKDTIRGFKEIIEGKMDDIPEAAFYMAGTIDEVYERAKKM 464
>gi|148378162|ref|YP_001252703.1| ATP synthase F1, beta subunit [Clostridium botulinum A str. ATCC 3502] >gi|153930870|ref|YP_001382563.1| F0F1 ATP synthase subunit beta [Clostridium botulinum A str. ATCC 19397] >gi|153935797|ref|YP_001386115.1| F0F1 ATP synthase subunit beta [Clostridium botulinum A str. Hall] >gi|168177489|ref|ZP_02612153.1| ATP synthase F1, beta subunit [Clostridium botulinum NCTC 2916] >gi|168182234|ref|ZP_02616898.1| ATP synthase F1, beta subunit [Clostridium botulinum Bf] >gi|190358654|sp|A7FQH9.1|ATPB_CLOB1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358656|sp|A5HY52.1|ATPB_CLOBH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|148287646|emb|CAL81711.1| ATP synthase beta chain [Clostridium botulinum A str. ATCC 3502] >gi|152926914|gb|ABS32414.1| ATP synthase F1, beta subunit [Clostridium botulinum A str. ATCC 19397] >gi|152931711|gb|ABS37210.1| ATP synthase F1, beta subunit [Clostridium botulinum A str. Hall] >gi|182671405|gb|EDT83379.1| ATP synthase F1, beta subunit [Clostridium botulinum NCTC 2916] >gi|182674532|gb|EDT86493.1| ATP synthase F1, beta subunit [Clostridium botulinum Bf] (463 aa)
Score = 1645, Expect = 0.0e+00, Identities = 307/444 (69%), Positives = 368/444 (82%)
  Q:    25 ESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +S  LP +++ L +     ++  E  Q IGDD +R IA+  TEGL R  +  +    + VPVGK VLGR+FNVLGKPIDG  E   +   PIHR  PSF++QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAKEH GLSVF GVGERTREGNDLYYEM + GV++KTALVFGQMNEPPGARMRVALT LTM+EYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+I  LGI+PA++PLES+SR+LDP I+G  HY+VA+ V+NIL+R+ ELQDIIAILGIDEL++EDK++V RAR+I+ FLSQPF VAE+F+G+ GKYVP+ +T++ FKEIL+GKHD++PE AF F GTI++ ++KA++++
  S:    20 DSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQ-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQME 462
>gi|22266799|gb|AAM94913.1|AF522463_8 subunit beta [Ilyobacter tartaricus] (467 aa)
Score = 1644, Expect = 0.0e+00, Identities = 315/462 (68%), Positives = 372/462 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           G + Q+IGPVVDV F   ++LP+IY+ + +    GE L  E  Q +G+++VR I +  +EGL R  +V +   PI VPVGK VLGR+ NVLG+ ID KEEL  +   PIHR+ P+F+DQ   +EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H GLSVFAGVGERTREG DL+ EM + GV+DKT+LV+GQMNEPPGAR+RVALT LTMAE FRD + QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT+MG LQERI STKTGSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R IA+LGI+PA++PL+STS  L P + G  HY  A  VQ++LQR+ ELQDIIAILG+DEL+DEDKI V RAR+I  F SQPF VAE+F+G+ GKYV + +TI  FKEIL+GKHD LPEQAF +VGTI EA+ KA+ L K 
  S:     5 GILTQIIGPVVDVSF--DNELPKIYNAIKIDRGNGEILVAEVQQHLGNNVVRAICMDGSEGLQRGMEVIDTGAPITVPVGKAVLGRILNVLGEAIDQKEELNAEEFAPIHREAPAFEDQGTDVEIFETGIKVIDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGLSVFAGVGERTREGRDLFDEMTESGVLDKTSLVYGQMNEPPGARLRVALTGLTMAENFRDKEGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLGIYPAVDPLDSTSTALQPGVTGHEHYTTAREVQSVLQRYKELQDIIAILGMDELSDEDKITVSRARKIERFFSQPFHVAEQFTGMEGKYVTVKETITGFKEILEGKHDALPEQAFLYVGTIDEAIAKARELMKG 465
>gi|148543702|ref|YP_001271072.1| F0F1 ATP synthase subunit beta [Lactobacillus reuteri F275] >gi|184153112|ref|YP_001841453.1| ATP synthase beta subunit [Lactobacillus reuteri F275] >gi|194468265|ref|ZP_03074251.1| ATP synthase F1, beta subunit [Lactobacillus reuteri 100-23] >gi|166990370|sp|A5VIR1.1|ATPB_LACRF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|148530736|gb|ABQ82735.1| ATP synthase F1, beta subunit [Lactobacillus reuteri F275] >gi|183224456|dbj|BAG24973.1| ATP synthase beta subunit [Lactobacillus reuteri F275] >gi|194453118|gb|EDX42016.1| ATP synthase F1, beta subunit [Lactobacillus reuteri 100-23] (475 aa)
Score = 1643, Expect = 0.0e+00, Identities = 317/469 (67%), Positives = 377/469 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPID-GKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEE 474
           ++ GKV QVIGPVVDV F    +LP I D L +K + G+ L  E A  +GD +VR IA+  T+GL R  +V N    I VPVG + LGR+FNVLG+P+D G +  P   ++PIHR  P +DD +N  EI ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+YYEM   GV++KTA+V+GQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STS  L P IVG  HY+VA  VQ++LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+NFLSQ F VA +F+G+ GKYVPL +TI+ FKEIL GK+DDLPE+AF  VG I++ VEKAK++K  T E+
  S:     1 MSSGKVLQVIGPVVDVEFPLDEKLPEINDALKIKESDGKTLTTEVALELGDGVVRTIAMDGTDGLQRGMEVENTGASISVPVGDDTLGRVFNVLGEPVDNGPKFGPDAKRMPIHRDAPKYDDLNNATEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQIGIYPAVDPLASTSTALTPEIVGKEHYEVATQVQHVLQRYHELQDIISILGMDELSDEEKTIVARARRIQNFLSQSFSVASQFTGLPGKYVPLKETIKGFKEILAGKYDDLPEEAFRLVGPIEDVVEKAKKMKAETDED 471
>gi|190358736|sp|Q04G20.2|ATPB_OENOB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (466 aa)
Score = 1643, Expect = 0.0e+00, Identities = 310/461 (67%), Positives = 378/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G V QVIGP+VDV F ++ +LP I + L V ++ G EL +E +  +GD +VR IA+  T+GL R  KV +   PIEVPVG+  LGR+FNVLG+P+DG + +P    + PIHR  P +D+ + + E+ ETGIKVIDLL PY RGGK GLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+YYEM   GV+  TA+V+GQMNEPPGARMRV LT LTMAE FRD + +DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PLESTS  L P+IVG +HY+VA  VQ+ LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+ FLSQPF VAE+F+G+ G+YVP+ DT++ FKEILDGKHDDLPE+AF  VGTI++AVEKAK+L+ 
  S:     4 GTVLQVIGPIVDVQFPDNKKLPDINNALKVQRIDGSELTIEVSIDLGDSVVRTIAMDSTDGLTRGMKVLDTGAPIEVPVGEATLGRVFNVLGEPVDGGDPIPNSVDRHPIHRSAPKYDELATSTEVLETGIKVIDLLEPYLRGGKTGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLKNTAMVYGQMNEPPGARMRVGLTGLTMAEDFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLESTSSALTPDIVGEDHYEVATQVQHFLQRYKELQDIISILGMDELSDEEKTIVNRARRIQFFLSQPFSVAEQFTGVPGQYVPVEDTVRGFKEILDGKHDDLPEEAFRNVGTIEQAVEKAKKLES 466
>gi|153853572|ref|ZP_01994952.1| hypothetical protein DORLON_00942 [Dorea longicatena DSM 13814] >gi|149753727|gb|EDM63658.1| hypothetical protein DORLON_00942 [Dorea longicatena DSM 13814] (465 aa)
Score = 1643, Expect = 0.0e+00, Identities = 306/460 (66%), Positives = 371/460 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           +T G++ QV+GPVVDV F    +LP I D L V   G+   +E AQ +G++I RCI L  +EGL +  +VT     I+VPVG+  LGR+FNVLG+ ID  E +    +  IHRK PSF++QS  +E+ ETGIKVIDLLTPYA+GGKIGLFGGAGVGKTVL+QELIHNIA EH G S+F GVGER+REGNDL+ EM + GV+DKTALVFGQMNEPPG+RMRVA T LTMAEYFRD ++Q+VLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLA EMG LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF+HLDA TVL R I   GI+PA++PL+STSR+L+P +VG  HY+VA  VQ ILQ++ ELQDIIAILG++EL++EDK+ V RAR+I+ FLSQPF VAE F+G+ GKYVPL +T++ FK I+DG+ D+ PE AFF VGTI++ + KAK
  S:     1 MTKGRIVQVMGPVVDVEFNSREELPFIKDALEVDNGGKRCVMEVAQHVGNNIARCIMLASSEGLQKGMEVTATGAGIKVPVGEKTLGRLFNVLGETIDNGEPIKDSEEWVIHRKAPSFEEQSPAVEVLETGIKVIDLLTPYAKGGKIGLFGGAGVGKTVLIQELIHNIATEHGGYSIFTGVGERSREGNDLWTEMRESGVLDKTALVFGQMNEPPGSRMRVAETGLTMAEYFRDVEHQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLANEMGALQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFSHLDATTVLSRKIVEQGIYPAVDPLDSTSRILEPAVVGEEHYQVARKVQEILQKYKELQDIIAILGMEELSEEDKMTVARARKIQKFLSQPFSVAETFTGVPGKYVPLKETVRGFKAIIDGEMDEYPENAFFNVGTIEDVIAKAK 460
>gi|51891229|ref|YP_073920.1| F0F1 ATP synthase subunit beta [Symbiobacterium thermophilum IAM 14863] >gi|81826265|sp|Q67TB7|ATPB_SYMTH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|51854918|dbj|BAD39076.1| ATP synthase beta subunit [Symbiobacterium thermophilum IAM 14863] (472 aa)
Score = 1643, Expect = 0.0e+00, Identities = 320/459 (69%), Positives = 370/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+  ++G VVDV F +   LP++   L ++  GE     L LE AQ +G++ VRCIA+  T+GL R E V +   PI VPVG+ VLGR+FNVLG+ IDGK  +     LPIHR+PP   +     E+  TGIKVIDLL PYARGGKIGLFGGAGVGKTV++QELIHNIA +  G S+FAGVGERTREGNDLY+EMI+ GVIDK A+VFGQMNEPPGARMRVALT LTMAEYFRD    DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R +    IFPA++PL+STSR+LDPNIVG  HY+VA GVQ +LQR+ ELQDIIAILG+DEL+DEDK+IV RAR+I  FLSQP FVAEKF+ + G +V   DT++ FKEIL+GKHDDLPEQAF+ VGTI++AVEK K+L
  S:     6 GKILAIMGAVVDVEFPDG-HLPKLNHALVIRNGGERGDINLTLEVAQHLGNNQVRCIAMDSTDGLRRGETVYDTQAPITVPVGEPVLGRIFNVLGETIDGKGPVNSPVSLPIHREPPGVANVDPATEMLPTGIKVIDLLCPYARGGKIGLFGGAGVGKTVMIQELIHNIAYKFGGYSIFAGVGERTREGNDLYHEMIEAGVIDKVAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGYLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAVFEKAIFPAVDPLDSTSRILDPNIVGREHYEVARGVQKVLQRYKELQDIIAILGMDELSDEDKLIVARARKIERFLSQPMFVAEKFTNLPGVFVDPKDTVKGFKEILEGKHDDLPEQAFYMVGTIEQAVEKGKKL 467
>gi|91201498|emb|CAJ74558.1| strongly similar to ATP synthase subunit beta [Candidatus Kuenenia stuttgartiensis] (471 aa)
Score = 1642, Expect = 0.0e+00, Identities = 314/463 (67%), Positives = 376/463 (81%)
  Q:     5 NIT---YGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           NIT    G++ QVIGPVVDV F +  +LP I   +S+    +++ +  E AQ +G+D  RCIA+  T+GL R+ +V +   PI VPVGK VLGR+FN+LGKPID KE+   K  LPIHR PPSF+++  T  + ETG+KVIDLL P+ARGGKIGLFGGAGVGKTVL+ ELI +IA EH G S FAGVGERTREGNDL+ EM + GVIDKT LVFGQMNEPPGAR+RVALT LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI +TK GSITS+QA+YVPADD TDPAP TTF HLDA   L R IA LGI+PA++PL STSR+LDP I+G  HY+VA  VQ ILQRF ELQD IAILG++EL++ DK++V RARR++ FLSQPFFVAE+F+G  GKYVPL +TI+ FKE+++GK+D+LPEQAF+ VG I+E VEKAK++
  S:     3 NITERNIGQIVQVIGPVVDVRF-QPGKLPPIKSAVSINDVKKKISVVAEIAQHLGNDTARCIAMSSTDGLVRSMEVLDDGGPISVPVGKEVLGRIFNLLGKPIDTKEDFEAKNYLPIHRAPPSFEERETTTTVLETGLKVIDLLAPFARGGKIGLFGGAGVGKTVLIMELIRSIATEHGGYSAFAGVGERTREGNDLWLEMKESGVIDKTVLVFGQMNEPPGARLRVALTGLTMAEYFRDVEGQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGDLQERITTTKKGSITSLQAVYVPADDFTDPAPVTTFPHLDATIALSRQIAELGIYPAVDPLRSTSRILDPRILGQEHYEVAREVQRILQRFKELQDFIAILGMEELSEADKVLVARARRLQRFLSQPFFVAEQFTGTKGKYVPLKETIRGFKEVVEGKYDNLPEQAFYMVGGIEEVVEKAKQM 469
>gi|153811248|ref|ZP_01963916.1| hypothetical protein RUMOBE_01640 [Ruminococcus obeum ATCC 29174] >gi|149832746|gb|EDM87830.1| hypothetical protein RUMOBE_01640 [Ruminococcus obeum ATCC 29174] (463 aa)
Score = 1641, Expect = 0.0e+00, Identities = 312/464 (67%), Positives = 373/464 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           ++ GK+ QV+GPVVDV+F E   LP I D L V+  G++  +E +Q +G+D+VRCI L  +EGL R+ +V      I+VPVG   LGR+FNVLG+ +DG E L       IHR PPSF++Q   +EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI NIA EH G S+F GVGER+REGNDL+ EM + GV+ KTALVFGQMNEPPG+RMRVA T LTMAEYFRD +++DVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG+LQERIAST +GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLESTSR+L+ ++VG  HY+VA  VQ ILQ++ ELQDIIAILG++EL+DEDK  V RAR+I+ FLSQPF VAE F+GI GKYVPL +TI+ FK I+DG+ D+ PE AFF VGTI E VEKAK L++
  S:     1 MSKGKIVQVMGPVVDVVF-EDGDLPDIKDALEVENNGKKCVMEVSQHLGNDVVRCIMLSASEGLQRDREVIATGSGIKVPVGDCTLGRLFNVLGETVDGGESLDDAEHWVIHRDPPSFEEQKPAVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIQNIATEHGGYSIFTGVGERSREGNDLWSEMKESGVLKKTALVFGQMNEPPGSRMRVAETGLTMAEYFRDTEHRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTTSGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESTSRILEADVVGEEHYEVARRVQEILQKYKELQDIIAILGMEELSDEDKNTVFRARKIQKFLSQPFHVAENFTGIPGKYVPLKETIRGFKMIIDGEMDEYPENAFFNVGTIDEVVEKAKTLEQ 463
>gi|167768302|ref|ZP_02440355.1| hypothetical protein CLOSS21_02858 [Clostridium sp. SS2/1] >gi|167709826|gb|EDS20405.1| hypothetical protein CLOSS21_02858 [Clostridium sp. SS2/1] (462 aa)
Score = 1638, Expect = 2.1e-180, Identities = 310/459 (67%), Positives = 370/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q++GPV+DV F E+ QLP I+D L+V   G+E+ +E  Q +G+  VRCI L  +EGL +  +VT    PI+VPVGK  LGRMFNVLG+ ID  E +  + +  IHR+PP F+DQS  +E+FETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELIHNIA EH G S+F GVGER+REGNDL+ EM + GVI  TALVFGQMNEPPG+RMRVA T LTMAEYFRD + Q+VLLFIDNIFR+ QAGSEVSALLGRMPSAVGYQPTLA E+G LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I+  GI+PA++PLES+SR+L+P+IVG  HY+VA  V+  LQR+ ELQDIIAILG++EL +EDKI V RAR+I+ FLSQPF VAE F+GI GKYVP+ +TI+ FK ILDG+ D+ PEQAF  VGTI +  EKAK +
  S:     4 GKIVQILGPVIDVEF-ETEQLPLIHDALTVVNKGKEVVMEVEQHMGNRTVRCILLAASEGLHKGMEVTATGGPIKVPVGKQTLGRMFNVLGEAIDKGEPVESEEKWAIHREPPKFEDQSPVVEMFETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIHNIATEHGGYSIFTGVGERSREGNDLWNEMTESGVIKNTALVFGQMNEPPGSRMRVAQTGLTMAEYFRDQEKQNVLLFIDNIFRYVQAGSEVSALLGRMPSAVGYQPTLANEVGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAISEQGIYPAVDPLESSSRILEPDIVGEEHYEVARRVEEALQRYKELQDIIAILGMEELDEEDKITVYRARKIQKFLSQPFNVAETFTGIPGKYVPVKETIRGFKAILDGEMDEYPEQAFLMVGTIDDVKEKAKEV 461
>gi|42525218|ref|NP_970598.1| F0F1 ATP synthase subunit beta [Bdellovibrio bacteriovorus HD100] >gi|81829096|sp|Q6MGM7|ATPB_BDEBA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|39577429|emb|CAE81252.1| ATP synthase beta chain [Bdellovibrio bacteriovorus HD100] (468 aa)
Score = 1638, Expect = 2.6e-180, Identities = 314/463 (67%), Positives = 371/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           + +GKV QV+GPVVDV F E  +LP I   L V  K   +    L LE AQ +GD +VR I++  TEGL R EKV      I  PVG+  LGR+ NV+G+PID    +  K Q  IHR  P F+DQ+    +  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+QELI NIA EH G SVFAGVGERTREGNDL+ EM Q GV+ KT+LVFGQMNEPPGAR RVALT LT+AEYFRD +NQDVL F+DNIFRFTQAG+EVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADD TDPAPATTFTHLDA T LDR+IAA+ IFPA++PL STSRLLDP ++G  HYK A  VQ +LQR  ELQDIIAILG+DEL++ DK++V R+R+I+ FLSQPFFVAE+F+G+ GKYV + DT++ F+EILDGKHD LPEQAF+ VGTI++A+EKAK+L+
  S:     1 MAFGKVKQVMGPVVDVEF-EGGELPAINSALRVSNKFISDVEFNLVLEVAQHLGDGVVRTISMDQTEGLVRGEKVKALGTQITAPVGREALGRIINVVGEPIDEMGPVNAKEQWGIHRTAPKFEDQATAAAMLMTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGFSVFAGVGERTREGNDLWQEMKQSGVLAKTSLVFGQMNEPPGARARVALTGLTVAEYFRDVENQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATEMGTLQERITSTKKGSITSVQAVYVPADDYTDPAPATTFTHLDATTNLDRDIAAMAIFPAVHPLTSTSRLLDPTVIGEEHYKCARDVQALLQRNRELQDIIAILGMDELSESDKLVVSRSRKIQRFLSQPFFVAEQFTGLPGKYVDIKDTVKGFREILDGKHDALPEQAFYLVGTIEDAIEKAKKLQ 467
>gi|150020193|ref|YP_001305547.1| F0F1 ATP synthase subunit beta [Thermosipho melanesiensis BI429] >gi|166222423|sp|A6LJR1.1|ATPB_THEM4 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|149792714|gb|ABR30162.1| ATP synthase F1, beta subunit [Thermosipho melanesiensis BI429] (469 aa)
Score = 1636, Expect = 4.2e-180, Identities = 327/462 (70%), Positives = 384/462 (83%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ +VIGPVVDV F E  +LP IYD L V     G++L LE  QLIGD+ VR +AL  T+GL R  +V N   PI+VPVGK  LGRMFNV+G+PIDGKE++      PIHR PPS  +QS ++EI ETGIKVIDLL P+ +GGKIG FGGAGVGKTVLV ELI NIA EH G S+FAGVGERTREGN+LY +M +  V+D T LVFGQMNEPPGAR RVAL+ALTMAEYFRD + +DVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADD+TDPAPATTFTHLDA  VL R  AALG++PA++PL+STS++LDPN+VG  HY+VA GVQ +LQR+ +LQDIIAILG++EL++EDK+IV+RAR+I  FLSQP  VAEKFS I GKYVP+S+TI+ FKEIL+GK+DDLPE AF+ VGTI EAVEKAK+L+KA
  S:     7 GKILRVIGPVVDVQF-EEGELPDIYDALEVINPQTGKKLILEVEQLIGDNAVRTVALDTTDGLMRGLEVENTGEPIKVPVGKGALGRMFNVIGEPIDGKEDVKDVEYWPIHRTPPSITEQSTSVEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHHGFSMFAGVGERTREGNELYLDMQEAEVLDNTVLVFGQMNEPPGARFRVALSALTMAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATVVLSRRRAALGLYPAVDPLDSTSKMLDPNVVGQEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLIVQRARKIERFLSQPVHVAEKFSNIPGKYVPISETIRGFKEILEGKYDDLPEMAFYMVGTIDEAVEKAKKLQKA 469
>gi|184154917|ref|YP_001843257.1| F1F0-ATPase beta subunit [Lactobacillus fermentum IFO 3956] >gi|183226261|dbj|BAG26777.1| F1F0-ATPase beta subunit [Lactobacillus fermentum IFO 3956] (473 aa)
Score = 1634, Expect = 6.4e-180, Identities = 314/468 (67%), Positives = 375/468 (80%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPID-GKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEE 474
           T GKV QVIGPVVD+ F    +LP I   L ++ A ++ L +E A  +GD +VR IA+  T+GL R   V N +  I VPVG + LGR+FNVLG+P+D G E  P   ++PIHR  P ++D SNT E+ ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+YYEM   GV++KTA+V+GQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STS  L P +VG  HY+VA GVQ++LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+NFLSQ F VAE+F+G  G YVPL +T++ FK ILDG++DDLPE+AF  VG I EAV KAK+++  T  E
  S:     3 TTGKVVQVIGPVVDIEFPLDEKLPEINTALKIQEADDKTLTVEVALELGDGVVRTIAMDGTDGLKRGMAVENTDASISVPVGDDTLGRVFNVLGEPVDNGPEFGPDAQRMPIHRDAPKYEDLSNTTEVLETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQIGIYPAVDPLASTSTALTPEVVGQEHYEVATGVQHVLQRYRELQDIISILGMDELSDEEKTIVARARRIQNFLSQSFAVAEQFTGQPGAYVPLEETVKDFKAILDGEYDDLPEEAFRLVGGIDEAVAKAKKMQADTAAE 472
>gi|416680|sp|Q03235|ATPB_PECFR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|581446|emb|CAA45841.1| ATPase (beta-subunit); H(+)-transporting ATP synthase [Pectinatus frisingensis] (470 aa)
Score = 1634, Expect = 6.7e-180, Identities = 309/461 (67%), Positives = 378/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK-LAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPID-GKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+ QVIGPVVD+ F  + +LP I + +++K  +G+    L +E  Q +GD I RCIA+  T+GL R  +  +   PI+VPVG+  LGR+FNVLG+ +D     +  K   PIHR  P FD+Q  + +I ETGIKV+DL+ PY+RGGKIGLFGGAGVGKTVL+ ELIHNIA +H G SVF+GVGERTREGNDL+ EM + GVI+KTALV+GQMNEPPGARMRVALT LTMAEYFRD  +QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++G LQERI STK GSITSVQA+YVPADDLTDP PA TFTHLDA TVL R IA LGI+PA++PL+STSR+LDP+++G +HY+VA GVQ +LQ++ ELQDIIAILG++EL+D DK+ V RAR+I+ FLSQPFFVAE+F+G  GKYVPL +TI+ FKEIL+GK+DDLPE AF+ VG+I EAVE AK++K+
  S:     4 GKIVQVIGPVVDIEFP-AEELPSILNAITIKGKSGDIDINLTVEVMQHLGDGITRCIAMSSTDGLTRGMEAVDTGSPIKVPVGEETLGRVFNVLGQTVDHNPAPVGNKEFWPIHRPAPKFDEQETSTQILETGIKVVDLIAPYSRGGKIGLFGGAGVGKTVLIMELIHNIATQHGGYSVFSGVGERTREGNDLWSEMTESGVINKTALVYGQMNEPPGARMRVALTGLTMAEYFRDVQHQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLTTDVGALQERITSTKKGSITSVQAVYVPADDLTDPGPAATFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPHVIGEDHYEVARGVQAVLQKYKELQDIIAILGMEELSDADKLTVARARKIQRFLSQPFFVAEQFTGSPGKYVPLKETIRGFKEILEGKYDDLPESAFYMVGSIDEAVEAAKKIKQ 468
>gi|2662066|dbj|BAA23688.1| proton-translocating ATPase, beta subunit [Ruminococcus albus] (479 aa)
Score = 1634, Expect = 7.5e-180, Identities = 304/450 (67%), Positives = 360/450 (80%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFF 453
           E+   GK  Q++G VVDV F +   +P + + L +   G +L +E AQ IGDD+VRCIA+  T+GL R     +    I VPVG+  L RMFN+LG P+D         +  IHR+PPS+++Q+   EI ETGIKVIDL+ PY +GGKIGLFGGAGVGKTVL+QELI+N+A +H G+SVF GVGERTREGNDLY+EM + GVIDKT LV+GQMNEPPGARMRV L+ LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+IA+LGIFPA++PLESTSR+L P IVG  HY+VA  VQ+ILQR+ ELQDIIAI+G+DEL+DEDK+ V RAR+I+ FLSQPFFVAE+F+G  GKYVPL +TI+ FKEI++GKHDDLPE AF  
  S:     2 ESTNIGKFVQIVGAVVDVRF-DKEHMPNLLNALEIDNNGTKLVVEVAQHIGDDVVRCIAMSSTDGLVRGVDAVDTGRAISVPVGRETLSRMFNLLGDPVDNLPAPETAERWEIHREPPSYEEQTAANEILETGIKVIDLIAPYLKGGKIGLFGGAGVGKTVLIQELINNVANQHGGISVFTGVGERTREGNDLYWEMKESGVIDKTVLVYGQMNEPPGARMRVGLSGLTMAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTNKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIASLGIFPAVDPLESTSRILTPEIVGNEHYQVARQVQSILQRYVELQDIIAIMGMDELSDEDKLTVSRARKIQRFLSQPFFVAEQFTGYQGKYVPLKETIRGFKEIIEGKHDDLPESAFLL 450
>gi|118573528|sp|Q24MP1|ATPB_DESHY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (465 aa)
Score = 1633, Expect = 7.7e-180, Identities = 314/462 (67%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +  GK+ Q++G VVDV F  S  LP IY  + V +  +  +L LE AQ +G++ VRC+A+  T+GL R     N   PI VPVG   LGR+FNVLGK ID  EE+      PIHR  P+F DQ  +  + ETGIKVIDLL PY++GGKIGLFGGAGVGKTVL+QELI+NIA EH GLSVFAGVGERTREGNDL+ EM + GVIDK A+VFGQMNEPPGAR+RV LT LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST+ GSITSVQAIYVPADDLTDPAPAT F HLDA TVL+R I+  GI+PA++PL+S SR+L P I+G  HYKVA  VQ ILQ++ ELQDIIAILG+DEL++++K++V RARRI  FLSQPF VAE F+G  GKYVP+ +TI+ FKEI++GKHD+LPE AF  VGTI+EA+EKAK L
  S:     1 MNIGKIVQIMGAVVDVEFA-SEALPEIYSAVKVTVPEQKIDLTLEVAQHLGNNTVRCVAMSSTDGLQRGMAALNTGAPITVPVGPATLGRIFNVLGKAIDNGEEVHTDTSYPIHRPAPAFVDQDPSTVMLETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAMEHGGLSVFAGVGERTREGNDLWNEMRESGVIDKMAMVFGQMNEPPGARLRVGLTGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKGIYPAVDPLDSNSRILSPQIIGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLVVSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTIEEAIEKAKAL 463
>gi|171323836|ref|ZP_02912354.1| ATP synthase F1, beta subunit [Geobacillus sp. WCH70] >gi|171090147|gb|EDT36459.1| ATP synthase F1, beta subunit [Geobacillus sp. WCH70] (473 aa)
Score = 1632, Expect = 1.0e-179, Identities = 318/462 (68%), Positives = 374/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG+  LGR+FNVLG+PID + E+P   +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST TGSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK+IV RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D +PE AF  VG I+E VEKAK++
  S:     1 MTKGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDMQGEIPDDARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTATGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYRELQDIIAILGMDELSDEDKLIVHRARRIQFFLSQNFHVAEQFTGQPGSYVPIKETVRGFKEILEGKYDHIPEDAFRLVGRIEEVVEKAKQM 469
>gi|153809937|ref|ZP_01962605.1| hypothetical protein RUMOBE_00318 [Ruminococcus obeum ATCC 29174] >gi|149834115|gb|EDM89195.1| hypothetical protein RUMOBE_00318 [Ruminococcus obeum ATCC 29174] (464 aa)
Score = 1632, Expect = 1.2e-179, Identities = 304/458 (66%), Positives = 364/458 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           G+V QVIGPV+D+ F    +LP + + + ++  G +L  E AQ IGDD+VRCIA+  T+GL R  K  +   PI VPVG   LGR+FN+LG P+D K     K +  IHR  PS+++Q    EI ETGIKV+DL+ PYA+GGKIGLFGGAGVGKTVL+ ELIHN+A  H GLSVF GVGERTREGNDLY EM + GVIDKTALV+GQMNEPPGARMRV L+ LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST+ GSITSVQA+YVPADDLTDPAPATTF+HLDA TVL R I++ GI+PA++PL+STSR+L P IVG  HY++A  VQ +LQR+ ELQDIIAI+G+DEL++EDK  V RAR+++ +LSQ F VAE+F+G+ GKYVPL +T++ FK ILDG+ DD+PE  F F GTI E  EKAK+
  S:     7 GEVVQVIGPVLDIRFAHD-ELPALLNAIEIESNGAKLTAEVAQQIGDDVVRCIAMNSTDGLVRGTKAVDTGGPITVPVGDACLGRVFNLLGDPVDNKPAPEAKERWSIHRPAPSYEEQMPATEILETGIKVVDLICPYAKGGKIGLFGGAGVGKTVLIMELIHNVATAHGGLSVFTGVGERTREGNDLYNEMKESGVIDKTALVYGQMNEPPGARMRVGLSGLTMAEYFRDEKNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGNLQERITSTRKGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSREISSQGIYPAVDPLDSTSRILSPEIVGKEHYEIARSVQRVLQRYKELQDIIAIMGMDELSEEDKRTVSRARKVQRYLSQSFSVAEQFTGMPGKYVPLKETLRGFKMILDGECDDIPESYFLFAGTIDEVFEKAKK 463
>gi|109648044|ref|ZP_01371947.1| ATP synthase F1, beta subunit [Desulfitobacterium hafniense DCB-2] >gi|109641134|gb|EAT50689.1| ATP synthase F1, beta subunit [Desulfitobacterium hafniense DCB-2] (465 aa)
Score = 1632, Expect = 1.3e-179, Identities = 314/462 (67%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +  GK+ Q++G VVDV F  S  LP IY  + V +  +  +L LE AQ +G++ VRC+A+  T+GL R     N   PI VPVG   LGR+FNVLGK ID  EE+      PIHR  P+F DQ  +  + ETGIKVIDLL PY++GGKIGLFGGAGVGKTVL+QELI+NIA EH GLSVFAGVGERTREGNDL+ EM + GVIDK A+VFGQMNEPPGAR+RV LT LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST+ GSITSVQAIYVPADDLTDPAPAT F HLDA TVL+R I+  GI+PA++PL+S SR+L P I+G  HYKVA  VQ ILQ++ ELQDIIAILG+DEL++++K++V RARRI  FLSQPF VAE F+G  GKYVP+ +TI+ FKEI++GKHD+LPE AF  VGTI+EA+EKAK L
  S:     1 MNIGKIVQIMGAVVDVEFA-SEALPEIYSAVKVTVPEKKIDLTLEVAQHLGNNTVRCVAMSSTDGLQRGMAALNTGAPITVPVGPATLGRIFNVLGKAIDNGEEVHTDTSYPIHRPAPAFVDQDPSTVMLETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAMEHGGLSVFAGVGERTREGNDLWNEMRESGVIDKMAMVFGQMNEPPGARLRVGLTGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKGIYPAVDPLDSNSRILSPQILGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLVVSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTIEEAIEKAKAL 463
>gi|154484982|ref|ZP_02027430.1| hypothetical protein EUBVEN_02700 [Eubacterium ventriosum ATCC 27560] >gi|149733935|gb|EDM50054.1| hypothetical protein EUBVEN_02700 [Eubacterium ventriosum ATCC 27560] (468 aa)
Score = 1631, Expect = 1.4e-179, Identities = 307/459 (66%), Positives = 369/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QV+GPVVDV F +++ LP I D L V   G+   +E AQ IG++ VRCI L  +EGL +  +V      I VPVG+  LGR+FNVLG  +D  E+L  +    IHR PPSF+DQS  +E+ ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI NIA +H G S+F GVGER+REGNDL+ EM + GV+DKTALVFGQMNEPPGARMRVA T LTMAEYFRD ++Q+VLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLES SR+L+ ++VG  HY+ A  VQ ILQ++ ELQDII+ILG++EL+DEDK++V RAR+I+ FLSQPF VAE F+G+ GKYVPL +T++ FK I+DG+ DD PE AFF VGTI + +EKAK +
  S:     4 GKIVQVMGPVVDVEFADNN-LPYIKDALEVDNNGKRCVMEVAQHIGNNTVRCIMLAASEGLHKGMEVVATGSGISVPVGEKTLGRLFNVLGDTLDNGEKLDGEQHWCIHRDPPSFEDQSPVVEVLETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELITNIATQHGGYSIFTGVGERSREGNDLWTEMKESGVLDKTALVFGQMNEPPGARMRVAETGLTMAEYFRDEEHQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESNSRILEEDVVGKEHYETARRVQEILQKYTELQDIISILGMEELSDEDKLVVYRARKIQKFLSQPFHVAENFTGVPGKYVPLKETVRGFKAIIDGEMDDYPEAAFFNVGTIDDVIEKAKTM 461
>gi|169188267|ref|ZP_02848413.1| ATP synthase F1, beta subunit [Paenibacillus sp. JDR-2] >gi|169004916|gb|EDS51771.1| ATP synthase F1, beta subunit [Paenibacillus sp. JDR-2] (467 aa)
Score = 1630, Expect = 1.9e-179, Identities = 315/459 (68%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV---KLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V  V+GPVVD+ F E   LP I + + +     AG     L LE A  +GD++VR +A+  T+GL R  +  +   PI +PVG   LGR+FNVLG+PID   E   +  LPIHR+ P+FD+ S   EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTV +QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GV+ KTA+VFGQMNEPPGAR RVALT LTMAEYFRD + +DVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R I+ +GIFPA++PL S+SRLL+P I+G  HY VA GV+ ILQR+ ELQDIIAILG+DEL +EDK+ V RARRI+ FLSQPF VAE F+GI GKYVP+ + ++SFKEIL+GKHDDLPE+AF +VG I+EAVEKAK L
  S:     4 GRVVSVMGPVVDLEF-ERGNLPEILNAVKIVQQAPAGGIDINLTLEVAVHLGDNLVRAVAMSTTDGLVRGMEAVDTGAPITIPVGAATLGRVFNVLGEPIDQAGEAVSETNLPIHRQAPAFDELSTQSEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVTIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVLPKTAMVFGQMNEPPGARQRVALTGLTMAEYFRDAEGKDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKISEMGIFPAVDPLASSSRLLNPEILGEEHYNVAQGVKRILQRYKELQDIIAILGMDELTEEDKLTVSRARRIQLFLSQPFHVAEPFTGIKGKYVPVKEIVRSFKEILEGKHDDLPEEAFRYVGVIEEAVEKAKTL 467
>gi|138896935|ref|YP_001127388.1| F0F1 ATP synthase subunit beta [Geobacillus thermodenitrificans NG80-2] >gi|196249752|ref|ZP_03148448.1| ATP synthase F1, beta subunit [Geobacillus sp. G11MC16] >gi|166201707|sp|A4ITI9.1|ATPB_GEOTN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|134268448|gb|ABO68643.1| ATP synthase beta subunit [Geobacillus thermodenitrificans NG80-2] >gi|196210628|gb|EDY05391.1| ATP synthase F1, beta subunit [Geobacillus sp. G11MC16] (473 aa)
Score = 1630, Expect = 2.0e-179, Identities = 317/462 (68%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG   LGR+FNVLG+PID ++++P + +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEILDGK+D LPE AF  VG I+E VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHQARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVVDTGAPISVPVGDVTLGRVFNVLGEPIDLQDDIPAEARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTSKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARRVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILDGKYDHLPEDAFRLVGRIEEVVEKAKAM 469
>gi|160942705|ref|ZP_02089947.1| hypothetical protein FAEPRAM212_00181 [Faecalibacterium prausnitzii M21/2] >gi|158445979|gb|EDP22982.1| hypothetical protein FAEPRAM212_00181 [Faecalibacterium prausnitzii M21/2] (464 aa)
Score = 1630, Expect = 2.1e-179, Identities = 302/458 (65%), Positives = 369/458 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           GKV QVIGPV+D+ F +  +LP + + + +   G++L +E AQL GD++ RCIA+  T+GL R     +    I+VPVG   LGR+FN+LG+P+D K         PIHR  PS+++Q +T EI ETGIKV+DL+ PYA+GGKIGLFGGAGVGKTVL+QELI+NIA EH+G SVF GVGERTREGNDLY EM + GVI+KTALV+GQMNEPPGARMRVAL+ LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST+ GSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R+IA+ GI+PA++PL+STSR+L P +VG  HY++A  VQ +LQR+ ELQDIIAI+G+DEL++EDK  V RAR+++ FLSQ F VAE+F+G+ G+YVPL +T++ FK IL G+ D+LPE AF F GTI +   KAK+
  S:     7 GKVIQVIGPVLDIQFKDG-ELPELLNAIEIDNHGQKLVVEVAQLTGDNVARCIAMSSTDGLVRGTDAVDTGESIKVPVGDQCLGRVFNLLGEPVDNKPAPTPDAYWPIHRPAPSYEEQQSTTEILETGIKVVDLICPYAKGGKIGLFGGAGVGKTVLIQELIYNIATEHNGYSVFTGVGERTREGNDLYGEMTESGVINKTALVYGQMNEPPGARMRVALSGLTMAEYFRDVKNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRDIASQGIYPAVDPLDSTSRILSPEVVGQEHYEIARAVQKVLQRYKELQDIIAIMGMDELSEEDKRTVSRARKVQRFLSQSFHVAEQFTGMPGQYVPLKETLRGFKMILSGECDELPESAFLFAGTIDDVFAKAKK 463
>gi|167463135|ref|ZP_02328224.1| F0F1 ATP synthase subunit beta [Paenibacillus larvae subsp. larvae BRL-230010] (468 aa)
Score = 1629, Expect = 2.3e-179, Identities = 311/459 (67%), Positives = 370/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G++  V GPVVD+ F E   LP I + ++++   E        L +E A  +GD++VRC+A+  T+GL R  +V +   PI VPVG + LGR++NVLG+PIDG  E  +    PIH+  P + D +   E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR+RVAL+ LTMAEYFRD + +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLDA T L+R+IAA GIFPA++PL STSR+L P IVG  HY+VA GV+ ILQR+ ELQDIIAILG+DEL++EDKI V RARRI  FLSQP  VAE+F+GI G YVP+ +T++SFKE+L+GKHDDLPE AF  VGTI+EA EKAK L
  S:     4 GRIVSVQGPVVDIEF-ERGHLPDILNAITIEKKAESANEVGIHLTVEVALQLGDNLVRCVAMSSTDGLVRGMEVVDTGAPIMVPVGPSTLGRVYNVLGEPIDGDGEADRTLTSPIHKPAPEYSDLTTQAEMLETGIKVVDLLAPYMKGGKIGLFGGAGVGKTVTMQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVIAKTAMVFGQMNEPPGARLRVALSGLTMAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERSIAAKGIFPAVDPLASTSRILTPQIVGEEHYEVAQGVKEILQRYKELQDIIAILGMDELSEEDKITVNRARRIERFLSQPLHVAEQFTGIKGIYVPVKETVRSFKEVLEGKHDDLPEAAFINVGTIEEAREKAKTL 468
>gi|1352033|sp|P29707|ATPB_PROMO ATP synthase subunit beta, sodium ion specific (Na(+)-translocating ATPase subunit beta) >gi|897798|emb|CAA41374.1| beta subunit [Propionigenium modestum] (467 aa)
Score = 1627, Expect = 4.8e-179, Identities = 308/462 (66%), Positives = 369/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           G + Q+IGPVVDV F   ++LPRIY+ L +    GE L  E  Q +G+ +VR +A+  T+GL R  +V +    I VPVGK VLGR+ NVLG+P+D   E+  +   PIHR+ P+F+DQ    E+FETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA+ H GLSVFAGVGERTREG DLY EM++ GV+DKT+LV+GQMNEPPGAR+RV LT LTMAE FRD + QDVL F+DNIFRFTQA SEVSALLGRMPSAVGYQP LAT+MG LQERI STKTGSITSVQA+YVPADDLTDPAPATTFTHLDA TVL R IA+LGI+PA++PL+STS  L+P I+G  HY  A  VQ ILQR+ ELQDIIAILG+DEL+DEDK+ V RAR+I  F SQPF VAE+F+G+ GKYV + +TI+ FKEI++GKHDDLPEQAF +VGTI EA+ KA+ L K 
  S:     5 GVITQIIGPVVDVTF--ENELPRIYNALKIDRGNGEYLVAEVQQHLGNSVVRAVAMDATDGLQRGMEVVDTGPAITVPVGKAVLGRILNVLGEPVDEAGEVKAEEYAPIHREAPAFEDQGTEKEVFETGIKVVDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAQGHGGLSVFAGVGERTREGRDLYDEMLESGVLDKTSLVYGQMNEPPGARLRVGLTGLTMAENFRDKEGQDVLFFVDNIFRFTQAPSEVSALLGRMPSAVGYQPNLATDMGALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLGIYPAVDPLDSTSTALEPQIIGHEHYNTAREVQQILQRYKELQDIIAILGMDELSDEDKVTVNRARKIERFFSQPFHVAEQFTGMDGKYVTVKETIRGFKEIIEGKHDDLPEQAFLYVGTIDEAIAKARELMKG 465
>gi|192809056|ref|ZP_03037731.1| ATP synthase F1, beta subunit [Geobacillus sp. Y412MC10] >gi|192801727|gb|EDV78232.1| ATP synthase F1, beta subunit [Geobacillus sp. Y412MC10] (466 aa)
Score = 1626, Expect = 5.7e-179, Identities = 308/459 (67%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V  + G VVD+ F E   LP I++ + ++   E     +L LE +  +GD++VRCIA+  T+GL R  +  +   PI VPVG   LGR+FNVLG+PID    +  +   PIHR+ P++D+ S   E+ ETGIKVIDLL PY +GGKIGLFGGAGVGKTV +QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI+KTA+VFGQMNEPPGAR+RVALT LTMAEYFRD + +DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA+EMG+LQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R I+ +GI+PA++PL S+SR+L P IVG  HY VA GV+ IL R+ ELQDIIAILG+DEL++EDK IV RARR++ FLSQ F VAE+F+GI GKYVP+ +T++SFKEIL+GKHD LPE AF FVGTI+EAVEKAK L
  S:     4 GRVVSITGAVVDIEF-ERGHLPEIFNAVKIEATLEGGRSVDLTLEVSNHLGDNLVRCIAMSSTDGLVRGIEAVDLGRPITVPVGSATLGRVFNVLGEPIDNAGAVVSEVNNPIHREAPAYDELSTQAEMLETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVAIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVINKTAMVFGQMNEPPGARLRVALTGLTMAEYFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLASEMGRLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKISEMGIYPAVDPLASSSRILAPEIVGEEHYNVAQGVKKILARYNELQDIIAILGMDELSEEDKAIVGRARRVQRFLSQAFHVAEQFNGIPGKYVPVKETVRSFKEILEGKHDHLPEAAFLFVGTIEEAVEKAKTL 466
>gi|168333944|ref|ZP_02692176.1| ATP synthase F1, beta subunit [Epulopiscium sp. 'N.t. morphotype B'] (468 aa)
Score = 1626, Expect = 6.4e-179, Identities = 308/459 (67%), Positives = 364/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA------GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G +  +IGPV+D+ FT  + LP +Y+ + +          E + +E AQ +GDD+VRCI++  TEGL R  +  N   PI VPVG   LGR+FNV G P+D K   P     PIHR  PSF++QS T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI NIA EH G SVFAGVGERTREGNDL++EM   GVI+KT +VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLF+DNIFRF QAGSEVSALLGR+PSAVGYQPTLATE+G LQERI ST  GSITSVQA+YVPADDLTDPAPATTF HLDAKTVL R+I   GI+PA++PL+STSR+LDP IVG +HY V+  VQ  LQR+ ELQDIIAILG+DEL++ DKI V RAR+++ FLSQPF VAE F+G+ GK+VP+ +T++ FKEILDGK+D LPE AF  VGTI++A EKAK L
  S:     6 GHIITIIGPVIDIKFTPEN-LPALYNAIHIITGKDDEGNNETITVEVAQHLGDDVVRCISMAATEGLVRGMECINTGAPITVPVGDKTLGRIFNVTGDPVDNKPA-PDAEHWPIHRAAPSFEEQSTTAEILETGIKVVDLLCPYLKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGFSVFAGVGERTREGNDLFHEMTDSGVINKTTMVFGQMNEPPGARMRVALTGLTMAEYFRDESGQDVLLFVDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEVGTLQERITSTNKGSITSVQAVYVPADDLTDPAPATTFAHLDAKTVLSRSIVEQGIYPAVDPLDSTSRILDPQIVGQDHYDVSRQVQATLQRYKELQDIIAILGMDELSESDKITVNRARKVQKFLSQPFHVAETFTGMHGKFVPVKETVRGFKEILDGKYDHLPENAFLMVGTIEDAAEKAKTL 468
>gi|170017975|ref|YP_001728894.1| ATP synthase F1, beta subunit [Leuconostoc citreum KM20] >gi|169804832|gb|ACA83450.1| ATP synthase F1, beta subunit [Leuconostoc citreum KM20] (466 aa)
Score = 1626, Expect = 6.5e-179, Identities = 309/464 (66%), Positives = 374/464 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELP-KKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           ++ GKV QVIGPVVDV F    Q+P I + L + K  G+ L +E +  +GD IVR IA+  T+GL R   VT+    I+VPVG+  LGR+FNVLG+P+D   E+  + P+  IHR  PS+DD +N+ EI ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+Y+EM + GV+ +TA+V+GQMNEPPGARMRVALT LTMAE FRD + +DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STS  LDP +VG  HY+VA  VQ  LQR+ ELQDII+ILG+DEL+DE+K  V RARRI+ FLSQPF VAE F+GI G+YVP+++T++SFKEILDGK+DDLPE AF  VG I++ VEKAK + +
  S:     1 MSTGKVVQVIGPVVDVAFESGQQVPDINNALKIDKGDGQTLTVEVSLALGDGIVRTIAMDSTDGLQRGMSVTDTGDAIKVPVGEATLGRVFNVLGEPVDNNGEIAAETPRHSIHRDAPSYDDLANSTEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYHEMAESGVLKQTAMVYGQMNEPPGARMRVALTGLTMAENFRDSEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSSALDPQVVGQEHYEVATEVQRTLQRYRELQDIISILGMDELSDEEKTTVNRARRIQFFLSQPFSVAETFTGINGEYVPVAETVRSFKEILDGKYDDLPEDAFRNVGAIEQVVEKAKTMAQ 466
>gi|23100430|ref|NP_693897.1| F0F1 ATP synthase subunit beta [Oceanobacillus iheyensis HTE831] >gi|81845990|sp|Q8EM83|ATPB_OCEIH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|22778663|dbj|BAC14931.1| H(+)-transporting ATP synthase beta chain [Oceanobacillus iheyensis HTE831] (464 aa)
Score = 1625, Expect = 8.3e-179, Identities = 315/463 (68%), Positives = 373/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL-AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G+V Q++GPVVDV F E ++LP + + L V+  +GEEL LE A  +GD+ VR IA+  T+G  R  +V N   PI VPVG   LGR+FNVLG+ ID  E L +  +  PIHR+ P F++ S   EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLYYEM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T LDR ++  GI+PA++PLESTSR LDP +VG  HY+VA  VQ  LQ++ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+DDLPE AF  VG I+E VEKAK ++
  S:     1 MSKGRVTQLMGPVVDVRF-EDAELPAVNNALVVRSDSGEELTLEVALHLGDNSVRTIAMSSTDGFKRGAEVENLGRPISVPVGDVTLGRVFNVLGEKIDLDEPLEEGVRRDPIHREAPDFENLSTETEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMSDSGVIAKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTDKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLDRKLSEQGIYPAVDPLESTSRALDPEVVGKEHYEVATEVQQTLQKYRELQDIIAILGMDELSDEDKLVVARARRIQFFLSQNFHVAEQFTGQPGSYVPVQETVKGFKEILEGKYDDLPEDAFRLVGRIEEVVEKAKGME 464
>gi|50123428|ref|YP_052595.1| F0F1 ATP synthase subunit beta [Pectobacterium atrosepticum SCRI1043] >gi|81826953|sp|Q6CYJ5|ATPB_ERWCT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|49613954|emb|CAG77407.1| ATP synthase beta chain [Erwinia carotovora subsp. atroseptica SCRI1043] (460 aa)
Score = 1624, Expect = 9.6e-179, Identities = 308/459 (67%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++YD L V+   E+L LE  Q +G  IVRCIA+G ++GL R   V N  HPIEVPVGK  LGR+ NVLG PID K ++ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I E VEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYDALEVENGAEKLVLEVQQQLGGGIVRCIAMGSSDGLRRGLNVNNLGHPIEVPVGKATLGRIMNVLGDPIDMKGDIGEEERWAIHRSAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEVVEKAKKL 460
>gi|194684376|emb|CAR46024.1| ATP synthase beta chain [Proteus mirabilis HI4320] (460 aa)
Score = 1623, Expect = 1.4e-178, Identities = 308/459 (67%), Positives = 374/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVD  F + S +P++YD L V    E+L LE  Q +G  IVRCIA+G ++GL+R  KV +  HPIEVPVGK  LGR+ NVLG PID K E+  + +  IHR+ P++++ SN+ E+ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK IL+G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIVQVIGAVVDAEFPQDS-VPKVYDALEVMNGKEKLVLEVQQQLGGGIVRCIAMGTSDGLSRGLKVEDLGHPIEVPVGKATLGRIMNVLGTPIDMKGEIETEERWSIHREAPTYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|153815545|ref|ZP_01968213.1| hypothetical protein RUMTOR_01781 [Ruminococcus torques ATCC 27756] >gi|145847187|gb|EDK24105.1| hypothetical protein RUMTOR_01781 [Ruminococcus torques ATCC 27756] (462 aa)
Score = 1622, Expect = 1.6e-178, Identities = 306/457 (66%), Positives = 372/457 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAK 465
           GK+ QV+GPVVDV+F +   LP I D L V+  G++  +E AQ +G++ VRC+ L  +EGL ++ +VT     I+VPVG+  LGR+FNVLG+ +D  E++    Q  IHR PP+F+DQS  +EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI NIA EH G S+F GVGER+REGNDL+ EM + GV++KTALVFGQMNEPPGARMRVA T LTMAEYFRD ++++VLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R +   GI+PA++PLES+SR+L+  IVG  HY+VA  V  ILQ++ ELQDIIAILG++EL+DEDK  V RAR+I+ FLSQPFFVAE F+G+ GKYVPL +TI+ FK I+DG+ D+ PE AFF VG+I + +EKAK
  S:     4 GKIIQVMGPVVDVVF-QDGNLPFIKDALEVENNGKKCVMEVAQHLGNNEVRCLMLAASEGLHKDMEVTATGAGIKVPVGEKTLGRLFNVLGETVDDGEQITDADQWVIHRDPPTFEDQSPVVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSIFTGVGERSREGNDLWTEMKESGVLEKTALVFGQMNEPPGARMRVAETGLTMAEYFRDEEHRNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKVVEQGIYPAVDPLESSSRILEAEIVGEEHYEVANKVIAILQKYKELQDIIAILGMEELSDEDKATVMRARKIQKFLSQPFFVAETFTGVPGKYVPLKETIRGFKMIIDGEMDEYPESAFFNVGSIDDVIEKAK 459
>gi|160938925|ref|ZP_02086276.1| hypothetical protein CLOBOL_03819 [Clostridium bolteae ATCC BAA-613] >gi|158437888|gb|EDP15648.1| hypothetical protein CLOBOL_03819 [Clostridium bolteae ATCC BAA-613] (466 aa)
Score = 1621, Expect = 1.9e-178, Identities = 307/463 (66%), Positives = 374/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ GK+ QV+GPVVDV F E   LP I D L V   G++  +E AQ +G ++VRCI L  ++GL ++ +V      I+VPVG+  LGR+FNVLG+ IDG E L  + +  IHR PPSF+DQS  +E+ ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI NIA EH G S+F GVGER+REGNDL+ EM + GV++KTALVFGQMNEPPGARMRVA T LTMAEYFRD ++Q+VLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATE+G+LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLESTSR+L+ ++VG  HY+VA  VQ +LQ++ ELQDIIAILG++EL+++DK+ V RAR+I+ FLSQPF VAE F+G+ GKYVP+ +TI+ FK I+DG+ D+ PE AFF VGTI E  EKAK L+
  S:     1 MSKGKIIQVMGPVVDVAF-EDDGLPHIKDALVVDNQGKKCVMEVAQHVGGNVVRCIMLASSDGLCKDMEVEPTGAGIQVPVGEKTLGRLFNVLGETIDGGESLEGEDKWVIHRDPPSFEDQSPVVEMLETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELITNIATEHGGYSIFTGVGERSREGNDLWTEMRESGVLEKTALVFGQMNEPPGARMRVAETGLTMAEYFRDVEHQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEVGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESTSRILEEDVVGKEHYEVANKVQQMLQKYKELQDIIAILGMEELSEDDKLTVNRARKIQRFLSQPFHVAENFTGVPGKYVPVKETIRGFKAIIDGEMDEYPEAAFFNVGTIDEVAEKAKTLE 462
>gi|124516445|gb|EAY57953.1| F0F1-type ATP synthase, beta subunit [Leptospirillum sp. Group II UBA] (463 aa)
Score = 1621, Expect = 2.1e-178, Identities = 308/460 (66%), Positives = 372/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G++ QVIGPVVDV F E S +P IY  L V+  G ++ LE  Q IG+ +VR IA+  T+GL R  KV N   PI+VPVG++VLGRM +VLG P+D    +  + +  IHR+PP F++ ++  E+FETGIKV+DL+ P+A+GGK GLFGGAGVGKTV++ ELI NIA EH G SVFAGVGERTREGNDL+ EM +  VIDKT+LV+GQMNEPPG R+RVALT LT AEYFRD + +DVL FIDNIFRFT AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF+HLDA  VL R IA LGI+PA++PL+STSR+LDP IVG  HY VA  VQ  LQ++ +LQDIIAILG+DEL+D+DK IV RARRI+ FLSQPFFVAE F+G  GKYV   DT+++FKEI++GKHD+LPEQAF+ VGTI+EA+EKA++LK
  S:     4 GEIIQVIGPVVDVRFPEGS-VPDIYAALIVE--GNDIILETQQQIGEGVVRSIAMSTTDGLVRGMKVKNTGSPIQVPVGQSVLGRMMDVLGNPVDEAGPITAEARRSIHREPPGFEELASATEVFETGIKVVDLIAPFAKGGKTGLFGGAGVGKTVIIMELIRNIAMEHGGFSVFAGVGERTREGNDLWNEMKESKVIDKTSLVYGQMNEPPGVRLRVALTGLTQAEYFRDEERRDVLFFIDNIFRFTLAGAEVSALLGRMPSAVGYQPTLAVEMGGLQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDATVVLSRQIAELGIYPAVDPLDSTSRILDPMIVGEEHYGVARAVQKTLQKYKDLQDIIAILGMDELSDDDKRIVGRARRIQRFLSQPFFVAEVFTGSPGKYVSRQDTVKAFKEIVEGKHDELPEQAFYMVGTIEEALEKAEKLK 460
>gi|169826600|ref|YP_001696758.1| ATP synthase subunit beta [Lysinibacillus sphaericus C3-41] >gi|168991088|gb|ACA38628.1| ATP synthase subunit beta [Lysinibacillus sphaericus C3-41] (471 aa)
Score = 1621, Expect = 2.3e-178, Identities = 318/459 (69%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA--GEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G V QV+GPVVDV F ++ QLP IY+ L+VK+    EE   L LE A  +GDD VR IA+  T+GL R  +VT+    I VPVG+  LGR+FNVLG+ ID  EE+P   +   IHR+ P+F++ S T+EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EHSG+SVFAGVGERTREGNDL++EM   GVI +TA+VFGQMNEPPGARMRVALT LTMAEYFRD    DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA GVQ  +QR+ ELQDIIAILG+DEL+DEDK  VERARRI+ FLSQ F VAE+F+G  G YVP+ +T++SFKEILDGK D LPE AF  VG+I E VEKAK +
  S:     4 GHVIQVMGPVVDVKF-DNGQLPAIYNSLTVKIERPNEEPTILALEVALHLGDDSVRTIAMSSTDGLQRGAEVTDSGKAISVPVGEVTLGRVFNVLGEVIDLGEEIPADARRDSIHREAPTFEELSTTVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLFFEMSDSGVIKQTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGKLQERITSTNKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGAEHYAVATGVQRTIQRYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRSFKEILDGKWDHLPEDAFRLVGSIDEVVEKAKSM 467
>gi|163814609|ref|ZP_02205998.1| hypothetical protein COPEUT_00760 [Coprococcus eutactus ATCC 27759] >gi|158450244|gb|EDP27239.1| hypothetical protein COPEUT_00760 [Coprococcus eutactus ATCC 27759] (453 aa)
Score = 1621, Expect = 2.3e-178, Identities = 307/452 (67%), Positives = 367/452 (81%)
  Q:    15 IGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           +GPVVDV F ++  LP I D L V   G++  +E AQ +G++ VRCI L  +EGL+R+ +V      I+VPVG   LGR+FNVLG+ IDGKE+L       IHR+PP+F++QS  +EI ETGIKVIDLL PY++GGKIGLFGGAGVGKTVL+QELI NIA  H G S+F GVGER+REGNDL+ EM + GVIDKTALVFGQMNEPPGARMRVA T LTMAEYFRD ++QDVLLFIDNIFRFTQAGSEVS+LLGRMPSAVGYQPTLA EMG+LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLES+SR+L+ +IVG  HY+VA  VQ ILQ++ ELQDIIAILG++EL+DEDK+ V RAR+++ FLSQPF VAE F+GI GKYV L DTI+ FK I+DG+ D+ PE AFF VGTI+E  EKA++
  S:     1 MGPVVDVEFPDND-LPYIKDALEVDNHGKKCVMEVAQHVGNNTVRCIMLSASEGLSRDMEVVATGSGIKVPVGNQTLGRLFNVLGETIDGKEDLSDTEHWVIHREPPTFENQSPVIEILETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELIQNIASVHGGYSIFTGVGERSREGNDLWTEMSESGVIDKTALVFGQMNEPPGARMRVAETGLTMAEYFRDVNHQDVLLFIDNIFRFTQAGSEVSSLLGRMPSAVGYQPTLANEMGELQERIASTKEGSVTSVQAVYVPADDLTDPAPATTFAHLDANTVLSRKIVEQGIYPAVDPLESSSRILEADIVGEEHYEVARRVQEILQKYKELQDIIAILGMEELSDEDKLTVTRARKVQKFLSQPFHVAENFTGIPGKYVSLKDTIKGFKMIVDGEMDEYPEWAFFNVGTIEEVKEKAEK 451
>gi|189426219|ref|YP_001953396.1| ATP synthase F1, beta subunit [Geobacter lovleyi SZ] >gi|189422478|gb|ACD96876.1| ATP synthase F1, beta subunit [Geobacter lovleyi SZ] (471 aa)
Score = 1620, Expect = 2.7e-178, Identities = 308/459 (67%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-----EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG V+DV F E  +LP IY  L V           L LE AQ +G++ VR IA+  T+GL R + V +    I  PVG+  LGR+ NV+G+P+D    +  + +  IHR+ P+F+DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVALTAL++AEYFRD +NQDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI STK GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY VA  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F+EI+ GKHD+LPEQAF+ VG+I+EA+EKA +L
  S:     6 GKISQVIGAVIDVEF-EPGKLPEIYHALRVTNPAIDDRENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVIDTGKQICAPVGRKTLGRIMNVIGEPVDEMGPIGNEKEYGIHREAPAFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGYSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALTALSVAEYFRDEENQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAVARSVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDNLPEQAFYMVGSIEEAIEKAAKL 468
>gi|154503952|ref|ZP_02041012.1| hypothetical protein RUMGNA_01778 [Ruminococcus gnavus ATCC 29149] >gi|153795379|gb|EDN77799.1| hypothetical protein RUMGNA_01778 [Ruminococcus gnavus ATCC 29149] (464 aa)
Score = 1620, Expect = 2.8e-178, Identities = 307/456 (67%), Positives = 370/456 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKA 464
           G++ QV+GPVVDV+F E   LP I D L V+  G++  +E AQ +G++ VRC+ L  +EGL ++ +VT     I+VPVG+  LGR+FNVLG+ ID  E++    +  IHR+PP+F+DQS  +EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI NIA EH G S+F GVGER+REGNDL+ EM + GV++KTALVFGQMNEPPGARMRVA T LTMAEYFRD  +Q+VLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLES+SR+L+ ++VG  HY+VA  V  ILQ++ ELQDIIAILG++EL+DEDK  V RAR+I+ FLSQPFFVAE F+GI GKYVPL +TI+ FK I+DG+ D  PE AFF VGTI + + KA
  S:     4 GRIVQVMGPVVDVVF-EDGNLPYIKDALEVENNGKKCIMEVAQHLGNNEVRCLMLAASEGLHKDMEVTATGAGIKVPVGEKTLGRLFNVLGETIDNGEQIEDAEKWVIHREPPTFEDQSPVVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSIFTGVGERSREGNDLWSEMKESGVLEKTALVFGQMNEPPGARMRVAETGLTMAEYFRDEQHQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESSSRILEADVVGEEHYEVANKVIAILQKYKELQDIIAILGMEELSDEDKATVMRARKIQRFLSQPFFVAETFTGIPGKYVPLKETIRGFKMIIDGEMDAYPESAFFNVGTIDDVIAKA 458
>gi|56421893|ref|YP_149211.1| F0F1 ATP synthase subunit beta [Geobacillus kaustophilus HTA426] >gi|81819603|sp|Q5KUJ3|ATPB_GEOKA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56381735|dbj|BAD77643.1| F0F1-type ATP synthasebeta chain [Geobacillus kaustophilus HTA426] (473 aa)
Score = 1620, Expect = 2.9e-178, Identities = 316/462 (68%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG+  LGR+FNVLG+PID + ++P   +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE AF  VG I+E VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGRIEEVVEKAKAM 469
>gi|166033116|ref|ZP_02235945.1| hypothetical protein DORFOR_02838 [Dorea formicigenerans ATCC 27755] >gi|166027473|gb|EDR46230.1| hypothetical protein DORFOR_02838 [Dorea formicigenerans ATCC 27755] (470 aa)
Score = 1620, Expect = 3.2e-178, Identities = 309/466 (66%), Positives = 372/466 (79%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQ-LPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           + ++  G++ QV+GPVVDV+F E  +LP I D L V    +   +E AQ +G+  VRC+ L  +EGL ++ +V      I+VPVG   LGR+FNVLG+ ID  +E+ K  +   IHR+ P+F++QS  +EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI N+A EH G S+F GVGER+REGNDL+ EM   GV++KTALVFGQMNEPPGARMRVA T LTMAEYFRD ++Q+VLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERIASTK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R +   GI+PA++PLES SR+L+ +IVG  HYKVA  V  ILQ++ ELQDIIAILG++EL+DEDK  V RAR+I+ FLSQPFFVAE F+GI GKYVPL +TI+ FK I+DG+ D+ PE AFF VGTI E +EKAK LK
  S:     2 RTDMNKGRIVQVMGPVVDVLF-EDGELPNIKDALEVDNGDKTCIMEVAQHLGNSEVRCLMLAASEGLHKDMEVRATGSGIKVPVGDQTLGRLFNVLGQTIDDGKEIEKDAERWEIHRQAPTFEEQSPAVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIRNVATEHGGYSIFTGVGERSREGNDLWTEMKASGVLEKTALVFGQMNEPPGARMRVAETGLTMAEYFRDKEHQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKVVEQGIYPAVDPLESNSRILEADIVGEEHYKVANQVTEILQKYKELQDIIAILGMEELSDEDKATVMRARKIQKFLSQPFFVAETFTGIPGKYVPLKETIRGFKMIIDGEMDEYPEAAFFNVGTIDEVIEKAKTLK 467
>gi|157368257|ref|YP_001476246.1| F0F1 ATP synthase subunit beta [Serratia proteamaculans 568] >gi|166990375|sp|A8G7M8.1|ATPB_SERP5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157320021|gb|ABV39118.1| ATP synthase F1, beta subunit [Serratia proteamaculans 568] (460 aa)
Score = 1619, Expect = 3.3e-178, Identities = 306/459 (66%), Positives = 378/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y+ L V+    +L LE  Q +G  +VRCIA+G ++GL R  KVT+ +HPIEVPVGK  LGR+ NVLG+PID K ++ ++ +  IHR  PS++D +N+ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I+DG +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYNALEVENGANKLVLEVQQQLGGGVVRCIAMGTSDGLRRGLKVTDLDHPIEVPVGKATLGRIMNVLGEPIDMKGDIGEEERWAIHRPAPSYEDLANSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMNDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMDGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|1703680|sp|P50002|ATPB_ACEWO ATP synthase subunit beta, sodium ion specific (Na(+)-translocating ATPase subunit beta) >gi|501149|gb|AAA79908.1| F1FO ATPase beta subunit [Acetobacterium woodii] >gi|1096934|prf||2113197B Na ATPase:ISOTYPE=beta (466 aa)
Score = 1619, Expect = 3.9e-178, Identities = 311/460 (67%), Positives = 363/460 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GKV QVIGPVVDV F +  +LP++ + ++++L G  L +E AQ +GDDIVRCIA+  T+GL RN++  +    I+VPVGK  LGRMFNVLG+PIDGK    K   + PIHR PPSF++Q    E+FETGIKV+DL+ PY RGGKIGLFGGAGVGKTVL+QELI+NIA +H GLSVFAGVGERTREGNDLYYEM++ GVI+KTAL FGQMNEPPGARMR+AL  LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST  GSITSVQA+Y PADDLTDPAPATTF HLDA TVL R I   GI+PA++PL+STSR+LDP IVG  HY+ A  VQ ILQR+ ELQDIIAILG+DEL+D DKI V RAR++    +    +        G      DTI+ FKEIL G+HDDLPE AF  VGTI++AV KAK++K
  S:     6 GKVVQVIGPVVDVKF-QKDKLPKLNNAVNIELNGHTLVIEVAQQLGDDIVRCIAMDSTDGLMRNQEAVDTGSAIQVPVGKATLGRMFNVLGEPIDGKPFDTKDVVMHPIHRHPPSFEEQQTQPEMFETGIKVVDLICPYVRGGKIGLFGGAGVGKTVLIQELINNIATQHGGLSVFAGVGERTREGNDLYYEMMESGVINKTALCFGQMNEPPGARMRIALAGLTMAEYFRDDEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTSKGSITSVQAVYDPADDLTDPAPATTFAHLDATTVLSRAITEKGIYPAVDPLDSTSRILDPKIVGQEHYETAREVQEILQRYKELQDIIAILGMDELSDADKITVSRARKVERLFANHLMLRNSLPVRWGICKRFGDTIKGFKEILQGQHDDLPESAFLLVGTIEDAVVKAKKIK 465
>gi|82779076|ref|YP_405425.1| F0F1 ATP synthase subunit beta [Shigella dysenteriae Sd197] >gi|118573745|sp|Q329S1|ATPB_SHIDS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81243224|gb|ABB63934.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Shigella dysenteriae Sd197] (460 aa)
Score = 1618, Expect = 4.5e-178, Identities = 307/459 (66%), Positives = 374/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L+V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I+EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALAVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL 460
>gi|110602257|ref|ZP_01390383.1| ATP synthase F1, beta subunit [Geobacter sp. FRC-32] >gi|110547034|gb|EAT60334.1| ATP synthase F1, beta subunit [Geobacter sp. FRC-32] (470 aa)
Score = 1618, Expect = 4.9e-178, Identities = 308/459 (67%), Positives = 370/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-----EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG V+DV F E  +LP IY+ L V           L LE AQ +G++ VR IA+  T+GL R + V +    I VPVG+  LGR+ NV+G+P+D    +    +  IHR+ P F DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVAL+AL++AEYFRD + Q+VLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ FKEI+DGKHDD+PEQAF+ VGTI+EA+EKAK+L
  S:     6 GKISQVIGAVIDVEF-EPGKLPPIYNALRVTNPAIDDNENNLVLEVAQHLGENSVRTIAMDSTDGLVRGQAVLDTGKQISVPVGRKTLGRILNVIGEPVDEMGPVNADKEYGIHREAPEFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFKEIVDGKHDDIPEQAFYMVGTIEEAIEKAKKL 468
>gi|126653441|ref|ZP_01725537.1| F0F1 ATP synthase subunit beta [Bacillus sp. B14905] >gi|126589797|gb|EAZ83930.1| F0F1 ATP synthase subunit beta [Bacillus sp. B14905] (471 aa)
Score = 1617, Expect = 6.5e-178, Identities = 317/459 (69%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA--GEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G V QV+GPVVDV F  + QLP IY+ L+VK+    EE   L LE A  +GDD VR IA+  T+GL R  +VT+    I VPVG+  LGR+FNVLG+ ID  EE+P   +   IHR+ P+F++ S T+EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EHSG+SVFAGVGERTREGNDL++EM   GVI +TA+VFGQMNEPPGARMRVALT LTMAEYFRD    DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY +A GVQ  +QR+ ELQDIIAILG+DEL+DEDK  VERARRI+ FLSQ F VAE+F+G  G YVP+ +T++SFKEILDGK D LPE AF  VG+I E VEKAK +
  S:     4 GHVIQVMGPVVDVKFN-NGQLPAIYNSLTVKIERPNEEPTILALEVALHLGDDSVRTIAMSSTDGLQRGAEVTDSGKAISVPVGEVTLGRVFNVLGEVIDLGEEIPADARRDSIHREAPTFEELSTTVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLFFEMSDSGVIKQTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGKLQERITSTNKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGAEHYAIATGVQRTIQRYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRSFKEILDGKWDHLPEDAFRLVGSIDEVVEKAKSM 467
>gi|728922|sp|P41009|ATPB_BACCA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|533290|dbj|BAA07248.1| ATPase subunit beta [Bacillus caldotenax] (473 aa)
Score = 1617, Expect = 7.0e-178, Identities = 315/462 (68%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG+  LGR+FNVLG+PID + ++P   +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS TS+QAIYVPADD TDPAPATTF+HLDA T L+RN+A +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE  F  VG I+E VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSTTSIQAIYVPADDYTDPAPATTFSHLDATTNLERNVAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEVVEKAKAM 469
>gi|157163214|ref|YP_001460532.1| F0F1 ATP synthase subunit beta [Escherichia coli HS] >gi|166990368|sp|A8A6J5.1|ATPB_ECOHS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157068894|gb|ABV08149.1| ATP synthase F1, beta subunit [Escherichia coli HS] (460 aa)
Score = 1617, Expect = 7.0e-178, Identities = 307/459 (66%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I+EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGSERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL 460
>gi|81096628|ref|ZP_00874965.1| ATP synthase F1, beta subunit [Streptococcus suis 89/1591] >gi|190358731|sp|A4W1V7.2|ATPB_STRS2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358732|sp|A4VVJ9.2|ATPB_STRSY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|80977307|gb|EAP40853.1| ATP synthase F1, beta subunit [Streptococcus suis 89/1591] (468 aa)
Score = 1616, Expect = 7.3e-178, Identities = 308/463 (66%), Positives = 373/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL---AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ GK+ QV+GPVVDV F    +LP I + L V     + +++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +E  P    + PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA+ V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP+++T++ FKEILDGKHD LPE AF  VG+I++ V KA ++K
  S:     1 MSSGKITQVVGPVVDVAFAAEDKLPEINNALVVYKNDDSKQKVVLEVALELGDGVVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEESFPADFEREPIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQLGIYPAVDPLASSSRALAPQIVGEEHYAVAMEVKRVLQRYQELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVKGFKEILDGKHDHLPEDAFRNVGSIEDVVAKAAKMK 467
>gi|15804332|ref|NP_290371.1| F0F1 ATP synthase subunit beta [Escherichia coli O157:H7 EDL933] >gi|15833928|ref|NP_312701.1| F0F1 ATP synthase subunit beta [Escherichia coli O157:H7 str. Sakai] >gi|16131600|ref|NP_418188.1| F1 sector of membrane-bound ATP synthase, beta subunit [Escherichia coli str. K-12 substr. MG1655] >gi|24115035|ref|NP_709545.1| F0F1 ATP synthase subunit beta [Shigella flexneri 2a str. 301] >gi|26250476|ref|NP_756516.1| F0F1 ATP synthase subunit beta [Escherichia coli CFT073] >gi|30064963|ref|NP_839134.1| F0F1 ATP synthase subunit beta [Shigella flexneri 2a str. 2457T] >gi|74314242|ref|YP_312661.1| F0F1 ATP synthase subunit beta [Shigella sonnei Ss046] >gi|82546107|ref|YP_410054.1| F0F1 ATP synthase subunit beta [Shigella boydii Sb227] >gi|89110275|ref|AP_004055.1| F1 sector of membrane-bound ATP synthase, beta subunit [Escherichia coli W3110] >gi|91213257|ref|YP_543243.1| F0F1 ATP synthase subunit beta [Escherichia coli UTI89] >gi|110644073|ref|YP_671803.1| F0F1 ATP synthase subunit beta [Escherichia coli 536] >gi|110807556|ref|YP_691076.1| F0F1 ATP synthase subunit beta [Shigella flexneri 5 str. 8401] >gi|117626005|ref|YP_859328.1| F0F1 ATP synthase subunit beta [Escherichia coli APEC O1] >gi|157156404|ref|YP_001465223.1| F0F1 ATP synthase subunit beta [Escherichia coli E24377A] >gi|168709485|ref|ZP_02741762.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4045] >gi|168735318|ref|ZP_02767595.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4115] >gi|168748538|ref|ZP_02773560.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4113] >gi|168753634|ref|ZP_02778641.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4401] >gi|168759932|ref|ZP_02784939.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|168766232|ref|ZP_02791239.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4486] >gi|168772219|ref|ZP_02797226.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4196] >gi|168779967|ref|ZP_02804974.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4076] >gi|168786575|ref|ZP_02811582.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC869] >gi|168790965|ref|ZP_02815972.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4042] >gi|168798780|ref|ZP_02823787.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC508] >gi|170022231|ref|YP_001727185.1| ATP synthase F1, beta subunit [Escherichia coli ATCC 8739] >gi|170083233|ref|YP_001732553.1| F1 sector of membrane-bound ATP synthase, beta subunit [Escherichia coli str. K12 substr. DH10B] >gi|170681189|ref|YP_001746062.1| ATP synthase F1, beta subunit [Escherichia coli SMS-3-5] >gi|170766683|ref|ZP_02901136.1| ATP synthase F1, beta subunit [Escherichia albertii TW07627] >gi|187732921|ref|YP_001882431.1| ATP synthase F1, beta subunit [Shigella boydii CDC 3083-94] >gi|188493678|ref|ZP_03000948.1| ATP synthase F1, beta subunit [Escherichia coli 53638] >gi|191165806|ref|ZP_03027644.1| ATP synthase F1, beta subunit [Escherichia coli B7A] >gi|191170404|ref|ZP_03031957.1| ATP synthase F1, beta subunit [Escherichia coli F11] >gi|193063774|ref|ZP_03044861.1| ATP synthase F1, beta subunit [Escherichia coli E22] >gi|193069207|ref|ZP_03050164.1| ATP synthase F1, beta subunit [Escherichia coli E110019] >gi|194428061|ref|ZP_03060605.1| ATP synthase F1, beta subunit [Escherichia coli B171] >gi|194431044|ref|ZP_03063337.1| ATP synthase F1, beta subunit [Shigella dysenteriae 1012] >gi|194435783|ref|ZP_03067886.1| ATP synthase F1, beta subunit [Escherichia coli 101-1] >gi|195936359|ref|ZP_03081741.1| F0F1 ATP synthase subunit beta [Escherichia coli O157:H7 str. EC4024] >gi|81175147|sp|P0ABB4.2|ATPB_ECOLI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|123146532|sp|Q0SYU4.1|ATPB_SHIF8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166201701|sp|A1AHR4.1|ATPB_ECOK1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166990367|sp|A7ZTU4.1|ATPB_ECO24 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081332|sp|B1IX06.1|ATPB_ECOLC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81175145|sp|P0ABB6|ATPB_ECO57 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81175146|sp|P0ABB5|ATPB_ECOL6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81175148|sp|P0ABB7|ATPB_SHIFL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573529|sp|Q0TAX7|ATPB_ECOL5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573530|sp|Q1R4K2|ATPB_ECOUT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573744|sp|Q31UN2|ATPB_SHIBS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573746|sp|Q3YVN6|ATPB_SHISS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|12518589|gb|AAG58935.1|AE005605_3 membrane-bound ATP synthase, F1 sector, beta-subunit [Escherichia coli O157:H7 EDL933] >gi|26110906|gb|AAN83090.1|AE016769_205 ATP synthase beta chain [Escherichia coli CFT073] >gi|41038|emb|CAA23527.1| unnamed protein product [Escherichia coli] >gi|42277|emb|CAA23594.1| unnamed protein product [Escherichia coli] >gi|146325|gb|AAA83875.1| H+ ATPase F1 beta subunit [Escherichia coli] >gi|148139|gb|AAA24737.1| ATP synthase beta subunit [Escherichia coli] >gi|290581|gb|AAA62084.1| ATP synthase F1 beta subunit >gi|899257|emb|CAA25782.1| unnamed protein product [Escherichia coli] >gi|1790170|gb|AAC76755.1| F1 sector of membrane-bound ATP synthase, beta subunit [Escherichia coli str. K-12 substr. MG1655] >gi|13364149|dbj|BAB38097.1| membrane-bound ATP synthase beta-subunit AtpD [Escherichia coli O157:H7 str. Sakai] >gi|24054294|gb|AAN45252.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Shigella flexneri 2a str. 301] >gi|30043224|gb|AAP18945.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Shigella flexneri 2a str. 2457T] >gi|73857719|gb|AAZ90426.1| membrane-bound ATP synthase, F1 sector, beta subunit [Shigella sonnei Ss046] >gi|81247518|gb|ABB68226.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Shigella boydii Sb227] >gi|85676306|dbj|BAE77556.1| F1 sector of membrane-bound ATP synthase, beta subunit [Escherichia coli W3110] >gi|91074831|gb|ABE09712.1| membrane-bound ATP synthase F1 sector beta-subunit [Escherichia coli UTI89] >gi|110345665|gb|ABG71902.1| ATP synthase beta chain [Escherichia coli 536] >gi|110617104|gb|ABF05771.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Shigella flexneri 5 str. 8401] >gi|115515129|gb|ABJ03204.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Escherichia coli APEC O1] >gi|157078434|gb|ABV18142.1| ATP synthase F1, beta subunit [Escherichia coli E24377A] >gi|169757159|gb|ACA79858.1| ATP synthase F1, beta subunit [Escherichia coli ATCC 8739] >gi|169891068|gb|ACB04775.1| F1 sector of membrane-bound ATP synthase, beta subunit [Escherichia coli str. K12 substr. DH10B] >gi|170124121|gb|EDS93052.1| ATP synthase F1, beta subunit [Escherichia albertii TW07627] >gi|170518907|gb|ACB17085.1| ATP synthase F1, beta subunit [Escherichia coli SMS-3-5] >gi|187429913|gb|ACD09187.1| ATP synthase F1, beta subunit [Shigella boydii CDC 3083-94] >gi|187771754|gb|EDU35598.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4196] >gi|188016914|gb|EDU55036.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4113] >gi|188488877|gb|EDU63980.1| ATP synthase F1, beta subunit [Escherichia coli 53638] >gi|189002239|gb|EDU71225.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4076] >gi|189359262|gb|EDU77681.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4401] >gi|189364495|gb|EDU82914.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4486] >gi|189369653|gb|EDU88069.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|189373310|gb|EDU91726.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC869] >gi|189378771|gb|EDU97187.1| ATP synthase F1, beta subunit [Escherichia coli O157:H7 str. EC508] >gi|190904130|gb|EDV63841.1| ATP synthase F1, beta subunit [Escherichia coli B7A] >gi|190909212|gb|EDV68798.1| ATP synthase F1, beta subunit [Escherichia coli F11] >gi|192930489|gb|EDV83096.1| ATP synthase F1, beta subunit [Escherichia coli E22] >gi|192957531|gb|EDV87977.1| ATP synthase F1, beta subunit [Escherichia coli E110019] >gi|194413819|gb|EDX30097.1| ATP synthase F1, beta subunit [Escherichia coli B171] >gi|194420499|gb|EDX36575.1| ATP synthase F1, beta subunit [Shigella dysenteriae 1012] >gi|194425326|gb|EDX41310.1| ATP synthase F1, beta subunit [Escherichia coli 101-1] (460 aa)
Score = 1616, Expect = 7.8e-178, Identities = 307/459 (66%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I+EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL 460
>gi|116494662|ref|YP_806396.1| F0F1 ATP synthase subunit beta [Lactobacillus casei ATCC 334] >gi|191638161|ref|YP_001987327.1| ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) [Lactobacillus casei] >gi|122263917|sp|Q03A18.1|ATPB_LACC3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116104812|gb|ABJ69954.1| F0F1-type ATP synthase, beta subunit [Lactobacillus casei ATCC 334] >gi|190712463|emb|CAQ66469.1| ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) [Lactobacillus casei BL23] (488 aa)
Score = 1616, Expect = 8.4e-178, Identities = 312/461 (67%), Positives = 369/461 (80%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           + GK+ QVIGPVVDV F  +  LP I + L+V K  G +L LE A  +GD ++R IA+  T+GL RN  V +   PI VPVGK+ LGR+FNVLG PIDG E   P   +  IHR  P F+D + + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GV++ TA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +   GI+PA++PLES+S  L P IVG  HYKVA  VQ +LQR+ ELQDII+ILG+DEL+DE+K++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FK ILDGK+DD PE AF  VG I+E VEKAK++
  S:     4 STGKIAQVIGPVVDVAFPINGDLPEINNALTVAKKDGSQLVLEVALELGDGVMRTIAMDSTDGLQRNMAVQDTGGPISVPVGKDTLGRVFNVLGDPIDGGEAFGPDHRRDSIHRDAPKFEDLNTSSEILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVLENTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERRLTEQGIYPAVDPLESSSSALTPEIVGDEHYKVATEVQQVLQRYRELQDIISILGMDELSDEEKVVVARARRIQFFLSQNFNVAERFTGQPGSYVPVEETVKGFKAILDGKYDDYPEDAFRSVGRIEEVVEKAKKM 466
>gi|37524072|ref|NP_927416.1| F0F1 ATP synthase subunit beta [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81572787|sp|Q7NA94|ATPB_PHOLL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|36783495|emb|CAE12335.1| ATP synthase beta chain [Photorhabdus luminescens subsp. laumondii TTO1] (460 aa)
Score = 1615, Expect = 9.5e-178, Identities = 306/459 (66%), Positives = 376/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++YD L V+    +L LE  Q +G  +VRCIA+G ++GL+R   VT+  HPIEVPVGK  LGR+ NVLG+PID K ++ ++ +  IHR  PS+++ SN+ E+ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK ILDG +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDT-VPKVYDALEVQNGEAKLVLEVQQQLGGGVVRCIAMGTSDGLSRGLSVTDLGHPIEVPVGKATLGRIMNVLGEPIDMKGDIGEEERWAIHRPAPSYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYNVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVARARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILDGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|89897658|ref|YP_521145.1| F0F1 ATP synthase subunit beta [Desulfitobacterium hafniense Y51] >gi|89337106|dbj|BAE86701.1| ATP synthase F1 beta subunit [Desulfitobacterium hafniense Y51] (456 aa)
Score = 1615, Expect = 9.6e-178, Identities = 311/453 (68%), Positives = 362/453 (79%)
  Q:    15 IGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +G VVDV F  S  LP IY  + V +  +  +L LE AQ +G++ VRC+A+  T+GL R     N   PI VPVG   LGR+FNVLGK ID  EE+      PIHR  P+F DQ  +  + ETGIKVIDLL PY++GGKIGLFGGAGVGKTVL+QELI+NIA EH GLSVFAGVGERTREGNDL+ EM + GVIDK A+VFGQMNEPPGAR+RV LT LTMAEYFRD  NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST+ GSITSVQAIYVPADDLTDPAPAT F HLDA TVL+R I+  GI+PA++PL+S SR+L P I+G  HYKVA  VQ ILQ++ ELQDIIAILG+DEL++++K++V RARRI  FLSQPF VAE F+G  GKYVP+ +TI+ FKEI++GKHD+LPE AF  VGTI+EA+EKAK L
  S:     1 MGAVVDVEFA-SEALPEIYSAVKVTVPEQKIDLTLEVAQHLGNNTVRCVAMSSTDGLQRGMAALNTGAPITVPVGPATLGRIFNVLGKAIDNGEEVHTDTSYPIHRPAPAFVDQDPSTVMLETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAMEHGGLSVFAGVGERTREGNDLWNEMRESGVIDKMAMVFGQMNEPPGARLRVGLTGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKGIYPAVDPLDSNSRILSPQIIGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLVVSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTIEEAIEKAKAL 454
>gi|123444373|ref|YP_001008338.1| F0F1 ATP synthase subunit beta [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166222426|sp|A1JTC6.1|ATPB_YERE8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|122091334|emb|CAL14220.1| ATP synthase beta subunit protein [Yersinia enterocolitica subsp. enterocolitica 8081] (460 aa)
Score = 1615, Expect = 1.0e-177, Identities = 305/459 (66%), Positives = 378/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y+ L V+ A E+L LE  Q +G  +VRCIA+G ++GL+R  KV N  HPIEVPVGK+ LGR+ NVLG PID K  + ++ +  IHR+ PS++D +++ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I++G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYNALEVEGAAEKLVLEVQQQLGGGVVRCIAMGSSDGLSRGLKVINLEHPIEVPVGKSTLGRIMNVLGDPIDMKGPIGEEERWAIHREAPSYEDLASSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|86605139|ref|YP_473902.1| F0F1 ATP synthase subunit beta [Synechococcus sp. JA-3-3Ab] >gi|118573767|sp|Q2JX57|ATPB_SYNJA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|86553681|gb|ABC98639.1| ATP synthase F1, beta subunit [Synechococcus sp. JA-3-3Ab] (477 aa)
Score = 1615, Expect = 1.1e-177, Identities = 312/460 (67%), Positives = 367/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QVIGPV+D  F  S +LP IY+ L V+   E     ++  E  QL+GD+ VR +A+  T+GL R   V +   PI VPVG+  LGR+FNVLG+P+D  E +  K   PIHR  P F + +   E FETGIKVIDLL P+ RGGK+GLFGGAGVGKTVL+QELIHNIA+EHSGLSVFAGVGERTREGNDLY EM + GV+DK ALV+GQMNEPPGARMRV LTALTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLD+  VL R++AA GI+PA++PL+S+S +L  +IVG  HY  A  V+  LQR+ ELQDIIAILG+DEL++EDK++V RARRI  FLSQPFFVAE F+G  GKYV L DTI+ F+ IL G+ D LPEQAF+ VGTI+EA+EKA++LK
  S:    12 GYITQVIGPVIDAEFP-SGKLPEIYNALKVEATTESGLKVKVTFEVQQLLGDNRVRAVAMSSTDGLVRGMPVVDTGAPITVPVGEATLGRIFNVLGEPVDQGEPVQAKEFAPIHRSAPPFVELTVKPEPFETGIKVIDLLAPFKRGGKVGLFGGAGVGKTVLIQELIHNIAEEHSGLSVFAGVGERTREGNDLYNEMKESGVLDKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGNLQERITSTKQGSITSVQAVYVPADDLTDPAPATTFAHLDSTVVLSRSLAAKGIYPAVDPLDSSSTILQADIVGEEHYNTAQAVKQTLQRYKELQDIIAILGLDELSEEDKLVVARARRIERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQRILSGELDHLPEQAFYLVGTIEEAIEKAEKLK 475
>gi|183597137|ref|ZP_02958630.1| hypothetical protein PROSTU_00376 [Providencia stuartii ATCC 25827] >gi|188023447|gb|EDU61487.1| hypothetical protein PROSTU_00376 [Providencia stuartii ATCC 25827] (460 aa)
Score = 1615, Expect = 1.1e-177, Identities = 307/459 (66%), Positives = 375/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++YD L V    E+L LE  Q +G  +VRCIA+G ++GL+R  +V N  HPIEVPVGK  LGR+ NVLG PID K ++ ++ +  IHR  PS+++ S++ E+ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP IVG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK IL+G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYDALEVVNGKEKLVLEVQQQLGGGVVRCIAMGTSDGLSRGLEVKNLEHPIEVPVGKATLGRIMNVLGDPIDMKGDIGEEERWSIHRAAPSYEELSSSTELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLIVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|16762461|ref|NP_458078.1| F0F1 ATP synthase subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767149|ref|NP_462764.1| F0F1 ATP synthase subunit beta [Salmonella typhimurium LT2] >gi|29143949|ref|NP_807291.1| F0F1 ATP synthase subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|62182347|ref|YP_218764.1| F0F1 ATP synthase subunit beta [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161505610|ref|YP_001572722.1| F0F1 ATP synthase subunit beta [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161616985|ref|YP_001590950.1| F0F1 ATP synthase subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167560495|ref|ZP_02353498.1| hypothetical protein Sententeri_27037 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168224040|ref|ZP_02649272.1| hypothetical protein Senterenterica_26885 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168229020|ref|ZP_02654251.1| hypothetical protein Sententeric_24845 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168263239|ref|ZP_02685212.1| hypothetical protein Salmentericaenterica_19303 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464800|ref|ZP_02698692.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478093|ref|ZP_02707116.1| hypothetical protein Salmoentericaenterica_25881 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194444846|ref|YP_002043111.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450391|ref|YP_002047894.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194471110|ref|ZP_03077094.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734293|ref|YP_002116806.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189081341|sp|A9MJR9.1|ATPB_SALAR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081342|sp|A9MXA6.1|ATPB_SALPB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|75505463|sp|Q57HX9|ATPB_SALCH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81832703|sp|Q7CPE2|ATPB_SALTY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81849133|sp|Q8XGX4|ATPB_SALTI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|25290439|pir||AF0954 ATP synthase beta chain [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422439|gb|AAL22723.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Salmonella typhimurium LT2] >gi|16504766|emb|CAD03130.1| ATP synthase beta subunit [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139585|gb|AAO71151.1| ATP synthase beta subunit [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|62129980|gb|AAX67683.1| membrane-bound ATP synthase, F1 sector, beta-subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|160866957|gb|ABX23580.1| hypothetical protein SARI_03786 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161366349|gb|ABX70117.1| hypothetical protein SPAB_04806 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403509|gb|ACF63731.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408695|gb|ACF68914.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194457474|gb|EDX46313.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194709795|gb|ACF89016.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632484|gb|EDX50968.1| ATP synthase F1, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (460 aa)
Score = 1615, Expect = 1.1e-177, Identities = 307/459 (66%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E+L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGNEKLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL 460
>gi|6625703|gb|AAF19362.1|AF188265_8 ATP synthase subunit beta [Salmonella typhimurium] (460 aa)
Score = 1614, Expect = 1.3e-177, Identities = 306/459 (66%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+D+IAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I+EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDVIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL 460
>gi|169852676|ref|XP_001833020.1| ATP synthase beta chain [Coprinopsis cinerea okayama7#130] >gi|116505814|gb|EAU88709.1| ATP synthase beta chain [Coprinopsis cinerea okayama7#130] (540 aa)
Score = 1614, Expect = 1.6e-177, Identities = 313/463 (67%), Positives = 368/463 (79%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK-LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-----DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           + G V  VIG VVDV F ES  LP I + L V+   G  L LE A  +G++ VR IA+  TEGL R  KV +   PI VPVGK  LGR+ NV+G+PID +  +  +  LPIH  PP+F DQS T E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTVL+QELI+N+AK H G S+F GVGERTREGNDLY+EMI+ GVI      K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTL+T+MG +QERI +TK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+IA LGI+PA++PL+S SR+LDP IVG  HY+VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ VERAR+I+ F+SQPF VA+ F+G  GK V L DTI+SFKEIL G+HD LPE AF+ VGTI++   KA++L K
  S:    69 SIGTVKTVIGAVVDVQF-ESDNLPPILNALEVQDFHGGRLVLEVASHLGENSVRTIAMDGTEGLVRGAKVVDTGAPIMVPVGKGTLGRIINVIGEPIDERGPIKGEKMLPIHADPPAFVDQSTTAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNVAKAHGGFSIFCGVGERTREGNDLYHEMIETGVIQLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTDMGAMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLDSKSRMLDPRIVGQEHYEVATAVQKILQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFQVAQVFTGYEGKLVTLKDTIRSFKEILSGQHDSLPESAFYMVGTIEDVKAKAEQLAK 536
>gi|56415733|ref|YP_152808.1| F0F1 ATP synthase subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|81599724|sp|Q5PKX2|ATPB_SALPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56129990|gb|AAV79496.1| ATP synthase beta subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (460 aa)
Score = 1613, Expect = 1.6e-177, Identities = 307/459 (66%), Positives = 373/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E+L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I EAVEKAK+L
  S:     4 GKIVQVIGAVVDVDFPQDA-VPRVYDALEVQNGNEKLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL 460
>gi|191163783|ref|ZP_03025655.1| ATP synthase F1, beta subunit [Geobacter sp. M21] >gi|190995228|gb|EDV70684.1| ATP synthase F1, beta subunit [Geobacter sp. M21] (470 aa)
Score = 1613, Expect = 1.6e-177, Identities = 307/461 (66%), Positives = 374/461 (81%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEE--LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
            +GK+ QVIG V+DV F E  +LP IY  L V    +  +E  L LE AQ +G++ VR IA+  T+GL R ++V +    I VPVGK  LGR+ NV+G+P+D    +  + +  IHR+ P+F +QS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVAL+AL++AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F EI+ GKHDDLPEQAF+ VGTI+EA+EKA++L
  S:     4 NFGKISQVIGAVIDVEF-EPGKLPPIYQALRVTNPAIDDQEFNLVLEVAQHLGENAVRTIAMDSTDGLVRGQQVKDMGKQISVPVGKKTLGRILNVIGEPVDEMGPIGNEKEYGIHREAPAFVNQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGDEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQKFLSQPFHVAEAFTGSPGKYVELKDTIKGFSEIIAGKHDDLPEQAFYMVGTIEEAIEKAQKL 468
>gi|77918557|ref|YP_356372.1| F0F1 ATP synthase subunit beta [Pelobacter carbinolicus DSM 2380] >gi|118573499|sp|Q3A605|ATPB1_PELCD ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|77544640|gb|ABA88202.1| ATP synthase F1, beta subunit [Pelobacter carbinolicus DSM 2380] (468 aa)
Score = 1613, Expect = 1.6e-177, Identities = 308/462 (66%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPV+DV F E+ +LP IY  L V     G+E   L  E AQ +G++ VR IA+  T+GL R ++V N    I VPVG+  LGR+ NV+G+P+D +  +       IHR  P F DQS  +E FETGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELIHNIAK+H G SVFAGVGERTREGNDL+ EM +  V+DKTALV+GQMNEPPGAR RVAL+ALT+AEYFRD +NQDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTL+TEMG+LQERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+S+SR+LDP ++G  HY+VA  VQ +LQR+ +LQDIIAILG+DEL++EDK  V RAR+I+ FLSQPF VAE F+G  GKYV LS+TI+ FKEI++GKHD +PEQAF+  G I E +E A ++
  S:     1 MSNGKITQVIGPVIDVEF-EAGELPEIYYALKVSNPSLGDEPWNLVAEVAQHLGENTVRAIAMDSTDGLVRGQEVLNTGRQISVPVGRGTLGRILNVIGEPVDEQGPVETDTTWEIHRPTPEFVDQSTKVEAFETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELIHNIAKKHGGFSVFAGVGERTREGNDLWNEMKESNVLDKTALVYGQMNEPPGARARVALSALTVAEYFRDQENQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITTTKNGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSSSRILDPQVLGEEHYQVARDVQYVLQRYKDLQDIIAILGMDELSEEDKQTVSRARKIQRFLSQPFHVAEIFTGTPGKYVELSETIRGFKEIVEGKHDSVPEQAFYMAGGIDEVLENAAKM 466
>gi|146318826|ref|YP_001198538.1| F0F1 ATP synthase subunit beta [Streptococcus suis 05ZYH33] >gi|146321035|ref|YP_001200746.1| F0F1 ATP synthase subunit beta [Streptococcus suis 98HAH33] >gi|145689632|gb|ABP90138.1| F0F1-type ATP synthase, beta subunit [Streptococcus suis 05ZYH33] >gi|145691841|gb|ABP92346.1| F0F1-type ATP synthase, beta subunit [Streptococcus suis 98HAH33] (481 aa)
Score = 1613, Expect = 1.7e-177, Identities = 308/467 (65%), Positives = 374/467 (80%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL---AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +   ++ GK+ QV+GPVVDV F    +LP I + L V     + +++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +E  P    + PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA+ V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP+++T++ FKEILDGKHD LPE AF  VG+I++ V KA ++K
  S:    10 RGNRMSSGKITQVVGPVVDVAFAAEDKLPEINNALVVYKNDDSKQKVVLEVALELGDGVVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEESFPADFEREPIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQLGIYPAVDPLASSSRALAPQIVGEEHYAVAMEVKRVLQRYQELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVKGFKEILDGKHDHLPEDAFRNVGSIEDVVAKAAKMK 480
>gi|157144366|ref|YP_001451685.1| F0F1 ATP synthase subunit beta [Citrobacter koseri ATCC BAA-895] >gi|166201697|sp|A8ACN6.1|ATPB_CITK8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157081571|gb|ABV11249.1| hypothetical protein CKO_00070 [Citrobacter koseri ATCC BAA-895] (460 aa)
Score = 1613, Expect = 1.8e-177, Identities = 307/459 (66%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K E+ ++ +  IHR  PS+++ SN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGNEHLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL 460
>gi|90961576|ref|YP_535492.1| F0F1 ATP synthase subunit beta [Lactobacillus salivarius UCC118] >gi|118573690|sp|Q1WUC6|ATPB_LACS1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|90820770|gb|ABD99409.1| ATP synthase beta chain [Lactobacillus salivarius UCC118] (468 aa)
Score = 1613, Expect = 1.8e-177, Identities = 313/462 (67%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPK-KPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV QVIGPVVDV F  S  LP I D L VK   G EL +E A  +GD I+R +A+  T+GL R  +V      I VPVGK+ LGR+FNVLG  ID   E  +  P+ PIHR  P +D  S  +EI ETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH+G+SVF GVGERTREGNDLY+EM + GV++KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PL STS  L P IVG  HY+VA  VQ++LQR+ ELQDII+ILG+DEL+DE+KIIV RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D+LPE+AF  VG I++ VEKAK+L
  S:     1 MSSGKVVQVIGPVVDVQFPLSESLPDIDDALKVKREDGTELVIEVALELGDGIMRTVAMDSTDGLKRGAEVEGTGASISVPVGKDTLGRVFNVLGNTIDNGPEFDEDHPRNPIHRDAPKYDQLSTGIEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKESGVLEKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALTPEIVGEEHYEVATEVQHVLQRYRELQDIISILGMDELSDEEKIIVARARRIQFFLSQNFHVAEQFTGNPGSYVPVEETVKGFKEILEGKYDNLPEEAFRLVGGIEDVVEKAKKL 464
>gi|28625015|emb|CAD56146.1| F1F0-ATPase subunit beta [Pediococcus parvulus] (470 aa)
Score = 1612, Expect = 2.6e-177, Identities = 314/465 (67%), Positives = 373/465 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           ++ GKV QVIGPVVDV F     LP I + L+VK   G  L  E A  +GD +VR IA+  T+GL R  +V +    I VPVG   LGR+FNVLG+ ID  E+  P+  + PIHR PP +DD + ++EI ETGIKVIDLL PY RGGK+GLFGGAGVGKTVL+QELIHNIA+EH+G+SVF GVGERTREGNDLY+EM   GV++KTA+V+GQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PL STS  LDP++VG  HYKVA  VQ++LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+DDLPE AF  VG I E VEKAK+L  A
  S:     1 MSTGKVVQVIGPVVDVEFPLDGNLPDINNALNVKKPDGSILVAEVALELGDGVVRTIAMDGTDGLQRGLEVEDTGSSITVPVGDKTLGRVFNVLGETIDNGEKFGPEVKRNPIHRDPPKYDDLNPSMEILETGIKVIDLLAPYIRGGKVGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALDPSVVGEEHYKVATDVQHVLQRYRELQDIISILGMDELSDEEKTIVARARRIQFFLSQNFSVAEQFTGQPGSYVPVEETVKGFKEILEGKYDDLPEDAFRQVGNIDEVVEKAKKLTSA 467
>gi|77920721|ref|YP_358536.1| F0F1 ATP synthase subunit beta [Pelobacter carbinolicus DSM 2380] >gi|118573500|sp|Q39ZU1.1|ATPB3_PELCD ATP synthase subunit beta 3 (ATPase subunit beta 3) (ATP synthase F1 sector subunit beta 3) >gi|77546804|gb|ABA90366.1| ATP synthase F1, beta subunit [Pelobacter carbinolicus DSM 2380] (468 aa)
Score = 1612, Expect = 2.7e-177, Identities = 308/462 (66%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPV+DV F E+ +LP IY  L V     G+E   L  E AQ +G++ VR IA+  T+GL R ++V N    I VPVG+  LGR+ NV+G+P+D +  +       IHR  P F DQS  +E FETGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELIHNIAK+H G SVFAGVGERTREGNDL+ EM +  V+DKTALV+GQMNEPPGAR RVAL+ALT+AEYFRD +NQDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTL+TEMG+LQERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+S+SR+LDP ++G  HY+VA  VQ +LQR+ +LQDIIAILG+DEL++EDK  V RAR+I+ FLSQPF VAE F+G  GKYV LS+TI+ FKEI++GKHD +PEQAF+  G I E +E A ++
  S:     1 MSNGKITQVIGPVIDVEF-EAGELPEIYYALKVSNPSLGDEPWNLVAEVAQHLGENTVRAIAMDSTDGLVRGQEVLNTGRQISVPVGRGTLGRILNVIGEPVDEQGPVETDTTWEIHRPTPEFVDQSTKVEAFETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELIHNIAKKHGGFSVFAGVGERTREGNDLWNEMKESNVLDKTALVYGQMNEPPGARARVALSALTVAEYFRDQENQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITTTKHGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSSSRILDPQVLGEEHYQVARDVQYVLQRYKDLQDIIAILGMDELSEEDKQTVSRARKIQRFLSQPFHVAEIFTGTPGKYVELSETIRGFKEIVEGKHDSVPEQAFYMAGGIDEVLENAAKM 466
>gi|152977492|ref|YP_001377009.1| F0F1 ATP synthase subunit beta [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189081327|sp|A7GV56.1|ATPB_BACCN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152026244|gb|ABS24014.1| ATP synthase F1, beta subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (464 aa)
Score = 1611, Expect = 2.9e-177, Identities = 309/459 (67%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L +K     L LE A  +GDD VR +A+  T+GL R  +V +   PI VPVG   LGR+FNVLG+ ID   E+P   +  PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAE+FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GKHDDLPE AF  VG I+E VE AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALRIKKDEVNLTLEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGRPISVPVGDATLGRVFNVLGEAIDLDGEIPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKHDDLPEDAFRLVGGIEEVVENAKKM 462
>gi|42558884|sp|Q9LA80|ATPB_GEOTH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|7578511|gb|AAF64075.1|AF147781_1 ATP synthase beta subunit [Geobacillus thermoleovorans] (473 aa)
Score = 1611, Expect = 3.3e-177, Identities = 314/462 (67%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG+  LGR+FNVLG+PID + ++P   +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE  F  VG I++ VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEDVVEKAKAM 469
>gi|16124229|ref|NP_407542.1| F0F1 ATP synthase subunit beta [Yersinia pestis CO92] >gi|22128003|ref|NP_671426.1| F0F1 ATP synthase subunit beta [Yersinia pestis KIM] >gi|45443751|ref|NP_995290.1| F0F1 ATP synthase subunit beta [Yersinia pestis biovar Microtus str. 91001] >gi|51598251|ref|YP_072442.1| F0F1 ATP synthase subunit beta [Yersinia pseudotuberculosis IP 32953] >gi|108810156|ref|YP_654072.1| F0F1 ATP synthase subunit beta [Yersinia pestis Antiqua] >gi|108814138|ref|YP_649905.1| F0F1 ATP synthase subunit beta [Yersinia pestis Nepal516] >gi|145601152|ref|YP_001165228.1| F0F1 ATP synthase subunit beta [Yersinia pestis Pestoides F] >gi|150260945|ref|ZP_01917673.1| ATP synthase beta subunit protein [Yersinia pestis CA88-4125] >gi|153948511|ref|YP_001403118.1| F0F1 ATP synthase subunit beta [Yersinia pseudotuberculosis IP 31758] >gi|162421072|ref|YP_001608472.1| F0F1 ATP synthase subunit beta [Yersinia pestis Angola] >gi|165926118|ref|ZP_02221950.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939967|ref|ZP_02228504.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166009572|ref|ZP_02230470.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213362|ref|ZP_02239397.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401612|ref|ZP_02307106.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422841|ref|ZP_02314594.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425526|ref|ZP_02317279.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170026430|ref|YP_001722935.1| ATP synthase F1, beta subunit [Yersinia pseudotuberculosis YPIII] >gi|186897468|ref|YP_001874580.1| ATP synthase F1, beta subunit [Yersinia pseudotuberculosis PB1/+] >gi|122979850|sp|Q1CCH5.1|ATPB_YERPN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|123776436|sp|Q7CFM8.1|ATPB_YERPE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166222427|sp|A4TSJ3.1|ATPB_YERPP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166990376|sp|A7FPE0.1|ATPB_YERP3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81825677|sp|Q663Q8|ATPB_YERPS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573782|sp|Q1C095|ATPB_YERPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|21961151|gb|AAM87677.1|AE014015_2 membrane-bound ATP synthase, F1 sector, beta-subunit [Yersinia pestis KIM] >gi|45438621|gb|AAS64167.1| ATP synthase beta subunit protein [Yersinia pestis biovar Microtus str. 91001] >gi|51591533|emb|CAH23205.1| ATP synthase beta subunit protein [Yersinia pseudotuberculosis IP 32953] >gi|108777786|gb|ABG20305.1| ATP synthase beta subunit protein [Yersinia pestis Nepal516] >gi|108782069|gb|ABG16127.1| ATP synthase beta subunit protein [Yersinia pestis Antiqua] >gi|115349708|emb|CAL22689.1| ATP synthase beta subunit protein [Yersinia pestis CO92] >gi|145212848|gb|ABP42255.1| ATP synthase beta subunit protein [Yersinia pestis Pestoides F] >gi|149290353|gb|EDM40430.1| ATP synthase beta subunit protein [Yersinia pestis CA88-4125] >gi|152960006|gb|ABS47467.1| ATP synthase F1, beta subunit [Yersinia pseudotuberculosis IP 31758] >gi|162353887|gb|ABX87835.1| ATP synthase F1, beta subunit [Yersinia pestis Angola] >gi|165912093|gb|EDR30733.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165921978|gb|EDR39155.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991494|gb|EDR43795.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205660|gb|EDR50140.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958233|gb|EDR55254.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048994|gb|EDR60402.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055540|gb|EDR65333.1| ATP synthase F1, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752964|gb|ACA70482.1| ATP synthase F1, beta subunit [Yersinia pseudotuberculosis YPIII] >gi|186700494|gb|ACC91123.1| ATP synthase F1, beta subunit [Yersinia pseudotuberculosis PB1/+] (460 aa)
Score = 1611, Expect = 3.3e-177, Identities = 304/459 (66%), Positives = 378/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y+ L V+   E+L LE  Q +G  +VRCIA+G ++GL+R  KVTN  HPIEVPVGK  LGR+ NVLG+PID K  + ++ +  IHR+ PS+++ +++ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I++G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYNALEVEGTTEKLVLEVQQQLGGGVVRCIAMGSSDGLSRGLKVTNLEHPIEVPVGKATLGRIMNVLGEPIDMKGPIGEEERWAIHREAPSYEELASSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|32265928|ref|NP_859960.1| F0F1 ATP synthase subunit beta [Helicobacter hepaticus ATCC 51449] >gi|81835987|sp|Q7VJ21|ATPB_HELHP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|32261977|gb|AAP77026.1| FoF1-type ATP synthase [Helicobacter hepaticus ATCC 51449] (466 aa)
Score = 1610, Expect = 3.7e-177, Identities = 307/462 (66%), Positives = 372/462 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F  SS LP I + + V    E     L LE A  +GD+ VR IA+  TEGL R ++V     PIEVPVG+ VLGR+FNV G  IDG + L    + PIHR+ PSF++QS   E+FETGIKV+DL+ PY++GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+GSE+SALLGR+PSAVGYQPTLA EMG+LQERI STK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVLDR I+  GI+PA++PL STSR+LDP IVG  H+KVA GVQ +LQ++ +LQDIIAILG+DEL++EDK +V RAR+I  FLSQPFFVAE F+G  GKYV L +T++ FK IL+GK+DD+PE AF+ VG IQEA+EKA++LK A
  S:     3 GKITQVMGPVVDVEF--SSYLPMINEAIDVNFDIEGRKNNLVLEVAAHLGDNRVRTIAMDMTEGLIRGQEVKARGKPIEVPVGEAVLGRIFNVTGDVIDGGKPLESDLKWPIHREAPSFENQSTRTEMFETGIKVVDLIAPYSKGGKVGLFGGAGVGKTVVIMELIHNVAYKHSGYSVFAGVGERTREGNDLYHEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGSEMSALLGRIPSAVGYQPTLAGEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLDRKISEKGIYPAVDPLGSTSRILDPQIVGEEHHKVATGVQQVLQKYKDLQDIIAILGMDELSEEDKQVVARARKIERFLSQPFFVAEIFTGSPGKYVTLEETLEGFKGILEGKYDDIPENAFYLVGNIQEALEKAQKLKNA 466
>gi|77977936|ref|ZP_00833373.1| COG0055: F0F1-type ATP synthase, beta subunit [Yersinia intermedia ATCC 29909] (460 aa)
Score = 1610, Expect = 4.2e-177, Identities = 304/459 (66%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+Y+ L V+   E+L LE  Q +G  +VRCIA+G ++GL+R  KV N  HPIEVPVGK+ LGR+ NVLG PID K  + ++ +  IHR+ PS+++ +++ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I++G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPRVYNALEVEGTAEKLVLEVQQQLGGGVVRCIAMGSSDGLSRGLKVINLEHPIEVPVGKSTLGRIMNVLGDPIDMKGPIGEEERWAIHREAPSYEELASSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|39995224|ref|NP_951175.1| F0F1 ATP synthase subunit beta [Geobacter sulfurreducens PCA] >gi|81832140|sp|Q74GY0|ATPB_GEOSL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|39981986|gb|AAR33448.1| ATP synthase F1, beta subunit [Geobacter sulfurreducens PCA] (470 aa)
Score = 1610, Expect = 4.4e-177, Identities = 305/460 (66%), Positives = 373/460 (81%)
  Q:     8 YGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +GK+ QVIG V+DV F E  +LP IY+ L V     +     L LE AQ +G++ VR IA+  T+GL R + V +    I VPVG+  LGR+ NV+G+P+D    +  + +  IHR+ P+F DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVAL+AL++AEYFRD + Q+VLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F+EI+ GKHDD+PEQAF+ VGTI+EA+EKAK+L
  S:     5 FGKISQVIGAVIDVEF-EPGKLPPIYNALRVTNPAIDDKEYNLVLEVAQHLGENAVRTIAMDSTDGLVRGQAVLDTGKQISVPVGRKTLGRILNVIGEPVDEMGPVNAEKEYGIHREAPAFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQNVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYSIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDDVPEQAFYMVGTIEEALEKAKKL 468
>gi|121999208|ref|YP_001003995.1| F0F1 ATP synthase subunit beta [Halorhodospira halophila SL1] >gi|166201711|sp|A1WZT1.1|ATPB_HALHL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|121590613|gb|ABM63193.1| ATP synthase F1, beta subunit [Halorhodospira halophila SL1] (458 aa)
Score = 1609, Expect = 4.7e-177, Identities = 307/462 (66%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG VVDV F    Q+P+IYD L V   G  L LE  Q +GD +VR IA+G ++GL R+EKV+N  +PI VPVG+  LGR+ +VLG+P+D   E+    +  IHR  PS+++QS   E+ ETGIKVIDLL P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAEYFRD + +DVL+FIDNI+R+T AG EVSALLGRMPSAVGYQPTLA EMG+LQERI STKTGSITSVQA+YVPADDLTDPAPATTF HLDA  VL R IA LGI+PA++PL+STSR LDP ++G  HY VA GVQ +LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I+ FLSQPFFVAE F+G+ GKYV L DT+ SFK I+DG++D LPEQAF+ VGT++EA EKAK L
  S:     1 MSAGKIVQVIGAVVDVEFPRD-QVPQIYDALVVDERG--LTLEVQQQLGDGVVRTIAMGSSDGLTRSEKVSNTGNPISVPVGQGTLGRIMDVLGEPVDEAGEVKTDERWSIHRNAPSYEEQSGGQELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAVEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEYFRD-EGRDVLMFIDNIYRYTLAGQEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKTGSITSVQAVYVPADDLTDPAPATTFAHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVIGQEHYDVARGVQGVLQRYKELKDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFFVAEVFTGMPGKYVSLKDTVASFKAIIDGEYDHLPEQAFYMVGTVEEAAEKAKNL 458
>gi|78043094|ref|YP_361338.1| F0F1 ATP synthase subunit beta [Carboxydothermus hydrogenoformans Z-2901] >gi|118573518|sp|Q3A946|ATPB_CARHZ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|77995209|gb|ABB14108.1| ATP synthase F1, beta subunit [Carboxydothermus hydrogenoformans Z-2901] (473 aa)
Score = 1609, Expect = 4.8e-177, Identities = 304/444 (68%), Positives = 363/444 (81%)
  Q:    25 ESSQLPRIYDCLSVKLAGEE--------LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           E  ++P IY+ L ++   ++        L LE AQ +G++ VR +A+  T+GL R  KV +   PI VPVG+ VLGR+ NVLG+PIDGK  +      PIHR  P  ++QS   EI ETGIKVIDLL P+ +GGKIGLFGGAGVGKTV+V ELI+NIAK+H G+SVFAGVGERTREGNDLY+EM + GV+DKT +VFGQMNEPPG R+RV LT LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GSITSVQA+YVPADDLTDPAPATTF HLDA  VL R IA LGI+PA++PL+STSR+LDP+IVG  HY+VA GVQ +LQR+ ELQDIIAILG+DEL+DEDK+IV RAR+++ FLSQPF VAE F+G  GKYVP+ +TI+ FKEIL+GKHDD+PE  F+  GTI E VE+A+ L+
  S:    19 EPGKVPPIYNALKIRSEDQDTPTEVPINLTLEVAQHLGNNRVRAVAMSSTDGLVRGMKVVDTGAPITVPVGRPVLGRLLNVLGEPIDGKGPVESDHYYPIHRPAPPLEEQSTRAEILETGIKVIDLLVPFLKGGKIGLFGGAGVGKTVIVMELINNIAKQHGGISVFAGVGERTREGNDLYHEMKEAGVLDKTIMVFGQMNEPPGVRLRVGLTGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTRKGSITSVQAVYVPADDLTDPAPATTFAHLDATVVLSRQIAELGIYPAVDPLDSTSRILDPHIVGEEHYQVARGVQRVLQRYKELQDIIAILGMDELSDEDKLIVARARKLQRFLSQPFTVAEAFTGRPGKYVPVKETIRGFKEILEGKHDDIPETCFYMAGTIDEVVERARELE 470
>gi|41179057|ref|NP_958414.1| ATP synthase CF1 beta subunit [Chlamydomonas reinhardtii] >gi|336667|gb|AAA84146.1| ATP synthase beta subunit [Chlamydomonas reinhardtii] >gi|28269780|tpg|DAA00958.1| TPA_inf: TPA_exp: CF1 ATP synthase beta subunit [Chlamydomonas reinhardtii] (491 aa)
Score = 1609, Expect = 4.8e-177, Identities = 310/465 (66%), Positives = 370/465 (79%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL---AGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           E    G++ Q+IGPV+D++F +  Q+P IY+ L+++    AG E+ +  E  QL+GD+ VR +++ PTEGL R  +V +   P+ VPVGK  LGR+FNVLG+P+D    +  +  LPIHR  P+F D    L IFETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREGNDLY EM + GVI        K ALV+GQMNEPPGARMRVALTALTMAEYFRD + QDVL FIDNIFRF QAG+EVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVPADDLTDPAPATTF HLDA TVL RN+AA GI+PA++PLESTS +L P I+G  HY  A  V+  LQR+ ELQDIIAILG+DEL++ED++IV RAR+I  FLSQPFFVAE F+G  GKYV L++TI+ F +I  G+ DDLPEQAF+ VG I EA+ KA  LK
  S:    16 ETKNMGRIVQIIGPVLDIVFAKG-QVPNIYNALTIRAKNSAGTEMAVTCEVQQLLGDNCVRAVSMNPTEGLMRGMEVVDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGNVKVEETLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLSDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFGKIFAGELDDLPEQAFYLVGNITEAISKAASLK 491
>gi|145621083|ref|ZP_01777083.1| ATP synthase F1, beta subunit [Geobacter bemidjiensis Bem] >gi|144942615|gb|EDJ77740.1| ATP synthase F1, beta subunit [Geobacter bemidjiensis Bem] >gi|197089671|gb|ACH40942.1| ATP synthase F1, beta subunit [Geobacter bemidjiensis Bem] (470 aa)
Score = 1609, Expect = 4.8e-177, Identities = 307/461 (66%), Positives = 373/461 (80%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEE--LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
            +GK+ QVIG V+DV F E  +LP IY  L V    +  +E  L LE AQ +G++ VR IA+  T+GL R ++V +    I VPVGK  LGR+ NV+G+P+D    +  + +  IHR+ P F +QS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVAL+AL++AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F EI+ GKHDDLPEQAF+ VGTI+EA+EKA++L
  S:     4 NFGKISQVIGAVIDVEF-EPGKLPPIYQALRVTNPAIDDQEFNLVLEVAQHLGENAVRTIAMDSTDGLVRGQQVKDMGKQISVPVGKKTLGRILNVIGEPVDEMGPIGNEKEYGIHREAPLFVNQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGDEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQKFLSQPFHVAEAFTGSPGKYVELKDTIKGFSEIIAGKHDDLPEQAFYMVGTIEEAIEKAQKL 468
>gi|108884792|sp|P06541|ATPB_CHLRE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (480 aa)
Score = 1609, Expect = 5.5e-177, Identities = 310/465 (66%), Positives = 370/465 (79%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL---AGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           E    G++ Q+IGPV+D++F +  Q+P IY+ L+++    AG E+ +  E  QL+GD+ VR +++ PTEGL R  +V +   P+ VPVGK  LGR+FNVLG+P+D    +  +  LPIHR  P+F D    L IFETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREGNDLY EM + GVI        K ALV+GQMNEPPGARMRVALTALTMAEYFRD + QDVL FIDNIFRF QAG+EVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVPADDLTDPAPATTF HLDA TVL RN+AA GI+PA++PLESTS +L P I+G  HY  A  V+  LQR+ ELQDIIAILG+DEL++ED++IV RAR+I  FLSQPFFVAE F+G  GKYV L++TI+ F +I  G+ DDLPEQAF+ VG I EA+ KA  LK
  S:     5 ETKNMGRIVQIIGPVLDIVFAKG-QVPNIYNALTIRAKNSAGTEMAVTCEVQQLLGDNCVRAVSMNPTEGLMRGMEVVDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGNVKVEETLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLSDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFGKIFAGELDDLPEQAFYLVGNITEAISKAASLK 480
>gi|118579930|ref|YP_901180.1| F0F1 ATP synthase subunit beta [Pelobacter propionicus DSM 2379] >gi|190358235|sp|A1AP52.1|ATPB2_PELPD ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|118502640|gb|ABK99122.1| ATP synthase F1, beta subunit [Pelobacter propionicus DSM 2379] (471 aa)
Score = 1608, Expect = 6.9e-177, Identities = 310/459 (67%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCL-----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F E  +LP IY  L     ++  +   L LE AQ +G++ VR IA+  T+GL R + V +    I  PVGK  LGR+ NV+G+P+D    +    + PIHR+ P F+DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIA++H G SVFAGVGERTREGNDL+ EM + GV++KTALV+GQMNEPPGAR RVALTAL++AE+FRD +  DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI STK GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP I+G  HY +A  VQ ILQ++ +LQDIIAILG+DEL++EDK+IV RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ F+EI+ GKHD LPEQAF+ VG+I+EAVEKA +L
  S:     6 GKITQVIGAVVDVEF-EPGKLPEIYHALRVTNPAINDSENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVLDTGKQICAPVGKKTLGRIINVIGEPVDEMGPIGNDKENPIHREAPPFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIARQHGGFSVFAGVGERTREGNDLWMEMKETGVLEKTALVYGQMNEPPGARARVALTALSIAEHFRDDEGLDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQIIGEEHYAIARQVQYILQKYKDLQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFFVAEVFTGSPGKYVELKDTIKGFQEIVSGKHDHLPEQAFYMVGSIEEAVEKAAKL 468
>gi|77973800|ref|ZP_00829345.1| COG0055: F0F1-type ATP synthase, beta subunit [Yersinia frederiksenii ATCC 33641] (460 aa)
Score = 1608, Expect = 7.1e-177, Identities = 303/459 (66%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y+ L V+   E+L LE  Q +G  +VRCIA+G ++GL+R  KV N  HPIEVPVGK+ LGR+ NVLG PID K  + ++ +  IHR+ PS+++ +++ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I++G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYNALEVEGTAEKLVLEVQQQLGGGVVRCIAMGSSDGLSRGLKVVNLEHPIEVPVGKSTLGRIMNVLGDPIDMKGPIGEEERWAIHREAPSYEELASSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|77961816|ref|ZP_00825646.1| COG0055: F0F1-type ATP synthase, beta subunit [Yersinia mollaretii ATCC 43969] (460 aa)
Score = 1607, Expect = 8.1e-177, Identities = 303/459 (66%), Positives = 378/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y+ L V+ A ++L LE  Q +G  +VRCIA+G ++GL+R  KV N  HPIEVPVGK+ LGR+ NVLG PID K  + ++ +  IHR+ PS+++ +++ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I++G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYNALEVEGAAQKLVLEVQQQLGGGVVRCIAMGSSDGLSRGLKVINLEHPIEVPVGKSTLGRIMNVLGDPIDMKGPIGEEERWAIHREAPSYEELASSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|118579045|ref|YP_900295.1| F0F1 ATP synthase subunit beta [Pelobacter propionicus DSM 2379] >gi|190358211|sp|A1ALL7.1|ATPB1_PELPD ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|118501755|gb|ABK98237.1| ATP synthase F1, beta subunit [Pelobacter propionicus DSM 2379] (471 aa)
Score = 1606, Expect = 1.1e-176, Identities = 309/459 (67%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCL-----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F E  +LP IY  L     ++  +   L LE AQ +G++ VR IA+  T+GL R + V +    I  PVGK  LGR+ NV+G+P+D    +    + PIHR+ P F+DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIA++H G SVFAGVGERTREGNDL+ EM + GV++KTALV+GQMNEPPGAR RVALTAL++AE+FRD +  DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI STK GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ ILQ++ +LQDIIAILG+DEL++EDK+IV RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ F+EI+ GKHD LPEQAF+ VG+I+EAVEKA +L
  S:     6 GKITQVIGAVVDVEF-EPGKLPEIYHALRVTNPAINDSENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVLDTGKQICAPVGKKTLGRIINVIGEPVDEMGPIGNDKENPIHREAPPFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIARQHGGFSVFAGVGERTREGNDLWMEMKETGVLEKTALVYGQMNEPPGARARVALTALSIAEHFRDDEGLDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAIARQVQYILQKYKDLQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFFVAEVFTGSPGKYVELKDTIKGFQEIVSGKHDHLPEQAFYMVGSIEEAVEKAAKL 468
>gi|52082213|ref|YP_081004.1| F0F1 ATP synthase subunit beta [Bacillus licheniformis ATCC 14580] >gi|52787604|ref|YP_093433.1| F0F1 ATP synthase subunit beta [Bacillus licheniformis ATCC 14580] >gi|81825160|sp|Q65DX4|ATPB_BACLD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|52005424|gb|AAU25366.1| ATP synthase (subunit beta) [Bacillus licheniformis ATCC 14580] >gi|52350106|gb|AAU42740.1| AtpD [Bacillus licheniformis DSM 13] (473 aa)
Score = 1606, Expect = 1.1e-176, Identities = 311/459 (67%), Positives = 365/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKP-QLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QV+GPVVDV F E   LP IY+ + V    +       +L LE A  +GDD VR IA+  T+G+ R  +  +   PI VPVG   LGR+FNVLG+ ID  E LP    + PIHR+ P FD  S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLYYEM   GVI KTA+VFGQMNEPPGARMRVALT LTMAE+FRD + QDVL FIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY+VA  VQ ILQR+ ELQDIIA+LG+DEL+DEDK++V RARR++ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE AF  VG I+E VEKAK +
  S:     4 GRVSQVLGPVVDVRF-EDGHLPEIYNAIKVTHKAQNENEVDIDLTLEVALHLGDDSVRTIAMASTDGVTRGMEAIDLGEPISVPVGNVTLGRVFNVLGENIDLDEPLPADAAKDPIHREAPKFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMKDSGVIGKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDKEGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYEVARSVQQILQRYKELQDIIAMLGMDELSDEDKLVVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKEILEGKYDHLPEDAFRLVGRIEEVVEKAKEM 469
>gi|171779638|ref|ZP_02920594.1| hypothetical protein STRINF_01475 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281740|gb|EDT47174.1| hypothetical protein STRINF_01475 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (468 aa)
Score = 1606, Expect = 1.3e-176, Identities = 308/462 (66%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG---EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPK-KPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV F    +LP I + L V   G   +++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID  E   +  P+  IH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY+VA  VQ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP+++T++ FKEIL+GK+DDLPE AF  VG I++ VEKAK++
  S:     1 MSSGKIAQVVGPVVDVAFAAGDKLPEINNALIVYKNGDKSQKIVLEVALELGDGLVRTIAMESTDGLTRGLEVFDTGRPISVPVGKETLGRVFNVLGDTIDLDEPFAEDAPRETIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALAPEIVGQEHYEVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVRGFKEILEGKYDDLPEDAFRNVGPIEDVVEKAKKM 466
>gi|78224596|ref|YP_386343.1| F0F1 ATP synthase subunit beta [Geobacter metallireducens GS-15] >gi|118573539|sp|Q39Q56|ATPB_GEOMG ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|78195851|gb|ABB33618.1| ATP synthase F1, beta subunit [Geobacter metallireducens GS-15] (470 aa)
Score = 1606, Expect = 1.3e-176, Identities = 305/460 (66%), Positives = 372/460 (80%)
  Q:     8 YGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +G++ QVIG V+DV F E  +LP IY+ L V     +     L LE AQ +G++ VR IA+  T+GL R +   +    I VPVG+  LGR+ NV+G+P+D    +  + +  IHR+ PSF DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVAL+AL++AEYFRD + Q+VLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F+EI+ GKHDD+PEQAF+ VGTI+EA+EKAK+L
  S:     5 FGRISQVIGAVIDVEF-EPGKLPPIYNALRVTNPAIDDKEYNLVLEVAQHLGENSVRTIAMDSTDGLVRGQAALDTGKQISVPVGRKTLGRILNVIGEPVDEMGPVNAEKEYGIHRESPSFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDDIPEQAFYMVGTIEEALEKAKKL 468
>gi|86609936|ref|YP_478698.1| F0F1 ATP synthase subunit beta [Synechococcus sp. JA-2-3B'a(2-13)] >gi|118573768|sp|Q2JIV9|ATPB_SYNJB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|86558478|gb|ABD03435.1| ATP synthase F1, beta subunit [Synechococcus sp. JA-2-3B'a(2-13)] (477 aa)
Score = 1605, Expect = 1.5e-176, Identities = 310/461 (67%), Positives = 367/461 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G + QVIGPV+D  F  S +LP IY+ L V+   E      +  E  QL+GD+ VR +A+  T+GL R   V +   PI VPVG+  LGR+FNVLG+P+D  E +  +   PIHR  P   D +   E FETGIKVIDLL P+ +GGK+GLFGGAGVGKTVL+QELIHNIA+EHSGLSVFAGVGERTREGNDLY EM + GV+DK ALV+GQMNEPPGARMRV LTALTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLD+  VL R++AA GI+PA++PL+S+S +L  +IVG  HY  A  V+  LQR+ ELQDIIAILG+DEL++EDK++V RARRI  FLSQPFFVAE F+G  GKYV L+DTI+ F+ IL G+ D+LPEQAF+ VGTI+EA+EKA++LK 
  S:    12 GYITQVIGPVIDAEFP-SGKLPEIYNALKVEGTTESGLKVNVTFEVQQLLGDNRVRAVAMSSTDGLVRGMPVVDTGAPITVPVGQPTLGRIFNVLGEPVDQGEPVQAQEFAPIHRSAPPLVDLTIKPEPFETGIKVIDLLAPFKKGGKVGLFGGAGVGKTVLIQELIHNIAEEHSGLSVFAGVGERTREGNDLYNEMKESGVLDKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGNLQERITSTKQGSITSVQAVYVPADDLTDPAPATTFAHLDSTVVLSRSLAAKGIYPAVDPLDSSSTILQADIVGEEHYNTARAVKQTLQRYKELQDIIAILGLDELSEEDKLVVARARRIERFLSQPFFVAEVFTGSPGKYVKLADTIKGFQRILSGELDNLPEQAFYLVGTIEEAIEKAEKLKS 476
>gi|15616316|ref|NP_244621.1| F0F1 ATP synthase subunit beta [Bacillus halodurans C-125] >gi|14916533|sp|Q9K6H5|ATPB_BACHD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|10176378|dbj|BAB07473.1| ATP synthase beta subunit [Bacillus halodurans C-125] (470 aa)
Score = 1605, Expect = 1.5e-176, Identities = 312/459 (67%), Positives = 369/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-------LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G + QV+GPVVDV F +S QLP + + L V+  G +       + LE A  +GDD VR IA+G T+GL R  +V +    I VPVG+  LGR+FNVLG+ ID  E +P   +  PIHR+ P F++ S   EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVAL+ LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQ++ ELQDIIAILG+DEL++EDK+IV RARRI+ FLSQ F VAE+F+G  G YVP+ +TI+ FKEIL+GK+DDLPE AF  VG I+E VE+AK++
  S:     4 GHITQVMGPVVDVRF-QSGQLPELNNALRVEQKGADQNAVDVNVTLEVALHLGDDTVRTIAMGSTDGLVRGTEVVDTGAAISVPVGEVTLGRVFNVLGESIDLDEPIPADAERSPIHREAPKFEELSTKTEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDKQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQKYKELQDIIAILGMDELSEEDKLIVARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETIKGFKEILEGKYDDLPEDAFRLVGRIEEVVERAKQM 469
>gi|42784475|ref|NP_981722.1| F0F1 ATP synthase subunit beta [Bacillus cereus ATCC 10987] >gi|166984521|ref|ZP_02255862.1| F0F1 ATP synthase subunit beta [Bacillus cereus AH187] >gi|168162322|ref|ZP_02597555.1| F0F1 ATP synthase subunit beta [Bacillus cereus H3081.97] >gi|81830903|sp|Q72XE8|ATPB_BACC1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|42740407|gb|AAS44330.1| ATP synthase F1, beta subunit [Bacillus cereus ATCC 10987] (468 aa)
Score = 1605, Expect = 1.6e-176, Identities = 309/459 (67%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L+VK + E     L  E A  +GDD VR +A+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID   E+P   +  PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ DT++ FKEIL+GK+DDLPE AF  VG I+E +E AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALTVKQSNENGELNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKDTVRGFKEILEGKYDDLPEDAFRLVGGIEEVIENAKKM 466
>gi|170729216|ref|YP_001763242.1| ATP synthase F1, beta subunit [Shewanella woodyi ATCC 51908] >gi|169814563|gb|ACA89147.1| ATP synthase F1, beta subunit [Shewanella woodyi ATCC 51908] (458 aa)
Score = 1604, Expect = 1.8e-176, Identities = 304/461 (65%), Positives = 372/461 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ G V QVIG VVDV F + + +P++YD L +K   E+L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG+  LGR+ NVLG+P+D   E+ ++ +  IHR+ PS++DQSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA++GI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+DEDK  V RAR+I  +LSQPFFVAE F+G  GKYV L DTI+ FK IL+G++D+LPEQAF+ VG+I E VEKA +
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQVYDALEIK--SEDLVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVVNSGSPISVPVGEKTLGRIMNVLGQPVDEAGEIGEEERYVIHREAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMEDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASMGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKTTVSRARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEYDNLPEQAFYMVGSIDEVVEKANK 457
>gi|114322016|ref|YP_743699.1| F0F1 ATP synthase subunit beta [Alkalilimnicola ehrlichei MLHE-1] >gi|122310606|sp|Q0A4M8.1|ATPB_ALHEH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|114228410|gb|ABI58209.1| ATP synthase F1, beta subunit [Alkalilimnicola ehrlichei MLHE-1] (458 aa)
Score = 1604, Expect = 1.9e-176, Identities = 308/462 (66%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG VVDV F +  Q+P+IYD L V   G  L LE  Q +GD +VR IA+G ++GL R+EKV+    PI VPVGK  LGR+ +VLG+P+D K  +  + +  IHR  PSF +Q+   E+ ETGIKVIDLL P+A+GGK+GLFGGAGVGKTV + ELI NIA EH+G SVFAGVGERTREGND Y+EM    V+DK ALV+GQMNEPPG R+RVALT LTMAEYFRD + +D+L+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG+LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+++DK+ V RAR+I+ FLSQPFFVAE F+G  GKYVPL DTI SFK ILDG++D LPEQAF+ VGT+ EA EKAK L
  S:     1 MSSGKIVQVIGAVVDVEFPQD-QVPKIYDALIVDERG--LTLEVQQQLGDGVVRTIAMGSSDGLKRSEKVSATGKPISVPVGKGTLGRIMDVLGEPVDEKGAVETEERWGIHRSAPSFAEQAGGAELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIRNIATEHAGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEYFRD-EGRDILMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLARGIAELGIYPAVDPLDSTSRQLDPLVVGEEHYNVARGVQGVLQRYKELRDIIAILGMDELSEDDKLTVARARKIQRFLSQPFFVAEVFTGAPGKYVPLKDTIASFKAILDGEYDHLPEQAFYMVGTVDEAAEKAKNL 458
>gi|28625013|emb|CAD56145.1| F1F0-ATPase subunit beta [Pediococcus damnosus] (470 aa)
Score = 1604, Expect = 1.9e-176, Identities = 312/466 (66%), Positives = 372/466 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK-LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           ++ GKV QVIGPV+DV F     LP I + L++K L G  L  E A  +GD +VR IA+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID  EE  P+  + PIHR PP +D+ + ++EI ETGIKVIDLL PY RGGK+GLFGGAGVGKTVL+QELIHNIA+EH+G+SVF GVGERTREGNDLY+EM   GV++KTA+V+GQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PL STS  LDP +VG  HYKVA  VQ++LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ F+ IL+GK+DDLPE AF  VG I E VEKAK+L  AT
  S:     1 MSTGKVVQVIGPVIDVEFPLDGNLPDINNALNIKKLDGSILVAEVALELGDGVVRTIAMDGTDGLQRGAEVEDTGSSITVPVGDKTLGRVFNVLGDTIDNGEEFGPEAKRNPIHRDPPKYDELNPSMEILETGIKVIDLLAPYIRGGKVGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALDPAVVGEEHYKVATDVQHVLQRYRELQDIISILGMDELSDEEKTIVGRARRIQFFLSQNFSVAEQFTGKPGSYVPVEETVKGFEGILEGKYDDLPEDAFNGVGNIDEVVEKAKQLTSAT 468
>gi|14916961|sp|P22478|ATPB_BACPF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|12061046|gb|AAG48363.1|AF330160_10 ATP synthase beta subunit [Bacillus pseudofirmus] (470 aa)
Score = 1604, Expect = 2.0e-176, Identities = 310/459 (67%), Positives = 368/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-------LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G + QV+GPVVDV F +S QLP I + L V   G +       + LE A  +GDD VR +A+G T+GL R  +  +   PI VPVG+  LGR+FNVLG+ ID  E +    +  PIHR+ P F++ S T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVAL+ LTMAE+FRD D QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQ++ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +TI+ FKEILDGK+DDLPE AF  VG I+E +EK K++
  S:     4 GHITQVMGPVVDVKF-KSGQLPEINNALKVVQVGADKNAVDVTVTLEVALHLGDDSVRTVAMGSTDGLVRGTEALDTGAPISVPVGEATLGRVFNVLGEAIDLGEPVAADVKRDPIHREAPKFEELSTTTEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEHFRDRDGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYSVARQVQQTLQKYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETIKGFKEILDGKYDDLPEDAFRLVGRIEEVIEKGKQM 469
>gi|1168582|sp|P42469|ATPB_STIAU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|587526|emb|CAA54206.1| ATPase beta-subunit [Stigmatella aurantiaca] (481 aa)
Score = 1604, Expect = 2.0e-176, Identities = 307/470 (65%), Positives = 370/470 (78%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCL-----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           M  +  T GK+ QV+GPV+DV F     LP +Y  L     S+    + L +E AQ +G+++VRCI++  TEGLAR + V N   PI+VPVG+  LGR+ NV+G+P+D +  +      PIHR  P+F DQ   ++ FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+ ELI N+AKE  G SVFAGVGERTREGNDLY+EM +G V         +  LV+GQMNEPPGAR RVAL+ALT+AEYFRD +  DVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTL+TEMG LQERI ST  GS+TSVQAIYVPADDLTDPAPATTF HLDA TVL+R I+ LGI+PA++PL+STSR+LDPN+VG  HY VA  VQ ILQ++ ELQDIIAILG+DEL++ DK+ V RAR+I+ FLSQPF VAE F+G  G+YV L DTIQ FKE+ +GKHDDLPE AF+ VG I EA+EKA++L  A
  S:     1 MSAQVATVGKITQVLGPVIDVEFPPGG-LPEVYTALKVTNTSISAEADNLTIEVAQHLGENMVRCISMDSTEGLARGQAVKNTGAPIQVPVGQGTLGRILNVIGEPVDERGPITSSQTWPIHRPAPTFVDQDVRVQAFETGIKVIDLLGPYTRGGKIGLFGGAGVGKTVLLMELIVNVAKERGGFSVFAGVGERTREGNDLYHEMQEGNVSTPRTWMESQCVLVYGQMNEPPGARARVALSALTIAEYFRDMEGHDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGALQERITSTTKGSVTSVQAIYVPADDLTDPAPATTFAHLDATTVLNRAISELGIYPAVDPLDSTSRILDPNVVGPEHYAVARKVQGILQKYKELQDIIAILGMDELSETDKLTVARARKIQKFLSQPFHVAEVFTGAPGRYVELKDTIQGFKELAEGKHDDLPEAAFYMVGNINEAIEKARKLAAA 481
>gi|226371|prf||1508208B ATPase beta (460 aa)
Score = 1603, Expect = 2.3e-176, Identities = 302/459 (65%), Positives = 374/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E L LE  Q +G  +VR IA+G ++GL R  +V +  HP EVPVGK +LGR+ NVLG+PID K ++ ++ +  IHR  PS+++ S++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ++LQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I+EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGNESLVLEVQQQLGGGVVRAIAMGSSDGLRRGLEVKDLEHPTEVPVGKAILGRIMNVLGEPIDMKGDIGEEERWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSLLQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL 460
>gi|172058681|ref|YP_001815141.1| ATP synthase F1, beta subunit [Exiguobacterium sibiricum 255-15] >gi|171991202|gb|ACB62124.1| ATP synthase F1, beta subunit [Exiguobacterium sibiricum 255-15] (472 aa)
Score = 1603, Expect = 2.3e-176, Identities = 309/459 (67%), Positives = 367/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V  V+GPV+DV F     LP IY+ L ++   +       +L LE A  +GDD+VR IA+  T+G+ R  +V +   PI VPVG+  LGR+FNVLG PID KE      +LPIH+K P+FD+ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EHSG+SVFAGVGERTREGNDLY+EM   GVI +TA+VFGQMNEPPGAR+RVALT LTMAEYFRD   QDVLLF+DNIFR+TQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST  GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQR+ ELQDIIAILG+DEL++EDK+ V RARRI+ FLSQ F VAE+F+G  G YVP+ DTI+ FKEIL GKHDDL E+AF  VG I++A+EKAK L
  S:     8 GRVVAVMGPVIDVKF--DGHLPNIYNALRIQYTPQTVEEVAIDLTLEVALHLGDDVVRTIAMDSTDGVRRGVEVLDTGAPISVPVGEATLGRVFNVLGNPIDEKELDASVERLPIHKKAPTFDNLSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLYHEMTDSGVIKQTAMVFGQMNEPPGARLRVALTGLTMAEYFRDEQGQDVLLFVDNIFRYTQAGSEVSALLGRMPSAVGYQPTLATEMGMLQERITSTNKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLSEMGIYPAVDPLASTSRALSPEIVGEEHYGVARQVQETLQRYKELQDIIAILGMDELSEEDKLTVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKDTIRGFKEILGGKHDDLTEEAFRLVGPIEDAIEKAKTL 471
>gi|95929971|ref|ZP_01312711.1| ATP synthase F1, beta subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133940|gb|EAT15599.1| ATP synthase F1, beta subunit [Desulfuromonas acetoxidans DSM 684] (468 aa)
Score = 1603, Expect = 2.7e-176, Identities = 309/459 (67%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIGPVVDV F E+ +LP IY  L +     GE    L +E AQ +G++ VR IA+  TEGL R ++V      I +PVG+  LGR+ NV+G+P+D    +    Q  IHR  P F +QS  +E FETGIKVIDLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIA++H G SVFAGVGERTREGNDL+ EM + GV+DK ALV+GQMNEPPGAR RVAL+ALT+AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTL+TEMG+LQERI +T  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+S+SR+LDP +VG  HYK+A  VQ +LQR+ +LQDIIAILG+DEL+++DK +V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F+EILDGKHDD+PEQAF+ VGTI+E +EKAK +
  S:     4 GKIVQVIGPVVDVQF-EAGKLPEIYHALKITNPALGEGELNLVVEVAQHLGENTVRAIAMDSTEGLVRGQEVLATGDQIVMPVGRKTLGRILNVVGEPVDEAGPVEADLQWGIHRPAPEFVNQSTKVESFETGIKVIDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAQQHGGFSVFAGVGERTREGNDLWEEMKESGVLDKAALVYGQMNEPPGARARVALSALTVAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITTTDKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSSSRILDPQVVGEEHYKLARDVQFVLQRYKDLQDIIAILGMDELSEDDKQVVARARKIQRFLSQPFHVAEVFTGSPGKYVELKDTIKGFQEILDGKHDDVPEQAFYLVGTIEEVLEKAKSM 466
>gi|149193991|ref|ZP_01871089.1| F0F1 ATP synthase subunit beta [Caminibacter mediatlanticus TB-2] >gi|149135944|gb|EDM24422.1| F0F1 ATP synthase subunit beta [Caminibacter mediatlanticus TB-2] (469 aa)
Score = 1603, Expect = 2.9e-176, Identities = 303/461 (65%), Positives = 377/461 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GKV QV+GPV+DV F + +++P I + L V+   E    ++ LE A  IGD++VR IA+  T+GL R EKV     PI+VPVG+ VLGR+FNV G  ID  E +P    +  IHR PP F++QS  +EIFETGIKV+DLL PY +GGK GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY+EM + GV+DK AL +GQMNEPPG R RVA+T LTMAEYFRD +N+DVL+FIDNIFRF QAG+E+SALLGR+PSAVGYQPTLATEMG+LQERI STK GSITS+QA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+LDP IVG  HYKVA GVQ +LQ++ +LQDIIAILG+DEL++EDK+IV+RAR+I  FLSQPFFVA+ F+G  G+YV L  TI+ F++IL+G+ DDLPE AF+ VG + EA+EKAK++++
  S:     3 GKVIQVLGPVIDVEF-DGNKVPEINEALIVEFEAEGEKKKVVLEVAAQIGDNVVRTIAMDLTDGLTRGEKVVATGAPIKVPVGEAVLGRIFNVTGDVIDEGEPIPADVERWSIHRDPPPFEEQSTKMEIFETGIKVVDLLCPYMKGGKTGLFGGAGVGKTVIIMELIHNVAYKHSGYSVFAGVGERTREGNDLYHEMKESGVLDKVALCYGQMNEPPGCRNRVAMTGLTMAEYFRDVENRDVLMFIDNIFRFAQAGAEMSALLGRIPSAVGYQPTLATEMGRLQERITSTKKGSITSIQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILDPQIVGERHYKVARGVQEVLQKYKDLQDIIAILGMDELSEEDKLIVQRARKIEKFLSQPFFVAKVFTGADGRYVELEKTIEGFEKILNGEVDDLPENAFYMVGDLDEAIEKAKKMQQ 467
>gi|77958186|ref|ZP_00822224.1| COG0055: F0F1-type ATP synthase, beta subunit [Yersinia bercovieri ATCC 43970] (460 aa)
Score = 1603, Expect = 3.0e-176, Identities = 302/459 (65%), Positives = 377/459 (82%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y+ L V+   ++L LE  Q +G  +VRCIA+G ++GL+R  KV N  HPIEVPVGK+ LGR+ NVLG PID K  + ++ +  IHR+ PS+++ +++ ++ ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GK+V L DTI+ FK I++G +D LPEQAF+ VGTI+EAVEKAK+L
  S:     4 GKIIQVIGAVVDVEFPQDA-VPKVYNALEVEGTAQKLVLEVQQQLGGGVVRCIAMGSSDGLSRGLKVINLEHPIEVPVGKSTLGRIMNVLGDPIDMKGPIGEEERWAIHREAPSYEELASSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMNGDYDHLPEQAFYMVGTIEEAVEKAKKL 460
>gi|15603359|ref|NP_246433.1| F0F1 ATP synthase subunit beta [Pasteurella multocida subsp. multocida str. Pm70] >gi|17372630|sp|Q9CKW1|ATPB_PASMU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|12721878|gb|AAK03578.1| AtpD [Pasteurella multocida subsp. multocida str. Pm70] (457 aa)
Score = 1602, Expect = 3.1e-176, Identities = 302/459 (65%), Positives = 369/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IG V+DV F + + +P++YD L+V+     L LE  Q +G  +VRCIA+G ++GL R   VTN N+PI VPVG   LGR+ NVLG+PID + E+  +    IHR PPS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL R IA+LGI+PA++PLESTSR LDP +VG  HY VA GVQ  LQR+ EL+DIIAILG+DEL++EDK++V RAR+I  FLSQPFFVAE F+G  GKYVPL +TI+ FK ILDG++D +PEQAF+  GTI E +EKAK+L
  S:     4 GKIVQIIGAVIDVEFPQDA-VPKVYDALNVETG---LVLEVQQQLGGGVVRCIAMGSSDGLKRGLSVTNTNNPISVPVGTKTLGRIMNVLGEPIDEQGEIGAEENWSIHRAPPSYEEQSNSTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLESTSRQLDPLVVGEEHYNVARGVQTTLQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFNGTPGKYVPLKETIRGFKGILDGEYDHIPEQAFYMAGTIDEVLEKAKKL 457
>gi|3913123|sp|O50341|ATPB_FERIS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|2687832|emb|CAA75783.1| F1F0-ATPase beta subunit [Fervidobacterium islandicum] (472 aa)
Score = 1602, Expect = 3.3e-176, Identities = 320/472 (67%), Positives = 386/472 (81%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATV 472
           M K+++  GK+ ++IGPVVDV F E   LP IYD L V     G++L LE  QLIGD+IVR +A+  T+GL R  +V N   PI+ PVG+ VLGRMFNV+G+PID + EL      PIHR  PS  +Q   +EI ETG+KVIDLL P+ +GGKIG FGGAGVGKTVLV E+I NIA EH G S+FAGVGERTREGNDLY EM + GV++ T LVFGQMNEPPGAR RVALTALT+AEYFRD + +DVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL+T+MG+LQERI STK GSITSVQAIYVPADD+TDPAPATTFTHLDA  VL R +AALG++PA++PL+STS++LDPNIVG  HY+VA GVQ +LQR+ +LQDIIAILG++EL++EDK+IV+RAR+I+ FL+QP  VAE+FSGI G YVP+ +TI+ FKEIL+G++DDLPE AF+ VGTI EAVEKAK+L K+ V
  S:     1 MSKKSV--GKIVRIIGPVVDVKFQEGD-LPDIYDALVVINPQTGKKLILEVEQLIGDNIVRTVAMDSTDGLVRGLEVENTGEPIKAPVGRGVLGRMFNVIGEPIDEQGELKDIEYWPIHRPAPSMTEQKTEIEILETGLKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMEMIRNIAIEHHGFSIFAGVGERTREGNDLYLEMTEAGVLNNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATIVLSRQLAALGLYPAVDPLDSTSKILDPNIVGKEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLIVQRARKIQRFLTQPTHVAERFSGIPGVYVPIKETIRGFKEILEGRYDDLPEAAFYMVGTIDEAVEKAKKLMKSAV 471
>gi|81428735|ref|YP_395735.1| F0F1 ATP synthase subunit beta [Lactobacillus sakei subsp. sakei 23K] >gi|78610377|emb|CAI55427.1| H(+)-transporting two-sector ATPase (ATP synthase), beta subunit [Lactobacillus sakei subsp. sakei 23K] (483 aa)
Score = 1602, Expect = 3.9e-176, Identities = 313/467 (67%), Positives = 369/467 (79%)
  Q:     1 MKKENITY--GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           M++E  T   GKV QVIGPVVDV F+  + LP I + L+V    +E + LE A  +GD ++R I++  T+GL R   V +    I VPVGK  LGR+FNVLG+ IDG EE P    +  IHR  P F++ + + EI ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GV++KTA+VFGQMNE PGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T LDR +   GI+PA+NPLES+S  LDP IVG  HY+VA  VQ++LQR+ ELQDII+ILG+DEL+D++KIIV RARRI+ FLSQ F VAE F+G AG YVP+ DT+  FK IL G +DD+PE+AF  VG I  A+ KAK +
  S:     1 MREEETTMSMGKVVQVIGPVVDVEFSLDTDLPDINNALTVDKGNDETVVLEVALELGDGVMRTISMESTDGLRRGMPVEDAGRAINVPVGKETLGRVFNVLGETIDGGEEFPADFRRDSIHRSAPKFEELNTSSEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVLEKTAMVFGQMNESPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLDRKLTQQGIYPAVNPLESSSSALDPEIVGQEHYEVASEVQHVLQRYRELQDIISILGMDELSDDEKIIVARARRIQFFLSQNFHVAEAFTGQAGSYVPVKDTVSGFKAILAGDYDDVPEEAFRLVGNIDAALAKAKEM 471
>gi|146313762|ref|YP_001178836.1| F0F1 ATP synthase subunit beta [Enterobacter sp. 638] >gi|166990369|sp|A4WGF5.1|ATPB_ENT38 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|145320638|gb|ABP62785.1| ATP synthase F1, beta subunit [Enterobacter sp. 638] (460 aa)
Score = 1601, Expect = 4.3e-176, Identities = 304/459 (66%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+YD L V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+PID K ++ ++ +  IHR  PS+++ S++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ++LQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYDALEVQNGNESLVLEVQQQLGGGIVRTIAMGSSDGLRRGLAVKDLEHPIEVPVGKATLGRIMNVLGQPIDMKGDIGEEDRWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSLLQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL 460
>gi|356768|prf||1211283A ATPase beta F1 (473 aa)
Score = 1601, Expect = 4.7e-176, Identities = 312/462 (67%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG+  LGR+FNVLG+PID + ++P   +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAG GKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSA+GYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  L+R+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE  F  VG I+E VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGQVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGDGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAIGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLVSTSRALAPEIVGEEHYQVARKVQQTLERYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEVVEKAKAM 469
>gi|114571|sp|P07677|ATPB_BACP3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|77453|pir||A25504 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - thermophilic bacterium PS-3 >gi|2981977|pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub- Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 >gi|45804|emb|CAA28277.1| unnamed protein product [Bacillus sp. PS3] >gi|45817|emb|CAA30655.1| unnamed protein product [Bacillus sp. PS3] >gi|217147|dbj|BAA00066.1| thermophilic proton ATPase beta subunit [Bacillus sp. PS3] (473 aa)
Score = 1601, Expect = 4.7e-176, Identities = 312/462 (67%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG+  LGR+FNVLG+PID + ++P   +  PIHR  P F++ +  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QD LLFIDNIFRFTQAGSEVSALLGRMPSA+GYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  L+R+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE  F  VG I+E VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGQVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDGLLFIDNIFRFTQAGSEVSALLGRMPSAIGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLVSTSRALAPEIVGEEHYQVARKVQQTLERYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEVVEKAKAM 469
>gi|28193539|emb|CAD48597.1| F1F0-ATPase subunit beta [Lactobacillus hilgardii] (481 aa)
Score = 1600, Expect = 5.2e-176, Identities = 306/463 (66%), Positives = 373/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ GKV QVIGPVVDV F+ + +LP I   L+V ++ ++ L +E A  +GD +VR IA+  T+GL R  +V N    I VPVG + LGR+FNVLG+PIDG  E  P   + PIHR+ P +D+ + + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+YYEM   GV+ KTA+V+GQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK G+ITS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PL STS  LDP IVG  HY VA  VQ++LQR+ ELQDII+ILG+DEL+DE+K IV RARRI+ FLSQ F VAE+F+G+ GKYV ++DT++ FK+ILDGK+DD+PE AF   G I++ +  AKRL+
  S:     1 MSTGKVLQVIGPVVDVEFSLNDKLPEINTALNVHVSDDKTLVVEVALDLGDGVVRTIAMDGTDGLRRGMEVENTESSISVPVGNDTLGRVFNVLGEPIDGGPEFGPDAERWPIHREAPKYDELNPSTEILETGIKVIDLLEPYIRGGKVGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKGSGVLAKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDEAGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGAITSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALDPQIVGQEHYDVATEVQHVLQRYRELQDIISILGMDELSDEEKTIVNRARRIQFFLSQSFSVAEQFTGLPGKYVSVTDTVKGFKDILDGKYDDIPEDAFRNCGPIEDVIANAKRLQ 465
>gi|149183570|ref|ZP_01861992.1| F0F1 ATP synthase subunit beta [Bacillus sp. SG-1] >gi|148848711|gb|EDL62939.1| F0F1 ATP synthase subunit beta [Bacillus sp. SG-1] (472 aa)
Score = 1600, Expect = 6.6e-176, Identities = 313/459 (68%), Positives = 365/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK------LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G V QV+GPVVDV F ES QLP I++ L VK        G +L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG   LGR+FNVLG+ ID +EE+ K  +  PIHR+ P FD  S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH GLSVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT+MGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK+IV RARR++ FLSQ F VAE+F+G  G YV + DT+Q FKEIL+GK+D +PE AF  VG + + ++ AK +
  S:     4 GHVLQVMGPVVDVKF-ESGQLPDIFNALVVKQEAKADAKGIDLTLEVALHLGDDTVRTIAMDSTDGLTRGIEVADTGAPISVPVGDVTLGRVFNVLGETIDLEEEIDKSARRDPIHREAPKFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGLSVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQRYKELQDIIAILGMDELSDEDKLIVSRARRVQFFLSQNFHVAEQFTGQKGSYVQVKDTVQDFKEILEGKYDHIPEDAFRLVGPMSDVLKAAKEM 468
>gi|116618945|ref|YP_819316.1| F0F1 ATP synthase subunit beta [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270855|sp|Q03V29.1|ATPB_LEUMM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|28193535|emb|CAD48595.1| F1F0-ATPase subunit beta [Leuconostoc mesenteroides subsp. mesenteroides] >gi|116097792|gb|ABJ62943.1| F0F1-type ATP synthase, beta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (466 aa)
Score = 1599, Expect = 6.9e-176, Identities = 304/464 (65%), Positives = 372/464 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           ++ GKV QVIGPVVD+ F    Q+P I + L + K  G+ L +E +  +GD +VR IA+  T+GL R   V +  +PIEVPVG+  LGR+FNVLG+P+D    +     +  IHR  P +D+ +++ EI ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+Y+EM + GV+ +TA+V+GQMNEPPGARMRVALT LTMAE FRD++ +DVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STS  LDP IVG  HY+VA  VQ  LQR+ ELQDII+ILG+DEL+DE+K  V RARRI+ FLSQPF VAE F+GI G+YVP+++T++SFKEILDGK+DDLPE AF  VG I++ VEKAK + +
  S:     1 MSTGKVVQVIGPVVDIAFEAGQQVPDINNALVIDKGNGQSLTVEVSLALGDGVVRTIAMDSTDGLQRGMGVVDTGNPIEVPVGEATLGRVFNVLGEPVDNNGAIASDVRRSSIHRDAPKYDELTSSTEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYHEMEESGVLKQTAMVYGQMNEPPGARMRVALTGLTMAENFRDNEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSSALDPQIVGQEHYEVATEVQRTLQRYRELQDIISILGMDELSDEEKTTVNRARRIQFFLSQPFSVAETFTGINGEYVPVAETVRSFKEILDGKYDDLPEDAFRNVGAIEQVVEKAKTMAQ 466
>gi|4239652|gb|AAD13383.1| ATPase, beta subunit [Streptococcus mutans] (468 aa)
Score = 1599, Expect = 7.0e-176, Identities = 307/462 (66%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV F    +LP I + L V   G++   + LE A  +GD +VR IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG  ID  +   +  +  PIH+K PSFDD S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ++LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GK+D+LPE AF  VG I++ VEKAK++
  S:     1 MSTGKIAQVVGPVVDVAFATDDKLPEINNALVVYKDGDKSQRIVLEVALELGDGLVRTIAMESTDGLTRGLEVFDTGRAISVPVGKETLGRVFNVLGDTIDLDKPFAEDAERQPIHKKAPSFDDLSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERRLTQMGIYPAVDPLASSSRALSPEIVGQEHYDVATEVQHVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDELPEDAFRSVGAIEDVVEKAKKM 466
>gi|166996503|ref|ZP_02262963.1| F0F1 ATP synthase subunit beta [Bacillus cereus AH820] >gi|196039564|ref|ZP_03106869.1| ATP synthase F1, beta subunit [Bacillus cereus NVH0597-99] >gi|196029724|gb|EDX68326.1| ATP synthase F1, beta subunit [Bacillus cereus NVH0597-99] (469 aa)
Score = 1599, Expect = 7.0e-176, Identities = 308/459 (67%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L+VK + E      L  E A  +GDD VR +A+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID   E+P   +  PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAE+FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ DT++ FKEIL+GK+DDLPE AF  VG I+E +E AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALTVKQSNENGTSINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKDTVRGFKEILEGKYDDLPEDAFRLVGGIEEVIENAKKM 467
>gi|1168575|sp|P43451|ATPB_ENTHR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|153573|gb|AAA26859.1| H+ ATPase (468 aa)
Score = 1599, Expect = 8.1e-176, Identities = 308/462 (66%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLP-IHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F+    LP I + L V    E+   + LE A  +GD ++R IA+  T+GL R  +V +    I VPVGK+ LGR+FNVLG  ID     P+  +   IH+K PSFD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLYYEM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QAIYVPADD TDPAPAT F HLDA T L+R +   GI+PA++PL S+S  L P IVG  HYKVA  VQ++LQR+ ELQDIIAILG+DEL+D++K++V RARR++ FLSQ F VAE+F+G+ G YVP+ +T++ F+EIL+GK+DDLPE+AF  VG I++ VEKAK+L
  S:     1 MSSGKIVQVIGPVVDVEFSLDQSLPDINNALVVYKNDEKKSKVVLETALELGDGVIRTIAMESTDGLQRGMEVIDTGKAISVPVGKDTLGRVFNVLGDTIDLGSSFPEDAERSEIHKKAPSFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQGIYPAVDPLASSSSALAPEIVGEEHYKVATEVQHVLQRYRELQDIIAILGMDELSDQEKVLVSRARRVQFFLSQNFNVAEQFTGLPGSYVPVEETVKGFREILEGKYDDLPEEAFRSVGRIEDVVEKAKKL 466
>gi|118573692|sp|Q38WK5|ATPB_LACSS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (476 aa)
Score = 1599, Expect = 8.4e-176, Identities = 310/462 (67%), Positives = 366/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV QVIGPVVDV F+  + LP I + L+V    +E + LE A  +GD ++R I++  T+GL R   V +    I VPVGK  LGR+FNVLG+ IDG EE P    +  IHR  P F++ + + EI ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GV++KTA+VFGQMNE PGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T LDR +   GI+PA+NPLES+S  LDP IVG  HY+VA  VQ++LQR+ ELQDII+ILG+DEL+D++KIIV RARRI+ FLSQ F VAE F+G AG YVP+ DT+  FK IL G +DD+PE+AF  VG I  A+ KAK +
  S:     1 MSMGKVVQVIGPVVDVEFSLDTDLPDINNALTVDKGNDETVVLEVALELGDGVMRTISMESTDGLRRGMPVEDAGRAINVPVGKETLGRVFNVLGETIDGGEEFPADFRRDSIHRSAPKFEELNTSSEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVLEKTAMVFGQMNESPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLDRKLTQQGIYPAVNPLESSSSALDPEIVGQEHYEVASEVQHVLQRYRELQDIISILGMDELSDDEKIIVARARRIQFFLSQNFHVAEAFTGQAGSYVPVKDTVSGFKAILAGDYDDVPEEAFRLVGNIDAALAKAKEM 464
>gi|152972641|ref|YP_001337787.1| F0F1 ATP synthase subunit beta [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166201714|sp|A6TG36.1|ATPB_KLEP7 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|150957490|gb|ABR79520.1| ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (460 aa)
Score = 1598, Expect = 8.9e-176, Identities = 304/459 (66%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +PR+Y+ L V+   E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+P+D K ++ ++ +  IHR  PS+++ S++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPRVYEALEVQNGNEVLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGQPVDMKGDIGEEERWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVALKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL 460
>gi|148266273|ref|YP_001232979.1| F0F1 ATP synthase subunit beta [Geobacter uraniireducens Rf4] >gi|189081335|sp|A5G9D8.1|ATPB_GEOUR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|146399773|gb|ABQ28406.1| ATP synthase F1, beta subunit [Geobacter uraniireducens Rf4] (470 aa)
Score = 1598, Expect = 1.0e-175, Identities = 304/459 (66%), Positives = 369/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCL-----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG V+DV F E  +LP IY+ L     S+      L LE AQ +G++ VR IA+  T+GL R +   +    I VPVG+  LGR+ NV+G P+D    +  + +  IHR+ P+F DQS  +E F TGIKV+DLL PYARGGKIGLFGGAGVGKTVL+ ELI+NIA +H G SVFAGVGERTREGNDL+ EM + GV++KTALV+GQMNEPPGAR RVAL+AL++AEYFRD + Q+VLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG+LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++ +LQDIIAILG+DEL++EDK++V RAR+I+ FLSQPF VAE F+G  GKYV L DTI+ F+EI+ GKHDD+PEQAF+ VGTI+EA+EKAK L
  S:     6 GKISQVIGAVIDVEF-EPGKLPPIYNALRVTNPSIDDKENNLVLEVAQHLGENSVRTIAMDSTDGLVRGQAAIDTGKQISVPVGRKTLGRILNVIGDPVDEMGPVGAEKEYGIHREAPAFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAMQHGGFSVFAGVGERTREGNDLWMEMKESGVLEKTALVYGQMNEPPGARARVALSALSIAEYFRDEEGQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGAPGKYVELKDTIKGFQEIVAGKHDDVPEQAFYLVGTIEEAIEKAKTL 468
>gi|156936112|ref|YP_001440028.1| F0F1 ATP synthase subunit beta [Enterobacter sakazakii ATCC BAA-894] >gi|166201702|sp|A7MMW9.1|ATPB_ENTS8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|156534366|gb|ABU79192.1| hypothetical protein ESA_04006 [Enterobacter sakazakii ATCC BAA-894] (460 aa)
Score = 1598, Expect = 1.1e-175, Identities = 304/459 (66%), Positives = 371/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++YD L V    E L LE  Q +G  IVR IA+G ++GL R   V +  HPIEVPVGK  LGR+ NVLG+PID K ++ ++ +  IHR  PS+++ S++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ+ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I++G++D LPEQAF+ VG+I EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPKVYDALEVTNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLPVADLEHPIEVPVGKATLGRIMNVLGQPIDMKGDIGEEERWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGAPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL 460
>gi|188535583|ref|YP_001909380.1| ATP synthase, F1 complex, beta subunit [Erwinia tasmaniensis] >gi|188030625|emb|CAO98521.1| ATP synthase, F1 complex, beta subunit [Erwinia tasmaniensis] (460 aa)
Score = 1597, Expect = 1.3e-175, Identities = 302/459 (65%), Positives = 370/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG VVDV F + + +P++Y  L VK     L LE  Q +G  +VR IA+G ++GL R  +  +  HPIEVPVG   LGR+ NVLG+PID K ++ ++ +  IHR  PS++DQSN+ ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY  A GVQ++LQR+ EL+DIIAILG+DEL++EDK++V R+R+++ FLSQPFFVAE F+G  GKYV L DTI+ FK I+DG+ D LPEQAF+ VG+I+EAVEKAK+L
  S:     4 GKIVQVIGAVVDVEFPQDA-VPQVYSALEVKNGDARLVLEVQQQLGGGVVRTIAMGSSDGLKRGLETVDLQHPIEVPVGTATLGRIMNVLGEPIDMKGDIGEEERWAIHRSAPSYEDQSNSQDLLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAAEHSGFSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSLLQRYQELKDIIAILGMDELSEEDKLVVARSRKMQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMDGEFDHLPEQAFYMVGSIEEAVEKAKKL 460
>gi|152978010|ref|YP_001343639.1| F0F1 ATP synthase subunit beta [Actinobacillus succinogenes 130Z] >gi|171472936|sp|A6VL57.1|ATPB_ACTSZ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|150839733|gb|ABR73704.1| ATP synthase F1, beta subunit [Actinobacillus succinogenes 130Z] (458 aa)
Score = 1597, Expect = 1.3e-175, Identities = 301/462 (65%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F +++ +P++YD L V+  G  L LE  Q +G  +VRCIALG ++GL R   V N  +PI VPVG   LGR+ NVLG+PID K E+  +    IHR+ PS++DQSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAIL +DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G++D +PEQAF+ VG+I+E VEKAK +
  S:     1 MSAGKIVQIIGAVIDVEFPQNA-VPKVYDALKVEEGG--LTLEVQQQLGGGVVRCIALGTSDGLKRGLAVKNTGNPISVPVGTKTLGRIMNVLGEPIDQKGEIGAEETWAIHREAPSYEDQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGFSVFAGVGERTREGNDFYHEMTESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVARGVQGILQRYKELKDIIAILSMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEYDHIPEQAFYMVGSIEEVVEKAKNM 458
>gi|30023337|ref|NP_834968.1| F0F1 ATP synthase subunit beta [Bacillus cereus ATCC 14579] >gi|47569800|ref|ZP_00240471.1| ATP synthase F1, beta subunit [Bacillus cereus G9241] >gi|168136017|ref|ZP_02579246.1| F0F1 ATP synthase subunit beta [Bacillus cereus B4264] >gi|81837221|sp|Q814W2|ATPB_BACCR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|29898898|gb|AAP12169.1| ATP synthase beta chain [Bacillus cereus ATCC 14579] >gi|47553542|gb|EAL11922.1| ATP synthase F1, beta subunit [Bacillus cereus G9241] (468 aa)
Score = 1597, Expect = 1.4e-175, Identities = 308/459 (67%), Positives = 364/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L+VK + E     L  E A  +GDD VR +A+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID   ELP      PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAE+FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T+  FKEIL+GK+DDLPE AF  VG I+E +E AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALTVKQSNENGSMNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGELPADVHRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGGIEEVIENAKKM 466
>gi|108773085|ref|YP_635994.1| CF1 beta subunit of ATP synthase [Scenedesmus obliquus] >gi|118573743|sp|Q1KVT0|ATPB_SCEOB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|88696651|gb|ABD48277.1| CF1 beta subunit of ATP synthase [Scenedesmus obliquus] (480 aa)
Score = 1597, Expect = 1.4e-175, Identities = 307/460 (66%), Positives = 368/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL---AGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+IGPV+D+ F +  Q+P IY+ L++K    AG E+ +  E  QL+GD  VR +A+ PT+GL R  +V +   P+ VPVGK+ LGR+FNVLG+P+D    +  +  LPIHR  P+F D    L IFETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREGNDLY EM + GVI        K ALV+GQMNEPPGARMRVALTALTMAEYFRD + QDVL FIDNIFRF QAG+EVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVPADDLTDPAPATTF HLDA TVL R +A+ GI+PA++PL+STS +L P I+G  HY  A  V+  LQR+ ELQDIIAILG+DEL++ED+++V RAR+I  FLSQPFFVAE F+G  GKYV L++TI+ F +IL G+ DDLPEQAF+ VG I EA+ KA  +K
  S:    10 GKISQIIGPVLDIAFGQG-QVPNIYNALTIKAKNAAGLEMSVTCEVQQLLGDSCVRAVAMNPTDGLMRGMEVLDTGKPLNVPVGKSTLGRIFNVLGEPVDNLGPVKNEESLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLIDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGALQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPWILGEKHYGCAQSVKRTLQRYKELQDIIAILGLDELSEEDRLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFNKILAGELDDLPEQAFYLVGNINEALTKAASMK 480
>gi|15791495|ref|NP_281318.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237114|ref|YP_178126.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni RM1221] >gi|86149745|ref|ZP_01067975.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151230|ref|ZP_01069445.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|86154037|ref|ZP_01072238.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88597713|ref|ZP_01100946.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613266|ref|YP_999831.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926907|ref|ZP_01810585.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|157414420|ref|YP_001481676.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. jejuni 81116] >gi|167004802|ref|ZP_02270560.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni 81-176] >gi|122953061|sp|Q0PC30.1|ATPB_CAMJE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358271|sp|A8FJR2.1|ATPB_CAMJ8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358273|sp|A1VXJ0.1|ATPB_CAMJJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81819580|sp|Q5HX59|ATPB_CAMJR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|57165918|gb|AAW34697.1| ATP synthase F1, beta subunit [Campylobacter jejuni RM1221] >gi|85840013|gb|EAQ57272.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841577|gb|EAQ58824.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842451|gb|EAQ59665.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87248948|gb|EAQ71910.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190017|gb|EAQ93993.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359494|emb|CAL34278.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844484|gb|EDK21592.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|157385384|gb|ABV51699.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni 81116] (465 aa)
Score = 1597, Expect = 1.5e-175, Identities = 305/460 (66%), Positives = 366/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QV+GPVVDV F +   LP+I + + V    E    +L LE A  +GD+ VR IA+  T+GL R  K      PI VPVG+ VLGR+FNV G  ID  EE+    +  IHR PP+F+DQS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY EM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+ QERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R IA  GI+PA++PL+STSR+LDPNI+G  HYKVA GVQ++LQ++ +LQDIIAILG+DEL++EDK++VERAR+I  FLSQPFFVAE F+G  GKY+ L DTI  FK IL+GK+D LPE AF+ VG I EA+ KA +LK
  S:     3 GFISQVLGPVVDVDFND--YLPQINEAIVVNFESEGKKHKLVLEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEISFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDHLPENAFYMVGNIDEAIAKADKLK 464
>gi|170087348|ref|XP_001874897.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164650097|gb|EDR14338.1| predicted protein [Laccaria bicolor S238N-H82] (540 aa)
Score = 1596, Expect = 1.6e-175, Identities = 309/461 (67%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK-LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G V  VIG VVDV F E+  LP I + L V+  +G  L LE A  +G++ VR IA+  TEGL R  KV +   PI VPVG   LGR+ NV+G+PID +  +      PIH  PP F DQS T E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTVL+QELI+N+AK H G S+F GVGERTREGNDLY+EMI+ GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTL+T+MG +QERI +TK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+S SR+LDP IVG  HY VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ VERAR+I+ F+SQPF VA+ F+G  GK VPL DT++SFKEIL G+HD LPE AF+  GTI++   KA++L K
  S:    71 GSVKTVIGAVVDVQF-ETDNLPPILNALEVQNFSGGRLVLEVASHLGENSVRTIAMDGTEGLVRGTKVVDTGSPIMVPVGTATLGRIMNVIGEPIDERGPIKGVKLCPIHADPPPFVDQSTTAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNVAKAHGGFSIFCGVGERTREGNDLYHEMIETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTDMGGMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSKSRMLDPRIVGQEHYDVATAVQKILQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFQVAQVFTGYEGKLVPLKDTVRSFKEILSGQHDSLPESAFYMAGTIEDVKAKAEQLAK 536
>gi|153951038|ref|YP_001397361.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. doylei 269.97] >gi|190358272|sp|A7H1I1.1|ATPB_CAMJD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152938484|gb|ABS43225.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. doylei 269.97] (484 aa)
Score = 1596, Expect = 1.6e-175, Identities = 305/463 (65%), Positives = 369/463 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           G + QV+GPVVDV F +   LP+I + + V    E    +L LE A  +GD+ VR IA+  T+GL R  K      PI VPVG+ VLGR+FNV G  ID  EE+P   +  IHR PP+F+DQS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY EM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+ QERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R IA  GI+PA++PL+STSR+LDPNI+G  HYKVA GVQ++LQ++ +LQDIIAILG+DEL++EDK++VERAR+I  FLSQPFFVAE F+G  GKY+ L DTI  FK IL+GK+D LPE AF+ VG I EA+ KA+ L++ +
  S:     3 GFISQVLGPVVDVDFND--YLPQINEAIVVNFESEGKKHKLVLEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEIPFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKFLSQPFFVAEVFTGSPGKYINLEDTIAGFKGILEGKYDHLPENAFYMVGNIDEAIAKAETLREIS 467
>gi|187603975|ref|ZP_02990186.1| ATP synthase F1, beta subunit [Exiguobacterium sp. AT1b] >gi|187484037|gb|EDU22030.1| ATP synthase F1, beta subunit [Exiguobacterium sp. AT1b] (472 aa)
Score = 1596, Expect = 1.8e-175, Identities = 306/459 (66%), Positives = 365/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V  V+GPV+DV F   + LP IY+ L V            +L LE A  +GDD VR IA+  T+G+ R  +V +   PI VPVG+  LGR+FNVLG PID KE      + PIHR+ P+FD+ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EHSG+SVFAGVGERTREGNDL++EM   GVI +TA+VFGQMNEPPGAR+RVALT LTMAEYFRD   QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI ST  GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+++DK+ V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GKHDDLPE AF  VG I++ +EKAK L
  S:     8 GRVVAVMGPVIDVKF--DNHLPNIYNALKVTHVAATADDVSVDLTLEVAVHLGDDTVRTIAMDSTDGVRRGMEVLDLGSPISVPVGEATLGRVFNVLGNPIDDKEVAADVLRAPIHRQAPTFDELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLFHEMTDSGVIKQTAMVFGQMNEPPGARLRVALTGLTMAEYFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGMLQERITSTAKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLSEMGIYPAVDPLASTSRALSPEIVGKEHYEVARNVQQTLQRYKELQDIIAILGMDELSEDDKLTVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILEGKHDDLPEDAFRLVGPIEDVIEKAKTL 471
>gi|113461832|ref|YP_719901.1| F0F1 ATP synthase subunit beta [Haemophilus somnus 129PT] >gi|123327497|sp|Q0I5X3.1|ATPB_HAES1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|112823875|gb|ABI25964.1| ATP synthase, F1 subunit beta [Haemophilus somnus 129PT] (457 aa)
Score = 1596, Expect = 1.8e-175, Identities = 301/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F +++ +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N  +PI VPVG   LGR+ NVLG+PID K E+  +    IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG++D +PEQAF+ VG+I+E +EKAK++
  S:     1 MSAGKIIQIIGAVIDVEFPQNA-VPKVYDALKVESG---LTLEVQQQLGGGVVRCIALGSSDGLKRGLKVENTGNPISVPVGTKTLGRIMNVLGEPIDEKGEIGAEETWAIHRAAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEYDHIPEQAFYMVGSIEEVLEKAKKM 457
>gi|24379917|ref|NP_721872.1| F0F1 ATP synthase subunit beta [Streptococcus mutans UA159] >gi|26006949|sp|P95789|ATPB_STRMU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|24377897|gb|AAN59178.1|AE014985_2 FoF1 membrane-bound proton-translocating ATPase, beta subunit [Streptococcus mutans UA159] (468 aa)
Score = 1596, Expect = 1.9e-175, Identities = 307/462 (66%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV F    +LP I + L V   G++   + LE A  +GD +VR IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG  ID  +   +  +  PIH+K PSFDD S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ++LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GK+D+LPE AF  VG I++ VEKAK +
  S:     1 MSTGKIAQVVGPVVDVAFATDDKLPEINNALVVYKDGDKSQRIVLEVALELGDGLVRTIAMESTDGLTRGLEVFDTGRAISVPVGKETLGRVFNVLGDTIDLDKPFAEDAERQPIHKKAPSFDDLSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERRLTQMGIYPAVDPLASSSRALSPEIVGQEHYDVATEVQHVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDELPEDAFRSVGAIEDVVEKAKNM 466
>gi|170718139|ref|YP_001785168.1| ATP synthase F1, beta subunit [Haemophilus somnus 2336] >gi|168826268|gb|ACA31639.1| ATP synthase F1, beta subunit [Haemophilus somnus 2336] (457 aa)
Score = 1596, Expect = 1.9e-175, Identities = 301/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F +++ +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N  +PI VPVG   LGR+ NVLG+PID K E+  +    IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG++D +PEQAF+ VG+I+E +EKAK++
  S:     1 MSAGKIIQIIGAVIDVEFPQNA-VPKVYDALKVESG---LTLEVQQQLGGGVVRCIALGSSDGLKRGLKVENTGNPISVPVGTKTLGRIMNVLGEPIDEKGEIGAEEYWAIHRAAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEYDHIPEQAFYMVGSIEEVLEKAKKM 457
>gi|139474050|ref|YP_001128766.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes str. Manfredo] >gi|166222419|sp|A2RFC2.1|ATPB_STRPG ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|134272297|emb|CAM30551.1| ATP synthase beta chain [Streptococcus pyogenes str. Manfredo] (468 aa)
Score = 1596, Expect = 1.9e-175, Identities = 304/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV---KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV+F    +LP I + L V       +++ LE A  +GD +VR IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG+ ID +E   +   + PIH+K PSFD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP++DT++ FKEIL+GK+DDLPE AF  VG I++ ++KA+++
  S:     1 MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVADTVRGFKEILEGKYDDLPEDAFRSVGPIEDVIKKAEKM 466
>gi|168142841|ref|ZP_02586070.1| F0F1 ATP synthase subunit beta [Bacillus cereus G9842] (468 aa)
Score = 1595, Expect = 2.0e-175, Identities = 308/459 (67%), Positives = 364/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L+VK + E     L  E A  +GDD VR +A+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID   ELP      PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAE+FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T+  FKEIL+GK+DDLPE AF  VG I+E +E AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALTVKQSNENGSMNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDVTLGRVFNVLGDAIDLDGELPADVHRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGGIEEVIENAKKM 466
>gi|30265328|ref|NP_847705.1| F0F1 ATP synthase subunit beta [Bacillus anthracis str. Ames] >gi|47530867|ref|YP_022216.1| F0F1 ATP synthase subunit beta [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188141|ref|YP_031394.1| F0F1 ATP synthase subunit beta [Bacillus anthracis str. Sterne] >gi|49481141|ref|YP_039296.1| F0F1 ATP synthase subunit beta [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140257|ref|YP_086574.1| F0F1 ATP synthase subunit beta [Bacillus cereus E33L] >gi|65317282|ref|ZP_00390241.1| COG0055: F0F1-type ATP synthase, beta subunit [Bacillus anthracis str. A2012] >gi|118480344|ref|YP_897495.1| F0F1 ATP synthase subunit beta [Bacillus thuringiensis str. Al Hakam] >gi|165873338|ref|ZP_02217941.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0488] >gi|167636395|ref|ZP_02394695.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0442] >gi|167642060|ref|ZP_02400286.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0193] >gi|170689704|ref|ZP_02880881.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0465] >gi|170709426|ref|ZP_02899834.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0389] >gi|177656024|ref|ZP_02937131.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0174] >gi|196036290|ref|ZP_03103688.1| ATP synthase F1, beta subunit [Bacillus cereus W] >gi|196045693|ref|ZP_03112923.1| ATP synthase F1, beta subunit [Bacillus cereus 03BB108] >gi|166201691|sp|A0RL95.1|ATPB_BACAH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81824106|sp|Q630U3|ATPB_BACCZ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81828124|sp|Q6HAY0|ATPB_BACHK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81837543|sp|Q81JZ5|ATPB_BACAN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|30260006|gb|AAP29191.1| ATP synthase F1, beta subunit [Bacillus anthracis str. Ames] >gi|47506015|gb|AAT34691.1| ATP synthase F1, beta subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182068|gb|AAT57444.1| ATP synthase F1, beta subunit [Bacillus anthracis str. Sterne] >gi|49332697|gb|AAT63343.1| ATP synthase F1, beta subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973726|gb|AAU15276.1| ATP synthase F1, beta subunit [Bacillus cereus E33L] >gi|118419569|gb|ABK87988.1| ATP synthase F1, beta subunit [Bacillus thuringiensis str. Al Hakam] >gi|164710935|gb|EDR16509.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0488] >gi|167509978|gb|EDR85398.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0193] >gi|167528229|gb|EDR91011.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0442] >gi|170125659|gb|EDS94578.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0389] >gi|170666346|gb|EDT17132.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0465] >gi|172079879|gb|EDT64988.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0174] >gi|195991082|gb|EDX55052.1| ATP synthase F1, beta subunit [Bacillus cereus W] >gi|196023524|gb|EDX62201.1| ATP synthase F1, beta subunit [Bacillus cereus 03BB108] (469 aa)
Score = 1595, Expect = 2.1e-175, Identities = 307/459 (66%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L+VK + E      L  E A  +GDD VR +A+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID   E+P   +  PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAE+FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+DDLPE AF  VG I+E +E AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALTVKQSNENGTSINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILEGKYDDLPEDAFRLVGGIEEVIENAKKM 467
>gi|71082935|ref|YP_265654.1| F0F1 ATP synthase subunit beta [Candidatus Pelagibacter ubique HTCC1062] >gi|91762641|ref|ZP_01264606.1| F1-ATP Synthase Beta Chain [Candidatus Pelagibacter ubique HTCC1002] >gi|118573715|sp|Q4FP38|ATPB_PELUB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71062048|gb|AAZ21051.1| F1-ATP Synthase Beta Chain [Candidatus Pelagibacter ubique HTCC1062] >gi|91718443|gb|EAS85093.1| F1-ATP Synthase Beta Chain [Candidatus Pelagibacter ubique HTCC1002] (472 aa)
Score = 1595, Expect = 2.2e-175, Identities = 308/464 (66%), Positives = 362/464 (78%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           ++ GK+ Q+IG VVDV F    +LP I   L  K     L LE AQ +G+  VR IA+  TEGL R ++VT    PI+VPVG   LGR+ NV+G+PID K E+  K + PIHR  P F DQS   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI  GVI       K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVL F+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +T  GSITSVQAIYVPADDLTDPAPAT+F HLDA TVL R IA +GI+PA++PL+STSR+LDP IVG  HY+VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPFFVAE F+G  GK V L  TI+ F  I +G++D LPE AF+ VGTI+EAVEKA+++ K
  S:     1 MSKGKITQIIGAVVDVKF--DGELPEILSALECKNGDNRLVLEVAQHLGESSVRTIAMDATEGLKRGDEVTATGAPIQVPVGPETLGRIINVIGEPIDEKGEVKTKEKWPIHRAAPEFSDQSTETEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYHEMIDSGVIKPEGPGSKAALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGNLQERITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEIGIYPAVDPLDSTSRILDPRIVGDEHYRVAREVQKILQTYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFFVAEVFTGSPGKLVDLESTIKGFAAICNGEYDHLPEAAFYMVGTIEEAVEKAEKMAK 468
>gi|190571537|ref|YP_001975895.1| ATP synthase F1, beta subunit [Wolbachia pipientis] >gi|190357809|emb|CAQ55265.1| ATP synthase F1, beta subunit [Wolbachia pipientis] (478 aa)
Score = 1595, Expect = 2.5e-175, Identities = 310/463 (66%), Positives = 374/463 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA--GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ GKV ++   VVD+ F +   LP+I++ L  KL   G+EL LE +Q IGD+IVRCIA+  T+G++R ++  +   PI VPVG++ LGR+FNV+G+ ID    L  K  L PIHR PPSF +Q    E+  TGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H G SVFAGVGERTREGNDLY EMI   VID       +  LV+GQMNEPPGAR RVALTALTMAEYFRDH+NQDVL F+DNIFRFTQAGSE+SALLGR+PSAVGYQPTLAT+MG +QERIAST  GSITSVQAIYVPADDLTDPAPATTF+HLDA TVL R IA +GI+PA++PL+STS+ L   I+G  HY VA  V+ ILQ +  LQDIIAILG+DEL+DEDKIIV+RAR+I+ FLSQPF VAE F+G++GK+V LSDTI SFK I++GK+D LPE AF+ VG+I EA+EKA+ +K
  S:     1 MSTGKVVKITQAVVDLKFEDG--LPKIFNALKSKLKYKGKELVLEVSQHIGDNIVRCIAMDSTDGMSRGDEFVDTGAPISVPVGRSTLGRIFNVVGELIDECGPLKGKYDLEPIHRSPPSFTEQKIQEEVLVTGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKAHKGFSVFAGVGERTREGNDLYNEMITSNVIDINEHEKSQAVLVYGQMNEPPGARARVALTALTMAEYFRDHENQDVLFFVDNIFRFTQAGSEISALLGRIPSAVGYQPTLATDMGAMQERIASTTAGSITSVQAIYVPADDLTDPAPATTFSHLDATTVLSRQIAEMGIYPAVDPLDSTSQSLSAEIIGEEHYNVASEVKRILQTYKSLQDIIAILGMDELSDEDKIIVDRARKIQKFLSQPFHVAEVFTGMSGKFVSLSDTISSFKGIIEGKYDHLPEAAFYMVGSISEAIEKAESIK 471
>gi|188527915|ref|YP_001910602.1| F0F1 ATP synthase subunit beta [Helicobacter pylori Shi470] >gi|188144155|gb|ACD48572.1| F0F1 ATP synthase subunit beta [Helicobacter pylori Shi470] (469 aa)
Score = 1594, Expect = 2.9e-175, Identities = 300/462 (64%), Positives = 368/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ V      IEVPVG+ VLGR+FNV+G+ ID  E L      PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+GSE+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY++A G+Q +LQ++ +LQDIIAILG+DEL++EDK IVERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F  IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     6 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEINGTQKSLVLEVAAHLGANRVRAIAMDMTEGLVRNQAVKARGKMIEVPVGEEVLGRIFNVVGESIDNLEPLKPSLTWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGSEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKIVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSIQEVLEKAKNMKNS 469
>gi|29377093|ref|NP_816247.1| F0F1 ATP synthase subunit beta [Enterococcus faecalis V583] >gi|81436390|sp|Q831A5|ATPB_ENTFA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|29344559|gb|AAO82317.1| ATP synthase F1, beta subunit [Enterococcus faecalis V583] (468 aa)
Score = 1594, Expect = 2.9e-175, Identities = 309/462 (66%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLP-IHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F+    LP I + L V   GE   ++ LE A  +GD ++R IA+  T+GL R  +V +    I VPVGK+ LGR+FNVLG  ID +   P   +   IH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLYYEM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QAIYVPADD TDPAPAT F HLDA T L+R +   GI+PA++PL S+S  L P IVG  HY+VA  VQ+ILQR+ ELQDIIAILG+DEL+D++K++V RARR++ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GKHD+LPE+AF  VG I++A+EKAK+L
  S:     1 MSSGKIVQVIGPVVDVEFSLDQSLPDINNALVVYKNGEAKQKVVLEVALELGDGVIRSIAMESTDGLQRGMEVIDTGKSISVPVGKDTLGRVFNVLGDTIDLEAPFPADAERSGIHKKAPAFDELSTSNEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQGIYPAVDPLASSSSALAPEIVGEEHYEVATEVQHILQRYRELQDIIAILGMDELSDDEKVLVGRARRVQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDNLPEEAFRSVGKIEDAIEKAKQL 466
>gi|34556938|ref|NP_906753.1| F0F1 ATP synthase subunit beta [Wolinella succinogenes DSM 1740] >gi|1168583|sp|P42470|ATPB_WOLSU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|587588|emb|CAA54207.1| ATPase beta-subunit [Wolinella succinogenes] >gi|34482653|emb|CAE09653.1| ATP SYNTHASE F1 SECTOR BETA SUBUNIT [Wolinella succinogenes] (467 aa)
Score = 1594, Expect = 3.3e-175, Identities = 303/460 (65%), Positives = 368/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G++ QV+GPVVDV F   S LP I + L V    E    +L LE A  IGD  VR IA+  TEGL R  KV      IEVPVG+ VLGR+FNV+G  IDG +EL +  +  IHR  P+F++QS   E+FETGIKV+DLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY+EM + GV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA+EMG+LQERI STK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+LDP +VG +HYK A GVQ +LQ++ +LQDIIAILG+DEL++EDK +VERARRI  FLSQPFFVAE F+G  GKYV L +T++ FK IL+GK+D +PE AF+ VG I E +EKA+RLK
  S:     3 GRITQVMGPVVDVDF--DSYLPAINEALDVNYDIEGHPKKLVLEVAAHIGDSRVRTIAMDMTEGLTRGTKVVARGKSIEVPVGEQVLGRIFNVVGDVIDGGDELKEPVKWSIHRTAPTFENQSTKTEMFETGIKVVDLLAPYSKGGKVGLFGGAGVGKTVVIMELIHNVAFKHSGYSVFAGVGERTREGNDLYHEMKESGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLASEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILDPQVVGEDHYKTATGVQQVLQKYKDLQDIIAILGMDELSEEDKRVVERARRIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFKGILEGKYDQIPENAFYMVGGIDEVLEKAERLK 464
>gi|153007332|ref|YP_001381657.1| F0F1 ATP synthase subunit beta [Anaeromyxobacter sp. Fw109-5] >gi|190358251|sp|A7HIX7.1|ATPB_ANADF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152030905|gb|ABS28673.1| ATP synthase F1, beta subunit [Anaeromyxobacter sp. Fw109-5] (481 aa)
Score = 1593, Expect = 3.5e-175, Identities = 307/467 (65%), Positives = 373/467 (79%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK-----LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDK-------TALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           M   N   GK+ QVIGPVVDV F   + LP IY  LSV         + L +E +Q +G++  RCIA+  T+GL R   V +   PI VPVGK VLGR+ NV+G P+D +  +    + PIHR  P+  DQ+  +E FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+ EL++N+AK+  G SVFAGVGERTREGNDLY+EMI+ GVI+K         LV+GQMNEPPGAR RVAL+AL +AEYFRD + +D+LLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTL+TEMG+LQERI STK G+ITSVQAIYVPADDLTDPAPAT F HLDA TVL R +  +GI+PA++PL+STSR+LDP +VG  HY+VA  VQ  LQR+ +LQDIIAILG+DEL+++DK+ V RAR+++ FLSQPF VAE+F+G  GKYV L+DTI+ FKEI++GKHDDLPEQAF+ VG I+EAVEKAK+L
  S:     1 MATPNAQSGKITQVIGPVVDVEFPPGA-LPDIYTALSVTNPAIDARADNLVIEVSQHLGENTARCIAMDSTDGLVRGMVVRDTGAPISVPVGKEVLGRILNVVGDPVDERGPVASVRKFPIHRPAPTLVDQNVKIEAFETGIKVIDLLAPYLRGGKIGLFGGAGVGKTVLLMELVNNVAKKRGGFSVFAGVGERTREGNDLYHEMIESGVINKDDLSKSQCVLVYGQMNEPPGARARVALSALAIAEYFRDEEKRDMLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITSTKNGAITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRKLTEIGIYPAVDPLDSTSRILDPLVVGAEHYQVAREVQETLQRYKDLQDIIAILGMDELSEDDKLTVARARKVQRFLSQPFHVAEQFTGNPGKYVELADTIRGFKEIVEGKHDDLPEQAFYMVGGIEEAVEKAKKL 478
>gi|160893773|ref|ZP_02074557.1| hypothetical protein CLOL250_01327 [Clostridium sp. L2-50] >gi|156864758|gb|EDO58189.1| hypothetical protein CLOL250_01327 [Clostridium sp. L2-50] (453 aa)
Score = 1593, Expect = 3.6e-175, Identities = 302/452 (66%), Positives = 361/452 (79%)
  Q:    15 IGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           +GPVVDV F ++  LP I D L V   G++  +EAAQ IG++ VRCI L  +EGL+R+ +V      I+VPVG + LGR+FNV G  +DG   L       IHR PPSF+DQS  +EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELI N+A EH G S+F GVGER+REGNDL+ EM + GV+ KTALVFGQMNEPPGARMRVA T LTMAEYFRD ++QDVLLFIDNIFRF QAGSEVS+LLGRMPSAVGYQPTLA E+G+LQERIASTK+GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PLES SR+L+ ++VG  HY VA GVQ ILQ++ ELQDIIAILG++EL++EDKI V RAR+++ FLSQPF VAE F+G+ GKYVPL +T++ FK ILDG+ D+ PE AFF VG I+E  EKA +
  S:     1 MGPVVDVEFPDND-LPNIKDALEVDNHGKKCIMEAAQHIGNNTVRCIMLAASEGLSRDMEVVPTGSGIKVPVGTDTLGRLFNVTGDTLDGGPNLADTEHWVIHRDPPSFEDQSPVVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIQNVATEHGGYSIFTGVGERSREGNDLWTEMKESGVLSKTALVFGQMNEPPGARMRVAETGLTMAEYFRDVNHQDVLLFIDNIFRFVQAGSEVSSLLGRMPSAVGYQPTLANELGELQERIASTKSGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESNSRILEVDVVGEEHYNVARGVQEILQKYRELQDIIAILGMEELSEEDKITVTRARKVQKFLSQPFHVAENFTGVPGKYVPLKETVKGFKAILDGEMDEYPEWAFFNVGGIEEVKEKAAK 451
>gi|69247775|ref|ZP_00604480.1| ATP synthase F1, beta subunit [Enterococcus faecium DO] >gi|68194704|gb|EAN09186.1| ATP synthase F1, beta subunit [Enterococcus faecium DO] (468 aa)
Score = 1593, Expect = 3.8e-175, Identities = 308/462 (66%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLP-IHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F+    LP I + L V    E   ++ LEAA  +GD ++R IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG  ID +   P+  +   IH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLYYEM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QAIYVPADD TDPAPAT F HLDA T L+R +   GI+PA++PL S+S  L P IVG  HYKVA  VQ++LQR+ ELQDIIAILG+DEL+D++K++V RARR++ FLSQ F VAE+F+G+ G YVP+ +T++ F+EIL+GK+DDLPE+AF  VG I++ VEKAK L
  S:     1 MSSGKIVQVIGPVVDVEFSLDQSLPDINNALVVYKNDENKSKVVLEAALELGDGVIRTIAMESTDGLQRGMEVIDTGKAISVPVGKETLGRVFNVLGDTIDLETPFPEDAERSEIHKKAPAFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQGIYPAVDPLASSSSALAPEIVGEEHYKVATEVQHVLQRYRELQDIIAILGMDELSDQEKVLVSRARRVQFFLSQNFNVAEQFTGLPGSYVPVEETVKGFREILEGKYDDLPEEAFRSVGRIEDVVEKAKTL 466
>gi|75908515|ref|YP_322811.1| F0F1 ATP synthase subunit beta [Anabaena variabilis ATCC 29413] >gi|118573506|sp|Q3MAS0|ATPB_ANAVT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|75702240|gb|ABA21916.1| ATP synthase F1, beta subunit [Anabaena variabilis ATCC 29413] (482 aa)
Score = 1593, Expect = 4.2e-175, Identities = 310/467 (66%), Positives = 373/467 (79%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDK-------TALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +K NI Y  + Q+IGPVVDV F  S +LP+IY+ L++K    AG+EL L  E  QL+GD+ +R +A+  T+GL R  +V +   PI VPVGK  LGR+FNVLG+P+D +  +  +  LPIHR  P   +      +FETGIKV+DLLTPY RGGKIGLFGGAGVGKTV++ ELI+NIA +H G+SVFAGVGERTREGNDLY EMI+ GVI+K        ALV+GQMNEPPGARMRV L+ LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++GQLQERI ST  GSITS+QA+YVPADDLTDPAPATTF HLD  TVL R +AA GI+PA++PL STS +L PNIVG  HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED++IV RAR++  FLSQPFFVAE F+G  GKYV L DTI+ F++IL G+ DDLPEQAF+ VG I EA+ KA++LK
  S:     6 EKTNIGY--ITQIIGPVVDVKF-PSGKLPQIYNALTIKGTNEAGQELNLTVEVQQLLGDNQIRAVAMSSTDGLVRGLEVVDTGAPISVPVGKATLGRIFNVLGEPVDNRGPVNNQETLPIHRPAPKLTELETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVINKDNLNESKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDINEAIAKAEKLK 481
>gi|163942993|ref|YP_001647877.1| F0F1 ATP synthase subunit beta [Bacillus weihenstephanensis KBAB4] >gi|163865190|gb|ABY46249.1| ATP synthase F1, beta subunit [Bacillus weihenstephanensis KBAB4] (469 aa)
Score = 1592, Expect = 5.3e-175, Identities = 306/459 (66%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +  +LP IY+ L+VK + E      L  E A  +GDD VR +A+  T+GL R  +V +    I VPVG   LGR+FNVLG  ID   ++P   +  PIHR+ P+F++ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGAR RVALT LTMAE+FRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T+  FKEIL+GK+DDLPE AF  VG+I+E +E AK++
  S:     4 GRVTQIMGPVVDVKF-DGGKLPEIYNALTVKQSNENGASINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDVTLGRVFNVLGDAIDLDGDVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGSIEEVIENAKKM 467
>gi|15901355|ref|NP_345959.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae TIGR4] >gi|15903403|ref|NP_358953.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae R6] >gi|111657410|ref|ZP_01408163.1| hypothetical protein SpneT_02001380 [Streptococcus pneumoniae TIGR4] >gi|116516544|ref|YP_816797.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae D39] >gi|148984851|ref|ZP_01818104.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP3-BS71] >gi|149007587|ref|ZP_01831222.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|149021774|ref|ZP_01835781.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP23-BS72] >gi|168487559|ref|ZP_02712067.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|168575963|ref|ZP_02721878.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae MLV-016] >gi|169833283|ref|YP_001694914.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|122277705|sp|Q04HT9.1|ATPB_STRP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81588075|sp|Q8DP44|ATPB_STRR6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81854993|sp|Q97PT6|ATPB_STRPN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|14972998|gb|AAK75599.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae TIGR4] >gi|15459007|gb|AAL00164.1| Proton-translocating ATPase, F1 sector, beta-subunit [Streptococcus pneumoniae R6] >gi|116077120|gb|ABJ54840.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae D39] >gi|147760946|gb|EDK67916.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|147922873|gb|EDK73989.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP3-BS71] >gi|147930010|gb|EDK80997.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP23-BS72] >gi|168995785|gb|ACA36397.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|183569628|gb|EDT90156.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|183578206|gb|EDT98734.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae MLV-016] (468 aa)
Score = 1592, Expect = 5.4e-175, Identities = 306/462 (66%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV+F    +LP I + L V    E   ++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +    +  +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEILDGK+D LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDVIAKAEKM 466
>gi|16080734|ref|NP_391562.1| F0F1 ATP synthase subunit beta [Bacillus subtilis subsp. subtilis str. 168] >gi|584808|sp|P37809|ATPB_BACSU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (Vegetative protein 31) (VEG31) >gi|433991|emb|CAA82260.1| ATP synthase subunit beta [Bacillus subtilis] >gi|2636206|emb|CAB15698.1| ATP synthase (subunit beta) [Bacillus subtilis subsp. subtilis str. 168] (473 aa)
Score = 1592, Expect = 5.6e-175, Identities = 311/459 (67%), Positives = 362/459 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL-------AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QV+GPVVDV F E   LP IY+ + +          G +L LE A  +GDD VR IA+  T+G+ R  +  +   PI VPVG   LGR+FNVLG+ ID  E +P   +  PIHR+ PSFD  S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDL+YEM   GVI+KTA+VFGQMNEPPGARMRVALT LTMAE+FRD   QDVL FIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY VA  VQ+ LQR+ ELQDIIAILG+DEL +EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T+Q FKEIL GK+D LPE AF  VG I+E VEKAK +
  S:     4 GRVSQVLGPVVDVRF-EDGHLPEIYNAIKISQPAASENEVGIDLTLEVALHLGDDTVRTIAMASTDGVQRGMEAVDTGAPISVPVGDVTLGRVFNVLGENIDLNEPVPADAKKDPIHRQAPSFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLFYEMSDSGVINKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDVQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVGEEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVQGFKEILAGKYDHLPEDAFRLVGRIEEVVEKAKEM 469
>gi|116333888|ref|YP_795415.1| F0F1 ATP synthase subunit beta [Lactobacillus brevis ATCC 367] >gi|122269425|sp|Q03QY8.1|ATPB_LACBA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|28193537|emb|CAD48596.1| F1F0-ATPase subunit beta [Lactobacillus brevis] >gi|116099235|gb|ABJ64384.1| F0F1-type ATP synthase, beta subunit [Lactobacillus brevis ATCC 367] (471 aa)
Score = 1592, Expect = 5.6e-175, Identities = 310/465 (66%), Positives = 368/465 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           ++ GK+ QVIGPVVDV F  + +LP I   L++K   G  L  E A  +GD ++R IA+  T+GL R  +V N    I VPVG + LGR+FNVLG PIDG  E  P   ++PIHR  P +D+ + T EI ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+ H+G+SVF GVGERTREGND+Y+EM   GV+ +TA+V+GQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STS  L P I+G  HY VA  VQ +LQR+ ELQDII+ILG+DEL+DE++ IV+RARRI+ FLSQPF VA +F+G+ GKYV L DTI+SFK ILDGK+DDLPE AF   G I++AVEKAK++  A
  S:     1 MSAGKIVQVIGPVVDVEFPLNDELPDINTALNIKKDDGSVLVTEVALELGDGVMRTIAMDGTDGLRRGLEVENTGASISVPVGDDTLGRVFNVLGDPIDGGAEFGPDAERMPIHRDAPKYDELNPTTEILETGIKVIDLLEPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYWEMKGSGVLKQTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSTALAPEIIGQEHYDVATEVQRVLQRYHELQDIISILGMDELSDEEQTIVQRARRIQFFLSQPFSVASQFTGMDGKYVKLEDTIRSFKGILDGKYDDLPEDAFRNCGAIEDAVEKAKQMNDA 467
>gi|183220215|ref|YP_001838211.1| ATP synthase F1, beta subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910333|ref|YP_001961888.1| Beta subunit of the H(+)-transporting two-sector ATPase, F1 sector [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775009|gb|ABZ93310.1| Beta subunit of the H(+)-transporting two-sector ATPase, F1 sector [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778637|gb|ABZ96935.1| ATP synthase F1, beta subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (468 aa)
Score = 1591, Expect = 5.7e-175, Identities = 306/460 (66%), Positives = 371/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+IG V+D+ F ES  +P IY+ + +  K+ G+++ +  E  Q IGD+ VR I+L  T+GL R  +VT+   PI VPVG   LGR+FNVLG+ ID   +LPK   ++PIHR  P++++     EIFETGIKVIDLL PY +GGK GLFGGAGVGKTVL+QELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GVIDKT L FGQMNEPPGAR+RVAL+ALTMAE FRD    D+LLF+DNIFRF+QAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI ST  GSITSVQAIYVPADDLTDPAPAT FTHLDA TVL R I+  GI+PA++PL+STSR+++P IVG  HY  A  VQ ILQR+ +LQDIIAILG+DEL+++DKI+V RARR+  FLSQPF VAE+F+G  GKYV L DTI+SFK I++GK+D LPEQAF+ VG+I E +E AK+LK
  S:     4 GKIKQIIGSVMDISF-ESGNMPEIYNAVEIQTKVNGKDVTITAEVQQHIGDNTVRAISLQSTDGLKRGLEVTDTGIPISVPVGTKTLGRIFNVLGEAIDELGDLPKDVKKMPIHRNAPTYEEIKPKTEIFETGIKVIDLLAPYIKGGKTGLFGGAGVGKTVLIQELINNIAKQHGGFSVFAGVGERTREGNDLWNEMKESGVIDKTVLCFGQMNEPPGARLRVALSALTMAENFRDESGSDILLFVDNIFRFSQAGSEVSALLGRMPSAVGYQPTLSTEMGGLQERITSTTRGSITSVQAIYVPADDLTDPAPATAFTHLDATTVLSRAISEKGIYPAVDPLDSTSRIMNPQIVGEEHYSTAREVQRILQRYKDLQDIIAILGMDELSEDDKILVARARRLEKFLSQPFHVAEQFTGRPGKYVKLEDTIRSFKGIIEGKYDSLPEQAFYMVGSIDEVIEAAKQLK 467
>gi|15674808|ref|NP_268982.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes M1 GAS] >gi|71910394|ref|YP_281944.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS5005] >gi|81856117|sp|Q9A0I7|ATPB_STRP1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|13621938|gb|AAK33703.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes M1 GAS] >gi|71853176|gb|AAZ51199.1| ATPase, beta subunit [Streptococcus pyogenes MGAS5005] (468 aa)
Score = 1591, Expect = 5.8e-175, Identities = 303/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG---EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV+F    +LP I + L V       +++ LE A  +GD +VR IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG+ ID +E   +   + PIH+K PSFD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP++DT++ FKEIL+GK+D+LPE AF  VG I++ ++KA+++
  S:     1 MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVADTVRGFKEILEGKYDELPEDAFRSVGPIEDVIKKAEKM 466
>gi|21910035|ref|NP_664303.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS315] >gi|28896267|ref|NP_802617.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes SSI-1] >gi|71903225|ref|YP_280028.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS6180] >gi|94988266|ref|YP_596367.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS9429] >gi|94992140|ref|YP_600239.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS2096] >gi|81847483|sp|Q8K826|ATPB_STRP3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573761|sp|Q1JCL3|ATPB_STRPB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573762|sp|Q1JMI9|ATPB_STRPC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573765|sp|Q48UD3|ATPB_STRPM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|21904225|gb|AAM79106.1| putative proton-translocating ATPase beta subunit [Streptococcus pyogenes MGAS315] >gi|28811518|dbj|BAC64450.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes SSI-1] >gi|71802320|gb|AAX71673.1| ATPase, beta subunit [Streptococcus pyogenes MGAS6180] >gi|94541774|gb|ABF31823.1| ATP synthase beta chain [Streptococcus pyogenes MGAS9429] >gi|94545648|gb|ABF35695.1| ATP synthase beta chain [Streptococcus pyogenes MGAS2096] (468 aa)
Score = 1591, Expect = 5.8e-175, Identities = 303/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG---EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV+F    +LP I + L V       +++ LE A  +GD +VR IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG+ ID +E   +   + PIH+K PSFD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP+++T++ FKEIL+GK+DDLPE AF  VG I++ ++KA+++
  S:     1 MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDDLPEDAFRSVGPIEDVIKKAEKM 466
>gi|109947169|ref|YP_664397.1| F0F1 ATP synthase subunit beta [Helicobacter acinonychis str. Sheeba] >gi|123362703|sp|Q17Y78.1|ATPB_HELAH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|109714390|emb|CAJ99398.1| ATP synthase F1 sector beta subunit [Helicobacter acinonychis str. Sheeba] (466 aa)
Score = 1591, Expect = 7.0e-175, Identities = 302/462 (65%), Positives = 372/462 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL--PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ V      IEVPVG+ VLGR+FNV+G+ ID  E  P KP L  PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY++A G+Q +LQ++ +LQDIIAILG+DEL++EDK IVERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F+ IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     3 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEVNGVQKSLVLEVAAHLGGNRVRAIAMDMTEGLVRNQVVKARGKMIEVPVGEGVLGRIFNVVGESIDNLE--PLKPSLIWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKIVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFRGILEGKYDHIPENAFYMVGSIQEVLEKAKSMKNS 466
>gi|149003278|ref|ZP_01828174.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP14-BS69] >gi|147758738|gb|EDK65735.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP14-BS69] (468 aa)
Score = 1590, Expect = 8.0e-175, Identities = 306/462 (66%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV+F    +LP I + L V    E   ++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +    +  +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEILDGK+D LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDVIVKAEKM 466
>gi|160943200|ref|ZP_02090436.1| hypothetical protein FAEPRAM212_00686 [Faecalibacterium prausnitzii M21/2] >gi|158445439|gb|EDP22442.1| hypothetical protein FAEPRAM212_00686 [Faecalibacterium prausnitzii M21/2] (470 aa)
Score = 1590, Expect = 8.2e-175, Identities = 306/467 (65%), Positives = 361/467 (77%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK 475
           G + +V GPVVDV FT + +LP + + L+V   G E  +E  Q + +  VRCI L  +EGL +   V    H +  PVG+  LGRMF+ LG+PIDGK  + + P  PIHRK P F +Q    EI ETGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+QELIHN+A EH G S+F GVGER+REG DL+ EM   GV+DKTALVFGQMNEPPGARMRVA T LTMAEYFR+  ++DVLLFIDNIFRF QAGSEVSAL+GRMPSAVGYQPTLA E+G LQERI STK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R I   GI+PA++PL STSR+L+ +IVG  HY+VA  VQ+ILQR+ ELQDIIAILG+DEL + DK+ V RAR+++ FLSQPF VAE F+G+ GKYVPL DT++SF  I+DGK DDLPE AFF VGT++EA EKA   +K   EEK
  S:     4 GTIIRVAGPVVDVQFT-AGRLPALQEALTVTAEGTERTMEVTQHVNETTVRCIMLSASEGLGKGMPVEATGHGLTAPVGEGTLGRMFDPLGRPIDGKGAVDELPHWPIHRKAPGFAEQKPATEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIHNVATEHGGYSIFTGVGERSREGCDLWGEMNASGVLDKTALVFGQMNEPPGARMRVAETGLTMAEYFREETHKDVLLFIDNIFRFVQAGSEVSALMGRMPSAVGYQPTLANELGALQERITSTKDGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLASTSRILEADIVGEEHYRVARKVQSILQRYQELQDIIAILGMDELDENDKLTVMRARKLQKFLSQPFAVAENFTGLKGKYVPLKDTVRSFAAIVDGKADDLPEWAFFNVGTLEEAREKA---EKKLAEEK 466
>gi|114567888|ref|YP_755042.1| F0F1 ATP synthase subunit beta [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317245|sp|Q0AUD3.1|ATPB_SYNWW ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|114338823|gb|ABI69671.1| Sodium-transporting two-sector ATPase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (476 aa)
Score = 1590, Expect = 8.2e-175, Identities = 299/464 (64%), Positives = 369/464 (79%)
  Q:     5 NITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK----------LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           N+TYG+V QVIG VVD+ F +  +LP + + ++++          +A  ++ LEA QL+G+D+VRC+AL PT+G++R  K  N    I++PVG+  LGR+ NVLG+P+D    +       IHRKPP+  +Q    +  ETGIKV DL+ PYA+GGKIGLFGGAGVGKTV++QELI NIA EH G SVF GVGERTREGNDL+ EM + GVIDK AL+FGQMNEPPGAR+RV LT +T+AEYFRD    DVL+FIDNIFRF QAG+EVSALLGRMPSAVGYQPTLAT+MG LQERI ST+ GSITS QA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+STSR+LDP +VG  HY  A GVQ ILQR+ ELQDIIAILG+DEL+DEDK+IV RAR+I+ FLSQPF VAE+F+G  G YVP S+T++SF ++L GKHD+L E +F+ VG I  AV KAKRL+
  S:     3 NVTYGEVTQVIGAVVDIRF-KPGELPDLMNAITIRSSEQDAGFTAVAEIDVMLEAMQLLGNDVVRCVALQPTDGISRGMKAVNTGAAIKIPVGEGCLGRILNVLGQPVDEAGPVNASDYWEIHRKPPALVEQLPATQQLETGIKVADLICPYAKGGKIGLFGGAGVGKTVIIQELIRNIAYEHGGYSVFTGVGERTREGNDLWGEMTESGVIDKCALIFGQMNEPPGARLRVGLTGMTVAEYFRDFSGLDVLIFIDNIFRFAQAGNEVSALLGRMPSAVGYQPTLATDMGYLQERITSTRKGSITSAQAVYVPADDLTDPAPATTFAHLDATTVLSRAISELGIYPAVDPLDSTSRILDPQVVGDKHYDTARGVQKILQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGSPGIYVPTSETVESFSQVLAGKHDNLSEDSFYMVGNIDTAVAKAKRLE 475
>gi|52426401|ref|YP_089538.1| F0F1 ATP synthase subunit beta [Mannheimia succiniciproducens MBEL55E] >gi|81825450|sp|Q65Q07|ATPB_MANSM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|52308453|gb|AAU38953.1| AtpD protein [Mannheimia succiniciproducens MBEL55E] (458 aa)
Score = 1589, Expect = 1.0e-174, Identities = 299/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F E++ +P++YD L V   G  L LE  Q +G  IVRCIA+G ++GL R   V+N   PI VPVG   LGR+ NVLG+P+D +  +  + +  IHR+ PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G++D +PEQAF+ VG+I+E VEKAK +
  S:     1 MSAGKIVQIIGAVIDVEFPENA-VPKVYDALKVAEGG--LTLEVQQQLGGGIVRCIAMGSSDGLKRGLSVSNTGKPISVPVGTKTLGRIMNVLGEPVDEQGPIGAEEEWAIHREAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGFSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEYDHIPEQAFYMVGSIEEVVEKAKNM 458
>gi|120556779|ref|YP_961130.1| F0F1 ATP synthase subunit beta [Marinobacter aquaeolei VT8] >gi|166201716|sp|A1U7H4.1|ATPB_MARAV ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|120326628|gb|ABM20943.1| ATP synthase F1, beta subunit [Marinobacter aquaeolei VT8] (464 aa)
Score = 1589, Expect = 1.1e-174, Identities = 301/464 (64%), Positives = 372/464 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           ++ G + Q+IG V+DV F   S +P +YD L   L G E  LE  Q +GD IVR IA+G TEGL R  K  N   PI VPVG   LGR+ +VLG+PID + ++ ++ +  IHRK P + DQ+ + ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSGLSVFAGVGERTREGND YYEM +  V+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMGQLQERI STKTGSITS+QA+YVPADDLTDP+PATTF+HLDA  VL R+IA+ GI+PAI+PL+STSR LDP ++G  HY VA GVQN+LQR+ EL+DIIAILG+DEL+++DK+IV RAR+I  FLSQPF VAE F+G  GKYV L +TI SF+ IL+G +DD+PEQAF+  G I+EA+EKAK +K+
  S:     1 MSSGHIVQIIGAVIDVEFPRDS-VPSVYDAL--LLEGGETTLEVQQQLGDGIVRTIAMGSTEGLKRGLKAENTGKPISVPVGTQTLGRIMDVLGRPIDEQGDIGEEERWAIHRKAPGYADQAASADLLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHSGLSVFAGVGERTREGNDFYYEMKESNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGQLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFSHLDATVVLSRDIASKGIYPAIDPLDSTSRQLDPLVIGEQHYNVARGVQNVLQRYKELKDIIAILGMDELSEDDKLIVSRARKIERFLSQPFHVAEVFTGSPGKYVSLKETIASFEGILNGDYDDMPEQAFYMCGGIEEAIEKAKAMKE 460
>gi|57504649|ref|ZP_00370727.1| ATP synthase F1, beta subunit [Campylobacter coli RM2228] >gi|57019418|gb|EAL56113.1| ATP synthase F1, beta subunit [Campylobacter coli RM2228] (465 aa)
Score = 1589, Expect = 1.1e-174, Identities = 304/460 (66%), Positives = 366/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QV+GPVVDV F +   LP+I + + V    E    +L LE A  +GD+ VR IA+  T+GL R  K      PI VPVG+ VLGR+FNV G  ID  EE+    +  IHR PP+F+DQS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY EM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+ QERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R+IA  GI+PA++PL+STSR+LDP I+G  HYKVA GVQ++LQ++ +LQDIIAILG+DEL++EDK+IVERAR+I  FLSQPFFVAE F+G  GKY+ L +TI  FK IL+GK+D LPE AF+ VG I EA+ KA +LK
  S:     3 GFISQVLGPVVDVDFND--YLPQINEAIVVNFESEGKKQKLVLEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEISFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLDSTSRMLDPQIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLIVERARKIEKFLSQPFFVAEVFTGSPGKYISLEETIAGFKGILEGKYDHLPENAFYMVGNIDEAIAKADKLK 464
>gi|162447836|ref|YP_001620968.1| F-type H+-transporting ATPase beta chain [Acholeplasma laidlawii PG-8A] >gi|190358283|sp|A9NGW2.1|ATPB_ACHLI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|161985943|gb|ABX81592.1| F-type H+-transporting ATPase beta chain [Acholeplasma laidlawii PG-8A] (460 aa)
Score = 1589, Expect = 1.2e-174, Identities = 302/459 (65%), Positives = 365/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEEL-FLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+  +IGPVVDV F +  +LP I D L V+L+  E   LE A  +G+ +VR I+L  T+GLAR  +V     PI+VPVGK VLGRM NVLGKP+DG +E+  K  +PIH+ PP F D     EI ETGIKVIDL+ PY +GGKIGLFGGAGVGKTVL+QE+IHN+AK H G+SVF GVGER REG++LY+EM   GV+DKTALVFGQMNEPPGAR+RVALT LT+AEYFRD + Q+VLLFIDNI+R+ QAGSE+SALLGRMPSAVGYQPTLATEMG+LQERI ST+ GSITS+QA+YVPADD TDPAPAT F+HLDA T L R +   GI+PAI+PL STSR L P++VG  HY  A  VQ +LQR+ EL DIIAILG+DEL+D+DK++V RARRI+NFLSQ   VAE+F+G  G +VP+ +TI+ FKEIL GKHDDLPE+AF  VGTI +A+ KAK+L
  S:     3 GKIVAIIGPVVDVSFMD--ELPNINDALEVRLSETETRTLEVASHLGNHMVRTISLEATDGLARGMEVIGTLSPIKVPVGKKVLGRMLNVLGKPMDGLDEVDTKRYMPIHKLPPDFHDLGGETEILETGIKVIDLIAPYIKGGKIGLFGGAGVGKTVLIQEMIHNVAKNHGGISVFTGVGERVREGHELYHEMKDSGVLDKTALVFGQMNEPPGARLRVALTGLTLAEYFRDGEKQNVLLFIDNIYRYIQAGSEISALLGRMPSAVGYQPTLATEMGKLQERITSTRYGSITSIQAVYVPADDYTDPAPATVFSHLDATTALSRKLTEDGIYPAIDPLGSTSRALTPSVVGQEHYDTAREVQRMLQRYHELLDIIAILGMDELSDDDKLVVHRARRIQNFLSQNMHVAERFTGQTGSFVPIRETIRGFKEILQGKHDDLPEEAFLLVGTIDDAIAKAKKL 460
>gi|154687796|ref|YP_001422957.1| F0F1 ATP synthase subunit beta [Bacillus amyloliquefaciens FZB42] >gi|166201690|sp|A7Z9Q0.1|ATPB_BACA2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|154353647|gb|ABS75726.1| AtpD [Bacillus amyloliquefaciens FZB42] (473 aa)
Score = 1588, Expect = 1.3e-174, Identities = 311/459 (67%), Positives = 359/459 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL-------AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QV+GPVVDV F E   LP IY+ + V          G +L LE A  +GDD VR IA+  T+G+ R  +  +   PI VPVG   LGR+FNVLG  ID  E LP   Q  PIHR  PSFD+ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDL+YEM   GVI KTA+VFGQMNEPPGARMRVALT LTMAE+FRD   QDVL FIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY VA  VQ+ LQR+ ELQDIIAILG+DEL +EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL GK+D LPE AF  VG I+E +E AK +
  S:     4 GRVSQVLGPVVDVRF-EDGHLPAIYNAIKVSQPATGENEVGIDLTLEVALHLGDDTVRTIAMASTDGIQRGMEAVDTGAPISVPVGDVTLGRVFNVLGDKIDLNEPLPADAQKDPIHRSAPSFDELSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLFYEMSDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDKQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVGEEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILSGKYDHLPEDAFRLVGRIEEVIENAKEM 469
>gi|108563495|ref|YP_627811.1| F0F1 ATP synthase subunit beta [Helicobacter pylori HPAG1] >gi|107837268|gb|ABF85137.1| ATP synthase F1, subunit beta [Helicobacter pylori HPAG1] (469 aa)
Score = 1588, Expect = 1.3e-174, Identities = 299/462 (64%), Positives = 368/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ V      IEVPVG+ VLGR+FNV+G+ ID  E L      PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY++A G+Q +LQ++ +LQDIIAILG+DEL++EDK IVERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F  IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     6 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEVNGVQKSLVLEVAAHLGGNRVRAIAMDMTEGLVRNQIVKARGKMIEVPVGEEVLGRIFNVVGESIDNLEPLKPSLTWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKIVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSIQEVLEKAKNMKNS 469
>gi|149375664|ref|ZP_01893433.1| ATP synthase F1, beta subunit [Marinobacter algicola DG893] >gi|149360066|gb|EDM48521.1| ATP synthase F1, beta subunit [Marinobacter algicola DG893] (464 aa)
Score = 1588, Expect = 1.3e-174, Identities = 304/463 (65%), Positives = 369/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G + Q+IG V+DV F   S +P +YD L   L G E  LE  Q +GD IVR IA+G TEGL R  K  N    I VPVG   LGR+ +VLG+PID + E+ ++ +  IHRK P + DQS + ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSGLSVFAGVGERTREGND YYEM    V+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG+LQERI STKTGSITS+QA+YVPADDLTDP+PATTF+HLDA  VL R+IA+ GI+PAI+PL+STSR LDP ++G  HY+VA GVQ  LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I  FLSQPF VAE F+G  GKYV L +TI SFK IL+G +DD+PEQAF+ VGTI+EAVEKAK +K
  S:     1 MSSGHIVQIIGAVIDVEFPRDS-VPNVYDAL--LLEGGETTLEVQQQLGDGIVRTIAMGSTEGLKRGLKADNTGKAISVPVGTQTLGRIMDVLGRPIDEQGEIGEEERWAIHRKAPGYADQSASADLLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHSGLSVFAGVGERTREGNDFYYEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAQEMGELQERITSTKTGSITSIQAVYVPADDLTDPSPATTFSHLDATVVLSRDIASKGIYPAIDPLDSTSRQLDPLVIGDEHYEVARGVQTNLQRYKELKDIIAILGMDELSEEDKLTVARARKIERFLSQPFHVAEVFTGSPGKYVSLKETISSFKGILNGDYDDMPEQAFYMVGTIEEAVEKAKEMK 459
>gi|89092247|ref|ZP_01165201.1| ATP synthase subunit B [Oceanospirillum sp. MED92] >gi|89083335|gb|EAR62553.1| ATP synthase subunit B [Oceanospirillum sp. MED92] (458 aa)
Score = 1588, Expect = 1.3e-174, Identities = 300/462 (64%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G + Q+IG VVDV F   S +P++YD L+V   G  L LE  Q +GD +VR IA+G TEG++R + V N   P+ VPVG   LGR+ +VLG PID   E+ ++ ++PIHRK PS+D+Q+ + E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND YYEM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITS+QA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP ++G  HY++A  VQ +LQR+ EL+DIIAILG+DEL++EDK +V RAR+I+ FLSQPFFVAE F+G  GKYVPL +TI  FK IL+G++DDLPEQAF+ VG I EA+EKAK +
  S:     1 MSSGTIVQIIGAVVDVEFPRDS-VPKVYDALTVTKNG--LTLEVQQQLGDGVVRAIAMGQTEGVSRGQDVANTGAPVSVPVGTATLGRIMDVLGNPIDECGEIGEEERMPIHRKAPSYDEQAASNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGFSVFAGVGERTREGNDFYYEMKESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFSHLDATVVLSRQIAELGIYPAVDPLDSTSRQLDPLVIGTEHYEIARNVQGVLQRYKELKDIIAILGMDELSEEDKSLVARARKIQRFLSQPFFVAEVFTGAPGKYVPLKETISGFKGILEGQYDDLPEQAFYMVGGIDEAIEKAKGM 458
>gi|148988552|ref|ZP_01819985.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP6-BS73] >gi|148992608|ref|ZP_01822276.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|148997432|ref|ZP_01825037.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP11-BS70] >gi|149011742|ref|ZP_01832938.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|168483883|ref|ZP_02708835.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|168489668|ref|ZP_02713867.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae SP195] >gi|168492577|ref|ZP_02716720.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|168493409|ref|ZP_02717552.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|182684462|ref|YP_001836209.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14] >gi|147756487|gb|EDK63528.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP11-BS70] >gi|147764173|gb|EDK71105.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|147925753|gb|EDK76828.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP6-BS73] >gi|147928625|gb|EDK79639.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|172042786|gb|EDT50832.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|182629796|gb|ACB90744.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14] >gi|183571943|gb|EDT92471.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae SP195] >gi|183573274|gb|EDT93802.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|183576634|gb|EDT97162.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC3059-06] (468 aa)
Score = 1588, Expect = 1.4e-174, Identities = 305/462 (66%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV+F    +LP I + L V    E   ++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +    +  +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEILDGK+D LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDVIAKAEKM 466
>gi|119368476|sp|Q1CSD5|ATPB_HELPH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (466 aa)
Score = 1588, Expect = 1.5e-174, Identities = 299/462 (64%), Positives = 368/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ V      IEVPVG+ VLGR+FNV+G+ ID  E L      PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY++A G+Q +LQ++ +LQDIIAILG+DEL++EDK IVERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F  IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     3 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEVNGVQKSLVLEVAAHLGGNRVRAIAMDMTEGLVRNQIVKARGKMIEVPVGEEVLGRIFNVVGESIDNLEPLKPSLTWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKIVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSIQEVLEKAKNMKNS 466
>gi|125717636|ref|YP_001034769.1| F0F1 ATP synthase subunit beta [Streptococcus sanguinis SK36] >gi|166222420|sp|A3CM14.1|ATPB_STRSV ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|125497553|gb|ABN44219.1| Proton-translocating ATPase, F1 sector, beta subunit, putative [Streptococcus sanguinis SK36] (468 aa)
Score = 1588, Expect = 1.5e-174, Identities = 305/462 (66%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F    +LP I + L V    E+   + LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID     P   +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+D++K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GKHD LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVAFAAGDKLPEINNALVVYKNDEKKSKIVLEVALELGDGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDLDAPFPADAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALSPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDDEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDKLPEDAFRGVGSIEDVLAKAEKM 466
>gi|57240728|ref|ZP_00368676.1| ATP synthase F1, beta subunit [Campylobacter lari RM2100] >gi|57018347|gb|EAL55121.1| ATP synthase F1, beta subunit [Campylobacter lari RM2100] (484 aa)
Score = 1588, Expect = 1.6e-174, Identities = 306/463 (66%), Positives = 370/463 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGEE--LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           G + QV+GPVVDV F +   LP+I + + V  +L G+E  L LE A  +GD+ VR IA+  T+GL R        +PI VPVG+ VLGR+FNV G  ID  EE+       IHR PP F++QS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY EM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+ QERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R+IA  GI+PA++PL+STSR+LDP I+G  HYKVA GVQ++LQ++ +LQDIIAILG+DEL++EDK+IVERAR+I  FLSQPFFVAE F+G  GKY+ L DTI  FK IL+GK+DDLPE AF+ VG I EA+ KA+ LK+ +
  S:     3 GFISQVLGPVVDVEFKD--YLPQINEAIVVNYELEGKECKLVLEVAAHLGDNKVRTIAMDMTDGLVRGLTAVATGNPISVPVGEKVLGRIFNVTGDLIDEGEEINFDKHWSIHRDPPPFEEQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLDSTSRMLDPQIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLIVERARKIEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDDLPENAFYMVGNIDEAIAKAETLKEVS 467
>gi|171110|gb|AAA34444.1| F1-ATPase beta-subunit precursor (511 aa)
Score = 1588, Expect = 1.6e-174, Identities = 305/461 (66%), Positives = 367/461 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GKV  VIG +VDV F E S+LP I + L +K    +L LE AQ +G++ VR IA+  TEGL R EKV +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH  PPSF +QS + EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVFAGVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDP+P+T+F HLDA +VL R I+ LGI+PA++PL+S SRLLD  +VG  HY VA  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI GK V L DT+ SFK +L+GK+D++PE AF+ VG I++ V KA++L +
  S:    44 GKVTAVIGAIVDVHF-EQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPSPSTSFAHLDASSVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVRKAEKLAR 508
>gi|92115399|ref|YP_575327.1| F0F1 ATP synthase subunit beta [Chromohalobacter salexigens DSM 3043] >gi|118573521|sp|Q1QSD0|ATPB_CHRSD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|91798489|gb|ABE60628.1| ATP synthase F1, beta subunit [Chromohalobacter salexigens DSM 3043] (458 aa)
Score = 1587, Expect = 1.8e-174, Identities = 304/460 (66%), Positives = 368/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G++ Q+IG V+DV F   + +P++YD L  K++  E  LE  Q +GD +VR IA+G TEGL R   V N    I VPVGK  LGR+ NVLG+PID   E+ +  ++PIHRK PS+ +Q+ + E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LT+AE FRD D +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R+IA LGI+PAI+PL+STSR LDP  VG  HY  A GVQ +LQR+ EL+DIIAILG+DEL+DEDK+ V RAR+I+ FLSQPFFVAE F+G  GKYV L +TI+ F+ ILDG++DDLPEQAF+ VGTI EAVEKA  +K
  S:     3 GRIVQIIGAVIDVEFPRDA-VPKVYDAL--KVSDTETILEVQQQLGDGVVRAIAMGTTEGLKRGLDVVNSGSAISVPVGKATLGRIMNVLGEPIDEAGEIGEDERMPIHRKAPSYAEQAASNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIATEHSGYSVFAGVGERTREGNDFYHEMQESNVLDKVSLVYGQMNEPPGNRLRVALTGLTIAEKFRD-DGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATVVLARSIAELGIYPAIDPLDSTSRQLDPLTVGEEHYNTARGVQGVLQRYKELKDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFFVAEVFTGAPGKYVSLKETIRGFQGILDGEYDDLPEQAFYMVGTIDEAVEKANNMK 458
>gi|18253303|gb|AAL66415.1|AF368465_5 proton-translocating ATPase beta subunit [Streptococcus pneumoniae] (468 aa)
Score = 1587, Expect = 1.8e-174, Identities = 305/462 (66%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV+F    +LP I + L V    E   ++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +    +  +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HL++ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEILDGK+D LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLNSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDVIAKAEKM 466
>gi|416679|sp|Q03234|ATPB_LACCA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|43972|emb|CAA45840.1| ATPase (beta-subunit); H(+)-transporting ATP synthase [Lactobacillus casei] (470 aa)
Score = 1587, Expect = 1.8e-174, Identities = 306/461 (66%), Positives = 367/461 (79%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELP-KKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           + GK+ QVIGPVVDV F  +  LP I + L++ +  G +L LE A  +GD ++R IA+  T+GL R   V +   PI VPVGK+ LGR+FNVLG PID  E L     +  IHR  P F+D + + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GV++ TA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAP TTF HLDA T L+R +   GI+PA++PLES+S  L P IVG  HYKVA  VQ +LQR+ ELQDII+ILG+DEL+DE+K+IV RARR++ FLSQ F VAE+F+G  G YVP+ +T++ FK+IL+GK+DD PE AF  VG I+E VEKAK++
  S:     4 STGKIAQVIGPVVDVAFPINDNLPEINNALTITRKDGSQLVLEVALELGDGVMRTIAMDSTDGLQRGMAVEDTGGPISVPVGKDTLGRVFNVLGDPIDDGEALDLNHRRDSIHRDAPKFEDLNTSSEILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVMENTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPRTTFAHLDATTNLERRLTEQGIYPAVDPLESSSSALTPEIVGEEHYKVATEVQQVLQRYRELQDIISILGMDELSDEEKVIVARARRVQFFLSQNFNVAERFTGQPGSYVPVEETVKGFKQILEGKYDDYPEDAFRSVGRIEEVVEKAKKM 466
>gi|154249022|ref|YP_001409847.1| F0F1 ATP synthase subunit beta [Fervidobacterium nodosum Rt17-B1] >gi|171769321|sp|A7HJV7.1|ATPB_FERNB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|154152958|gb|ABS60190.1| ATP synthase F1, beta subunit [Fervidobacterium nodosum Rt17-B1] (472 aa)
Score = 1587, Expect = 1.8e-174, Identities = 317/472 (67%), Positives = 385/472 (81%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATV 472
           M K++I  GK+ ++IGPVVDV F+E  +LP IYD L V     G++L LE  QLIGD+ VR +A+  T+GL R  +V N   PI+ PVG+ +LGRM NV+G+PID   EL      PIHR  PS  +Q   +EI ETG+KVIDLL P+ +GGKIG FGGAGVGKTVLV E+I NIA EH G S+FAGVGERTREGNDLY EM + GV++ T LVFGQMNEPPGAR RVALTALT+AEYFRD + +DVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADD+TDPAPATTFTHLDA  VL R +AALG++PA++PL+STS++LDPNIVG  HY+VA GVQ +LQR+ +LQDIIAILG++EL++EDK+IV+RAR+I+ FL+QP  VAE+F+G+ G YVP+ +TI+ FKEIL+G++DDLPE AF+ VGTI EAVEKAK+L +A V
  S:     1 MSKKSI--GKIVRIIGPVVDVKFSEG-ELPDIYDALVVNNPQTGKKLILEVEQLIGDNTVRTVAMDSTDGLIRGMEVENTGEPIKAPVGRGILGRMINVIGEPIDENGELKDVEYWPIHRPAPSMAEQKTEIEILETGLKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMEMIRNIAIEHKGFSMFAGVGERTREGNDLYLEMQEAGVLNNTVLVFGQMNEPPGARFRVALTALTVAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTKRGSITSVQAIYVPADDITDPAPATTFTHLDATIVLSRQLAALGLYPAVDPLDSTSKILDPNIVGKEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLIVQRARKIQRFLTQPTHVAERFTGMPGVYVPIKETIRGFKEILEGRYDDLPEAAFYMVGTIDEAVEKAKKLTQAVV 471
>gi|167626199|ref|YP_001676493.1| F0F1 ATP synthase subunit beta [Shewanella halifaxensis HAW-EB4] >gi|189081345|sp|B0TQF4.1|ATPB_SHEHH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|167356221|gb|ABZ78834.1| ATP synthase F1, beta subunit [Shewanella halifaxensis HAW-EB4] (458 aa)
Score = 1587, Expect = 2.0e-174, Identities = 305/461 (66%), Positives = 367/461 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ G V QVIG VVDV F   + +P+IYD L +K  G  L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG PID   E+ ++ +  IHR+ PS++DQS++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA++GI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+DEDK  V RAR+I  +LSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D LPEQAF+ VG+I EAVEKA +
  S:     1 MSTGTVVQVIGAVVDVEFPHDA-VPQIYDALEIKSEG--LVLEVQQQLGGGVVRTIAMGTSDGLRRGLEVVNSGSPISVPVGSATLGRIMNVLGDPIDECGEIGEQERYVIHREAPSYEDQSSSTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASMGIYPAVDPLDSTSRQLDPLVVGQEHYDVASGVQTVLQRYKELKDIIAILGMDELSDEDKTTVARARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHLPEQAFYMVGSIDEAVEKANK 457
>gi|152990964|ref|YP_001356686.1| F0F1 ATP synthase subunit beta [Nitratiruptor sp. SB155-2] >gi|166201722|sp|A6Q4C0.1|ATPB_NITSB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|151422825|dbj|BAF70329.1| F0F1-type ATP synthase, beta subunit [Nitratiruptor sp. SB155-2] (469 aa)
Score = 1587, Expect = 2.0e-174, Identities = 304/460 (66%), Positives = 368/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ QV+GPVVDV F +   LP I + L ++L  E+    L LE A  +GD+ VR IA+  T+GL R  +V      I+VPVG+ VLGR+FNV+G  ID  E L  K    IHR  P F++QS   EIFETGIKV+DLL PY +GGK GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLYYEM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFR+ QAG+E+SALLGR+PSAVGYQPTLA+EMG+LQERI STK GSITS+QA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+LDPNIVG  HYKVA GVQ +LQ++ +LQDIIAILG+DEL++EDK+ VERAR+I  FLSQPFFVAE F+G  GKYV L +TI+ FK +L+GK+DD+PE AF+ VG I EA+EKA++LK
  S:     6 GKIIQVMGPVVDVDFED--YLPAINEALEMELEVEDKKIRLVLEVAAHLGDNRVRTIAMDMTDGLVRGMEVKATGDSIKVPVGEEVLGRIFNVIGDTIDEGEPLQAKTYWSIHRSAPPFEEQSTKEEIFETGIKVVDLLAPYKKGGKTGLFGGAGVGKTVIIMELIHNVAYKHSGYSVFAGVGERTREGNDLYYEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRYAQAGAEMSALLGRIPSAVGYQPTLASEMGRLQERITSTKKGSITSIQAVYVPADDLTDPAPASVFAHLDATTVLNRRIAEKGIYPAVDPLDSTSRMLDPNIVGEEHYKVARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVERARKIERFLSQPFFVAEVFTGAPGKYVTLEETIEGFKGLLEGKYDDIPEAAFYMVGNIDEALEKAEKLK 467
>gi|1168569|sp|P42006|ATPB_BACST ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|534854|dbj|BAA07255.1| ATPase subunit beta [Geobacillus stearothermophilus] (473 aa)
Score = 1587, Expect = 2.0e-174, Identities = 311/462 (67%), Positives = 366/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           +T G+V QV+GPVVDV F E+  LP IY+ L ++           +L LE A  +GDD VR IA+  T+GL R  +V +   PI  PVG+  LGR+FNVLG+PID + ++P   +  PIHR  P F++ +  +EI ETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAG GERTREGNDLY+EM   GVI KT +VFGQMNEPPG RMRVALT LTMAEYFRD   QDVLLFIDN FRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF+HLDA T L+R +A +GI+PA++PL STSR L P IVG  HY+VA  VQ  LQR+ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE  F  VG I+E VEKAK +
  S:     1 MTRGRVIQVMGPVVDVKF-ETGHLPAIYNALKIQHQARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISRPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGFGERTREGNDLYHEMKDSGVISKTGMVFGQMNEPPGPRMRVALTGLTMAEYFRDEQGQDVLLFIDNNFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEVVEKAKAM 469
>gi|19114063|ref|NP_593151.1| F1-ATPase beta subunit (PMID 6228552) [Schizosaccharomyces pombe 972h-] >gi|114565|sp|P22068|ATPB_SCHPO ATP synthase subunit beta, mitochondrial precursor >gi|6433997|emb|CAB60704.1| F1-ATPase beta subunit (PMID 6228552) [Schizosaccharomyces pombe] (525 aa)
Score = 1586, Expect = 2.4e-174, Identities = 303/461 (65%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-----DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G + QVIG VVD  F ++  LP I + L VKL   + L LE AQ +G++ VR IA+  TEGL R   V +   PI +PVG   LGR+ NV+G+P+D +  +      PIH   PSF++QS T EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI      K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+I+ LGI+PA++PL+S SR++DP I+G  HY +A  VQ +LQ +  LQDIIAILG+DEL++ DK+ VERAR+++ FLSQPF VAE F+GI G+ V L DTI+SFKEIL+GKHD LPE AF+ VG+I +AV+KA+++ +
  S:    55 GSIKQVIGAVVDCQFEDADSLPSILNALEVKLPDNKRLVLEVAQHVGENTVRTIAMDGTEGLVRGTAVIDTGSPISIPVGPGTLGRIMNVIGEPVDERGPIKAVKYSPIHADAPSFEEQSTTPEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGYSVFTGVGERTREGNDLYREMQETGVIKLEGESKAALVFGQMNEPPGARARVALTGLTVAEYFRDIEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGAMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRMMDPRILGEEHYNLAGSVQQMLQEYKSLQDIIAILGMDELSEADKLTVERARKVQRFLSQPFAVAEVFTGIEGRLVSLKDTIRSFKEILEGKHDSLPESAFYMVGSIDDAVKKAEKIAQ 521
>gi|163762349|ref|ZP_02169414.1| methyl-accepting chemotaxis sensory transducer [Bacillus selenitireducens MLS10] >gi|160357088|gb|EDP83736.1| methyl-accepting chemotaxis sensory transducer [Bacillus selenitireducens MLS10] (473 aa)
Score = 1586, Expect = 2.5e-174, Identities = 307/460 (66%), Positives = 368/460 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV----KLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G+V QV GPV+DV F E  QLP I + + +    + +GE   +L LE A  +GDD VR +A+  T+G+ R  +  +   PI VPVG+N LGR+FNVLG+ ID +E +P+  +  PIHR+ P++DD S   EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD    DVLLFIDNIFRFTQAG EVSALLGRMPSAVGYQPTL+TEMGQLQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQ++ ELQDIIAILG+DEL++ED+  V RARRI+ FLSQ F VAE+F+G  G YV + DTI+ F+EILDGK+DD+PE AF  VG I++ VEKAK ++
  S:     5 GRVTQVTGPVIDVQF-ERGQLPEINNAVRIVHEAQSSGEVDIDLVLEVALHLGDDTVRTVAMSSTDGIVRGMECVDQGAPISVPVGENTLGRVFNVLGQEIDLQEPIPEGERRDPIHRQAPAYDDLSTNTEILETGIKVVDLLAPYVKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVITKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEKGADVLLFIDNIFRFTQAGMEVSALLGRMPSAVGYQPTLSTEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGDEHYSVAREVQETLQKYKELQDIIAILGMDELSEEDRQTVSRARRIQFFLSQNFHVAEQFTGQPGSYVQVKDTIRGFREILDGKYDDVPEDAFRLVGPIEDVVEKAKNMQ 471
>gi|156619211|gb|ABU88284.1| ATP synthase CF1 beta subunit [Chlamydomonas moewusii] (508 aa)
Score = 1586, Expect = 2.6e-174, Identities = 307/460 (66%), Positives = 367/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV---KLAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G+V Q+IGPV+D++FT+  Q+P IY+ L++      G EL +  E  QL+GD+ VR +++ PT+GL R  +V +   P+ VPVGK  LGR+FNVLG+P+D    +  +  LPIHRK P+F D    L IFETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREGNDLY EM + GVI        K ALV+GQMNEPPGARMRVALTALTMAEYFRD + QDVL FIDNIFRF QAG+EVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVPADDLTDPAPATTF HLDA TVL RN+AA GI+PA++PLESTS +L P I+G  HY+ A  V+  LQR+ ELQDIIAILG+DEL+++D+  V RAR+I  FLSQPFFVAE F+G  GKY  L+++I  F +IL G+ DDLPEQ+F+ VG I EA+ KA  LK
  S:    38 GRVIQIIGPVLDIVFTKG-QVPNIYNALTITAKNATGVELAVTCEVQQLLGDNAVRAVSMQPTDGLMRGMEVLDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGPVKVEDTLPIHRKAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLADSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLESTSTMLQPWILGDKHYQTAQNVKKTLQRYKELQDIIAILGLDELSEDDRQTVARARKIERFLSQPFFVAEVFTGSPGKYTSLAESIDGFNKILTGELDDLPEQSFYLVGNISEAIAKAATLK 508
>gi|113170421|ref|YP_717213.1| AtpB [Ostreococcus tauri] >gi|118573712|sp|Q0P3P2|ATPB_OSTTA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|112806828|emb|CAL36335.1| AtpB - contains Intron II [Ostreococcus tauri] (483 aa)
Score = 1586, Expect = 2.6e-174, Identities = 308/465 (66%), Positives = 374/465 (80%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPID--GKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELI--HNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++NI  G++ Q+IGPV+D +F+  +++P IY+ + ++   +     +   E  QL+GD++VR +++  T+GL R   V +    + VPVGKN LGR+FNVLG+P+D  G    P+   LPIHR  P+F D    L IFETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI  +NIAK H G+SVFAGVGERTREGNDLY EM +  VID       K ALV+GQMNEPPGARMRV LTALTMAEYFRD +NQDVLLF+DNIFRF QAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STKTGSITS+QA+YVPADDLTDPAPATTF HLDA TVL RN+AA GI+PA++PL+STS +L P I+G +HY  A GV+  LQR+ ELQDIIAILG+DEL++ED++ V RAR++  FLSQPFFVAE F+G  GKYV L+++IQ FK IL G+ DDLPEQAF+ VG I EAVEKA +L
  S:     7 EQNI--GRITQIIGPVIDAVFS-PNKMPNIYNSVVIEGKNDVGDTIKCVAEVQQLLGDNVVRAVSMSATDGLMRGMTVVDTGAALSVPVGKNTLGRIFNVLGEPVDELGAVSTPEG-MLPIHRAAPAFVDLDTNLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELIVNNNIAKAHGGVSVFAGVGERTREGNDLYQEMCESKVIDTANLANSKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNNQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKTGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLDSTSTMLQPWILGDDHYDTAQGVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKVERFLSQPFFVAEVFTGSPGKYVSLAESIQGFKMILGGELDDLPEQAFYLVGNIDEAVEKAAKL 483
>gi|118726890|ref|ZP_01575505.1| ATP synthase F1, beta subunit [Clostridium cellulolyticum H10] >gi|118663705|gb|EAV70351.1| ATP synthase F1, beta subunit [Clostridium cellulolyticum H10] (465 aa)
Score = 1585, Expect = 3.0e-174, Identities = 300/462 (64%), Positives = 362/462 (78%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           + G + QVIGPV+D+ F E+  LP IY+ + +      +  E  Q +G+D VRC+A+  T+GL R  K  +    I VPVGK VLGR+FNVLG+P+D    +     LPIHR+ PS ++Q  + EI ETGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI NIA EH G S+F GVGERTREGNDL+++M   GVI+KTA+VFGQMNEPPGARMRV LT LTMAEYFRD   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLAT++G LQERIAST  GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+I A+GI+PA++PLESTSR+LDP +VG  HY +A  VQ ILQR  ELQDIIAILG+DEL +EDK+ V RAR+I+ +LSQPFFV E+F+G  GKYVP+ +TI+ FKEI+DGK D++ E AF+  GTI+E  E AK ++
  S:     4 SSGVIVQVIGPVLDIRF-ENGILPDIYNAIKIPADSGTVTAEVMQHLGNDTVRCVAMSSTDGLVRGMKAEDTGDAITVPVGKEVLGRIFNVLGEPVDKAGPVEPTAYLPIHREAPSLEEQRPSTEILETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSIFTGVGERTREGNDLWHDMNDSGVIEKTAMVFGQMNEPPGARMRVGLTGLTMAEYFRDQMGQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLATDVGALQERIASTNKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRDIVAMGIYPAVDPLESTSRILDPKVVGEEHYTIARKVQEILQRNKELQDIIAILGMDELPEEDKLTVFRARKIQRYLSQPFFVGEQFTGYKGKYVPIKETIRGFKEIIDGKMDNISEAAFYMKGTIEEVYEAAKEME 464
>gi|116493065|ref|YP_804800.1| F0F1 ATP synthase subunit beta [Pediococcus pentosaceus ATCC 25745] >gi|122265471|sp|Q03EL4.1|ATPB_PEDPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116103215|gb|ABJ68358.1| F0F1-type ATP synthase, beta subunit [Pediococcus pentosaceus ATCC 25745] (469 aa)
Score = 1585, Expect = 3.1e-174, Identities = 307/463 (66%), Positives = 369/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA-GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ GKV QVIGPV+DV F    +LP I + L +K A G  L  E    +GD +VR IA+  T+GL R   V +    I+VPVGK  LGR+FNVLG  IDG +EL P   + PIHR PP +D+ + + E+ ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+EH+G+SVF GVGERTREGNDLY+EM   GV+++TA+V+GQMNEPPGARMRVALT LT+AE+FRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STS  LDP IVG  HY+VA  VQ++LQR+ ELQDII+ILG+DEL+DE+K +V RARRI+ FLSQ F VA +F+G+ G YV + DTI  FK ILDGK+DDLPE+AF  VG+I + VEKAK++ 
  S:     1 MSTGKVVQVIGPVIDVEFPLDEELPTINNALKIKKADGTVLVSEVTLELGDGVVRTIAMDGTDGLQRGLDVEDTGDSIKVPVGKETLGRVFNVLGDTIDGGKELGPDIKRDPIHRDPPDYDELNPSTEVLETGIKVIDLLAPYIRGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKGSGVLERTAMVYGQMNEPPGARMRVALTGLTIAEHFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSTALDPQIVGEEHYEVATEVQHVLQRYKELQDIISILGMDELSDEEKTVVARARRIQLFLSQDFSVAAQFTGLPGHYVKIEDTISGFKGILDGKYDDLPEEAFRLVGSIDDVVEKAKKIS 465
>gi|50424093|ref|XP_460631.1| hypothetical protein DEHA0F06798g [Debaryomyces hansenii CBS767] >gi|49656300|emb|CAG88959.1| unnamed protein product [Debaryomyces hansenii CBS767] (503 aa)
Score = 1585, Expect = 3.3e-174, Identities = 305/459 (66%), Positives = 367/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GKV  VIG VVD+ F E + LP I + L++K   ++L LE AQ +G++ VR IA+  T+GL R   V +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH  PPSF +QS + E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVFAGVGERTREGNDLY EM + GVI+     K +LVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNI+RFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD  +VG  HY VA GVQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI GK V L +T++SFKE+LDGKHD LPE AF+ VG I++A  KA++L
  S:    36 GKVRAVIGAVVDIQFDEGN-LPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTDGLVRGAPVNDTGAPISVPVGRETLGRIINVIGEPIDERGPIKTKQKNPIHADPPSFVEQSTSSEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTREGNDLYREMQETGVINLEGDSKVSLVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIYRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDIAVVGKEHYDVASGVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLQETVKSFKEVLDGKHDHLPENAFYMVGGIEDATAKAEKL 498
>gi|2197129|gb|AAB61298.1| F1F0-ATPase beta subunit [Helicobacter pylori] (469 aa)
Score = 1585, Expect = 3.3e-174, Identities = 298/462 (64%), Positives = 367/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ V      IEVPVG+ VLGR+FNV+G+ ID  E L      PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY++A G+Q +LQ++ +LQDIIAILG+DEL++EDK  VERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F  IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     6 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEVNGVQKSLVLEVAAHLGGNRVRAIAMDMTEGLVRNQAVKARGKMIEVPVGEEVLGRIFNVVGESIDNLEPLKPSLTWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKTVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSIQEVLEKAKNMKNS 469
>gi|157694077|ref|YP_001488539.1| F0F1 ATP synthase subunit beta [Bacillus pumilus SAFR-032] >gi|166990366|sp|A8FIB2.1|ATPB_BACP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157682835|gb|ABV63979.1| H(+)-transporting two-sector ATPase, F(1) beta subunit [Bacillus pumilus SAFR-032] (473 aa)
Score = 1585, Expect = 3.4e-174, Identities = 308/459 (67%), Positives = 361/459 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G++ Q++GPVVDV F E   LP IY+ + V    E       +L LE A  +GDD VR IA+  T+G+ R  +  +   PI VPVG   LGR+FNVLG  ID  E L  + Q  PIHR+ PSFD  S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLYYEM   GVI+KTA+VFGQMNEPPGARMRVALT LTMAE+FRD   QDVL FIDNI+RFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +  +GI+PA++PL STSR L P IVG  HY +A  VQ  LQR+ ELQDIIAILG+DEL+++DK++V RARR++ FLSQ F VAE+F+G  G YVPL +T++ FKEIL GK+D LPE AF  VG I+E VEKAK +
  S:     4 GRISQIMGPVVDVRF-EDGHLPEIYNAIRVSHKAESESEVDIDLTLEVALHLGDDTVRTIAMASTDGVKRGMEAVDLGKPISVPVGNVTLGRVFNVLGDNIDLDEPLGVEAQRDPIHRQAPSFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDELGQDVLFFIDNIYRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVGEEHYAIAREVQQTLQRYKELQDIIAILGMDELSEDDKLVVHRARRVQFFLSQNFHVAEQFTGQKGSYVPLKETVKGFKEILSGKYDHLPEDAFRLVGRIEEVVEKAKEM 469
>gi|85060392|ref|YP_456094.1| F0F1 ATP synthase subunit beta [Sodalis glossinidius str. 'morsitans'] >gi|118573748|sp|Q2NQ86|ATPB_SODGM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|84780912|dbj|BAE75689.1| ATP synthase beta subunit [Sodalis glossinidius str. 'morsitans'] (460 aa)
Score = 1585, Expect = 3.4e-174, Identities = 301/459 (65%), Positives = 372/459 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G V QVIG VVDV F + + +P++Y+ L V+    +L LE  Q +G  +VRCIA+G ++GL R  KVT+    IEVPVGK  LGR+ NVLG+P+D K ++ ++ +  IHR  PS+++ +++ ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ+ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK I+DG++D LPEQAF+ VG+I EAVEK K+L
  S:     4 GNVIQVIGAVVDVEFPQDA-VPKVYNALEVENGAAKLVLEVEQQLGGGVVRCIAMGSSDGLRRGLKVTDLERAIEVPVGKATLGRIMNVLGEPVDMKGDIGEEERWSIHRPAPSYEELASSQDLLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVSRARKIQRFLSQPFFVAEVFTGSPGKYVALKDTIRGFKGIMDGEYDHLPEQAFYMVGSIDEAVEKGKKL 460
>gi|169832274|ref|YP_001718256.1| ATP synthase F1, beta subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169639118|gb|ACA60624.1| ATP synthase F1, beta subunit [Candidatus Desulforudis audaxviator MP104C] (472 aa)
Score = 1585, Expect = 3.7e-174, Identities = 299/466 (64%), Positives = 371/466 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELF-------LEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           +  G+V Q+IG VVDV F    Q+P IY+ L+++    + F       LE AQ +G+++VR +A+  T+GL R  KV +   PI+VPVG+ VLGR+ +VLG PIDG  ++  +   PIHR  P+  DQS  +E  ETG+KVIDLL P+ +GGKIG+FGGAGVGKTV+V ELI+NIAK+H G+SVFAGVGERTREGN+L  EM + GV+DKT +VFGQMNEPPG R+RV LT L +AEYFRD +  DVL+FIDNIFRF QAG+EVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITSVQA+YVPADDLTDPAPA TF HLD   VL R IA LGI+PA++PL+S SR+LDPN+VG  HY+VA GVQ +LQR+ ELQDIIAILG++EL++EDK+IV RAR+++ +LSQPF VAE F+G  G+YV L D I+ F+EILDGKHD LPE AF+ VGTI+EAVEK K++ +A+
  S:     1 MNVGEVVQIIGVVVDVRFP-PGQVPEIYNALTIETDKVDAFGRKFNLTLEVAQHLGNNVVRTVAMSTTDGLVRGAKVVDTGAPIKVPVGRPVLGRLIDVLGMPIDGLGDIKAETYYPIHRPAPALVDQSTKVEQLETGLKVIDLLVPFMKGGKIGMFGGAGVGKTVIVMELINNIAKQHGGISVFAGVGERTREGNELLLEMTEAGVLDKTMMVFGQMNEPPGCRLRVGLTGLCLAEYFRDEEGADVLIFIDNIFRFAQAGTEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSITSVQAVYVPADDLTDPAPANTFAHLDGTVVLSRQIAELGIYPAVDPLDSVSRILDPNVVGQEHYQVARGVQKVLQRYKELQDIIAILGMEELSEEDKLIVARARKLQRYLSQPFHVAEAFTGTPGRYVSLKDNIRGFQEILDGKHDGLPEDAFYMVGTIEEAVEKGKKILEAS 472
>gi|83649673|ref|YP_438108.1| F0F1 ATP synthase subunit beta [Hahella chejuensis KCTC 2396] >gi|118573541|sp|Q2S6P1|ATPB_HAHCH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|83637716|gb|ABC33683.1| ATP synthase F1, beta subunit [Hahella chejuensis KCTC 2396] (459 aa)
Score = 1584, Expect = 3.7e-174, Identities = 306/463 (66%), Positives = 370/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G++ Q+IG V+DV F   + +P++YD L  K+ G    LE  Q +GD IVR IA+G TEGL R  +V N N PI VPVG   LGR+ +VLG PID K  + ++ ++PIHR  P + DQS++ ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSGLSVFAGVGERTREGND YYEM +  V+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK GSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R+IAA GI+PAI+PL+STSR LDP ++G  HY VA GVQ +LQR+ EL+DIIAILG+DEL++EDK IV RAR+I  FLSQPF VAE F+G  GKYV L DTI+ FK ILDG+ D LPEQAF+ VG I EAVEKAK+ K
  S:     1 MSSGQIVQIIGAVIDVEFPRDT-VPKVYDAL--KVEGGATTLEVQQQLGDGIVRTIAMGSTEGLRRGLQVENTNAPISVPVGTQTLGRIMDVLGNPIDEKGPIGEEERMPIHRTAPGYADQSSSRDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHSGLSVFAGVGERTREGNDFYYEMEESKVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKVGSITSVQAVYVPADDLTDPSPATTFSHLDATVVLSRDIAAKGIYPAIDPLDSTSRQLDPLVIGQEHYDVARGVQTVLQRYKELKDIIAILGMDELSEEDKQIVSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILDGEFDHLPEQAFYMVGGIDEAVEKAKKTK 459
>gi|50288781|ref|XP_446820.1| unnamed protein product [Candida glabrata] >gi|49526129|emb|CAG59751.1| unnamed protein product [Candida glabrata] (507 aa)
Score = 1584, Expect = 3.8e-174, Identities = 306/456 (67%), Positives = 360/456 (78%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAV 461
           +  GKV  VIG +VDV F E S LP I + L +K    +L LE AQ +G++ VR IA+  TEGL R EKV +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH  PPSF +QS   E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R+I+ LGI+PA++PL+S SRLLD  +VG  HY VA  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI GK V L DTI SFK +L+GK+DDLPE AF+ VG I++ V
  S:    37 LASGKVSAVIGAIVDVQF-EESNLPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVVDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKLRKPIHADPPSFAEQSTAAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRLLDAAVVGEEHYNVATKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIEGKLVRLKDTISSFKAVLEGKYDDLPENAFYMVGGIEDVV 496
>gi|15612125|ref|NP_223777.1| F0F1 ATP synthase subunit beta [Helicobacter pylori J99] >gi|9910638|sp|Q9ZK81|ATPB_HELPJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|4155651|gb|AAD06639.1| ATP synthase F1, subunit beta [Helicobacter pylori J99] (469 aa)
Score = 1584, Expect = 3.8e-174, Identities = 298/462 (64%), Positives = 367/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ V      IEVPVG+ VLGR+FNV+G+ ID  E L      PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY++A G+Q +LQ++ +LQDIIAILG+DEL++EDK  VERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F  IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     6 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEVNGTQKALVLEVAAHLGGNRVRAIAMDMTEGLVRNQAVKARGKMIEVPVGEEVLGRIFNVVGESIDNLEPLKPSLTWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEIATGIQQVLQKYKDLQDIIAILGLDELSEEDKKTVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSIQEVLEKAKNMKNS 469
>gi|55820567|ref|YP_139009.1| F0F1 ATP synthase subunit beta [Streptococcus thermophilus LMG 18311] >gi|81820501|sp|Q5M5J1|ATPB_STRT2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|55736552|gb|AAV60194.1| H+-translocating ATPase beta subunit [Streptococcus thermophilus LMG 18311] (468 aa)
Score = 1584, Expect = 3.9e-174, Identities = 304/462 (65%), Positives = 367/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV F    +LP I + L V    E+   + LE A  +G+ +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +       +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGER+REGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GK+D+LPE AF  VG I++ V KAK +
  S:     1 MSSGKIAQVVGPVVDVAFATGDKLPEINNALVVYTDEEKSRRIVLEVALELGEGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDMEAPFADDAEREPIHKKAPTFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERSREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEDKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDNLPEDAFRSVGPIEDVVAKAKAM 466
>gi|19745847|ref|NP_606983.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS8232] >gi|50913944|ref|YP_059916.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS10394] >gi|94990145|ref|YP_598245.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS10270] >gi|94994061|ref|YP_602159.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS10750] >gi|81822768|sp|Q5XCY0|ATPB_STRP6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81847967|sp|Q8P1K5|ATPB_STRP8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573763|sp|Q1JHN5|ATPB_STRPD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573764|sp|Q1J7F9|ATPB_STRPF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|19747995|gb|AAL97482.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes MGAS8232] >gi|50903018|gb|AAT86733.1| ATP synthase beta chain [Streptococcus pyogenes MGAS10394] >gi|94543653|gb|ABF33701.1| ATP synthase beta chain [Streptococcus pyogenes MGAS10270] >gi|94547569|gb|ABF37615.1| ATP synthase beta chain [Streptococcus pyogenes MGAS10750] (468 aa)
Score = 1584, Expect = 3.9e-174, Identities = 302/462 (65%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG---EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV+F    +LP I + L V       +++ LE A  +GD +VR IA+  T+GL R  +V +    I VPVGK  LGR+FNVLG+ ID +E   +   + PIH+K PSFD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G+ G YVP+++T++ FKEIL+GK+D LPE AF  VG I++ ++KA+++
  S:     1 MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDHLPEDAFRSVGPIEDVIKKAEKM 466
>gi|15645746|ref|NP_207923.1| F0F1 ATP synthase subunit beta [Helicobacter pylori 26695] >gi|2493023|sp|P55988|ATPB_HELPY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|2314283|gb|AAD08174.1| ATP synthase F1, subunit beta (atpD) [Helicobacter pylori 26695] (469 aa)
Score = 1584, Expect = 4.0e-174, Identities = 298/462 (64%), Positives = 367/462 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           GK+ QV+GPVVDV F   S LP I++ L +        + L LE A  +G + VR IA+  TEGL RN+ +      IEVPVG+ VLGR+FNV+G+ ID  E L      PIHRK PSF+ QS   E+FETGIKVIDLL PY++GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY+EM +GGV+DK AL +GQMNEPPGAR R+A T LTMAEYFRD    DVL+FIDNIFR+ Q+G+E+SALLGR+PSAVGYQPTLA EMG+LQERIASTK GSITSVQA+YVPADDLTDPAPA+ F HLDA TVL+R IA  GI+PA++PL+STSR+L P ++G  HY+VA G+Q +LQ++ +LQDIIAILG+DEL++EDK  VERAR+I  FLSQPFFVAE F+G  GKYV L +T++ F  IL+GK+D +PE AF+ VG+IQE +EKAK +K +
  S:     6 GKIIQVLGPVVDVEF--ESYLPAIFEALDINFEVNGVQKSLVLEVAAHLGGNRVRAIAMDMTEGLVRNQVIKARGKMIEVPVGEEVLGRIFNVVGESIDNLEPLKPSLTWPIHRKAPSFEQQSTKTEMFETGIKVIDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAYKHNGYSVFAGVGERTREGNDLYFEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLAGEMGKLQERIASTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSPQMIGEKHYEVATGIQQVLQKYKDLQDIIAILGLDELSEEDKKTVERARKIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFGGILEGKYDHIPENAFYMVGSIQEVLEKAKNMKNS 469
>gi|153168634|ref|ZP_01928457.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N1-017] >gi|153175781|ref|ZP_01931085.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N3-165] >gi|153180619|ref|ZP_01933662.1| ATP synthase F1, beta subunit [Listeria monocytogenes F6900] >gi|153192185|ref|ZP_01939230.1| ATP synthase F1, beta subunit [Listeria monocytogenes J2818] >gi|153204115|ref|ZP_01944965.1| ATP synthase F1, beta subunit [Listeria monocytogenes HPB2262] >gi|127764513|gb|EBA25045.1| ATP synthase F1, beta subunit [Listeria monocytogenes J2818] >gi|133726197|gb|EBA27895.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N1-017] >gi|133729206|gb|EBA30904.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N3-165] >gi|133732012|gb|EBA33710.1| ATP synthase F1, beta subunit [Listeria monocytogenes F6900] >gi|133734347|gb|EBA36045.1| ATP synthase F1, beta subunit [Listeria monocytogenes HPB2262] (479 aa)
Score = 1584, Expect = 4.7e-174, Identities = 309/467 (66%), Positives = 371/467 (79%)
  Q:     1 MKKEN-ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           M++ N ++ G+V QV+GPVVDV F E   LP IY+ L ++   +       +L LE A  +GDD+VR IA+  T+G+ R  +V +   PI VPVG   LGR+FNVLG  ID  E LP    +  IHR+ P+FD  + T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD ++QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STSR L P+IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK  V RARR++ FLSQ F VAE+F+G  G YVP+ +T++ FK++L GK+D +PE AF  VG I++ +EKAK +
  S:     1 MRRNNCMSKGQVIQVMGPVVDVKF-EGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDVLEKAKDM 475
>gi|159466892|ref|XP_001691632.1| beta subunit of mitochondrial ATP synthase [Chlamydomonas reinhardtii] >gi|584796|sp|P38482|ATPBM_CHLRE ATP synthase subunit beta, mitochondrial precursor >gi|18123|emb|CAA43808.1| H(+)-transporting ATP synthase; beta subunit of mitochondrial ATP synthase [Chlamydomonas reinhardtii] >gi|158278978|gb|EDP04740.1| beta subunit of mitochondrial ATP synthase [Chlamydomonas reinhardtii] (574 aa)
Score = 1584, Expect = 4.7e-174, Identities = 306/467 (65%), Positives = 360/467 (77%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI--------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK 475
           G V QVIGPVVDV F    +LP I   L V+     L LE AQ +GD+ VRC+A+  T+GL R +KV N   PI+VPVG+  LGR+ NV+G+P+D +  +       IHR+ P F +QS   EI  TGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+ GVI         K  LV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQA SEVSALLGR+PSAVGYQPTLAT++G LQERI +T  GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R+IA LGI+PA++PL+STSR+L+PNI+G  HY +A GVQ +LQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GKYV L DTI +F  IL GK+DDLPE AF+ VG I E VEKA +L K     K
  S:    38 GFVSQVIGPVVDVRF--DGELPSILSALEVQGHNVRLVLEVAQHMGDNTVRCVAMDSTDGLVRGQKVVNTGSPIKVPVGRGTLGRIMNVIGEPVDEQGPIECSEVWSIHREAPEFTEQSTEQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKRGESKCTLVYGQMNEPPGARARVALTGLTVAEYFRDVEGQDVLLFVDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTTKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLDSTSRMLNPNIIGAEHYNIARGVQKVLQDYKNLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGTPGKYVDLKDTISAFTGILQGKYDDLPEMAFYMVGGIHEVVEKADKLAKDVAARK 510
>gi|163726773|ref|ZP_02134280.1| ATP synthase F1, beta subunit [Desulfatibacillum alkenivorans AK-01] >gi|161399918|gb|EDQ24179.1| ATP synthase F1, beta subunit [Desulfatibacillum alkenivorans AK-01] (472 aa)
Score = 1584, Expect = 4.8e-174, Identities = 299/467 (64%), Positives = 370/467 (79%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCL-----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           ENI  GK+ QV+GPVVDV F E   LP I   L     ++    + L +E AQ +GD++VR IA+  T+GL R   V +   PI +PVG+ VLGR+ NV+G+P+DG   + ++  LPIHR  P F +Q  T+ + ETG+KVIDLL P+ RGGK+G+FGGAGVGKTV++ E++HNIA +H G+SVFAGVGERTREGNDLY+EM +GGV+ K +LV+GQM EPPGAR RVAL+ALT AEYFRD + QDVL+FIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA ++G+LQERI ST  GSIT+VQ +YVPADDLTDPAPATTF HLD   VL R I  LGI+PA++PL+S+SR+LDP  +G  HY VA  VQ +LQ++ ELQDIIAILG+DEL+DEDKI V RAR+I+ FLSQPFFVAE F+G  GKYV L DT++ FKEI+DGKHDDLPE+AF+ VG I+EA+E AK + +A
  S:     3 ENI--GKITQVMGPVVDVEF-EQGNLPNILTALLITNPTINDEADNLVVEVAQHLGDNVVRTIAMDVTDGLVRGMPVKDTGDPIMMPVGEAVLGRVLNVVGRPVDGLGPVSQEKMLPIHRLAPKFTEQDTTVRVLETGVKVIDLLVPFPRGGKMGMFGGAGVGKTVIMMEMVHNIAMQHGGISVFAGVGERTREGNDLYHEMKEGGVLPKASLVYGQMTEPPGARARVALSALTSAEYFRDQEGQDVLIFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAVDLGELQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQIVELGIYPAVDPLDSSSRILDPGYLGDEHYGVARTVQQMLQKYKELQDIIAILGMDELSDEDKITVARARKIQRFLSQPFFVAENFTGKPGKYVKLEDTVRGFKEIVDGKHDDLPERAFYMVGGIEEAIENAKAMAEA 471
>gi|1073879|pir||D64071 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - Haemophilus influenzae (strain Rd KW20) (468 aa)
Score = 1583, Expect = 5.0e-174, Identities = 300/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N N+PI+VPVG   LGR+ NVLG+PID +  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG++D +PEQAF+ VG+I E +EKAK +
  S:    12 MSAGKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGVVRCIALGTSDGLKRGLKVENTNNPIQVPVGTKTLGRIMNVLGEPIDEQGAIGEEERWAIHRSAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVTLKDTIRGFKGILDGEYDHIPEQAFYMVGSIDEVLEKAKNM 468
>gi|194033266|ref|YP_002000428.1| CF1 beta subunit of ATP synthase [Oedogonium cardiacum] >gi|156618960|gb|ABU88157.1| ATP synthase CF1 beta subunit [Oedogonium cardiacum] >gi|186968883|gb|ACC97206.1| CF1 beta subunit of ATP synthase [Oedogonium cardiacum] (482 aa)
Score = 1583, Expect = 5.0e-174, Identities = 306/461 (66%), Positives = 366/461 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G + Q+IGPVVD+IF  +  +P IY+ L +K    AG+++ +  E  QL+GD  +R +A+ PTEGL R  +V +  +P+ VPVGK+ LGR+FNVLG+P+D    +  + +LPIHR  P+F D    L IFE+GIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREGNDLY EM +  VI        K ALV+GQMNEPPGARMRV LTALTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVPADDLTDPAPATTF+HLDA TVL R +AA GI+PA++PL STS +L P IVG  HY  A  V+  LQR+ ELQDIIAILG+DEL++ED++IV RAR+I  FLSQPFFVAE F+G  GKY  L++TI  F +IL G+ D LPEQAF+ VGTI EA+ K  +L+ 
  S:    11 GSIVQIIGPVVDIIF-PTGNVPNIYNALVIKGKNTAGQDMSVTCEVQQLLGDRCIRAVAMNPTEGLMRGMEVVDTGNPLLVPVGKDTLGRIFNVLGEPVDNMGPVQTEEKLPIHRPAPAFTDLDTRLSIFESGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYMEMKESKVIVEDNLGESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGSLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFSHLDATTVLSRGLAAKGIYPAVDPLASTSTMLQPWIVGDAHYNCAQKVKETLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYCSLAETIDGFNKILSGELDSLPEQAFYLVGTIDEAITKGAKLQS 482
>gi|157964051|ref|YP_001504085.1| F0F1 ATP synthase subunit beta [Shewanella pealeana ATCC 700345] >gi|189081346|sp|A8HAG3.1|ATPB_SHEPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157849051|gb|ABV89550.1| ATP synthase F1, beta subunit [Shewanella pealeana ATCC 700345] (458 aa)
Score = 1583, Expect = 5.0e-174, Identities = 305/461 (66%), Positives = 367/461 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ G V QVIG VVDV F   + +P++YD L +K  G  L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+P+D    + ++ +  IHR+ PS++DQSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+DEDK  V RAR+I  +LSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D LPEQAF+ VG+I EAVEKA +
  S:     1 MSTGTVVQVIGAVVDVEFPHDA-VPQVYDALEIKSEG--LVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVVNSGSPITVPVGSATLGRIMNVLGEPVDEAGPIGEEDRYVIHREAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMEDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKTTVFRARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHLPEQAFYMVGSIDEAVEKANK 457
>gi|16272426|ref|NP_438639.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae Rd KW20] >gi|53733287|ref|ZP_00156312.2| COG0055: F0F1-type ATP synthase, beta subunit [Haemophilus influenzae R2866] >gi|68249081|ref|YP_248193.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 86-028NP] >gi|145628859|ref|ZP_01784659.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 22.1-21] >gi|145638605|ref|ZP_01794214.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittII] >gi|2506208|sp|P43715|ATPB_HAEIN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81336513|sp|Q4QN64|ATPB_HAEI8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|1573457|gb|AAC22137.1| ATP synthase F1, subunit beta (atpD) [Haemophilus influenzae Rd KW20] >gi|68057280|gb|AAX87533.1| ATP synthase beta chain [Haemophilus influenzae 86-028NP] >gi|144979329|gb|EDJ89015.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 22.1-21] >gi|145272200|gb|EDK12108.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittII] (457 aa)
Score = 1583, Expect = 5.6e-174, Identities = 300/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N N+PI+VPVG   LGR+ NVLG+PID +  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG++D +PEQAF+ VG+I E +EKAK +
  S:     1 MSAGKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGVVRCIALGTSDGLKRGLKVENTNNPIQVPVGTKTLGRIMNVLGEPIDEQGAIGEEERWAIHRSAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVTLKDTIRGFKGILDGEYDHIPEQAFYMVGSIDEVLEKAKNM 457
>gi|85858477|ref|YP_460679.1| F0F1 ATP synthase subunit beta [Syntrophus aciditrophicus SB] >gi|118573766|sp|Q2LR05|ATPB_SYNAS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|85721568|gb|ABC76511.1| ATP synthase beta chain [Syntrophus aciditrophicus SB] (469 aa)
Score = 1583, Expect = 6.1e-174, Identities = 297/464 (64%), Positives = 373/464 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEE--LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           +  G++ QVIGPV+DV+F E  QLP I + +++    +  EE  L +E AQ +GD+ VRCIA+  T+GL R     +   PI VPVGK  LGR+ NV+GKP+DG   +  K  +PIHR+ PSF +Q  ++ + ETG+KVIDLL P+ RGGK+GLFGGAG GKTV++ E+IHNIA  H G+SVFAGVGERTREGNDLY EM++ GVI + AL++GQM EPPGAR RV+LTAL  AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT++G+LQERI ST  GSIT+VQ +YVPADDLTDPAPATTF HLD   VL R IA LGI+PA++PL+STSR+LDP ++G  HYKVA  VQ  LQ++ +LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPFFVA +F+G+ GK+V + DT++ FKEIL+GK+DDLPEQAF+ VG I+EAVEKAK+ ++
  S:     1 MNIGRIVQVIGPVIDVVF-EEGQLPAILNAITITNPVINDEEDNLIVEVAQHLGDNNVRCIAMDVTDGLVRGMPAKDTGAPITVPVGKECLGRILNVVGKPVDGLGPIEAKNTMPIHREAPSFLEQDTSVHVLETGVKVIDLLVPFPRGGKMGLFGGAGCGKTVVMMEMIHNIAMHHGGISVFAGVGERTREGNDLYREMLESGVIKQAALIYGQMTEPPGARARVSLTALAAAEYFRDVEGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDLGELQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRPIAELGIYPAVDPLDSTSRILDPIVLGEEHYKVARAVQVTLQKYKDLQDIIAILGMDELSEEDKLTVNRARKIQRFLSQPFFVAAQFTGVDGKFVSVPDTVRGFKEILEGKYDDLPEQAFYMVGGIEEAVEKAKKYQE 468
>gi|154148258|ref|YP_001406268.1| F0F1 ATP synthase subunit beta [Campylobacter hominis ATCC BAA-381] >gi|190358270|sp|A7I177.1|ATPB_CAMHC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|153804267|gb|ABS51274.1| ATP synthase F1, beta subunit [Campylobacter hominis ATCC BAA-381] (465 aa)
Score = 1582, Expect = 6.6e-174, Identities = 303/460 (65%), Positives = 367/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QV+GPVVDV F +   LP+I + + VK   E     L LE A  +GD+ VR IA+  ++GL R  +      PI VPVGK VLGR+FNV G  ID  E    + +  IHR PPSF+DQS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +H+G SVFAGVGERTREGNDLY EM + GV+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+LQERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R+IA  GI+PA++PL STSR+LDP IVG  HYK+A GVQ +LQ++ +LQDIIAILG+DEL++EDK++VERAR+I  +LSQPFFVAE F+G  GKY+ L DTI  FK IL+GK+DDLPE AF+ VG+I E + KA+++K
  S:     3 GIISQVMGPVVDVDFKD--YLPKINEAIEVKYDVEGIQKRLVLEVAAHLGDNKVRTIAMDMSDGLRRGLEAEALGAPISVPVGKKVLGRIFNVTGDLIDEGEPEDFETRWSIHRDPPSFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHNGYSVFAGVGERTREGNDLYNEMKESGVLDKVALTYGQMNEPPGARNRIALTGLTMAEYFRDELGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLNSTSRMLDPQIVGEEHYKIARGVQAVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKYLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDDLPENAFYMVGSIDEVLAKAEKMK 464
>gi|55822457|ref|YP_140898.1| F0F1 ATP synthase subunit beta [Streptococcus thermophilus CNRZ1066] >gi|116627376|ref|YP_819995.1| F0F1 ATP synthase subunit beta [Streptococcus thermophilus LMD-9] >gi|122268023|sp|Q03LX3.1|ATPB_STRTD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81820338|sp|Q5M104|ATPB_STRT1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|20070093|gb|AAM01190.1| H+-ATPase cytoplasmic F1-part beta-subunit [Streptococcus thermophilus] >gi|55738442|gb|AAV62083.1| proton-translocating ATPase, beta subunit [Streptococcus thermophilus CNRZ1066] >gi|116100653|gb|ABJ65799.1| F0F1-type ATP synthase, beta subunit [Streptococcus thermophilus LMD-9] (468 aa)
Score = 1582, Expect = 6.6e-174, Identities = 304/462 (65%), Positives = 367/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QV+GPVVDV F    +LP I + L V    E+   + LE A  +G+ +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +       +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGER+REGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  +GI+PA++PL S+SR L P IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GK+D+LPE AF  VG I++ V KAK +
  S:     1 MSSGKIAQVVGPVVDVAFATGDKLPEINNALVVYTDEEKSRRIVLEVALELGEGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDMEAPFADDAEREPIHKKAPTFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERSREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEDKTLVGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDNLPEDAFRSVGPIEDVVAKAKAM 466
>gi|116873893|ref|YP_850674.1| F0F1 ATP synthase subunit beta [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466611|sp|A0ALL3.1|ATPB2_LISW6 ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|116742771|emb|CAK21895.1| atpD [Listeria welshimeri serovar 6b str. SLCC5334] (473 aa)
Score = 1582, Expect = 6.7e-174, Identities = 308/462 (66%), Positives = 367/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G+V QV+GPVVDV F E   LP IY+ L ++   +       +L LE A  +GDD+VR IA+  T+G+ R  +V +   PI VPVG   LGR+FNVLG  ID  E LP    +  IHR+ P+FD  + T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD ++QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STSR L P+IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK  V RARR++ FLSQ F VAE+F+G  G YVP+ +T++ FK++L GK+D +PE AF  VG I+E +EKAK +
  S:     1 MSKGQVIQVMGPVVDVKF-EGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEEVLEKAKDM 469
>gi|4100657|gb|AAD00918.1| proton-translocating ATPase beta subunit [Streptococcus sanguinis] (468 aa)
Score = 1582, Expect = 7.3e-174, Identities = 304/462 (65%), Positives = 367/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F    +LP I + L V    E+   + LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID         +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+D++K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GKHD LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVAFASGDKLPEINNALVVYKNDEKKSKIVLEVALELGDGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDLDAPFADDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALSPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDDEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDKLPEDAFRGVGSIEDVLAKAEKM 466
>gi|190345407|gb|EDK37286.2| ATP synthase beta chain, mitochondrial precursor [Pichia guilliermondii ATCC 6260] (489 aa)
Score = 1582, Expect = 8.1e-174, Identities = 304/454 (66%), Positives = 363/454 (79%)
  Q:    14 VIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           VIG VVDV + E   LP I++ L++K   + L LE AQ +G++ VR IA+  TEGL R   VT+   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH +PPSF +QS + E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD ++VG  HY VA  VQ  LQ +  LQDIIAILG+DEL++ DK+ VERAR+I  FLSQPF VAE F+GI+GK V L DTI+SFKE+L+GK+D LPE AF+ VG I++ V KA++L
  S:    28 VIGAVVDVHY-EDGNLPAIFNALTLKNGDQNLVLEVAQHLGENTVRTIAMDGTEGLVRGASVTDTGAPISVPVGRGTLGRIINVIGEPIDERGPIESKQKKPIHAEPPSFVEQSTSAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASVVGEEHYSVASNVQQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIERFLSQPFAVAEVFTGISGKLVRLEDTIRSFKEVLEGKYDHLPENAFYMVGGIEDVVAKAEKL 485
>gi|146419503|ref|XP_001485713.1| ATP synthase beta chain, mitochondrial precursor [Pichia guilliermondii ATCC 6260] (489 aa)
Score = 1581, Expect = 9.0e-174, Identities = 304/454 (66%), Positives = 363/454 (79%)
  Q:    14 VIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           VIG VVDV + E   LP I++ L++K   + L LE AQ +G++ VR IA+  TEGL R   VT+   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH +PPSF +QS + E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD ++VG  HY VA  VQ  LQ +  LQDIIAILG+DEL++ DK+ VERAR+I  FLSQPF VAE F+GI+GK V L DTI+SFKE+L+GK+D LPE AF+ VG I++ V KA++L
  S:    28 VIGAVVDVHY-EDGNLPAIFNALTLKNGDQNLVLEVAQHLGENTVRTIAMDGTEGLVRGASVTDTGAPISVPVGRGTLGRIINVIGEPIDERGPIESKQKKPIHAEPPSFVEQSTSAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASVVGEEHYSVASNVQQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIERFLSQPFAVAEVFTGISGKLVRLEDTIRSFKEVLEGKYDHLPENAFYMVGGIEDVVAKAEKL 485
>gi|127514770|ref|YP_001095967.1| F0F1 ATP synthase subunit beta [Shewanella loihica PV-4] >gi|190358704|sp|A3QJR0.1|ATPB_SHELP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|126640065|gb|ABO25708.1| ATP synthase F1, beta subunit [Shewanella loihica PV-4] (458 aa)
Score = 1581, Expect = 9.1e-174, Identities = 301/461 (65%), Positives = 367/461 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ G V QVIG VVDV F   + +P++YD L +K  G  L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+P+D    + +  +  IHR+ PS++DQSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM + GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQN+LQR+ EL+DIIAILG+DEL+DEDK  V RAR+I  +LSQPFFVAE F+G  GKYV L DTI+ FK +L+G+ D +PEQAF+  G+I E +E+A +
  S:     1 MSTGTVVQVIGAVVDVEFPHDA-VPQVYDALEIKSEG--LVLEVQQQLGGGVVRTIAMGSSDGLRRGIEVVNTGSPITVPVGSATLGRIMNVLGQPVDEAGPIGEDERYVIHREAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMEESGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVASGVQNVLQRYKELKDIIAILGMDELSDEDKTTVARARKIEKYLSQPFFVAEVFTGSPGKYVALKDTIRGFKGLLEGEFDHIPEQAFYMAGSIDEVIERANK 457
>gi|148260678|ref|YP_001234805.1| F0F1 ATP synthase subunit beta [Acidiphilium cryptum JF-5] >gi|190358247|sp|A5FZ54.1|ATPB_ACICJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|146402359|gb|ABQ30886.1| ATP synthase F1, beta subunit [Acidiphilium cryptum JF-5] (476 aa)
Score = 1581, Expect = 9.3e-174, Identities = 304/465 (65%), Positives = 368/465 (79%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +N+T G++ Q++GPVVDV F    +LP I + L  ++    L LE AQ IG+  VRCIA+  T+GLAR ++V +    I VPVG   LGR+ NV+G+PID +  +P     PIHR+ PSFD+Q+ + EI  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIAK H G+SVFAGVGERTREGNDLY+EMI  GVI          K ALV+GQMNEPPGARMRV L+ LTMAEYFRD + QDVL F+DNIFRFTQAG+EVSALLGR+PSAVGYQPTLAT+MG LQERI STK GSITSVQAIYVPADDLTDPAPAT+F+HLDA T L+R IA  GI+PA++PL+STSR LDP IVG  HY VA  VQ ILQ +  LQDIIAILG+DEL+++DK+ V RAR+I  FLSQPF VAE F+G  G +VP+ DT++SFK I  G++D LPE AF+ VGTI++AV+KA+ L 
  S:     3 KNVT-GRITQIMGPVVDVQF--EGELPYILNALETRVGDRRLVLEVAQEIGERTVRCIAMDSTDGLARGDEVRDTGEAIAVPVGPETLGRILNVIGEPIDERGPIPTTRTAPIHRQAPSFDEQATSAEILVTGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKGHGGVSVFAGVGERTREGNDLYHEMIDAGVIKLGEGTTEGSKVALVYGQMNEPPGARMRVGLSGLTMAEYFRDEEGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATDMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATSFSHLDATTTLNRAIAEKGIYPAVDPLDSTSRALDPRIVGEEHYNVAREVQRILQSYKSLQDIIAILGMDELSEDDKLTVARARKIERFLSQPFHVAEVFTGSPGIFVPVEDTVRSFKAICAGEYDHLPEAAFYMVGTIEDAVKKAESLN 473
>gi|194397468|ref|YP_002038137.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae G54] >gi|194357135|gb|ACF55583.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae G54] (468 aa)
Score = 1581, Expect = 1.0e-173, Identities = 304/462 (65%), Positives = 369/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV+F    +LP I + L V    E   ++ LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID +    +  +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ   VAE+F+G  G YVP+++T++ FKEILDGK+D LPE AF  VG+I++ + KA+++
  S:     1 MSSGKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNXNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDVIAKAEKM 466
>gi|28378938|ref|NP_785830.1| F0F1 ATP synthase subunit beta [Lactobacillus plantarum WCFS1] >gi|81840957|sp|Q88UU3|ATPB_LACPL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|28271775|emb|CAD64681.1| H(+)-transporting two-sector ATPase, beta subunit [Lactobacillus plantarum WCFS1] (467 aa)
Score = 1580, Expect = 1.2e-173, Identities = 305/462 (66%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEEL-PKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV QVIGPVVDV F+ + +LP I + L ++   ++ L +E +  +GD +VR +A+  T+GL R   V +    I VPVGK  LGR+FNVLG+ IDG  E  P   + PIHR  P +D+ + + E+ ETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELIHNIA+EH+G+SVF GVGERTREGNDLY+EM   GV+  TA+V+GQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GS+TS+QA+YVPADD TDPAPATTF HLDA T L+R++   GI+PA++PL S+S  LDP+IVG  HY+VA  VQ +LQR+ ELQDII+ILG+DEL+DE+K  V RARRI+ FLSQ FFVAE F+G  G YVP++DTI+ FKEIL+GK+DDLPE AF  VG I + VEKAK +
  S:     1 MSTGKVVQVIGPVVDVEFSLNDKLPDINNALIIQKDNDDTLTVEVSLELGDGVVRTVAMDGTDGLRRGMTVEDTGSSITVPVGKETLGRVFNVLGETIDGGPEFGPDAERNPIHRDAPKYDELTTSTEVLETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLKNTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTEQGIYPAVDPLASSSIALDPSIVGEEHYQVATEVQRVLQRYRELQDIISILGMDELSDEEKTTVARARRIQFFLSQNFFVAENFTGQPGSYVPINDTIKGFKEILEGKYDDLPEDAFRQVGKIDDVVEKAKSM 464
>gi|71018215|ref|XP_759338.1| hypothetical protein UM03191.1 [Ustilago maydis 521] >gi|46099188|gb|EAK84421.1| hypothetical protein UM03191.1 [Ustilago maydis 521] (523 aa)
Score = 1580, Expect = 1.3e-173, Identities = 303/463 (65%), Positives = 365/463 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           G V  VIGPVVDV F ++  LP I++ L V+    G  L LE AQ +G++ VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+P+D +  +      PIH +PP+F DQS   E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTVL+QELI+N+AK H G SVF GVGERTREGNDLY+EMI+ GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSE SALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+S SR+LDP +VG  HY +A GVQ +LQ +  LQDIIAILG+DEL++EDK+ VERAR+I+ F+SQPF VA+ F+GI GK V L DTI + KEIL G HD LPE AF+  G I +  +KA+ + ++T
  S:    55 GAVKAVIGPVVDVQF-DTEDLPSIFNALEVQNVTGGGRLVLEVAQHLGENTVRAIAMEGTEGLVRGQKVVDTGLPIQIPVGPGTLGRIMNVIGEPMDERGPIKGNKLAPIHVEPPAFVDQSTKAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNVAKAHGGYSVFTGVGERTREGNDLYHEMIETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSETSALLGRIPSAVGYQPTLATDMGVMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSKSRMLDPAVVGREHYDIATGVQKLLQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFAVAQVFTGIEGKLVSLKDTISACKEILRGDHDALPESAFYMCGGIDDVKKKAEEIARST 523
>gi|16801734|ref|NP_472002.1| F0F1 ATP synthase subunit beta [Listeria innocua Clip11262] >gi|81853853|sp|Q927W4.1|ATPB2_LISIN ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|16415209|emb|CAC97899.1| atpD [Listeria innocua] (473 aa)
Score = 1580, Expect = 1.3e-173, Identities = 307/462 (66%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G+V QV+GPVVDV F E   LP IY+ L ++   +       +L LE A  +GDD+VR IA+  T+G+ R  +V +   PI VPVG   LGR+FNVLG  ID  E LP    +  IHR+ P+FD  + T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD ++QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STSR L P+IVG  HY+VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK  V RARR++ FLSQ F VAE+F+G  G YVP+ +T++ FK++L GK+D +PE AF  VG I++ +EKAK +
  S:     1 MSKGQVIQVMGPVVDVKF-EGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYEVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDVLEKAKDM 469
>gi|157151073|ref|YP_001450821.1| F0F1 ATP synthase subunit beta [Streptococcus gordonii str. Challis substr. CH1] >gi|189081352|sp|A8AYG1.1|ATPB_STRGC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157075867|gb|ABV10550.1| ATP synthase F1, beta subunit [Streptococcus gordonii str. Challis substr. CH1] (468 aa)
Score = 1579, Expect = 1.4e-173, Identities = 305/462 (66%), Positives = 367/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE---LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F    +LP I + L V    E+   + LE A  +GD +VR IA+  T+GL R  +V +   PI VPVGK  LGR+FNVLG  ID         +  PIH+K P+FD+ S + EI ETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLD+ T L+R +  LGI+PA++PL S+SR L P IVG  HY VA  V+ +LQR+ ELQDIIAILG+DEL+DE+K +V RARRI+ FLSQ F VAE+F+G  G YVP+++T++ FKEIL+GKHD LPE AF  VG+I++ + KA+++
  S:     1 MSSGKITQVIGPVVDVAFAAGDRLPEINNALVVYKNDEKKSKIVLEVALELGDGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDLDAPFGDDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDKLPEDAFRGVGSIEDVLAKAEKM 466
>gi|94986847|ref|YP_594780.1| F0F1 ATP synthase subunit beta [Lawsonia intracellularis PHE/MN1-00] >gi|118573693|sp|Q1MRB8|ATPB_LAWIP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|94731096|emb|CAJ54458.1| proton ATPase beta subunit [Lawsonia intracellularis PHE/MN1-00] (471 aa)
Score = 1579, Expect = 1.5e-173, Identities = 308/468 (65%), Positives = 369/468 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV----KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
            ENI  GK+ QVIG VVDV F  + +LP I   L +     +   +L  E AQ +GDDIVR IA+  TEGL R   V +  HPI  PVGK  LGR+ NV+G+PIDG   +  K  LPIHRKPPSF DQ+ ++E  ETGIKVIDLL P+ +GGK+GLFGGAGVGKTV++ E+I+NIA++H G+SVFAGVGERTREGNDLY+EM + GV++K  LV+GQMNEPPGAR RVALTALT AEYFRD ++QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++G L+ERI ST  GSITSVQA+YVPADDLTDPAPATTF+HLD   VL R IA LGI+PA++PL+STSR+L+PN VG  HY VA GVQ ILQ++ ELQDIIAILG+DEL+DEDK++V RARRI+ FLSQPF VAE F+G AG+YV L DTI+ FK IL G++D L E  F+ VG I  AV K ++ K++
  S:     2 SENI--GKIVQVIGAVVDVSFP-NGKLPPILTALEIHNPNSIDAPKLICEVAQHLGDDIVRTIAMDATEGLKRGMDVLDTGHPIMAPVGKASLGRIMNVVGQPIDGLGVIDTKTYLPIHRKPPSFLDQNTSVEPLETGIKVIDLLVPFPKGGKMGLFGGAGVGKTVILMEMINNIARQHGGISVFAGVGERTREGNDLYHEMKEAGVLEKAILVYGQMNEPPGARSRVALTALTCAEYFRDEEHQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLGTDLGSLEERITSTHNGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELGIYPAVDPLDSTSRILEPNFVGEEHYTVARGVQKILQKYKELQDIIAILGMDELSDEDKLVVSRARRIQRFLSQPFHVAETFTGTAGEYVKLEDTIKGFKGILAGEYDHLSESDFYMVGNIDSAVAKYEKRKES 470
>gi|17232531|ref|NP_489079.1| F0F1 ATP synthase subunit beta [Nostoc sp. PCC 7120] >gi|20141199|sp|P06540|ATPB_ANASP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|17134177|dbj|BAB76738.1| ATP synthase beta subunit [Nostoc sp. PCC 7120] (482 aa)
Score = 1579, Expect = 1.5e-173, Identities = 306/467 (65%), Positives = 373/467 (79%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +K NI Y  + Q+IGPVVDV F  + +LP+IY+ L++K    AG++L L  E  QL+GD+ +R +A+  T+GL R  +V +   PI VPVGK  LGR+FNVLG+P+D +  +  +  LPIHR  P   +      +FETGIKV+DLLTPY RGGKIGLFGGAGVGKTV++ ELI+NIA +H G+SVFAGVGERTREGNDLY EMI+ GVI+       K ALV+GQMNEPPGARMRV L+ LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++GQLQERI ST  GSITS+QA+YVPADDLTDPAPATTF HLD  TVL R +A+ GI+PA++PL STS +L PNIVG  HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED++IV RAR++  FLSQPFFVAE F+G  GKYV L DTI+ F++IL G+ DDLPEQAF+ VG I EA+ KA+++K
  S:     6 EKTNIGY--ITQIIGPVVDVKF-PNGKLPQIYNALTIKGTNEAGQQLNLTVEVQQLLGDNQIRAVAMSSTDGLVRGLEVVDTGAPISVPVGKATLGRIFNVLGEPVDNRGPVNNQETLPIHRPAPKLTELETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVINNENLNESKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDINEAIAKAEKIK 481
>gi|16804567|ref|NP_466052.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes EGD-e] >gi|46908701|ref|YP_015090.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes str. 4b F2365] >gi|47094108|ref|ZP_00231832.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|47096952|ref|ZP_00234528.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153184895|ref|ZP_01935543.1| ATP synthase F1, beta subunit [Listeria monocytogenes J0161] >gi|153197165|ref|ZP_01941435.1| ATP synthase F1, beta subunit [Listeria monocytogenes 10403S] >gi|167015617|ref|ZP_02278150.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J1-194] >gi|167215202|ref|ZP_02285509.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL R2-503] >gi|167218318|ref|ZP_02287954.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J1-175] >gi|167405356|ref|ZP_02310113.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J2-003] >gi|167454996|ref|ZP_02321219.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J2-064] >gi|168266761|ref|ZP_02688726.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J2-071] >gi|81830121|sp|Q71WP9.1|ATPB2_LISMF ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|81849742|sp|Q8Y4C1.1|ATPB2_LISMO ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|16412017|emb|CAD00607.1| atpD [Listeria monocytogenes] >gi|46881973|gb|AAT05267.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 4b F2365] >gi|47014662|gb|EAL05619.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|47017515|gb|EAL08324.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|126942407|gb|EBA20146.1| ATP synthase F1, beta subunit [Listeria monocytogenes J0161] >gi|127633216|gb|EBA22633.1| ATP synthase F1, beta subunit [Listeria monocytogenes 10403S] (473 aa)
Score = 1579, Expect = 1.7e-173, Identities = 307/462 (66%), Positives = 367/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKK-PQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G+V QV+GPVVDV F E   LP IY+ L ++   +       +L LE A  +GDD+VR IA+  T+G+ R  +V +   PI VPVG   LGR+FNVLG  ID  E LP    +  IHR+ P+FD  + T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVFAGVGERTREGNDLY+EM   GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD ++QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R +   GI+PA++PL STSR L P+IVG  HY VA  VQ +LQR+ ELQDIIAILG+DEL+DEDK  V RARR++ FLSQ F VAE+F+G  G YVP+ +T++ FK++L GK+D +PE AF  VG I++ +EKAK +
  S:     1 MSKGQVIQVMGPVVDVKF-EGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDVLEKAKDM 469
>gi|152998457|ref|YP_001343292.1| F0F1 ATP synthase subunit beta [Marinomonas sp. MWYL1] >gi|190358234|sp|A6W3S8.1|ATPB2_MARMS ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|150839381|gb|ABR73357.1| ATP synthase F1, beta subunit [Marinomonas sp. MWYL1] (458 aa)
Score = 1578, Expect = 1.9e-173, Identities = 302/462 (65%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G + QVIG V+DV F   S +P++YD L+++  G++L LE  Q +GD IVR IA+G T+G+ R   V N N P+ VPVG   LGR+ +VLG PID K  + ++ +  IHR  PS+ +QS++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R+IA+LGI+PAI+PL+STSR LDP ++G  HY VA GVQ +LQR+ EL+DIIAILG+DEL++EDK  V R+R+I+ FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG+ DDLPEQAF+ +G+I EAVEKAK+L
  S:     1 MSSGHIVQVIGAVMDVEFPRDS-VPKVYDALTIE--GKQLVLEVQQQLGDGIVRTIAMGSTDGIKRGLVVENTNKPVSVPVGTKTLGRIMDVLGNPIDEKGPIGEEERWSIHRSAPSYAEQSSSNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATVVLSRDIASLGIYPAIDPLDSTSRQLDPLVIGQEHYDVARGVQMVLQRYKELKDIIAILGMDELSEEDKQTVNRSRKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEFDDLPEQAFYMIGSIDEAVEKAKKL 458
>gi|53733035|ref|ZP_00155478.2| COG0055: F0F1-type ATP synthase, beta subunit [Haemophilus influenzae R2846] >gi|145630340|ref|ZP_01786121.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 22.4-21] >gi|145632746|ref|ZP_01788480.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 3655] >gi|145634523|ref|ZP_01790232.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittAA] >gi|145636253|ref|ZP_01791922.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittHH] >gi|145640453|ref|ZP_01796037.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae R3021] >gi|148825242|ref|YP_001289995.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittEE] >gi|166201709|sp|A5UA11.1|ATPB_HAEIE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|144984075|gb|EDJ91512.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae R3021] >gi|144986941|gb|EDJ93493.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 3655] >gi|145268068|gb|EDK08063.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittAA] >gi|145270418|gb|EDK10352.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittHH] >gi|145275039|gb|EDK14901.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae 22.4-21] >gi|148715402|gb|ABQ97612.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittEE] (457 aa)
Score = 1578, Expect = 2.0e-173, Identities = 299/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N N+PI+VPVG   LGR+ NVLG+PID +  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G++D +PEQAF+ VG+I E +EKAK +
  S:     1 MSAGKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGVVRCIALGTSDGLKRGLKVENTNNPIQVPVGTKTLGRIMNVLGEPIDEQGAIGEEERWAIHRSAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVTLKDTIRGFKGILEGEYDHIPEQAFYMVGSIDEVLEKAKNM 457
>gi|91204911|ref|YP_537266.1| F0F1 ATP synthase subunit beta [Rickettsia bellii RML369-C] >gi|118573738|sp|Q1RKD7|ATPB_RICBR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|91068455|gb|ABE04177.1| ATP synthase beta chain [Rickettsia bellii RML369-C] (473 aa)
Score = 1578, Expect = 2.3e-173, Identities = 308/466 (66%), Positives = 366/466 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRD-HDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           K+NI  GK+ Q+I  VVDV FT   +LP+I + L      + + LE AQ IGDD VRCIA+  TEGL R  +V +   PI +PVG   LGR+ NV+G+PIDGK ++       I++  PSF  QS    I  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+AK H G +VFAGVGERTREGNDLY+EMI  GVI+       K ALV+GQMNEPPGAR RVALT LT+AE FRD ++ QDVL F+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADDLTDPAPAT+F HLDA TVL R IA LGI+PA++PL+STS++LDP IVG  HY VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK+V L+DTI  FK + +GK+DDLPE AF+ VGTI+EA+EKAK LK
  S:     2 KKNI--GKITQIISAVVDVKFTNKGKLPQILNALECYNDKQRIVLEIAQHIGDDTVRCIAMNSTEGLVRGMEVVDTGSPISIPVGIETLGRIMNVVGEPIDGKGKIKGSSISSIYKSAPSFTQQSTDRNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLEEPEKSKVALVYGQMNEPPGARARVALTGLTVAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSTSQVLDPMIVGEEHYNVARKVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLTEGKYDDLPEAAFYMVGTIEEALEKAKTLK 473
>gi|57505327|ref|ZP_00371256.1| ATP synthase F1, beta subunit [Campylobacter upsaliensis RM3195] >gi|57016463|gb|EAL53248.1| ATP synthase F1, beta subunit [Campylobacter upsaliensis RM3195] (484 aa)
Score = 1577, Expect = 2.7e-173, Identities = 300/463 (64%), Positives = 367/463 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG----EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           G + QV+GPVVDV F +   LP+I + + V        ++L LE A  +GD+ VR IA+  T+GL R  K      PI VPVG+ VLGR+FNV G  ID  EE+    +  IHR P +F+DQS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY EM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+ QERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R IA  GI+PA++PL+STSR+LDP I+G  HYKVA GVQ++LQ++ +LQDIIAILG+DEL++EDK++VERAR+I  FLSQPFFVAE F+G  GKY+ L +TI  FK IL+GK+D+LPE AF+ VG I EA+ KA+ L++ +
  S:     3 GFISQVLGPVVDVDFDD--YLPQINEAIRVDFNNDGKEQKLILEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGSPISVPVGEKVLGRIFNVTGDLIDEGEEISFDKRWSIHRDPSAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPQIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKFLSQPFFVAEVFTGSPGKYISLEETISGFKSILEGKYDNLPENAFYMVGNIDEAIAKAETLREIS 467
>gi|87121037|ref|ZP_01076928.1| ATP synthase subunit B [Marinomonas sp. MED121] >gi|86163529|gb|EAQ64803.1| ATP synthase subunit B [Marinomonas sp. MED121] (458 aa)
Score = 1577, Expect = 2.8e-173, Identities = 298/462 (64%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G++ Q+IG V+DV F   S +P++YD L+++  G+EL LE  Q +GD IVR IA+G TEG+ R   V N N+P+ VPVG   LGR+ +VLG PID K  + ++ +  IHR+ PS+ +QS+   + ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    VIDK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITS+QA+YVPADDLTDP+PATTF+HLDA  VL R+IA+LGI+PAI+PL+STSR LDP ++G  HY VA GVQ +LQR+ EL+DIIAILG+DEL++EDK+ V R+R+I+ F+SQPFFVAE F+G  GKYV L DTI+ FK ILDG+ D+LPEQAF+ +G+I EAVEKAK++
  S:     1 MSSGQIVQIIGAVIDVEFPRDS-VPKVYDALTIE--GKELVLEVQQQLGDGIVRAIAMGSTEGMKRGLVVDNTNNPVSVPVGTKTLGRIMDVLGNPIDEKGPIGEEERWAIHREAPSYAEQSSDNALLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFSHLDATVVLSRDIASLGIYPAIDPLDSTSRQLDPLVIGQEHYDVARGVQTVLQRYKELKDIIAILGMDELSEEDKLSVNRSRKIQRFMSQPFFVAEVFTGAPGKYVSLKDTIRGFKGILDGEFDELPEQAFYMIGSIDEAVEKAKKI 458
>gi|148827675|ref|YP_001292428.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittGG] >gi|166201710|sp|A5UGY9.1|ATPB_HAEIG ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|148718917|gb|ABR00045.1| F0F1 ATP synthase subunit beta [Haemophilus influenzae PittGG] (457 aa)
Score = 1576, Expect = 3.2e-173, Identities = 299/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N N+PI+VPVG   LGR+ NVLG+PID +  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL++EDK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G++D +PEQAF+ VG+I E +EKAK +
  S:     1 MSAGKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGVVRCIALGTSDGLKRGLKVENTNNPIQVPVGTKTLGRIVNVLGEPIDEQGAIGEEERWAIHRSAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVTLKDTIRGFKGILEGEYDHIPEQAFYMVGSIDEVLEKAKNM 457
>gi|124522171|ref|ZP_01696880.1| ATP synthase F1, beta subunit [Bacillus coagulans 36D1] >gi|124496270|gb|EAY43878.1| ATP synthase F1, beta subunit [Bacillus coagulans 36D1] (473 aa)
Score = 1576, Expect = 3.3e-173, Identities = 313/462 (67%), Positives = 369/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV----KLAGE---ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G V QV+GPVVDV F E+ QLP IY+ L +    K A E    + LE A  +GDD VR IA+  T+G+ R  +V +   PI VPVG+  LGR+FNVLG+ ID   EL    +  PI +  PSF+  S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+N+A+EH G+SVFAGVGERTREGNDLYYEM   GVI KTA+VFGQMNEPPGARMRVALT LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQR+ ELQDIIAILG+DEL+++DK+IV RARRI+ FLSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE AF  VGTI++AV+KA+ +
  S:     1 MSIGHVLQVMGPVVDVKF-ENGQLPDIYNALKINYKAKNANEVDINVTLEVALHLGDDAVRTIAMASTDGIRRGMEVVDTGAPISVPVGEATLGRVFNVLGEVIDLDGELKGNVRRDPIQKPAPSFEQLSTQVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGISVFAGVGERTREGNDLYYEMKDSGVIAKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERRLSEMGIYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQRYRELQDIIAILGMDELSEDDKMIVARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGTIEDAVKKAEAM 469
>gi|134300981|ref|YP_001114477.1| F0F1 ATP synthase subunit beta [Desulfotomaculum reducens MI-1] >gi|190358666|sp|A4J999.1|ATPB_DESRM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|134053681|gb|ABO51652.1| ATP synthase F1, beta subunit [Desulfotomaculum reducens MI-1] (472 aa)
Score = 1576, Expect = 3.3e-173, Identities = 296/441 (67%), Positives = 354/441 (80%)
  Q:    28 QLPRIYDCLSVKLAGEE-------LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           Q+P IY  + ++   +E       L LE AQ +G++ VRCIA+  TEGL R  KV +    I VPVG+ VLGR+ NVLG+  DG E +  +   PIHR  P+  DQS   E+ ETGIKVIDL+ P+ +GGKIGLFGGAGVGKTV+V ELI+NIAK+H G+SVFAGVGERTREGNDLY+EM + GV++KT +VFGQMNEPPGAR+RV LT LTMAE+FRD +  D LLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST+ GS+TSVQAIYVPADDLTDPAPA  F HLDA  VL R I+ LGI+PA++PL+STSR+LDP +VG  HY+ A GVQ++LQR+ ELQDIIAILG+DEL+DEDK+ V RAR+++ FLSQPF VAE F+G  GKYV L DTI+SF EIL GKHD LPEQAF+  G I+E +E AKR++
  S:    22 QVPDIYSAVKIRTEDQEDKSTKWNLTLEVAQHLGNNRVRCIAMSSTEGLKRGMKVVSTGKAISVPVGRPVLGRLLNVLGEEADGLEPIKAEKYYPIHRPAPALVDQSTKAEMLETGIKVIDLMIPFLKGGKIGLFGGAGVGKTVIVMELINNIAKQHGGISVFAGVGERTREGNDLYHEMKEAGVLEKTIMVFGQMNEPPGARLRVGLTGLTMAEFFRDEEGADTLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTRKGSVTSVQAIYVPADDLTDPAPANAFAHLDATVVLSRAISELGIYPAVDPLDSTSRILDPQVVGKEHYECARGVQSVLQRYKELQDIIAILGMDELSDEDKLTVARARKLQRFLSQPFHVAETFTGRPGKYVSLKDTIRSFNEILAGKHDALPEQAFYMAGAIEEVMENAKRIE 469
>gi|115349966|ref|YP_764399.1| CF1 beta subunit of ATP synthase [Stigeoclonium helveticum] >gi|122165149|sp|Q06SG7|ATPB_STIHE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|98990180|gb|ABF60147.1| CF1 beta subunit of ATP synthase [Stigeoclonium helveticum] (484 aa)
Score = 1576, Expect = 3.4e-173, Identities = 306/463 (66%), Positives = 364/463 (78%)
  Q:     5 NITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           N   G++ Q+IGPVVD+ F  +  +P IY+ + +     AGE++ +  E  QL+GD  VR +A+ PTEGL R    T+   P+ VPVGK  LGR+FNVLG+P+D    +  + +LPIHR  P+F D    L IFETGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+NIAK H G+SVFAGVGERTREGNDLY EM + GVI+       K ALV+GQMNEPPGARMRV LTALTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GSITS+QA+YVPADDLTDPAPATTF HLDA TVL R +AA GI+PA++PL+STS +L P IVG  HY  A  V+  LQR+ ELQDIIAILG+DEL++ED+++V RAR+I  FLSQPFFVAE F+G  GKYV L++TI+ FK +  G+ D LPEQAF+ VG+I E + KA  L
  S:     8 NKNTGRLIQIIGPVVDIAF-PAGNVPNIYNAVVISGKNTAGEDMCVTCEVQQLLGDRCVRAVAMNPTEGLMRGMDATDTGTPLMVPVGKTTLGRIFNVLGEPVDNLGPVETEQKLPIHRSAPAFTDLDTRLAIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYMEMKESGVINESNLSESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPWIVGDEHYACAQKVKETLQRYKELQDIIAILGLDELSEEDRLLVARARKIERFLSQPFFVAEVFTGSPGKYVALAETIRGFKMVFAGELDSLPEQAFYLVGSIDEVIAKAAAL 481
>gi|151945186|gb|EDN63437.1| F1F0 ATP synthase beta subunit [Saccharomyces cerevisiae YJM789] >gi|190409593|gb|EDV12858.1| F(1)F(0)-ATPase complex beta subunit [Saccharomyces cerevisiae RM11-1a] (511 aa)
Score = 1576, Expect = 3.7e-173, Identities = 306/453 (67%), Positives = 360/453 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAV 461
           GKV  VIG +VDV F E S+LP I + L +K    +L LE AQ +G++ VR IA+  TEGL R EKV +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH  PPSF +QS + EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD  +VG  HY VA  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI GK V L DT+ SFK IL+GK+D++PE AF+ VG I++ V
  S:    44 GKVTAVIGAIVDVHF-EQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAILEGKYDNIPEHAFYMVGGIEDVV 500
>gi|53802691|ref|YP_112553.1| F0F1 ATP synthase subunit beta [Methylococcus capsulatus str. Bath] >gi|81823727|sp|Q60CR4|ATPB_METCA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|53756452|gb|AAU90743.1| ATP synthase F1, beta subunit [Methylococcus capsulatus str. Bath] (460 aa)
Score = 1576, Expect = 3.9e-173, Identities = 304/462 (65%), Positives = 364/462 (78%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG VVD  F   S LP+IYD L V   G  L LE  Q +GD +VRCIA+G T+G+ R   VTN   PI VPVG   LGR+ NVLG PID K  + +K +  IHRK PS+ DQ+   E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LT+AE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQP LA EMG LQERI STKTGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R IA LGI+PA++PL+STSR LDP ++G  HY+    VQ+ LQR+ EL+DIIAILG+DEL++ DK+IV RAR+I+ FLSQPFFVAE F+G  GKYVPL DTI  FK I+DG +DD+PEQAF+ VG+I EA+EKAKRL
  S:     1 MSSGKIVQIIGAVVDAEFPRES-LPKIYDALRVDEVG--LVLEVQQQLGDGVVRCIAMGSTDGVRRGVTVTNTGAPISVPVGTETLGRIMNVLGDPIDEKGPIGEKERWGIHRKAPSYQDQAAANELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKESNVLDKVSLVYGQMNEPPGNRLRVALTGLTIAEKFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPNLAEEMGILQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELGIYPAVDPLDSTSRQLDPLVIGHEHYETTRRVQSTLQRYKELRDIIAILGMDELSENDKLIVSRARKIQRFLSQPFFVAEVFTGSPGKYVPLKDTIAGFKGIVDGDYDDVPEQAFYMVGSIDEALEKAKRL 458
>gi|163789448|ref|ZP_02183887.1| F0F1 ATP synthase subunit beta [Carnobacterium sp. AT7] >gi|159875302|gb|EDP69367.1| F0F1 ATP synthase subunit beta [Carnobacterium sp. AT7] (468 aa)
Score = 1576, Expect = 3.9e-173, Identities = 307/462 (66%), Positives = 362/462 (78%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV---KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQ-LPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G + QVIGPVVDV F  +  +P I + L V   K   + + LE A L+G+ ++R IA+  T+GL R   V +    I VPVG+  LGRMFNVLG+ ID KE  P+  + LPIHR  P+FD+ S+   I ETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GSITS+QAIYVPADD TDPAPAT F HLDA T L+R +   GI+PA++PL STS  L P IVG  HYKVA  VQ +LQR+ ELQDIIAILG+DEL+ ++KIIV RARRI+ FLSQ F VAE F+G+ G YVP+ +T++ FKEI+DG++D LPE AF  VG I+E V KAK +
  S:     1 MSIGHIVQVIGPVVDVEFPINDTMPEINNALIVEKNKSKNQTVVLETALLLGNGVIRTIAMESTDGLQRGMSVIDTEKSISVPVGEETLGRMFNVLGETIDQKEPFPEDAKRLPIHRNAPTFDELSSNTAILETGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMQESGVIKRTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEVGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTSKGSITSIQAIYVPADDYTDPAPATVFAHLDATTNLERKLTEQGIYPAVDPLASTSSALSPEIVGEEHYKVATEVQQLLQRYRELQDIIAILGMDELSADEKIIVSRARRIQFFLSQNFHVAEAFTGLPGSYVPVEETVRGFKEIIDGRYDHLPEDAFRNVGRIEEVVTKAKAM 466
>gi|58337090|ref|YP_193675.1| F0F1 ATP synthase subunit beta [Lactobacillus acidophilus NCFM] >gi|75432972|sp|Q5FKY0|ATPB_LACAC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|58254407|gb|AAV42644.1| ATP synthase beta subunit [Lactobacillus acidophilus NCFM] (479 aa)
Score = 1575, Expect = 4.2e-173, Identities = 300/462 (64%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPK-KPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G++ QVIGPVVDV F     LP I + L V K   E + LE    +GD ++R IA+  T+GL R  KV +   PI VPVG++ LGR+FNVLG+PIDG    PK  P+  IH++ P ++D + + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKT ++QELIHNIA+EH G+SVF GVGERTREGNDLY+EM   GV+ KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAP+TTF +LDA T L+R++   GI+PA++PLES+S  LDP +VG  HY+VA  VQ++LQR+ ELQDII++LG+DEL+DE+K+IV RAR+++ FLSQ FFVAE+F+G+ G YVP+ +TI+ FK ILDG  DDLPE AF  VG I++ ++KA+ +
  S:     1 MSEGEIVQVIGPVVDVKFPIDKNLPDINNALRVIKSEDESIVLEVTLELGDGVLRTIAMESTDGLRRGMKVEDTGAPISVPVGEDTLGRVFNVLGQPIDGGPAFPKDHPREGIHKEAPKYEDLTTSREILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPSTTFAYLDATTNLERSLVEQGIYPAVDPLESSSSALDPEVVGQEHYEVATRVQHVLQRYHELQDIISVLGMDELSDEEKLIVARARKVQFFLSQNFFVAEQFTGVPGSYVPIKETIKGFKLILDGHLDDLPEDAFRGVGPIEDVLKKAQEM 464
>gi|157363033|ref|YP_001469800.1| F0F1 ATP synthase subunit beta [Thermotoga lettingae TMO] >gi|190358709|sp|A8F3K2.1|ATPB_THELT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157313637|gb|ABV32736.1| ATP synthase F1, beta subunit [Thermotoga lettingae TMO] (469 aa)
Score = 1575, Expect = 4.3e-173, Identities = 313/460 (68%), Positives = 374/460 (81%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + ++IGPVVDV F E  +LP IY+ L V     GE+L LE  QLIGD+ VR +AL  T+GL R  +V +   PI  PVGK VLGR+ NV+GKPID K ++  +   PIHR  P   +Q   +E+ ETGIKVIDLL P+ +GGKIG FGGAGVGKTVLV ELI NIA E  G SVFAGVGERTREGNDL+ EM + GV++ T LVFGQMNEPPGAR RV LTALT+AEYFRD + +DVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTLAT+MG+LQERI ST+ GSITSVQAIYVPADD+TDPAPATTF+HLDA  VL R IA LGI+PA++PL+STS++LDP ++G  HY+VA GVQ +LQR+ +LQDIIAILG++EL +EDK+IV+RAR+I+ FLSQPFFVAE+F+G  GKYVP+S+T++ FKEIL+GKHD LPEQAFF VGTI EAV+KA+RLK
  S:     5 GYIVRIIGPVVDVKFDEK-ELPDIYNALEVTNPQNGEKLILEVEQLIGDNTVRAVALDSTDGLTRGLEVVDTGKPIVAPVGKGVLGRILNVVGKPIDEKGDIQAEDYWPIHRPAPKITEQKTEIEVLETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEQKGFSVFAGVGERTREGNDLWLEMQEAGVLENTVLVFGQMNEPPGARFRVGLTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTQKGSITSVQAIYVPADDITDPAPATTFSHLDASVVLSRKIAELGIYPAVDPLDSTSKILDPAVIGWEHYQVARGVQEVLQRYKDLQDIIAILGMEELTEEDKLIVQRARKIQRFLSQPFFVAERFTGANGKYVPISETVKGFKEILEGKHDSLPEQAFFMVGTIDEAVQKAERLK 465
>gi|6322581|ref|NP_012655.1| Beta subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; phosphorylated; Atp2p [Saccharomyces cerevisiae] >gi|84028178|sp|P00830|ATPB_YEAST ATP synthase subunit beta, mitochondrial precursor >gi|1015845|emb|CAA89652.1| ATP2 [Saccharomyces cerevisiae] >gi|1483632|gb|AAC49475.1| F1-ATPase beta-subunit (511 aa)
Score = 1575, Expect = 4.4e-173, Identities = 305/453 (67%), Positives = 360/453 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAV 461
           GKV  VIG +VDV F E S+LP I + L +K    +L LE AQ +G++ VR IA+  TEGL R EKV +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH  PPSF +QS + EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD  +VG  HY VA  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI GK V L DT+ SFK +L+GK+D++PE AF+ VG I++ V
  S:    44 GKVTAVIGAIVDVHF-EQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVV 500
>gi|70725933|ref|YP_252847.1| F0F1 ATP synthase subunit beta [Staphylococcus haemolyticus JCSC1435] >gi|118573757|sp|Q4L7Y4|ATPB_STAHJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|68446657|dbj|BAE04241.1| ATP synthase beta chain [Staphylococcus haemolyticus JCSC1435] (470 aa)
Score = 1575, Expect = 4.6e-173, Identities = 303/462 (65%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G+V QV+GPV+DV F E +++P I + L +++  E    EL LE A  +GDD+VR IA+  T+G+ R  +V N    I VPVG+  LGR+FNVLG  ID +++L    +  PIHR+ P+FD+ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLYYEM   GVI KTA+VFGQMNEPPGARMRVAL+ALTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QA++VPADD TDPAPAT F HLDA T L+R +  +GI+PA++PL STSR L+P IVG  HY+VA  VQ+ LQ++ ELQDIIAILG+DEL++EDK+ VERARRI+ FLSQ F VAE+F+G  G YVP+  T+  FK+ILDGK+D +PE AF  VG++++ + KAK +
  S:     1 MSNGRVTQVMGPVIDVRF-EHNEVPEINNALIIEVPKEDGTFELTLEVALQLGDDVVRTIAMDSTDGVQRGMEVQNTGKDISVPVGEVTLGRVFNVLGDTIDLEDKLDGSVRRDPIHRQSPNFDELSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMRDSGVIKKTAMVFGQMNEPPGARMRVALSALTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSVTSIQAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPAIVGQEHYEVARDVQSTLQKYRELQDIIAILGMDELSEEDKLTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVADFKDILDGKYDHIPEDAFRLVGSMEDVIAKAKDM 466
>gi|157377616|ref|YP_001476216.1| F0F1 ATP synthase subunit beta [Shewanella sediminis HAW-EB3] >gi|189081347|sp|A8G1W5.1|ATPB_SHESH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157319990|gb|ABV39088.1| ATP synthase F1, beta subunit [Shewanella sediminis HAW-EB3] (458 aa)
Score = 1575, Expect = 4.7e-173, Identities = 303/461 (65%), Positives = 367/461 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ G V QVIG VVDV F   + +P++YD L +K  G  L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG+  LGR+ NVLG+P+D    + ++ +  IHR+ PS++DQS++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ  LQR+ EL+DIIAILG+DEL+D+DK  V RAR+I  +LSQPFFVAE F+G  GKYV L DTI+ FK ILDG+ D LPEQAF+ VG+I EAVEKA +
  S:     1 MSTGTVVQVIGAVVDVEFPHDA-VPQVYDALEIKSEG--LVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVVNSGSPITVPVGEKTLGRIMNVLGEPVDEAGPIGEEDRYVIHREAPSYEDQSSSTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMEDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVATGVQTQLQRYKELKDIIAILGMDELSDDDKTTVFRARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEFDHLPEQAFYMVGSIDEAVEKANK 457
>gi|94501602|ref|ZP_01308119.1| ATP synthase F1, beta subunit [Oceanobacter sp. RED65] >gi|94426285|gb|EAT11276.1| ATP synthase F1, beta subunit [Oceanobacter sp. RED65] (458 aa)
Score = 1575, Expect = 4.7e-173, Identities = 301/462 (65%), Positives = 369/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG V+DV F   S +P++YD L  K+ G ++ LE  Q +GD +VR IA+G TEGL R     N N PI+VPVGK  LGR+ +VLG PID K  + ++ +  IHRK PS+D+Q+   E+ ETG+KVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK GSITSVQA+YVPADDLTDP+PATTF HLDA  VL R+IA+ GI+PAI+PL+STSR LDP ++G  HY +A GVQ +LQRF EL+DIIAILG+DEL++EDK+ V RAR+I  FLSQPFFVAE F+G  GKYV L +TI+ FK IL+G+ DDLPEQAF+ VGT+ EA+EKAK L
  S:     1 MSSGKIVQIIGAVIDVEFPRDS-VPKVYDAL--KVEGGKITLEVQQQLGDGMVRTIAMGSTEGLKRGLVAENTNQPIQVPVGKETLGRIMDVLGDPIDEKGPIGEQERASIHRKAPSYDEQAGGQELLETGVKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMSESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASKGIYPAIDPLDSTSRQLDPLVIGQEHYDIARGVQTVLQRFKELKDIIAILGMDELSEEDKLTVARARKIERFLSQPFFVAEVFTGAPGKYVSLKETIRGFKGILEGEFDDLPEQAFYMVGTMDEAIEKAKNL 458
>gi|90578412|ref|ZP_01234223.1| ATP synthase subunit B [Vibrio angustum S14] >gi|90441498|gb|EAS66678.1| ATP synthase subunit B [Vibrio angustum S14] (461 aa)
Score = 1575, Expect = 4.8e-173, Identities = 300/462 (64%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ +VIG VVDV F + S +PR+YD L++  +   EL LE  Q IG  +VRCIA+G ++GL R   V N   PI VPVG+  LGR+ NVLG PID   E+ +K +  IHR+ PS+++QSN+ E+ ETG+KVIDL+ P+A+GGKIGLFGGAGVGKTV + ELI+NIAK HSGLSVF GVGERTREGND YYEM + GV+DK A+V+GQMNEPPG R+RVALT LT+AE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITS+QA+YVPADDLTDP+PATTF HLDA  VL RNIAALG++PAI+PL+STSR LDP +VG +HY VA GVQ +LQR+ EL+DIIAILG+DEL++EDK  V RAR+I  FL+QP+ VAE F+G  G +V L +TI  FK +L G++DD+PEQAF + G I+E +EKAK L
  S:     1 MSTGKIVKVIGAVVDVEFDQDS-VPRVYDALTLSDSEHAELVLEVQQQIGSGVVRCIAMGSSDGLRRGLDVVNTKAPITVPVGEETLGRIMNVLGTPIDECGEIGEKTKYAIHREAPSYEEQSNSSELLETGVKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELINNIAKAHSGLSVFTGVGERTREGNDFYYEMKEAGVLDKVAMVYGQMNEPPGNRLRVALTGLTIAESFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRNIAALGLYPAIDPLDSTSRQLDPLVVGQDHYDVARGVQTVLQRYKELKDIIAILGMDELSEEDKQTVSRARKIERFLTQPYHVAEVFTGQPGVFVSLKETIAGFKGLLSGEYDDVPEQAFLYCGAIEEVLEKAKNL 461
>gi|56461719|ref|YP_157000.1| F0F1 ATP synthase subunit beta [Idiomarina loihiensis L2TR] >gi|81600226|sp|Q5QZI6|ATPB_IDILO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56180729|gb|AAV83451.1| F0F1-type ATP synthase, beta subunit [Idiomarina loihiensis L2TR] (461 aa)
Score = 1575, Expect = 4.8e-173, Identities = 302/462 (65%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV Q+IG VVD+ F + + +P++YD L V   G E L LE  Q +G  IVR IA+G T+GL R     N    I VPVGK  LGR+ +VLG PID    + ++ ++ IHR  PS+++QSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LT+AE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL+R+IA+LGI+PA++PL+STSR LDP ++G  HY  A+GVQ +LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI  FK ILDG +DD+PEQAF+ VGTI+EAVEKAK L
  S:     1 MSQGKVVQIIGAVVDLEFPQDA-VPKVYDALKVTEGGLEGLVLEVQQQLGGGIVRAIAMGTTDGLRRGITAKNTGESIMVPVGKKTLGRIMDVLGNPIDEAGPIGEEEKMSIHRAAPSYEEQSNTNELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMNDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTIAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLNRDIASLGIYPAVDPLDSTSRQLDPQVIGDEHYDTAMGVQEVLQRYKELKDIIAILGMDELSEEDKLSVSRARKIQRFLSQPFFVAEVFTGAPGKYVSLKDTIAGFKGILDGDYDDMPEQAFYMVGTIEEAVEKAKNL 461
>gi|42518865|ref|NP_964795.1| F0F1 ATP synthase subunit beta [Lactobacillus johnsonii NCC 533] >gi|81832255|sp|Q74K15|ATPB_LACJO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|41583151|gb|AAS08761.1| ATP synthase beta chain [Lactobacillus johnsonii NCC 533] (480 aa)
Score = 1575, Expect = 4.9e-173, Identities = 304/462 (65%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLP-IHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G++ QVIGPVVDV F     LP I + L V    G+ L LE    +GD ++R I++  T+GL R  +V +   PI VPVGK+ LGR+FNVLG PIDG   L K  +   IH++ P +D+ S + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKT ++QELIHNIA+EH G+SVF GVGERTREGNDLY+EM   GV+ KTA+VFGQMNEPPGARMRVALT LT+AEYFRD +  DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +   GI+PA++PLESTS  LDP IVG  HY+VA+ VQ+ILQR+ ELQDII++LG+DEL+D++K+IVERAR+I+ FLSQ FFVAE+F+GI G YVP+ +TI+ FK I+DGK DDLPE AF  VG I++ +++A+++
  S:     1 MSKGEIVQVIGPVVDVEFPLDKDLPDINNALRVTNNNGDTLVLEVTLELGDGVLRTISMESTDGLRRGMEVEDTGAPISVPVGKDTLGRVFNVLGDPIDGGPALGKDVKREGIHKEAPKYDELSTSEEILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQGIYPAVDPLESTSSALDPEIVGEEHYEVAVKVQHILQRYQELQDIISVLGMDELSDDEKLIVERARKIQFFLSQNFFVAEQFTGIPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPIEDVIKQAEKM 464
>gi|186684534|ref|YP_001867730.1| ATP synthase F1, beta subunit [Nostoc punctiforme PCC 73102] >gi|186466986|gb|ACC82787.1| ATP synthase F1, beta subunit [Nostoc punctiforme PCC 73102] (482 aa)
Score = 1575, Expect = 4.9e-173, Identities = 306/467 (65%), Positives = 371/467 (79%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV---KLAGEEL--FLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +K NI Y  + Q+IGPVVDV F    +LP+IY+ L +     +G+E+   +E  QL+GD+ VR +A+  TEGL R  +VT+   PI VPVGK  LGR+FNVLG+P+D +  +  +  LPIHR  P F D      +FETGIKV+DLLTPY RGGKIGLFGGAGVGKTV++ ELI+NIA +H G+SVFAGVGERTREGNDLY EMI+ GVI+       K ALV+GQMNEPPGARMRV L+ LT+AEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++G+LQERI ST  GSITS+QA+YVPADDLTDPAPATTF HLD  TVL R +AA GI+PA++PL STS +L PNIVG  HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED++IV RAR++  FLSQPFFVAE F+G  GKYV L DTI+ F++IL G+ D LPEQAF+ VG I EA+ KA+++K
  S:     6 EKTNIGY--ITQIIGPVVDVKF-PGGKLPQIYNALKIVGTNESGQEINITVEVQQLLGDNQVRTVAMSSTEGLVRGFEVTDTGAPITVPVGKATLGRIFNVLGEPVDNRGPVNAEASLPIHRSAPKFTDLETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVINNENLNESKIALVYGQMNEPPGARMRVGLSGLTVAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDALPEQAFYLVGDINEAIAKAEKIK 481
>gi|119776776|ref|YP_929516.1| F0F1 ATP synthase subunit beta [Shewanella amazonensis SB2B] >gi|166222412|sp|A1SBU0.1|ATPB_SHEAM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|119769276|gb|ABM01847.1| Sodium-transporting two-sector ATPase [Shewanella amazonensis SB2B] (462 aa)
Score = 1575, Expect = 5.0e-173, Identities = 302/461 (65%), Positives = 370/461 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG--EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ G V QVIG VVDV F + + +P++YD L +   G    L LE  Q +G  +VR IA+G ++GL R  +V N    I VPVGK  LGR+ NVLG+P+D    + ++ +  IHR  PS+++QSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM++ GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQN+LQR+ EL+DIIAILG+DEL+D+DK+ V RAR+I  FLSQPF VAE F+G  GKYVPL DTI+ FK IL+G+ D +PEQAF+ VG++ EAVEKA +
  S:     1 MSTGTVVQVIGAVVDVEFPQHA-VPQVYDALKITGEGTCNGLVLEVQQQLGGGVVRTIAMGSSDGLRRGIEVENTGSAIAVPVGKATLGRIMNVLGEPVDEAGPIGEEDRYVIHRAAPSYEEQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMMESGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQNVLQRYKELKDIIAILGMDELSDDDKMTVSRARKIERFLSQPFHVAEVFTGSPGKYVPLKDTIRGFKGILEGEFDHVPEQAFYMVGSVDEAVEKANK 461
>gi|47605558|sp|Q9PTY0|ATPB_CYPCA ATP synthase subunit beta, mitochondrial precursor >gi|5689156|dbj|BAA82837.1| ATP synthase beta-subunit [Cyprinus carpio] (518 aa)
Score = 1575, Expect = 5.0e-173, Identities = 309/461 (67%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K   PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL DTI+ FK IL G++D LPEQAF+ VG I+E V+KA++L +
  S:    51 GRIVAVIGAVVDVQFDED--LPPILNALEVAGRDTRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGAPIRIPVGPETLGRIMNVIGEPIDERGPITTKQTAPIHAEAPEFTDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHLGKLVPLKDTIKGFKAILGGEYDALPEQAFYMVGPIEEVVQKAEKLAE 515
>gi|118474804|ref|YP_892659.1| F0F1 ATP synthase subunit beta [Campylobacter fetus subsp. fetus 82-40] >gi|190358269|sp|A0RR26.1|ATPB_CAMFF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118414030|gb|ABK82450.1| ATP synthase F1, beta subunit [Campylobacter fetus subsp. fetus 82-40] (465 aa)
Score = 1574, Expect = 5.4e-173, Identities = 300/460 (65%), Positives = 365/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QV+GPVVDV F +   LP+I + + V    E    +L LE A  +GD+ VR IA+  +EGL R         PI VPVG+ VLGR+FNV+G  ID  EE     +  IHR PP+F+DQS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY EM + GV+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+GSE+SALLGR+PSAVGYQPTLA+EMG+LQERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R IA  GI+PA++PL+STSR+LDP I+G  HYK+A GVQ +LQ++ +LQDIIAILG+DEL++EDK+ V+RAR+I  +LSQPFFVAE F+G  GKYV L +TI  FK IL+GK+D LPE AF+ VG I EA+ KA++++
  S:     3 GIISQVMGPVVDVDFKD--YLPKINEAIEVNFTVEGNTHKLILETAAHLGDNRVRTIAMDMSEGLTRGLDAIALGSPISVPVGEKVLGRIFNVIGDLIDEGEEEKFDKKWSIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESGVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGRLQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPQILGEEHYKIARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVDRARKIEKYLSQPFFVAEVFTGSPGKYVSLEETIAGFKGILEGKYDQLPENAFYMVGNIDEAIAKAEKMR 464
>gi|80091|pir||S17726 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - Bacillus firmus (strain OF4) (469 aa)
Score = 1574, Expect = 5.6e-173, Identities = 305/458 (66%), Positives = 363/458 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE------LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPID-GKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           G + QV+GPVVDV F +S QLP I + L      ++      + LE A  +GDD VR +A+G T+GL R  +  +   PI VPVG+  LGR+FNVLG+ ID G+       + PIHR+ P F++ S T EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH  +SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVAL+ LTMAE+FRD D QDVLLF+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG LQERI STK GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ  LQ++ ELQDIIAILG+DEL++EDK++V RARRI+ FLSQ F VAE+F+G  G YVP+ +TI+ FKE LDGK+DDLPE AF  VG I+E +EK K+
  S:     4 GHITQVMGPVVDVKF-KSGQLPEINNALKSTSGADKNAVDVTVTLEVALHLGDDSVRTVAMGSTDGLVRGTEALDTGAPISVPVGEATLGRVFNVLGEAIDLGEPVAADVKRDPIHREAPKFEELSTTTEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGVISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEHFRDRDGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGHLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYSVARQVQQTLQKYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGHKGSYVPVKETIKGFKESLDGKYDDLPEDAFRLVGRIEEVIEKGKQ 467
>gi|108759590|ref|YP_635037.1| F0F1 ATP synthase subunit beta [Myxococcus xanthus DK 1622] >gi|118573702|sp|Q1CX36|ATPB_MYXXD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|108463470|gb|ABF88655.1| ATP synthase F1, beta subunit [Myxococcus xanthus DK 1622] (481 aa)
Score = 1574, Expect = 6.3e-173, Identities = 308/467 (65%), Positives = 364/467 (77%)
  Q:     1 MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-----KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI-------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           M  +  T G++ QV+GPVVDV F     LP +Y  L V       A + L LE AQ +G++ VR IA+  TEGL R   VTN   PI+VPVGK  LGR+ NV G+P+D    +  +    IHR PP F +Q   +++FETGIKVIDLL PY RGGKIGLFGGAGVGKTVL+QELI N+A E  G SVFAGVGERTREGNDLY+EM    VI        +  LV+GQMNEPPGAR RVAL+ALTMAEYFRD + +DVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMG LQERI ST  GSITSVQAIYVPADDLTDPAPAT F HLDA TVL+R+IA L IFPA++PL+STSR+LDP ++G  HY VA  VQ ILQR+ ELQDIIAILG+DEL+++DK++V RAR+I+ FLSQPFFVA+ F+G  G+YV L DTIQ FKEI +GKHDD+PE AF+  G+I E VE A++L
  S:     1 MSAQVPTAGRIIQVLGPVVDVEFPPGG-LPEVYTALKVTNANLSAAADNLTLEVAQHLGENTVRTIAMDSTEGLGRGMAVTNTGAPIQVPVGKATLGRILNVTGEPVDEMGPVKAQEYWSIHRAPPPFTEQDVRVQMFETGIKVIDLLAPYTRGGKIGLFGGAGVGKTVLLQELIRNVAVERGGFSVFAGVGERTREGNDLYHEMQDTKVIQTDNLEASQAVLVYGQMNEPPGARARVALSALTMAEYFRDVEGRDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGGLQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRSIAELAIFPAVDPLDSTSRILDPAVIGAEHYGVARKVQGILQRYKELQDIIAILGMDELSEDDKLVVARARKIQRFLSQPFFVAKVFTGKDGRYVKLQDTIQGFKEIAEGKHDDIPEGAFYMTGSIDEVVENARKL 478
>gi|116629873|ref|YP_815045.1| F0F1 ATP synthase subunit beta [Lactobacillus gasseri ATCC 33323] >gi|122273189|sp|Q042L5.1|ATPB_LACGA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116095455|gb|ABJ60607.1| F0F1-type ATP synthase, beta subunit [Lactobacillus gasseri ATCC 33323] (480 aa)
Score = 1574, Expect = 6.6e-173, Identities = 304/459 (66%), Positives = 368/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLP-IHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G++ QVIGPVVDV F     LP I + L V    G+ L LE    +GD ++R I++  T+GL R  +V +   PI VPVGK+ LGR+FNVLG PIDG   L K  +   IH++ P +D+ S + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKT ++QELIHNIA+EH G+SVF GVGERTREGNDLY+EM   GV+ KTA+VFGQMNEPPGARMRVALT LT+AEYFRD +  DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF HLDA T L+R +   GI+PA++PLESTS  LDP +VG  HY+VA+ VQ+ILQR+ ELQDII++LG+DEL+D++K+IVERAR+I+ FLSQ FFVAE+F+G+ G YVP+ +TI+ FK I+DGK DDLPE AF  VG I++ V+KA+++
  S:     4 GEIVQVIGPVVDVEFPLDKDLPDINNALRVTNNNGDTLVLEVTLELGDGVLRTISMESTDGLRRGMEVEDTGAPISVPVGKDTLGRVFNVLGDPIDGGPALGKDVKREGIHKEAPKYDELSTSEEILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQGIYPAVDPLESTSSALDPEVVGEEHYQVAVQVQHILQRYQELQDIISVLGMDELSDDEKLIVERARKIQFFLSQNFFVAEQFTGLPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPIEDVVKKAEKM 464
>gi|161507276|ref|YP_001577230.1| F0F1 ATP synthase subunit beta [Lactobacillus helveticus DPC 4571] >gi|172048219|sp|A8YUK1.1|ATPB_LACH4 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|160348265|gb|ABX26939.1| ATP synthase beta subunit [Lactobacillus helveticus DPC 4571] (479 aa)
Score = 1573, Expect = 7.7e-173, Identities = 298/462 (64%), Positives = 369/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPK-KPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G++ QVIGPV+DV F     LP I + L V K   E + LE    +GD ++R IA+  T+GL R  KV +   PI VPVG++ LGR+FNVLG+PIDG     K  P+  IH++ P ++D + + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKT ++QELIHNIA+EH G+SVF GVGERTREGNDLY+EM   GV+ KTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAP+TTF HLDA T L+R++   GI+PA++PLES+S  LDP +VG  HY+VA  VQ++LQR+ ELQDII++LG+DEL+DE+K+IV RAR+++ FLSQ FFVAE+F+G+ G YVP+ +TI+ FK ILDG  DDLPE +F  VG I++ ++KA+ +
  S:     1 MSEGEIVQVIGPVIDVKFPIDKNLPNINNALRVIKSENESIVLEVTVELGDGVLRTIAMESTDGLRRGMKVEDTGGPISVPVGEDTLGRVFNVLGQPIDGGPAFSKDHPRESIHKEAPKYEDLTTSREILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPSTTFAHLDATTNLERSLVEQGIYPAVDPLESSSSALDPEVVGKEHYEVATRVQHVLQRYHELQDIISVLGMDELSDEEKLIVARARKVQFFLSQNFFVAEQFTGVPGSYVPIKETIKGFKLILDGHLDDLPEDSFRGVGPIEDVLKKAQEM 464
>gi|189525553|ref|XP_001923522.1| PREDICTED: hypothetical protein LOC336197 [Danio rerio] >gi|159155102|gb|AAI54660.1| Zgc:111961 [Danio rerio] (517 aa)
Score = 1573, Expect = 8.1e-173, Identities = 308/461 (66%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K   PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ FK IL G++D LPEQAF+ VG I+E V+KA++L +
  S:    50 GRIVAVIGAVVDVQFDEG--LPPILNALEVAGRDSRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGAPIRIPVGPETLGRIMNVIGEPIDERGPISTKQTAPIHAEAPEFTDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGTEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFKSILGGEYDALPEQAFYMVGPIEEVVQKAEKLAE 514
>gi|47218629|emb|CAG04958.1| unnamed protein product [Tetraodon nigroviridis] (517 aa)
Score = 1573, Expect = 8.2e-173, Identities = 311/467 (66%), Positives = 366/467 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK 475
           G++  VIG VVDV F E   LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K   PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F+ IL G++D LPEQAF+ VG I+E V+KAK+L    VEE+
  S:    50 GRIVAVIGAVVDVQFDEG--LPPILNALEVAGRDSRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGAPIRIPVGPETLGRIMNVIGEPIDERGPITTKQTAPIHAEAPEFTDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGAEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFQSILAGEYDALPEQAFYMVGPIEEVVQKAKKL----VEEQ 516
>gi|15925093|ref|NP_372627.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus Mu50] >gi|15927677|ref|NP_375210.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus N315] >gi|21283756|ref|NP_646844.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus MW2] >gi|49484327|ref|YP_041551.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486896|ref|YP_044117.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652125|ref|YP_186910.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus COL] >gi|82751704|ref|YP_417445.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus RF122] >gi|87160880|ref|YP_494704.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus USA300] >gi|88196007|ref|YP_500820.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268554|ref|YP_001247497.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus JH9] >gi|150394618|ref|YP_001317293.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus JH1] >gi|151222219|ref|YP_001333041.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980418|ref|YP_001442677.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus Mu3] >gi|161510310|ref|YP_001575969.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728863|ref|ZP_02761140.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase beta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166222418|sp|A7X4U3.1|ATPB_STAA1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|172048985|sp|A6QIU7.1|ATPB_STAAE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081349|sp|A6U3I8.1|ATPB_STAA2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081350|sp|A5IUP8.1|ATPB_STAA9 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081351|sp|A8YY70.1|ATPB_STAAT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|54036785|sp|P63680|ATPB_STAAW ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|54036794|sp|P99112|ATPB_STAAN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|54040855|sp|P63679|ATPB_STAAM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|60389598|sp|Q6G7K7|ATPB_STAAS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|60389623|sp|Q6GEX2|ATPB_STAAR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81170378|sp|Q5HE97|ATPB_STAAC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573754|sp|Q2FF24|ATPB_STAA3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573755|sp|Q2FWF0|ATPB_STAA8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573756|sp|Q2YUK1|ATPB_STAAB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|13701897|dbj|BAB43189.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus N315] >gi|14247876|dbj|BAB58265.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21205198|dbj|BAB95892.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus MW2] >gi|49242456|emb|CAG41172.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245339|emb|CAG43814.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286311|gb|AAW38405.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus COL] >gi|82657235|emb|CAI81676.1| ATP synthase beta chain [Staphylococcus aureus RF122] >gi|87126854|gb|ABD21368.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203565|gb|ABD31375.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741623|gb|ABQ49921.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947070|gb|ABR53006.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus JH1] >gi|150375019|dbj|BAF68279.1| ATP synthase, beta subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722553|dbj|BAF78970.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus Mu3] >gi|160369119|gb|ABX30090.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase beta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (470 aa)
Score = 1573, Expect = 8.5e-173, Identities = 302/459 (65%), Positives = 368/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QV+GPV+DV F E +++P+I + L + +  EE    L LE A  +GDD+VR IA+  T+G+ R   V +    I VPVG   LGR+FNVLG+ ID KEE+    +  PIHR+ P+FD+ S  ++I ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVAL+ LTMAEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI ST  GS+TS+QA++VPADD TDPAPAT F HLDA T L+R +  +GI+PA++PL STSR L+P+IVG  HY+VA  VQ+ LQ++ ELQDIIAILG+DEL+DEDK  VERARRI+ FLSQ F VAE+F+G  G YVP+  T+ +FK+ILDGK+D +PE AF  VG++ + + KAK +
  S:     4 GRVTQVMGPVIDVRF-EHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIAMDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAPAFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSIQAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEHYEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDM 466
>gi|170077372|ref|YP_001734010.1| ATP synthase beta chain [Synechococcus sp. PCC 7002] >gi|169885041|gb|ACA98754.1| ATP synthase beta chain [Synechococcus sp. PCC 7002] (483 aa)
Score = 1573, Expect = 8.7e-173, Identities = 302/463 (65%), Positives = 368/463 (79%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA---GEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           T GK+ Q+IGPV+D  F  S ++PRIY+ L ++     G+E+ L  E  QL+GD+ VR +A+  T+GL R   + +   PI VPVGK  LGR+FNVLG+P+D K E+  +   PIHR  P   +      +FETGIKV+DLLTPY RGGKIGLFGGAGVGKTV++ ELI+NIA  H G+SVFAGVGERTREGNDLY EMI+ GVI+       K ALV+GQMNEPPGARMRV L+ LTMAEYFRD + QDVLLF+DNIFRF QAGSEVSALLGRMPSAVGYQPTL T++G LQERI STK GSITS+QA+YVPADDLTDPAPATTF HLD  TVL R +A+ GI+PA++PL+STS +L P+IVG +HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED++ V+RAR+I  FLSQPFFVAE F+G  GKYV L +TI+ FK IL G+ DDLPEQAF+ VG I+EA+ K K+LK+
  S:     8 TLGKITQIIGPVIDAEFP-SGKMPRIYNALKIQGKNPYGQEINLTCEVQQLLGDNQVRAVAMSSTDGLVRGMDILDTGAPISVPVGKKTLGRIFNVLGEPVDEKGEVGAEETSPIHRPAPKLTELDTAPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATNHGGVSVFAGVGERTREGNDLYNEMIESGVINPDNLNDSKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGDLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRALASKGIYPAVDPLDSTSTMLQPSIVGEDHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIERFLSQPFFVAEVFTGSPGKYVTLEETIEGFKRILSGELDDLPEQAFYLVGNIEEAIAKGKKLKE 481
>gi|119389907|pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389908|pdb|2HLD|E Chain E, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389909|pdb|2HLD|F Chain F, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389916|pdb|2HLD|M Chain M, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389917|pdb|2HLD|N Chain N, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389918|pdb|2HLD|O Chain O, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389925|pdb|2HLD|V Chain V, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389926|pdb|2HLD|W Chain W, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389927|pdb|2HLD|X Chain X, Crystal Structure Of Yeast Mitochondrial F1-Atpase (478 aa)
Score = 1573, Expect = 9.0e-173, Identities = 305/453 (67%), Positives = 360/453 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAV 461
           GKV  VIG +VDV F E S+LP I + L +K    +L LE AQ +G++ VR IA+  TEGL R EKV +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH  PPSF +QS + EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD  +VG  HY VA  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI GK V L DT+ SFK +L+GK+D++PE AF+ VG I++ V
  S:    11 GKVTAVIGAIVDVHF-EQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVV 467
>gi|116513801|ref|YP_812707.1| F0F1 ATP synthase subunit beta [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275429|sp|Q04BA3.1|ATPB_LACDB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116093116|gb|ABJ58269.1| F0F1-type ATP synthase, beta subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (479 aa)
Score = 1572, Expect = 9.7e-173, Identities = 304/462 (65%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELP-KKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G++ QVIGPVVDV F+    LP I + L V K   + + LE     GD ++RCIA+  T+GL R  KV +    I VPVG + LGR+FNVLG+PIDG  E P   P+  IH++ P +D+ + + EI ETGIKVIDLL PY RGGK+GLFGGAGVGKT ++QELIHNIA+EH+G+SVF GVGERTREGNDLY+EM   GV+DKTA+VFGQMNEPPGARMRVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLATEMGQLQERI STK GSITS+QA+YVPADD TDPAPATTF +LDA T L+R++   GI+PA++PLESTS  LDP IVG  HY VA  VQ+ILQR+ ELQDII++LG+DEL+DE+K+IV RARRI+ FLSQ FFVAE F+ + G YVP+ +TI+ FK ILDG  DDLPE AF  VG I++ ++KA ++
  S:     1 MSQGEIVQVIGPVVDVKFSIGKDLPDINNALKVIKSDDDSIILEVILEQGDGVLRCIAMESTDGLRRGMKVEDTGSSISVPVGPDTLGRVFNVLGQPIDGGPEFPADHPRSGIHKEAPKYDELTTSREILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTTIIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLDKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAYLDATTNLERSLVEQGIYPAVDPLESTSSALDPEIVGQEHYDVATRVQHILQRYRELQDIISVLGMDELSDEEKLIVARARRIQFFLSQNFFVAEVFTSVPGSYVPIKETIKGFKMILDGHLDDLPEDAFRGVGPIEDVLKKALKM 464
>gi|47575824|ref|NP_001001256.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Xenopus (Silurana) tropicalis] >gi|45767611|gb|AAH67388.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Xenopus tropicalis] >gi|89269884|emb|CAJ83426.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Xenopus tropicalis] (525 aa)
Score = 1572, Expect = 9.7e-173, Identities = 309/467 (66%), Positives = 367/467 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K    IH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG+ HY+VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL DTI+ FK+IL G +D+LPEQAF+ VG I+EAV KA++L +
  S:    52 KPGTAVGRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDTRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDAGTPIRIPVGPETLGRIMNVIGEPIDERGPITTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGLEHYEVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHLGKLVPLKDTIKGFKQILHGGYDNLPEQAFYMVGPIEEAVTKAEKLAE 522
>gi|196189320|gb|EDX84284.1| ATP synthase F1, beta subunit [Synechococcus sp. PCC 7335] (486 aa)
Score = 1572, Expect = 1.1e-172, Identities = 302/466 (64%), Positives = 369/466 (79%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV---KLAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           E    G + Q+IGPV+DV F  + +LP+IY+ + V     AG+E+ +  E  QL+GD  VR +++  T+GL R  +  +   PI VPVGK  LGR+FNVLG+P+D K  +  +  LPIHR  P   D      +FETGIKV+DLL PY RGGK+GLFGGAGVGKTVL+QELI+NIAKEHSG+SVF GVGERTREGNDLY E I+ GVI+       K ALV+GQMNEPPGARMRVAL+ALTMAEYFRD + QDVLLF+DNIFRF QAGSEVSALLGRMPSAVGYQPTL T+MG LQERIAST  GSITS+QA+YVPADDLTDPAPATTF HLDA T L R +A+ GI+PA++PL+STS +L P+IVG  HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED+ +V RAR+I  FLSQPFFVAE F+G++GKYV L DTI+ F  ILDG+ DD+PEQAF+  G I+E +E A+++K+
  S:     6 EKTNTGYITQIIGPVLDVKFP-NGELPKIYNAIKVTGTNPAGQEVTVTCEVQQLLGDSQVRAVSMSSTDGLVRGMEAEDLGSPINVPVGKATLGRIFNVLGEPVDEKGPVDAESSLPIHRPAPELVDLETKPAVFETGIKVVDLLAPYRRGGKVGLFGGAGVGKTVLIQELINNIAKEHSGVSVFGGVGERTREGNDLYNEFIESGVINADDLSQSKVALVYGQMNEPPGARMRVALSALTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDMGDLQERIASTTDGSITSIQAVYVPADDLTDPAPATTFAHLDATTTLSRALASKGIYPAVDPLDSTSTMLQPDIVGEEHYGTARAVQSTLQRYKELQDIIAILGLDELSEEDRQVVARARKIEKFLSQPFFVAEVFTGMSGKYVTLEDTIKGFNMILDGELDDVPEQAFYLKGGIEEVIEAAEKMKE 482
>gi|114049501|ref|YP_740051.1| F0F1 ATP synthase subunit beta [Shewanella sp. MR-7] >gi|123030131|sp|Q0HPG1.1|ATPB_SHESR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|113890943|gb|ABI44994.1| ATP synthase F1, beta subunit [Shewanella sp. MR-7] (463 aa)
Score = 1572, Expect = 1.1e-172, Identities = 304/463 (65%), Positives = 366/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + + +P++YD L +   G    L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+PID    + ++ +  IHR  PS++DQSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+D+DK+ V RAR+I  FLSQPF VAE F+G  GKYV L DTI+ FK IL G+ D +PEQAF+ VG+I EAVEKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQVYDALKITGEGSCNGLVLEVQQQLGGGVVRTIAMGTSDGLRRGLEVVNSGSPISVPVGTATLGRIMNVLGEPIDEAGAIGEEERYVIHRSAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDDDKMTVSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILSGEFDHIPEQAFYMVGSIDEAVEKANKKK 463
>gi|126002169|ref|XP_001352282.1| GA10801-PA [Drosophila pseudoobscura] >gi|195173595|ref|XP_002027573.1| GL18400 [Drosophila persimilis] >gi|54640128|gb|EAL29273.1| GA10801-PA [Drosophila pseudoobscura] >gi|194114485|gb|EDW36528.1| GL18400 [Drosophila persimilis] (506 aa)
Score = 1572, Expect = 1.1e-172, Identities = 311/461 (67%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+  VIG VVDV F +   LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +  +PI +PVG   LGR+ NV+G+PID +  +P     PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+GGVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL  TI+ F +IL G++D LPE AF+ VG I+E VEKA RL K
  S:    39 GKIVAVIGAVVDVQFDDD--LPPILNALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGYPIRIPVGAETLGRIMNVIGEPIDERGPIPTDKTAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSQILAGEYDHLPEVAFYMVGPIEEVVEKADRLAK 503
>gi|110762902|ref|XP_624156.2| PREDICTED: similar to ATP synthase- CG11154-PA, isoform A [Apis mellifera] (516 aa)
Score = 1572, Expect = 1.1e-172, Identities = 309/461 (67%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+  VIG VVDV F ++  LP I + L V+     L LE AQ +G++ VR IA+  TEGL R + V +  +PI +PVG   LGR+ NV+G+PID +  +P     PIH   P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL +TI+ FK+IL G +D LPE AF+ VG I+E V KA+ L K
  S:    51 GKIVAVIGAVVDVQFDDA--LPPILNALEVQNRTPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQSVLDSGYPIRIPVGAETLGRIINVIGEPIDERGPIPTDKLAPIHADAPEFVDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGAEHYNVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEETIKGFKKILAGDYDHLPEVAFYMVGPIEEVVAKAESLAK 515
>gi|51473969|ref|YP_067726.1| F0F1 ATP synthase subunit beta [Rickettsia typhi str. Wilmington] >gi|81826277|sp|Q68VU8|ATPB_RICTY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|51460281|gb|AAU04244.1| H(+)-transporting two-sector ATPase F(1) beta subunit; ATP synthase.; Chloroplast ATPase.; F(0)F(1)-ATPase.; F(1)-ATPase.; H(+)-transporting ATP synthase.; H(+)-transporting ATPase.; Mitochondrial ATPase. [Rickettsia typhi str. Wilmington] (474 aa)
Score = 1572, Expect = 1.1e-172, Identities = 304/460 (66%), Positives = 365/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHD-NQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ QVI  VVDV FT +S+LP I + L    A + + LE AQ IGDD VRCI++G TEGL R  +V +  +PI +PVG   LGR+ NV+G+PIDGK E+       I++  P F +QS   +I  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+AK H G +VFAGVGERTREGNDLY+EMI  GVI+       K ALV+GQMNEPPGAR RVAL+ LT+AE FRD +  QDVL F+DNIFRFTQAG+EVSALLGR+PSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADDLTDPAP+T+F HLDA TVL R IA LGI+PA++PL+S S++LDP IVG  HY VA  VQ +LQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G+ GK+V L DTI  FK +++GK+DDLPE AF+ VGTI EAVEKAK LK
  S:     6 GKITQVISAVVDVKFTNNSKLPEILNALECYNAKQRIVLEVAQHIGDDTVRCISMGSTEGLIRGLEVIDTGNPIHIPVGIATLGRIMNVVGEPIDGKGEIKSSTISSIYKPAPDFINQSTERDILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIASGVINLEAPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNAGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPSTSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGVEGKFVNLDDTIAGFKGLVEGKYDDLPEAAFYMVGTIDEAVEKAKILK 473
>gi|45657126|ref|YP_001212.1| F0F1 ATP synthase subunit beta [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|81568536|sp|Q72SX9|ATPB_LEPIC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|45600364|gb|AAS69849.1| ATP synthase beta chain [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (467 aa)
Score = 1572, Expect = 1.2e-172, Identities = 301/460 (65%), Positives = 366/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAG--EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+IG V+D+ F E+ +LP IY+ L ++  ++G  E +  E    IG   VR IAL  T+GL R ++V+N   PI VPVG   LGR+FNVLGK ID    +  K   PIHR  PSFD+ ++  E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+QELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GVIDKT L +GQMNEPPGAR+RVAL+ALTMAE+FRD    DVLLF+DNIFRF+QAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STK GSITSVQAIYVPADDLTDPAPA  F HLDA TVL R I+  GI+PA++PL+STSR+++  ++G  HY VA  VQ ILQR+ +LQDIIAILG+DEL+++DK++V RAR+I  FLSQPF VAE F+G  GKYV L+DT++SFKE++ G +D LPEQAF+ VG+I +A+EKAK  K
  S:     4 GKIKQIIGSVLDIEF-ENGELPEIYNALEIETNVSGKKETIIAEVQTHIGGKAVRAIALSSTDGLIRGQEVSNTGKPISVPVGDATLGRIFNVLGKTIDEGPAITVKETRPIHRAAPSFDELTSKTEVFETGIKVIDLLAPYIKGGKTGLFGGAGVGKTVLIQELINNIAKQHGGFSVFAGVGERTREGNDLWREMKESGVIDKTVLCYGQMNEPPGARLRVALSALTMAEHFRDSIGTDVLLFVDNIFRFSQAGSEVSALLGRMPSAVGYQPTLSTEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPANAFAHLDATTVLSRAISDKGIYPAVDPLDSTSRVMNAQVLGEEHYLVAREVQRILQRYKDLQDIIAILGMDELSEDDKVLVARARKIEKFLSQPFHVAEVFTGAPGKYVKLADTVRSFKEVISGNYDHLPEQAFYMVGSIDDAIEKAKGYK 466
>gi|119471627|ref|ZP_01614012.1| F0F1 ATP synthase subunit beta [Alteromonadales bacterium TW-7] >gi|119445406|gb|EAW26693.1| F0F1 ATP synthase subunit beta [Alteromonadales bacterium TW-7] (461 aa)
Score = 1571, Expect = 1.2e-172, Identities = 301/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV Q+IG VVD+ F++ + +P +YD L V    LAG  L LE  Q +G  +VR IALG T+GL R   V+N    I+VPVGK  LGR+ NVLG+PID    + ++ ++ IHR  PS+++QS+++E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERIASTKTGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+LGI+PA++PL+S+SR LDP ++G  HY  A GVQ +LQR+ EL+DIIAILG+DEL+DEDK +V RAR+I+ FLSQPFFVAE F+G +GKYV L DTI  FK IL+G+ DDLPEQAF+ VG+I+EA EKAK +
  S:     1 MSLGKVVQIIGAVVDIEFSQDN-VPAVYDALKVTDGDLAG--LTLEVQQQLGGGVVRTIALGTTDGLRRGAAVSNTGEAIQVPVGKATLGRIMNVLGEPIDEAGPIGEEDRMSIHRAAPSYEEQSSSVELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMNDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERIASTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSSSRQLDPLVIGQEHYDTARGVQTVLQRYKELKDIIAILGMDELSDEDKQLVSRARKIQRFLSQPFFVAEVFTGASGKYVSLKDTIAGFKGILNGEFDDLPEQAFYMVGSIEEAQEKAKSM 461
>gi|116328613|ref|YP_798333.1| F0F1 ATP synthase subunit beta [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331342|ref|YP_801060.1| F0F1 ATP synthase subunit beta [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122280912|sp|Q04S18.1|ATPB_LEPBJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|122283600|sp|Q04ZU5.1|ATPB_LEPBL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116121357|gb|ABJ79400.1| Beta subunit of the H(+)-transporting two-sector ATPase, F1 sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125031|gb|ABJ76302.1| Beta subunit of the H(+)-transporting two-sector ATPase, F1 sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (467 aa)
Score = 1571, Expect = 1.2e-172, Identities = 301/460 (65%), Positives = 366/460 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVK--LAG--EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+IG V+D+ F E+ +LP IY+ L ++  ++G  E L  E    IG   +R IAL  T+GL R ++VTN   PI VPVG   LGR+FNVLGK ID    +  K   PIHR  P+FD+ ++  E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+QELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GVIDKT L +GQMNEPPGAR+RVAL+ALTMAE+FRD    DVLLF+DNIFRF+QAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STK GSITSVQAIYVPADDLTDPAPA  F HLDA TVL R I+  GI+PA++PL+STSR+++  ++G  HY VA  VQ ILQR+ +LQDIIAILG+DEL+++DK++V RAR+I  FLSQPF VAE F+G  GKYV L+DT++SFKE++ G +D LPEQAF+ VG+I +A+EKAK  K
  S:     4 GKIKQIIGSVLDIEF-ENGELPEIYNALEIEATVSGKREILIAEVQTHIGGKAIRAIALSSTDGLIRGQEVTNTGKPISVPVGDATLGRIFNVLGKTIDEGPAITVKETRPIHRPAPAFDELTSKTEVFETGIKVIDLLAPYIKGGKTGLFGGAGVGKTVLIQELINNIAKQHGGFSVFAGVGERTREGNDLWREMKESGVIDKTVLCYGQMNEPPGARLRVALSALTMAEHFRDSIGTDVLLFVDNIFRFSQAGSEVSALLGRMPSAVGYQPTLSTEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPANAFAHLDATTVLSRAISDKGIYPAVDPLDSTSRVMNAQVLGEEHYTVAREVQRILQRYKDLQDIIAILGMDELSEDDKVLVARARKIEKFLSQPFHVAEVFTGAPGKYVKLADTVRSFKEVISGNYDHLPEQAFYMVGSIDDAIEKAKGYK 466
>gi|91084327|ref|XP_972481.1| PREDICTED: similar to H+ transporting ATP synthase beta subunit [Tribolium castaneum] (518 aa)
Score = 1571, Expect = 1.3e-172, Identities = 307/463 (66%), Positives = 370/463 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           GKV  VIG VVDV F ++  LP I + L V+     L LE AQ +G++ VR IA+  TEGL R + V++  +PI +PVG   LGR+ NV+G+PID +  +P     PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY VA GVQ ILQ +  LQDIIAILG+DEL+++DK+ V RAR+I+ FLSQPF VAE F+G AGK VPL +TI+ F++IL G++D LPE AF+ VG I+E V+KA++L ++T
  S:    51 GKVVAVIGAVVDVQFDDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQAVSDTGYPIRIPVGAETLGRIINVIGEPIDERGPVPTDKLAPIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGMDELSEDDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLQETIKGFQKILGGEYDHLPEVAFYMVGPIEEVVQKAEKLAEST 517
>gi|163792320|ref|ZP_02186297.1| F1-ATP Synthase Beta Chain [alpha proteobacterium BAL199] >gi|159182025|gb|EDP66534.1| F1-ATP Synthase Beta Chain [alpha proteobacterium BAL199] (474 aa)
Score = 1571, Expect = 1.3e-172, Identities = 300/463 (64%), Positives = 363/463 (78%)
  Q:     5 NITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           N   GK+ QVIG V+DV F    +LP I + L  K+    L LE AQ +G++ VR IA+  TEG  R + V++   PI VPVG   LGR+ NV+G P+D +  +  K + PIHR  P++ DQS   EI  TGIKVIDLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EM++ GVI       K ALV+GQMNEPPGAR RV LT LT+AEYFRD + QDVL F+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT+MG LQERI +TK GSITSVQAIYVPADDLTDPAPAT+F HLDA TVL R IA LGI+PA++PL+STSR+LDP ++G  HY +A  VQ +LQ++  LQDIIAILG+DEL++ED++ V RAR+I+ FLSQPF VAE F+G  GK V L DTI+ FK I++G++DDLPE AF+ VG I+EAVEKA+++
  S:     3 NNATGKITQVIGAVIDVKF--DGELPAILNALHTKIGDNLLVLEVAQHLGENTVRTIAMDSTEGAVRGQSVSDTGGPITVPVGPETLGRILNVIGDPVDERPPVETKLRFPIHRPAPAYIDQSTESEILITGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMVESGVIVPDGPGSKAALVYGQMNEPPGARARVGLTGLTLAEYFRDEEGQDVLFFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGALQERITTTKKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSTSRMLDPRVIGDEHYNIARRVQEVLQQYRSLQDIIAILGMDELSEEDRLTVARARKIQRFLSQPFHVAEIFTGSPGKLVSLEDTIKGFKAIVEGEYDDLPESAFYMVGGIEEAVEKARKM 469
>gi|24215476|ref|NP_712957.1| F0F1 ATP synthase subunit beta [Leptospira interrogans serovar Lai str. 56601] >gi|81467688|sp|Q8F2J5|ATPB_LEPIN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|24196607|gb|AAN49975.1|AE011443_4 ATP synthase F1, beta chain [Leptospira interrogans serovar Lai str. 56601] (467 aa)
Score = 1571, Expect = 1.5e-172, Identities = 300/460 (65%), Positives = 363/460 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL----AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+IG V+D+ F E+ +LP IY+ L ++       E +  E    IG   VR IAL  T+GL R ++V+N   PI VPVG   LGR+FNVLGK ID    +  K   PIHR  PSFD+ ++  E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+QELI+NIAK+H G SVFAGVGERTREGNDL+ EM + GVIDKT L +GQMNEPPGAR+RVAL+ALTMAE+FRD    DVLLF+DNIFRF+QAGSEVSALLGRMPSAVGYQPTL+TEMG LQERI STK GSITSVQAIYVPADDLTDPAPA  F HLDA TVL R I+  GI+PA++PL+STSR+++  ++G  HY VA  VQ ILQR+ +LQDIIAILG+DEL+++DK++V RAR+I  FLSQPF VAE F+G  GKYV L+DT++SFKE++ G +D LPEQAF+ VG+I +A+EKAK  K
  S:     4 GKIKQIIGSVLDIEF-ENGELPEIYNALEIETNVFGKKETIIAEVQTHIGGKAVRAIALSSTDGLIRGQEVSNTGKPISVPVGDATLGRIFNVLGKTIDEGPAITVKETRPIHRAAPSFDELTSKTEVFETGIKVIDLLAPYIKGGKTGLFGGAGVGKTVLIQELINNIAKQHGGFSVFAGVGERTREGNDLWREMKESGVIDKTVLCYGQMNEPPGARLRVALSALTMAEHFRDSIGTDVLLFVDNIFRFSQAGSEVSALLGRMPSAVGYQPTLSTEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPANAFAHLDATTVLSRAISDKGIYPAVDPLDSTSRVMNAQVLGEEHYLVAREVQRILQRYKDLQDIIAILGMDELSEDDKVLVARARKIEKFLSQPFHVAEVFTGAPGKYVKLADTVRSFKEVISGNYDHLPEQAFYMVGSIDDAIEKAKGYK 466
>gi|27468618|ref|NP_765255.1| F0F1 ATP synthase subunit beta [Staphylococcus epidermidis ATCC 12228] >gi|57867649|ref|YP_189274.1| F0F1 ATP synthase subunit beta [Staphylococcus epidermidis RP62A] >gi|38604812|sp|Q8CNJ7|ATPB_STAES ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81170379|sp|Q5HMB9|ATPB_STAEQ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|27316165|gb|AAO05299.1|AE016749_245 ATP synthase beta chain [Staphylococcus epidermidis ATCC 12228] >gi|57638307|gb|AAW55095.1| ATP synthase F1, beta subunit [Staphylococcus epidermidis RP62A] (470 aa)
Score = 1571, Expect = 1.5e-172, Identities = 300/459 (65%), Positives = 370/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V QV+GPV+DV F E +++P I + L +++  E    +L LE A  +GDD+VR IA+  T+G+ R  +V +    I VPVG   LGR+FNVLG+ ID  E++    +  PIHR+ P FD+ S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLYYEM   GVI KTA+VFGQMNEPPGARMRVAL+ LTMAEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI+ST  GS+TS+QA++VPADD TDPAPATTF HLD+ T L+R +  +GI+PA++PL STSR L+P++VG  HY VA  VQ+ LQ++ ELQDIIAILG+DEL+DEDK  VERARRI+ FLSQ F VAE+F+G  G YVP+  T+  F++ILDGK+D +PE AF  VG++++ +EKAK +
  S:     4 GRVTQVMGPVIDVRF-EHNEVPEINNALHIEVPKEDGALQLTLEVALQLGDDVVRTIAMDSTDGVQRGMEVKDTGRDISVPVGDVTLGRVFNVLGETIDLDEKIDDSVRRDPIHRQAPGFDELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERISSTNKGSVTSIQAVFVPADDYTDPAPATTFAHLDSTTNLERKLTEMGIYPAVDPLASTSRALEPSVVGQEHYDVAREVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVADFRDILDGKYDHIPEDAFRLVGSMEDVIEKAKDM 466
>gi|157132308|ref|XP_001655991.1| ATP synthase beta subunit [Aedes aegypti] >gi|108881686|gb|EAT45911.1| ATP synthase beta subunit [Aedes aegypti] (504 aa)
Score = 1571, Expect = 1.5e-172, Identities = 309/459 (67%), Positives = 364/459 (79%)
  Q:    11 VHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           V  VIG VVDV F ++  LP I + L V+  G  L LE AQ +G++ VR IA+  TEGL R ++V +   PI +PVG   LGR+ NV+G+PID +  +      PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+GGVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY +A GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL +TI+ F +IL+G+ D LPE AF+ VG I+E VEKA+RL K
  S:    39 VVAVIGAVVDVQFDDN--LPPILNALEVQERGSRLVLEVAQHLGENTVRTIAMDGTEGLVRGQRVLDTGSPIRIPVGAETLGRIINVIGEPIDERGPIETNLSAPIHAEAPEFIDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGAEHYNIARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEETIKGFTKILNGELDHLPEVAFYMVGPIEEVVEKAERLAK 501
>gi|68485407|ref|XP_713381.1| hypothetical protein CaO19.13098 [Candida albicans SC5314] >gi|68485502|ref|XP_713334.1| hypothetical protein CaO19.5653 [Candida albicans SC5314] >gi|46434817|gb|EAK94217.1| hypothetical protein CaO19.5653 [Candida albicans SC5314] >gi|46434865|gb|EAK94264.1| hypothetical protein CaO19.13098 [Candida albicans SC5314] (512 aa)
Score = 1571, Expect = 1.5e-172, Identities = 304/454 (66%), Positives = 365/454 (80%)
  Q:    14 VIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           VIG VVDV F E + LP I + L++K   ++L LE AQ +G++ VR IA+  TEGL R  +V +   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH +PPSF +QS   EI ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD ++VG  HY VA GVQ  LQ +  LQDIIAILG+DEL++ DK+ VERAR+I+ FLSQPF VAE F+GI G+ V L DT++SFK++L+GK+D+LPE AF+ VG I++ V KA++L
  S:    50 VIGAVVDVQFDEGN-LPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTEGLVRGTEVNDTGAPISVPVGRGTLGRIINVVGEPIDDRGPIECKEKKPIHAEPPSFVEQSTAAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASVVGQEHYDVATGVQQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIQRFLSQPFAVAEVFTGIPGRLVRLQDTVKSFKDVLEGKYDNLPENAFYMVGGIEDVVAKAEKL 507
>gi|187931020|ref|YP_001891004.1| ATP synthase, F1 sector, subunit beta [Francisella tularensis subsp. mediasiatica FSC147] >gi|187711929|gb|ACD30226.1| ATP synthase, F1 sector, subunit beta [Francisella tularensis subsp. mediasiatica FSC147] (458 aa)
Score = 1570, Expect = 1.6e-172, Identities = 300/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG V+DV F   +  P++YD L+V  AG  L LE  Q IGD +VR IA+G ++GL R  +V N N PI VPVG   LGR+ NVLG+PID    +    +  IH+ PP++D+ + + EI ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSG SVFAGVGERTREGND YYEM    V+DK +LV+GQMNEPPG R+RVAL+ LT+AE FRD + +DVL+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP +VG +HY++A  VQ +LQR+ EL+DIIAILG+DEL+DEDK IV+RAR+I+ FLSQPF VAE F+G  GK+V L DT+ SFK I++G++D LPEQAF+ VG+IQEA+EKAK L
  S:     1 MSTGKIIQVIGAVIDVEFARDNT-PKVYDALNVVEAG--LVLEVQQQIGDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTEKRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELINNIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRVALSGLTIAEGFRD-EKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVVGQDHYEIARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL 458
>gi|113972252|ref|YP_736045.1| F0F1 ATP synthase subunit beta [Shewanella sp. MR-4] >gi|123029180|sp|Q0HD79.1|ATPB_SHESM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|113886936|gb|ABI40988.1| ATP synthase F1, beta subunit [Shewanella sp. MR-4] (463 aa)
Score = 1570, Expect = 1.6e-172, Identities = 306/463 (66%), Positives = 368/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + + +P++YD L  K+ GE     L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+PID    + ++ +  IHR  PS++DQSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+D+DK+ V RAR+I  FLSQPF VAE F+G  GKYV L DTI+ FK IL G+ D +PEQAF+ VG+I EAVEKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQVYDAL--KIVGEGSCNGLVLEVQQQLGGGVVRTIAMGTSDGLRRGLEVVNSGSPISVPVGTATLGRIMNVLGEPIDEAGAIGEEERYVIHRSAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDDDKMTVSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILSGEFDHIPEQAFYMVGSIDEAVEKANKKK 463
>gi|114565195|ref|YP_752709.1| F0F1 ATP synthase subunit beta [Shewanella frigidimarina NCIMB 400] >gi|122298241|sp|Q07VU4.1|ATPB1_SHEFN ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|114336488|gb|ABI73870.1| ATP synthase F1, beta subunit [Shewanella frigidimarina NCIMB 400] (463 aa)
Score = 1570, Expect = 1.6e-172, Identities = 306/463 (66%), Positives = 370/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + S +PR+YD L  K+ GE     L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+PID    + ++ +  IHR  PS++DQSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT L++AE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK+GSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+D+DK +V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG+ D +PEQAF+ VG+I EAVEKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDS-VPRVYDAL--KITGEGACNGLVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVANSGSPITVPVGVATLGRIMNVLGEPIDEAGPIGEEERYVIHRAAPSYEDQSNSTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMEDSGVLDKVAMVYGQMNEPPGNRLRVALTGLSIAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKSGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDDDKTMVFRARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEFDHIPEQAFYMVGSIDEAVEKANKKK 463
>gi|157827763|ref|YP_001496827.1| F0F1 ATP synthase subunit beta [Rickettsia bellii OSU 85-389] >gi|166201730|sp|A8GY40.1|ATPB_RICB8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157803067|gb|ABV79790.1| F0F1 ATP synthase subunit beta [Rickettsia bellii OSU 85-389] (473 aa)
Score = 1570, Expect = 1.8e-172, Identities = 307/466 (65%), Positives = 365/466 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRD-HDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           K+NI  GK+ Q+I  VVDV FT   +LP+I + L      + + LE AQ IGDD VRCIA+  TEGL R  +V +   PI +PVG   LGR+ NV+G+PIDGK ++       I++  PSF  QS    I  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+AK H G +VFAGVGERTREGNDLY+EMI  GVI+       K ALV+GQMNEPPGAR RVALT LT+AE FRD ++ QDVL F+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADDLTDPAPAT+F HLDA  VL R IA LGI+PA++PL+STS++LDP IVG  HY VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK+V L+DTI  FK + +GK+DDLPE AF+ VGTI+EA+EKAK LK
  S:     2 KKNI--GKITQIISAVVDVKFTNKGKLPQILNALECYNDKQRIVLEIAQHIGDDTVRCIAMNSTEGLVRGMEVVDTGSPISIPVGIETLGRIMNVVGEPIDGKGKIKGSSISSIYKSAPSFTQQSTDRNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLEEPEKSKVALVYGQMNEPPGARARVALTGLTVAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATIVLSRQIAELGIYPAVDPLDSTSQVLDPMIVGEEHYNVARKVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLTEGKYDDLPEAAFYMVGTIEEALEKAKTLK 473
>gi|34447120|dbj|BAC84975.1| mitochondrial ATPase beta-subunit [Zygosaccharomyces rouxii] (506 aa)
Score = 1570, Expect = 1.9e-172, Identities = 304/461 (65%), Positives = 362/461 (78%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           + GKV  VIG VVDV F +   LP I + L ++    +L LE AQ +G++ VR IA+  T GL R   VT+   PI VPV K  LGR+ NV+G+PID    +  K + PIH +PPSF DQS   E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM++ GVID     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAV YQPTL+T+MG LQERIA+T+ GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD +IVG  HY +A  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF  A+ F+GI GK V L DTI+SFKE+LDGK+D LPE AF+ VG I++ + KA++L
  S:    37 STGKVRAVIGAVVDVQF-DQENLPEILNALEIERPQGKLVLEVAQHLGENTVRAIAMDGTSGLVRGAAVTDTGAPISVPVDKETLGRIINVIGEPIDEAGPINTKERRPIHAEPPSFVDQSTNSEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMMETGVIDLKGDSKVALVFGQMNEPPGARARVALTGLTVAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVAYQPTLSTDMGALQERIATTQKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASIVGEEHYNIASDVQMTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFATAQVFTGIEGKLVRLKDTIRSFKEVLDGKYDHLPENAFYMVGGIEDVIAKAEKL 501
>gi|119509845|ref|ZP_01628988.1| ATP synthase subunit B [Nodularia spumigena CCY9414] >gi|119465454|gb|EAW46348.1| ATP synthase subunit B [Nodularia spumigena CCY9414] (482 aa)
Score = 1570, Expect = 2.0e-172, Identities = 303/467 (64%), Positives = 369/467 (79%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDK-------TALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +K NI Y  + Q+IGPVVDV F    +LP+IY+ L++K + E     +L +E  QL+GD+ VR +A+  T+GL R  +V +   PI VPVGK  LGR+FNVLG+P+D +  +  +  LPIHR  P F D      +FETGIKV+DLLTPY RGGKIGLFGGAGVGKTV++ ELI+NIA +H G+SVFAGVGERTREGNDLY EM++ GVI+K        ALV+GQMNEPPGARMRV L+ LTMAEYFRD   QDVLLF+DNIFRF QAGSEVSALLGRMPSAVGYQPTL T++G LQERI ST  GSITS+QA+YVPADDLTDPAPATTF HLD  TVL R +A+ GI+PA++PL STS +L P IVG +HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED++IV RAR++  FLSQPFFVAE F+G  GKYV L DTI+ FK IL G+ D+LPEQAF+ VG I EA+ KA+++K
  S:     6 EKTNIGY--ITQIIGPVVDVKFA-GGKLPQIYNALTIKGSNEAGQEIKLTVEVQQLLGDNQVRTVAMSSTDGLIRGLEVVDTGAPISVPVGKVTLGRIFNVLGEPVDNQGPVNAEQTLPIHRPSPKFTDLETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMMESGVINKDNLNESKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVSKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLGSTSTMLQPEIVGDDHYSTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFKMILSGELDELPEQAFYLVGDINEAIAKAEKMK 481
>gi|148223359|ref|NP_001080126.1| ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [Xenopus laevis] >gi|28436792|gb|AAH46741.1| Atp5b protein [Xenopus laevis] (525 aa)
Score = 1569, Expect = 2.1e-172, Identities = 308/467 (65%), Positives = 366/467 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K    IH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG+ HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL DTI+ F++IL G +D+LPEQAF+ VG I+EAV KA++L +
  S:    52 KPGTASGRIVAVIGAVVDVQFDED--LPPILNALEVQGRDTRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDAGTPIRIPVGPETLGRIMNVIGEPIDERGPITTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGLEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKDTIKGFQQILHGAYDNLPEQAFYMVGPIEEAVTKAEKLAE 522
>gi|90415394|ref|ZP_01223328.1| ATP synthase subunit B [marine gamma proteobacterium HTCC2207] >gi|90332717|gb|EAS47887.1| ATP synthase subunit B [marine gamma proteobacterium HTCC2207] (465 aa)
Score = 1569, Expect = 2.1e-172, Identities = 301/462 (65%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G++ Q+IG V+DV F    Q+P +YD L V   G+ L LE  Q +GD +VR IA+G +EG++R   V N   PI VPVG   LGR+ +VLG PID K  + +K ++ IHRKPP++D+ + + ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIA EHSGLSVFAGVGERTREGND YYEM + GV++       K A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL R+IA+ GI+PA++PL+STSR LDP I+G  HY VA GVQ++LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I  FLSQPF VAE F+G  GKYV L DTI  F+ ILDG++DDLPEQAF+ VG+I EAVEKAK+L
  S:     1 MSSGRIVQIIGAVIDVEFARD-QVPSVYDALVVD--GKGLTLEVQQQLGDGVVRTIAMGASEGVSRGLGVVNTKAPISVPVGVETLGRIMDVLGNPIDEKGPIGEKERMAIHRKPPAYDELAASDDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIATEHSGLSVFAGVGERTREGNDFYYEMQESGVVNIETPSESKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASKGIYPAVDPLDSTSRQLDPLIIGTEHYAVARGVQSVLQRYKELKDIIAILGMDELSEEDKMAVARARKIERFLSQPFHVAEIFTGSPGKYVSLKDTIAGFQGILDGQYDDLPEQAFYMVGSIDEAVEKAKKL 465
>gi|157136033|ref|XP_001656737.1| ATP synthase beta subunit [Aedes aegypti] >gi|108881105|gb|EAT45330.1| ATP synthase beta subunit [Aedes aegypti] (504 aa)
Score = 1569, Expect = 2.2e-172, Identities = 309/459 (67%), Positives = 364/459 (79%)
  Q:    11 VHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           V  VIG VVDV F ++  LP I + L V+  G  L LE AQ +G++ VR IA+  TEGL R ++V +   PI +PVG   LGR+ NV+G+PID +  +      PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+GGVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY +A GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL +TI+ F +IL+G+ D LPE AF+ VG I+E VEKA+RL K
  S:    39 VVAVIGAVVDVQFDDN--LPPILNALEVQERGSRLVLEVAQHLGENTVRTIAMDGTEGLVRGQRVLDTGSPIRIPVGAETLGRIINVIGEPIDERGPIETNLSAPIHAEAPEFIDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGAEHYNIARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEETIKGFTKILNGELDHLPEVAFYMVGPIEEVVEKAERLAK 501
>gi|117922561|ref|YP_871753.1| F0F1 ATP synthase subunit beta [Shewanella sp. ANA-3] >gi|166222416|sp|A0L2S8.1|ATPB_SHESA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|117614893|gb|ABK50347.1| ATP synthase F1, beta subunit [Shewanella sp. ANA-3] (463 aa)
Score = 1569, Expect = 2.2e-172, Identities = 304/463 (65%), Positives = 365/463 (78%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + + +P++YD L +   G    L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG PID    + ++ +  IHR  PS+++QSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+DEDK+ V RAR+I  FLSQPF VAE F+G  GKYV L DTI+ FK IL G+ D +PEQAF+ VG+I EAVEKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQVYDALKITGEGSCNGLVLEVQQQLGGGVVRTIAMGTSDGLRRGLEVVNSGSPISVPVGTATLGRIMNVLGDPIDEAGAIGEEERYVIHRSAPSYEEQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKMTVSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILSGEFDHIPEQAFYMVGSIDEAVEKANKKK 463
>gi|58584946|ref|YP_198519.1| F0F1 ATP synthase subunit beta [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419262|gb|AAW71277.1| F0F1-type ATP synthase, beta subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] (488 aa)
Score = 1569, Expect = 2.2e-172, Identities = 306/470 (65%), Positives = 371/470 (78%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA--GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           K + +  G+  +V   VVD+ F    +LPRI++ L  KL   G+EL LE +Q IGD+IVRCIA+  T G++RN++  +   PI VPVG++ LGR+FNV+G+ ID    L  K  L  IHR PPSF +Q    E+  TGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H G SVFAGVGERTREGNDLY+EMI   VI+       +  LV+GQMNEPPGAR RVALTALTMAEYFRDH+NQDVL F+DNIFRFTQAGSE+SALLGRMPSAVGYQPTLAT+MG +QERIAST +GSITSVQAIYVPADDLTDPAPA TF+HLD+ TVL R IA +GI+PA++PL+STS+ L   IVG  HYKV   V+ ILQ +  LQDIIAILG+DEL+DEDKI V+RAR+I+ F SQPF VAE F+G+ GK+V LSDT+ SFK I++G++D LPE AF+ VG I EA++KA+ +K  T
  S:     5 KSKEMNVGRTVKVTQAVVDLKF--EGELPRIFNALKSKLEYRGKELILEVSQHIGDNIVRCIAMDSTNGVSRNDEFVDTGAPISVPVGRSTLGRIFNVVGEVIDECGPLKGKYDLESIHRVPPSFTEQKIQEEVLVTGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKAHKGFSVFAGVGERTREGNDLYHEMITSNVINVNEHEKSQAVLVYGQMNEPPGARARVALTALTMAEYFRDHENQDVLFFVDNIFRFTQAGSEISALLGRMPSAVGYQPTLATDMGAMQERIASTTSGSITSVQAIYVPADDLTDPAPAATFSHLDSTTVLSRQIAEMGIYPAVDPLDSTSQSLSAEIVGEEHYKVTSEVKRILQTYKSLQDIIAILGMDELSDEDKITVDRARKIQKFFSQPFHVAEVFTGMPGKFVSLSDTVSSFKGIVEGEYDHLPEAAFYMVGNIDEAIKKAELIKDET 482
>gi|94468834|gb|ABF18266.1| F0F1-type ATP synthase beta subunit [Aedes aegypti] (504 aa)
Score = 1569, Expect = 2.3e-172, Identities = 309/459 (67%), Positives = 364/459 (79%)
  Q:    11 VHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           V  VIG VVDV F ++  LP I + L V+  G  L LE AQ +G++ VR IA+  TEGL R ++V +   PI +PVG   LGR+ NV+G+PID +  +      PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+GGVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY +A GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL +TI+ F +IL+G+ D LPE AF+ VG I+E VEKA+RL K
  S:    39 VVAVIGAVVDVQFDDN--LPPILNALEVQERGSRLVLEVAQHLGENTVRTIAMDGTEGLVRGQRVLDTGSPIRIPVGAETLGRIINVIGEPIDERGPIETNLSAPIHAEAPEFIDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVIPLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGAEHYNIARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEETIKGFTKILNGELDHLPEVAFYMVGPIEEVVEKAERLAK 501
>gi|163751422|ref|ZP_02158647.1| ATP synthase subunit B [Shewanella benthica KT99] >gi|161328725|gb|EDP99873.1| ATP synthase subunit B [Shewanella benthica KT99] (458 aa)
Score = 1569, Expect = 2.4e-172, Identities = 304/462 (65%), Positives = 365/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G V QVIG VVDV F + + +P+IYD L +K  G  L LE  Q IG  +VR IA+G ++GL R  +VTN   PI VPVG   LGR+ NVLG+PID    +       IHR+ P+F++QS++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK  +V+GQMNEPPG R+RVALT LTMAE FRD + +DVL FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK+GSITSVQA+YVPADDLTDP+PATTF HLDA  VL RNIA++GI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+DEDK  V RAR+I  +LSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D LPEQAF+ VG+I EAVEKA  +
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQIYDALEIKSEG--LVLEVQQQIGGGVVRTIAMGTSDGLRRGLEVTNTGSPITVPVGSVTLGRIMNVLGEPIDEAGPIGGTDHYVIHREAPTFEEQSSSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDAGVLDKVTMVYGQMNEPPGNRLRVALTGLTMAERFRD-EGKDVLFFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKSGSITSVQAVYVPADDLTDPSPATTFAHLDATIVLSRNIASMGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKTTVARARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHLPEQAFYMVGSIDEAVEKANNI 458
>gi|54301816|ref|YP_131809.1| F0F1 ATP synthase subunit beta [Photobacterium profundum SS9] >gi|81828635|sp|Q6LKZ6|ATPB2_PHOPR ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|46915236|emb|CAG22009.1| putative ATP synthase F1, beta subunit [Photobacterium profundum SS9] (461 aa)
Score = 1568, Expect = 2.8e-172, Identities = 294/462 (63%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ +VIG VVDV F + S +PR+YD L++       L LE  Q IG  IVRCIA+G ++G+ R     N   PI VPVG+  LGR+ NVLG+PID   E+ +K   PIHR+PPS++DQ+N+ E+ ETG+KVIDL+ P+A+GGKIGLFGGAGVGKTV + ELI+NIAK HSGLSVF GVGERTREGND YYEM + GV+DK A+V+GQMNEPPG R+RVALT LT+AE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI ST  GSITS+QA+YVPADDLTDP+PATTF HLDA  VL RNIAALG++PAI+PL+STSR LDP +VG+ HY VA GVQ +LQR+ EL+DIIAILG+DEL+++DK+ V RAR++  FL+QP+ VAE F+G  G +V L DT+  FK +L G++DD+PEQAF + G I++ +EKAK +
  S:     1 MSTGKIVKVIGAVVDVEFDQDS-VPRVYDALNIIDGNNSSLVLEVQQQIGSGIVRCIAMGSSDGMRRGLVAVNTGEPITVPVGEETLGRIMNVLGQPIDECGEIGQKTSYPIHREPPSYEDQANSTELLETGVKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELINNIAKAHSGLSVFTGVGERTREGNDFYYEMKEAGVLDKVAMVYGQMNEPPGNRLRVALTGLTIAERFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTHKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRNIAALGLYPAIDPLDSTSRQLDPLVVGVEHYDVARGVQTVLQRYKELKDIIAILGMDELSEDDKLTVARARKVERFLTQPYHVAEVFTGQPGIFVSLKDTLNGFKGLLSGEYDDVPEQAFLYCGAIEDVIEKAKTM 461
>gi|114644226|ref|XP_509149.2| PREDICTED: ATP synthase, H+ transporting, mitochondrial F1 complex, beta subunit isoform 2 [Pan troglodytes] (529 aa)
Score = 1568, Expect = 2.9e-172, Identities = 308/467 (65%), Positives = 365/467 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    55 KAGAATGRIVAVIGAVVDVQFDEG--LPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|117619208|ref|YP_858679.1| F0F1 ATP synthase subunit beta [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166201687|sp|A0KQX8.1|ATPB_AERHH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|117560615|gb|ABK37563.1| ATP synthase F1, beta subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (462 aa)
Score = 1568, Expect = 3.1e-172, Identities = 299/462 (64%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G + Q+IG VVD+ F + + +P++YD L V  +  G+ L LE  Q IG  +VRCI +G ++GL R  +V N    I+VPVG + LGR+ NVLG PID K  + ++ +  IHR  PS++DQSN+ ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM++  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IAALGI+PA++PL+STSR LDP +VG  HY+ A GVQ +LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I  FLSQPFFVAE F+G  GKYVPL +TI+ F+ IL G++DDLPEQAF+ VG+I E VEKAK+L
  S:     1 MSNGFIVQIIGAVVDIEFPQDA-VPQVYDALKVVSEGQGQGLVLEVQQQIGGGVVRCITMGSSDGLRRGLEVVNSGKSIQVPVGVSTLGRIMNVLGDPIDEKGPIGEEERWSIHRAAPSYEDQSNSNDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMMESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAALGIYPAVDPLDSTSRQLDPLVVGKEHYETARGVQTVLQRYKELKDIIAILGMDELSEEDKLTVARARKIERFLSQPFFVAEVFTGSPGKYVPLKETIRGFQGILKGEYDDLPEQAFYMVGSIDEVVEKAKKL 462
>gi|56707243|ref|YP_169139.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669713|ref|YP_666270.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. tularensis FSC198] >gi|134301278|ref|YP_001121246.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. tularensis WY96-3418] >gi|123169682|sp|Q14K06.1|ATPB_FRAT1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166201706|sp|A4IW24.1|ATPB_FRATW ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81820830|sp|Q5NIK3|ATPB_FRATT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56603735|emb|CAG44697.1| ATP synthase beta chain [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320046|emb|CAL08080.1| ATP synthase beta chain [Francisella tularensis subsp. tularensis FSC 198] >gi|134049055|gb|ABO46126.1| ATP synthase F1, beta subunit [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568174|gb|EDN33828.1| hypothetical protein FTBG_01520 [Francisella tularensis subsp. tularensis FSC033] >gi|151572735|gb|EDN38389.1| conserved hypothetical protein [Francisella tularensis subsp. novicida GA99-3548] (458 aa)
Score = 1568, Expect = 3.1e-172, Identities = 300/462 (64%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG V+DV F   +  P++YD L+V  AG  L LE  Q IGD +VR IA+G ++GL R  +V N N PI VPVG   LGR+ NVLG+PID    +    +  IH+ PP++D+ + + EI ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSG SVFAGVGERTREGND YYEM    V+DK +LV+GQMNEPPG R+RVAL+ LT+AE FRD + +DVL+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP +VG +HY+ A  VQ +LQR+ EL+DIIAILG+DEL+DEDK IV+RAR+I+ FLSQPF VAE F+G  GK+V L DT+ SFK I++G++D LPEQAF+ VG+IQEA+EKAK L
  S:     1 MSTGKIIQVIGAVIDVEFARDNT-PKVYDALNVVEAG--LVLEVQQQIGDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTEKRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELINNIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRVALSGLTIAEGFRD-EKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVVGQDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL 458
>gi|125624725|ref|YP_001033208.1| F0F1 ATP synthase subunit beta [Lactococcus lactis subsp. cremoris MG1363] >gi|124493533|emb|CAL98514.1| ATP synthase F1, beta subunit [Lactococcus lactis subsp. cremoris MG1363] (486 aa)
Score = 1568, Expect = 3.4e-172, Identities = 301/464 (64%), Positives = 367/464 (79%)
  Q:     4 ENITYGKVHQVIGPVVDVIFTESSQLPRIYDCL----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           + ++ GK+ QVIGPVVDV F   ++LP I + L     V     ++ LE A  +GD  VR IA+  T+GL R  +V +    + VPVG++ LGR+FNVLG  IDG E+ P   +  PIH+K P+FD+ S   E+  TGIKV+DLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLDA T L+R +  +GI+PA++PL S+SR L P IVG  HY+VA+ VQ +LQR+ ELQDIIAILG+DEL+D++KI+V RARRI+ FLSQ F VAE+F+G  G YVP+  T+  FKEIL+GK+D++PE AF  VG I++ + KAK +
  S:    16 KTLSSGKITQVIGPVVDVEFGSDAKLPEINNALIVYKDVNGLKTKITLEVALELGDGAVRTIAMESTDGLTRGLEVLDTGKAVSVPVGESTLGRVFNVLGDVIDGGEDFPADAERNPIHKKAPTFDELSTANEVLVTGIKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMGIYPAVDPLASSSRALTPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKILVGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPIEDVLAKAKSM 484
>gi|118498208|ref|YP_899258.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. novicida U112] >gi|194324392|ref|ZP_03058165.1| ATP synthase F1, beta subunit [Francisella tularensis subsp. novicida FTE] >gi|166201705|sp|A0Q8D9.1|ATPB_FRATN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118424114|gb|ABK90504.1| ATP synthase, F1 sector, subunit beta [Francisella tularensis subsp. novicida U112] >gi|151571277|gb|EDN36931.1| ATP synthase subunit B [Francisella tularensis subsp. novicida GA99-3549] >gi|194321457|gb|EDX18942.1| ATP synthase F1, beta subunit [Francisella tularensis subsp. novicida FTE] (458 aa)
Score = 1567, Expect = 3.7e-172, Identities = 300/462 (64%), Positives = 369/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG V+DV F   +  P++YD L+V  AG  L LE  Q IGD +VR IA+G ++GL R  +V N N PI VPVG   LGR+ NVLG+PID    +    +  IH+ PP++D+ + + EI ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSG SVFAGVGERTREGND YYEM    V+DK +LV+GQMNEPPG R+RVAL+ LT+AE FRD + +DVL+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP +VG  HY+ A  VQ +LQR+ EL+DIIAILG+DEL+DEDK IV+RAR+I+ FLSQPF VAE F+G  GK+V L DT+ SFK I++G++D LPEQAF+ VG+IQEA+EKAK L
  S:     1 MSTGKIIQVIGAVIDVEFARDNT-PKVYDALNVVEAG--LVLEVQQQIGDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTEKRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELINNIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRVALSGLTIAEGFRD-EKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVVGQEHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL 458
>gi|91795097|ref|YP_564748.1| F0F1 ATP synthase subunit beta [Shewanella denitrificans OS217] >gi|123165633|sp|Q12HQ1.1|ATPB_SHEDO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|91717099|gb|ABE57025.1| ATP synthase F1, beta subunit [Shewanella denitrificans OS217] (463 aa)
Score = 1567, Expect = 3.8e-172, Identities = 303/463 (65%), Positives = 368/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG--EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + + +P+IYD L +   G  + L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+PID   E+ ++ +  IHR  PS++DQS++ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVAL+ LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK+GSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+DEDK  V RAR+I  FLSQPF VAE F+G  GKYV L DTI+ FK +L+G+ D +PEQAF+ VGTI EAVEKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQIYDALKITGEGACKGLVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVVNTGSPISVPVGVATLGRIMNVLGEPIDECGEIGEEERYVIHRSAPSYEDQSSSTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALSGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKSGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKTAVARARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGLLEGEFDHIPEQAFYMVGTIDEAVEKANKKK 463
>gi|147679147|ref|YP_001213362.1| F0F1 ATP synthase subunit beta [Pelotomaculum thermopropionicum SI] >gi|190358698|sp|A5CYE2.1|ATPB_PELTS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|146275244|dbj|BAF60993.1| F0F1-type ATP synthase, beta subunit [Pelotomaculum thermopropionicum SI] (470 aa)
Score = 1567, Expect = 3.9e-172, Identities = 292/440 (66%), Positives = 356/440 (80%)
  Q:    28 QLPRIYDCLSVKLAGEELF-------LEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           Q+P IY+ + +    E+ F       LE AQ +G++ VR +A+  T+GL R  K  +   PI  PVG+  LGR+ +VLG+PIDGK  +    + PIHR  P   +QS   E  ETGIKVIDLL P+ +GGKIGLFGGAGVGKTV+V ELI+NIAK+H G+SVFAGVGERTREGNDLY EM + GV+DKT +VFGQMNEPPGAR+RVALT L +AEYFRD +  D LLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQ+QERI ST  GS+TSVQA+YVPADDLTDPAPATTF HLD   VL R IA LGI+PA++PL+STSR+LDP +VG  HY+ A GVQ +LQR+ ELQDIIAILG++EL+D+DK++V RAR+++ FLSQPF VAE F+G++GK+VP+ +TI+ F+EILDGKHDDLPE AF+ VG+I+EAVEK K+L
  S:    22 QVPDIYNAIKITSDKEDAFGRKIDLTLEVAQHLGNNTVRTVAMSSTDGLVRGMKAVDTGAPITCPVGRPTLGRLVDVLGQPIDGKGPIISDKRYPIHRPAPPLVEQSTKAEQLETGIKVIDLLVPFLKGGKIGLFGGAGVGKTVIVMELINNIAKQHGGISVFAGVGERTREGNDLYREMTEAGVLDKTTMVFGQMNEPPGARLRVALTGLCLAEYFRDEEGADTLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQMQERITSTVKGSVTSVQAVYVPADDLTDPAPATTFAHLDGTVVLSRQIAELGIYPAVDPLDSTSRILDPLVVGNEHYQTARGVQKVLQRYKELQDIIAILGMEELSDDDKLVVARARKLQRFLSQPFHVAEAFTGMSGKFVPIKETIRGFQEILDGKHDDLPEDAFYMVGSIEEAVEKGKKL 468
>gi|118573739|sp|Q4UK18|ATPB_RICFE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (474 aa)
Score = 1567, Expect = 4.1e-172, Identities = 302/460 (65%), Positives = 361/460 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRD-HDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+I  VVDV FT + +LP I + L      + + LE AQ IGDD VRCIA+  TEGL R  +V +   PI +PVG   LGR+ NV+G+PIDGK ++       I++  P F +QS    I  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+AK H G +VFAGVGERTREGNDLY+EMI  GVID       K ALV+GQMNEPPGAR RVAL+ LT+AE FRD ++ QDVL F+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADDLTDPAPAT+F HLDA TVL R IA LGI+PA++PL+S S++LDP IVG  HY VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK+V L+DTI  FK +++GK+DDLPE AF+ VGT+ EA+EKAK LK
  S:     6 GKITQIISAVVDVKFTNNGELPEILNALECYNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKSAPDFTNQSTERNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVIDLEKPENSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTMDEAIEKAKILK 473
>gi|149029718|gb|EDL84889.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, isoform CRA_a [Rattus norvegicus] (529 aa)
Score = 1567, Expect = 4.3e-172, Identities = 308/467 (65%), Positives = 364/467 (77%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G +D LPEQAF+ VG I+EAV KA +L +
  S:    55 KAGTATGQIVAVIGAVVDVQFDEG--LPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGDYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|54113605|gb|AAV29436.1| NT02FT1772 [synthetic construct] (458 aa)
Score = 1566, Expect = 4.5e-172, Identities = 300/459 (65%), Positives = 368/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ QVIG V+DV F   +  P++YD L+V  AG  L LE  Q IGD +VR IA+G ++GL R  +V N N PI VPVG   LGR+ NVLG+PID    +    +  IH+ PP++D+ + + EI ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSG SVFAGVGERTREGND YYEM    V+DK +LV+GQMNEPPG R+RVAL+ LT+AE FRD + +DVL+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP +VG +HY+ A  VQ +LQR+ EL+DIIAILG+DEL+DEDK IV+RAR+I+ FLSQPF VAE F+G  GK+V L DT+ SFK I++G++D LPEQAF+ VG+IQEA+EKAK L
  S:     4 GKIIQVIGAVIDVEFARDNT-PKVYDALNVVEAG--LVLEVQQQIGDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTEKRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELINNIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRVALSGLTIAEGFRD-EKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVVGQDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL 458
>gi|89095631|ref|ZP_01168525.1| F0F1 ATP synthase subunit beta [Bacillus sp. NRRL B-14911] >gi|89089377|gb|EAR68484.1| F0F1 ATP synthase subunit beta [Bacillus sp. NRRL B-14911] (473 aa)
Score = 1566, Expect = 4.6e-172, Identities = 303/459 (66%), Positives = 364/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE-------ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           G+V Q++GPVVDV F +S +LP+IY+ L++ +           L LE A  +GDD VR IA+  T+GL R  +V +   PI VPVG   LGR+FNVLG+ ID    L    +   IHR+ P F+  S  +EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA+EH G+SVFAGVGERTREGNDLY+EM   GVI KTA+VFGQMNEPPGARMRVALT LTMAE+FRD   QDVL F+DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG+LQERI ST  GS+TS+QAIYVPADD TDPAPATTF HLDA T L+R ++ +GI+PA++PL STSR L P IVG  HY VA  VQ+ LQR+ ELQDIIAILG+DEL+DEDK++V RARRI+ +LSQ F VAE+F+G  G YVP+ +T++ FKEIL+GK+D LPE AF  VGTI++ +E AK +
  S:     4 GRVLQIMGPVVDVKF-DSGELPQIYNALTISVPARNESEVAISLTLEVALHLGDDTVRTIAMASTDGLTRGAEVIDTGAPISVPVGDITLGRVFNVLGETIDLDPALQAGIRRDSIHREAPKFEQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEFFRDDQGQDVLFFMDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGRLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYSVARQVQSTLQRYRELQDIIAILGMDELSDEDKLVVHRARRIQFYLSQNFHVAEQFTGQKGSYVPVKETVKGFKEILEGKYDHLPEDAFRLVGTIEDVLENAKSM 469
>gi|67459658|ref|YP_247282.1| F0F1 ATP synthase subunit beta [Rickettsia felis URRWXCal2] >gi|67005191|gb|AAY62117.1| ATP synthase beta chain [Rickettsia felis URRWXCal2] (508 aa)
Score = 1566, Expect = 4.6e-172, Identities = 302/460 (65%), Positives = 361/460 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRD-HDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           GK+ Q+I  VVDV FT + +LP I + L      + + LE AQ IGDD VRCIA+  TEGL R  +V +   PI +PVG   LGR+ NV+G+PIDGK ++       I++  P F +QS    I  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+AK H G +VFAGVGERTREGNDLY+EMI  GVID       K ALV+GQMNEPPGAR RVAL+ LT+AE FRD ++ QDVL F+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG+LQERI STK GSITSVQAIYVPADDLTDPAPAT+F HLDA TVL R IA LGI+PA++PL+S S++LDP IVG  HY VA  VQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK+V L+DTI  FK +++GK+DDLPE AF+ VGT+ EA+EKAK LK
  S:    40 GKITQIISAVVDVKFTNNGELPEILNALECYNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKSAPDFTNQSTERNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVIDLEKPENSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTMDEAIEKAKILK 507
>gi|54792127|ref|NP_599191.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta subunit [Rattus norvegicus] >gi|114562|sp|P10719|ATPB_RAT ATP synthase subunit beta, mitochondrial precursor >gi|71681130|gb|AAH99743.1| ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [Rattus norvegicus] (529 aa)
Score = 1566, Expect = 4.9e-172, Identities = 308/467 (65%), Positives = 364/467 (77%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G +D LPEQAF+ VG I+EAV KA +L +
  S:    55 KAGTATGQIVAVIGAVVDVQFDEG--LPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGDYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|23272966|gb|AAH37127.1| Atp5b protein [Mus musculus] (533 aa)
Score = 1566, Expect = 5.0e-172, Identities = 307/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    65 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 529
>gi|74198645|dbj|BAE39797.1| unnamed protein product [Mus musculus] (529 aa)
Score = 1566, Expect = 5.2e-172, Identities = 307/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFRVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|32189394|ref|NP_001677.2| ATP synthase, H+ transporting, mitochondrial F1 complex, beta subunit precursor [Homo sapiens] >gi|114549|sp|P06576|ATPB_HUMAN ATP synthase subunit beta, mitochondrial precursor >gi|179281|gb|AAA51809.1| ATP synthase beta subunit precursor [Homo sapiens] >gi|16741373|gb|AAH16512.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Homo sapiens] >gi|119617358|gb|EAW96952.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Homo sapiens] >gi|123981364|gb|ABM82511.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [synthetic construct] >gi|123996207|gb|ABM85705.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [synthetic construct] >gi|158255606|dbj|BAF83774.1| unnamed protein product [Homo sapiens] (529 aa)
Score = 1566, Expect = 5.3e-172, Identities = 308/467 (65%), Positives = 365/467 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    55 KAGAATGRIVAVIGAVVDVQFDEG--LPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|146286055|sp|A2RMI2|ATPB_LACLM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|6048355|gb|AAF02210.1| H+-ATPase cytoplasmic F1-part beta-subunit [Lactococcus lactis subsp. cremoris] >gi|15963437|dbj|BAB69471.1| H+-ATPase beta subunit [Lactococcus lactis subsp. lactis] (469 aa)
Score = 1566, Expect = 5.5e-172, Identities = 301/462 (65%), Positives = 366/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCL----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F   ++LP I + L     V     ++ LE A  +GD  VR IA+  T+GL R  +V +    + VPVG++ LGR+FNVLG  IDG E+ P   +  PIH+K P+FD+ S   E+  TGIKV+DLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLDA T L+R +  +GI+PA++PL S+SR L P IVG  HY+VA+ VQ +LQR+ ELQDIIAILG+DEL+D++KI+V RARRI+ FLSQ F VAE+F+G  G YVP+  T+  FKEIL+GK+D++PE AF  VG I++ + KAK +
  S:     1 MSSGKITQVIGPVVDVEFGSDAKLPEINNALIVYKDVNGLKTKITLEVALELGDGAVRTIAMESTDGLTRGLEVLDTGKAVSVPVGESTLGRVFNVLGDVIDGGEDFPADAERNPIHKKAPTFDELSTANEVLVTGIKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMGIYPAVDPLASSSRALTPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKILVGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPIEDVLAKAKSM 467
>gi|196158878|ref|YP_002128367.1| ATP synthase subunit B [Alteromonas macleodii 'Deep ecotype'] >gi|88773291|gb|EAR04559.1| ATP synthase subunit B [Alteromonas macleodii 'Deep ecotype'] >gi|196114657|gb|ACG68373.1| ATP synthase subunit B [Alteromonas macleodii 'Deep ecotype'] (461 aa)
Score = 1566, Expect = 5.8e-172, Identities = 301/461 (65%), Positives = 372/461 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKR 466
           ++ GKV Q+IG VVD+ F + + +PR+YD L V    L+G  L LE  Q +G  +VR IALG T+GL R   V N  +PI VPVG   LGR+ +VLG PID    + ++ ++ IHR+ PS++DQS+++E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+LGI+PA++PL+STSR LDP ++G  HY VA GVQ +LQR+ EL+DIIAILG+DEL++EDK +V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI  FK ILDG++D LPEQAF+ VG+I+EA+EKAK+
  S:     1 MSQGKVVQIIGAVVDIEFPQDA-VPRVYDALRVTEGDLSG--LTLEVQQQLGGGVVRGIALGTTDGLKRGLTVENTGNPIMVPVGTKTLGRIMDVLGNPIDEAGPIGEEERMSIHREAPSYEDQSSSVELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGFSVFAGVGERTREGNDFYHEMNDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVIGQEHYDVARGVQTVLQRYKELKDIIAILGMDELSEEDKQVVSRARKIQRFLSQPFFVAEVFTGAPGKYVSLKDTISGFKGILDGEYDHLPEQAFYMVGSIEEALEKAKK 460
>gi|162146520|ref|YP_001600979.1| F0F1 ATP synthase subunit beta [Gluconacetobacter diazotrophicus PAl 5] >gi|187595530|ref|ZP_02981794.1| ATP synthase F1, beta subunit [Gluconacetobacter diazotrophicus PAl 5] >gi|190358669|sp|A9H9A8.1|ATPB_GLUDA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|161785095|emb|CAP54639.1| ATP synthase subunit beta [Gluconacetobacter diazotrophicus PAl 5] >gi|187492365|gb|EDU30302.1| ATP synthase F1, beta subunit [Gluconacetobacter diazotrophicus PAl 5] (493 aa)
Score = 1565, Expect = 6.0e-172, Identities = 302/461 (65%), Positives = 362/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G+V QV G VVDV F     LP I D L V   G+ + LE AQ IG+  VRCIA+  T+GL R  +V      I VPVG   LGR+ NV+G+PID +  +    + PIHRK PSFD+Q+   EI  TGIKV+DLL PY +GGK+GLFGGAGVGKTV++QELI+NIAK H G+SVFAGVGERTREGNDLYYEM   GVI          K ALV+GQMNEPPGAR R+AL+ L++AEYFRD + QDVL F+DNIFRFTQAG+EVSALLGR+PSAVGYQPTLATEMG LQERI STK GSITSVQA+YVPADDLTDPAPA TF HLDA TVL+R+IA +GI+PA++PL+STSR LDP IVG  HY+VA  VQ ILQ +  LQDIIAILG+DEL+++DK +V RARRI+ FLSQPF VAE F+G  GK V L DT++SFK I+ G++D LPE AF+ VG+I+EAV KA+++K+
  S:    24 GRVTQVRGAVVDVQF--EGTLPHILDALHVTFNGQTVVLEVAQEIGEHEVRCIAMDTTDGLMRGTEVVATGGQITVPVGPGTLGRILNVIGEPIDERGPVKSDKRYPIHRKAPSFDEQAAATEILVTGIKVVDLLCPYLKGGKVGLFGGAGVGKTVIIQELINNIAKAHGGVSVFAGVGERTREGNDLYYEMQDAGVIKLGEDTTEGSKVALVYGQMNEPPGARARIALSGLSLAEYFRDEEGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPAATFAHLDATTVLNRSIAEMGIYPAVDPLDSTSRSLDPKIVGEEHYQVARDVQRILQTYKSLQDIIAILGMDELSEDDKQVVARARRIQRFLSQPFHVAEVFTGAPGKLVSLEDTVRSFKAIVAGEYDHLPEGAFYMVGSIEEAVAKAEKMKE 491
>gi|89257058|ref|YP_514420.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. holarctica] >gi|115315414|ref|YP_764137.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. holarctica OSU18] >gi|156503268|ref|YP_001429333.1| F0F1 ATP synthase subunit beta [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009445|ref|ZP_02274376.1| ATP synthase F1, beta subunit [Francisella tularensis subsp. holarctica FSC200] >gi|122324600|sp|Q0BK84.1|ATPB_FRATO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166201704|sp|A7NEH4.1|ATPB_FRATF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573537|sp|Q2A1I2|ATPB_FRATH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|89144889|emb|CAJ80234.1| ATP synthase beta chain [Francisella tularensis subsp. holarctica LVS] >gi|115130313|gb|ABI83500.1| H(+)-transporting two-sector ATPase [Francisella tularensis subsp. holarctica OSU18] >gi|134254106|gb|EBA53200.1| ATP synthase beta chain [Francisella tularensis subsp. holarctica 257] >gi|156253871|gb|ABU62377.1| ATP synthase F1, beta subunit [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122865|gb|EDO66982.1| ATP synthase [Francisella tularensis subsp. holarctica FSC022] (458 aa)
Score = 1565, Expect = 6.1e-172, Identities = 299/462 (64%), Positives = 370/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG V+DV F   +  P++YD L+V  AG  L LE  Q IGD +VR IA+G ++GL R  +V N N PI VPVG   LGR+ NVLG+PID    +    +  IH+ PP++D+ + + EI ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSG SVF+GVGERTREGND YYEM    V+DK +LV+GQMNEPPG R+RVAL+ LT+AE FRD + +DVL+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP +VG +HY+ A  VQ +LQR+ EL+DIIAILG+DEL+DEDK IV+RAR+I+ FLSQPF VAE F+G  GK+V L DT+ SFK I++G++D LPEQAF+ VG+IQEA+EKAK L
  S:     1 MSTGKIIQVIGAVIDVEFARDNT-PKVYDALNVVEAG--LVLEVQQQIGDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTEKRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELINNIAKEHSGYSVFSGVGERTREGNDFYYEMKYSNVLDKVSLVYGQMNEPPGNRLRVALSGLTIAEGFRD-EKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVVGQDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL 458
>gi|194770714|ref|XP_001967434.1| GF21882 [Drosophila ananassae] >gi|190618410|gb|EDV33934.1| GF21882 [Drosophila ananassae] (506 aa)
Score = 1565, Expect = 6.3e-172, Identities = 310/461 (67%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+  VIG VVDV F ++  LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +  +PI +PVG   LGR+ NV+G+PID +  +P     PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+ GVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL  TI+ F +IL G++D LPE AF+ VG I+E VEKA RL K
  S:    39 GKIVAVIGAVVDVQFDDN--LPPILNALEVDNRTPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGYPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAPIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSQILAGEYDHLPEVAFYMVGPIEEVVEKADRLAK 503
>gi|74139650|dbj|BAE40961.1| unnamed protein product [Mus musculus] (529 aa)
Score = 1565, Expect = 6.5e-172, Identities = 307/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFGEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|31980648|ref|NP_058054.2| ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [Mus musculus] >gi|20455479|sp|P56480|ATPB_MOUSE ATP synthase subunit beta, mitochondrial precursor >gi|12845667|dbj|BAB26846.1| unnamed protein product [Mus musculus] >gi|26350917|dbj|BAC39095.1| unnamed protein product [Mus musculus] >gi|28302366|gb|AAH46616.1| ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [Mus musculus] >gi|74139742|dbj|BAE31720.1| unnamed protein product [Mus musculus] >gi|74141200|dbj|BAE35911.1| unnamed protein product [Mus musculus] >gi|74151428|dbj|BAE38829.1| unnamed protein product [Mus musculus] >gi|74151806|dbj|BAE29691.1| unnamed protein product [Mus musculus] >gi|74185118|dbj|BAE39161.1| unnamed protein product [Mus musculus] >gi|74189002|dbj|BAE39267.1| unnamed protein product [Mus musculus] >gi|74195964|dbj|BAE30540.1| unnamed protein product [Mus musculus] >gi|74198581|dbj|BAE39769.1| unnamed protein product [Mus musculus] >gi|74213430|dbj|BAE35529.1| unnamed protein product [Mus musculus] >gi|74216691|dbj|BAE37764.1| unnamed protein product [Mus musculus] >gi|74216945|dbj|BAE26587.1| unnamed protein product [Mus musculus] >gi|74219911|dbj|BAE40537.1| unnamed protein product [Mus musculus] >gi|74223230|dbj|BAE40749.1| unnamed protein product [Mus musculus] >gi|74223633|dbj|BAE28692.1| unnamed protein product [Mus musculus] >gi|74227679|dbj|BAE35689.1| unnamed protein product [Mus musculus] >gi|148692595|gb|EDL24542.1| ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [Mus musculus] (529 aa)
Score = 1565, Expect = 6.6e-172, Identities = 307/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|119416492|emb|CAI34837.1| ATP synthase beta chain, mitochondrial precursor [Polytomella sp. Pringsheim 198.80] (574 aa)
Score = 1565, Expect = 7.1e-172, Identities = 302/470 (64%), Positives = 360/470 (76%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI--------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKATVEEK 475
           I  G V QVIGPVVDV F    +LP I   L V+     L LE AQ +GD+ VRCIA+  T+GL R +KV +   PI+VPVG+  LGR+ NV+G+P+D +  +       IHR+ P F +QS   EI  TGIKV+DLL PY RGGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+ GVI         K  LV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQA SEVSALLGR+PSAVGYQPTLAT++G LQERI +T  GSITSVQA+YVPADDLTDP PATTF HLDA TVL R+IA LGI+PA++PL+STSR+ +PN++G  HY VA GVQ +LQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GKYV L+DTI  F+ +L GK+DDLPE AF+ VG I+E  EKA ++ K     K
  S:    35 IDAGYVSQVIGPVVDVRF--DGELPSILSSLEVEGHSVRLVLEVAQHMGDNTVRCIAMDSTDGLVRGQKVVDTGSPIKVPVGRGTLGRIMNVIGEPVDEQGPIDAADIWSIHREAPEFTEQSTEQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGAERGNSKCTLVYGQMNEPPGARARVALTGLTVAEYFRDIEGQDVLLFVDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTTKGSITSVQAVYVPADDLTDPGPATTFAHLDATTVLSRSIAELGIYPAVDPLDSTSRMRNPNVIGAEHYNVARGVQKVLQDYKNLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGTPGKYVDLADTISGFQGVLTGKYDDLPEMAFYMVGDIKEVKEKADKMAKDIASRK 510
>gi|195450700|ref|XP_002072595.1| GK13685 [Drosophila willistoni] >gi|194168680|gb|EDW83581.1| GK13685 [Drosophila willistoni] (506 aa)
Score = 1565, Expect = 7.4e-172, Identities = 310/461 (67%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+  VIG VVDV F ++  LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +  +PI +PVG   LGR+ NV+G+PID +  +P     PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+ GVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL  TI+ F +IL G++D LPE AF+ VG I+E VEKA RL K
  S:    39 GKIVAVIGAVVDVQFDDN--LPPILNALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGYPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAPIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSQILGGEYDHLPEVAFYMVGPIEEVVEKADRLAK 503
>gi|15673746|ref|NP_267920.1| F0F1 ATP synthase subunit beta [Lactococcus lactis subsp. lactis Il1403] >gi|22653662|sp|Q9CES0|ATPB_LACLA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|12724786|gb|AAK05862.1|AE006406_6 ATP synthase alpha subunit (EC 3.6.1.34) [Lactococcus lactis subsp. lactis Il1403] (469 aa)
Score = 1565, Expect = 7.6e-172, Identities = 301/462 (65%), Positives = 365/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCL----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IGPVVDV F   ++LP I + L     V     ++ LE A  +GD  VR IA+  T+GL R  +V +    + VPVG+  LGR+FNVLG  IDG EE     +  PIH+K P+FD+ S   E+  TGIKV+DLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLDA T L+R +  +GI+PA++PL S+SR L P IVG  HY+VA+ VQ +LQR+ ELQDIIAILG+DEL+D++KI+V RARRI+ FLSQ F VAE+F+G  G YVP+  T+  FKEIL+GK+D++PE AF  VG I++ +EKAK +
  S:     1 MSSGKITQIIGPVVDVEFGSDAKLPEINNALIVYKDVNGLKTKITLEVALELGDGAVRTIAMESTDGLTRGLEVLDTGKAVSVPVGEATLGRVFNVLGDVIDGGEEFAADAERNPIHKKAPTFDELSTANEVLVTGIKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMGIYPAVDPLASSSRALTPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKILVGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPIEDVLEKAKSM 467
>gi|66773080|ref|NP_001019600.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Danio rerio] >gi|66267496|gb|AAH95620.1| Zgc:111961 [Danio rerio] (517 aa)
Score = 1564, Expect = 8.2e-172, Identities = 307/461 (66%), Positives = 362/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K   PIH + P F D S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++ DK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ FK IL G++D LPEQAF+ VG I+E V+KA++L +
  S:    50 GRIVAVIGAVVDVQFDEG--LPPILNALEVAGRDSRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGAPIRIPVGPETLGRIMNVIGEPIDERGPISTKQTAPIHAEAPEFTDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGTEHYDVARGVQKILQDYKSLQDIIAILGMDELSEGDKLTVARARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFKSILGGEYDALPEQAFYMVGPIEEVVQKAEKLAE 514
>gi|37522139|ref|NP_925516.1| F0F1 ATP synthase subunit beta [Gloeobacter violaceus PCC 7421] >gi|81709449|sp|Q7NHG7|ATPB_GLOVI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|35213139|dbj|BAC90511.1| ATP synthase beta subunit [Gloeobacter violaceus PCC 7421] (478 aa)
Score = 1564, Expect = 8.5e-172, Identities = 304/460 (66%), Positives = 355/460 (77%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE-----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + Q+IGPVVD  F E   LP IY+ L ++   +      L  E  QL+GD  VR +++  T+G+ R  K  +   PI VPVGK+ LGR+FNVLG+PID    +    +  IHR  P F D     EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELIHNIAKEHSG+SVF GVGERTREGNDLY E  +  V+ + ALV+GQMNEPPGARMRV LTALTMAEYFRD   QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL TEMG LQERI ST  GSITSVQA+YVPADDLTDPAPATTF HLDA TVL R +A+LGI+PA++PL STS +L P +VG  HY +A GVQ+ LQR+ +LQDIIAILG+DEL+ EDK++V RAR+++ FLSQPF VAE F+G  GKYV L  TI  FK +L G+ DDLPEQAF+ VG + EA+EKAK+LK
  S:    10 GYITQIIGPVVDAEFPEGD-LPAIYNALLIEGKTDSGLDIRLTCEVQQLLGDKKVRAVSMSTTDGMVRGMKAIDTGAPITVPVGKSTLGRIFNVLGEPIDELGPVEIVDKFSIHRSAPKFTDLVTQPEIFETGIKVIDLLAPYRKGGKIGLFGGAGVGKTVLIQELIHNIAKEHSGVSVFGGVGERTREGNDLYNEFKESNVLGQVALVYGQMNEPPGARMRVGLTALTMAEYFRDVSKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGDLQERITSTNEGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQLASLGIYPAVDPLSSTSTMLQPAVVGEEHYNIARGVQSTLQRYKDLQDIIAILGLDELSPEDKLVVNRARKLQRFLSQPFHVAEIFTGSPGKYVSLDKTIAGFKRVLQGEFDDLPEQAFYLVGDLDEALEKAKKLK 473
>gi|142006|gb|AAA21993.1| ATPase beta-subunit (471 aa)
Score = 1564, Expect = 8.7e-172, Identities = 302/467 (64%), Positives = 368/467 (78%)
  Q:     2 KKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFL--EAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           +K NI Y  + Q+IGPVVDV F  + +LP+IY+ L++K    AG++L L  E  QL+GD+ +R +A+  T+GL R  +V +   PI VPVGK  LGR+FNVLG+P+D +  +  +  LPIHR  P   +      +FETGIKV+DLLTPY RGGKIGLFGGAGVGKTV++ ELI+NIA +H G+SVFAGVGERTREGNDLY EMI      K ALV+GQMNEPPGARMRV L+ LTMAEYFRD + QDVLLFIDNIFRF QAGSEVSALLGRMPSAVGYQPTL T++GQLQERI ST  GSITS+QA+YVPADDLTDPAPATTF HLD  TVL R +A+ GI+PA++PL STS +L PNIVG  HY  A  VQ+ LQR+ ELQDIIAILG+DEL++ED+++V RAR++  FLSQPFFVAE F+G  GKYV L DTI+ F++IL G+ DDLPEQAF+ VG I EA+ KA+++K
  S:     6 EKTNIGY--ITQIIGPVVDVKF-PNGKLPQIYNALTIKGTNEAGQQLNLTVEVQQLLGDNQIRAVAMSSTDGLVRGLEVVDTGAPISVPVGKATLGRIFNVLGEPVDNRGPVNNQETLPIHRPAPKLTELETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMID----SKNALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLLVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDINEAIAKAEKIK 470
>gi|24376219|ref|NP_720263.1| F0F1 ATP synthase subunit beta [Shewanella oneidensis MR-1] >gi|81588954|sp|Q8E8C0|ATPB_SHEON ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|24351279|gb|AAN57706.1|AE015907_4 ATP synthase F1, beta subunit [Shewanella oneidensis MR-1] (463 aa)
Score = 1564, Expect = 8.9e-172, Identities = 303/463 (65%), Positives = 365/463 (78%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + + +P++YD L +   G    L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG PID    + ++ +  IHR  PS+++QSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+D+DK+ V RAR+I  FLSQPF VAE F+G  GKYV L DTI+ FK IL G+ D +PEQAF+ VG+I EAVEKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQVYDALKITGEGSCNGLVLEVQQQLGGGVVRTIAMGTSDGLRRGLEVVNSGSPISVPVGTATLGRIMNVLGDPIDEAGAIGEEERYVIHRAAPSYEEQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDDDKMTVSRARKIERFLSQPFHVAEVFTGSPGKYVSLKDTIRGFKGILSGEFDHIPEQAFYMVGSIDEAVEKANKKK 463
>gi|118054097|ref|ZP_01522638.1| ATP synthase F1, beta subunit [Comamonas testosteroni KF-1] >gi|117998519|gb|EAV12682.1| ATP synthase F1, beta subunit [Comamonas testosteroni KF-1] (469 aa)
Score = 1564, Expect = 9.2e-172, Identities = 302/459 (65%), Positives = 369/459 (80%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q IG VVDV F    Q+P++YD L  KL G  L LE  Q +GD +VR IALG ++GL R   VTN  +PI VPVGK  LGR+ +VLG PID + ++ +    PIHRK P++D+ S + E+ ETGIKVIDL++P+A+GGK+GLFGGAGVGKTV + ELI+NIAK H GLSVFAGVGERTREGND Y+EM   GV++       K A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG+LQERI STK GSITS+QA+YVPADDLTDP+PATTF HLD+  VL R+IA+LGI+PA++PL+STSR LDP +VG  HYKVA  VQ  LQR+ EL+DIIAILG+DELA EDK++V RAR+++ FLSQPF VAE F+G  GKYVPLS+TI+ FK I++G+ D LPEQAF+ VGTI EA EKAK+L
  S:     6 GKIVQCIGAVVDVEFAHG-QVPKVYDAL--KLEGTALTLEVQQQLGDGVVRTIALGSSDGLKRGLMVTNTGNPITVPVGKATLGRIMDVLGNPIDERGDVDQALTAPIHRKAPAYDELSPSQELLETGIKVIDLISPFAKGGKVGLFGGAGVGKTVNMMELINNIAKGHGGLSVFAGVGERTREGNDFYHEMSDAGVVNQANLNESKVAMVYGQMNEPPGNRLRVALTGLTMAEAFRD-EGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLGIYPAVDPLDSTSRQLDPQVVGEEHYKVARQVQGTLQRYKELRDIIAILGMDELAPEDKLVVSRARKMQRFLSQPFHVAEVFTGAPGKYVPLSETIRGFKMIVNGEADHLPEQAFYMVGTIDEAFEKAKKL 467
>gi|34500026|gb|AAQ73595.1| ATP synthase beta subunit [Actinobacillus rossii] (445 aa)
Score = 1564, Expect = 9.3e-172, Identities = 297/449 (66%), Positives = 361/449 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFV 454
           ++ GK+ Q+IG V+DV F + + +P+IYD L V+ AG  L LE  Q +G  +VRCIALG ++GL R  KV N  +PI VPVG   LGR+ NVLG+PID K E+  +    IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ ILQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK ILDG++D +PEQAF+ V
  S:     1 MSAGKIVQIIGAVIDVEFPQDA-VPKIYDALKVEDAG--LTLEVQQQLGGGVVRCIALGTSDGLKRGLKVNNTGNPISVPVGTKTLGRIMNVLGEPIDQKGEIGAEENWAIHRAAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGFSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEYDHIPEQAFYMV 445
>gi|167627186|ref|YP_001677686.1| F0F1 ATP synthase subunit beta [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189081334|sp|B0TWS7.1|ATPB_FRAP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|167597187|gb|ABZ87185.1| ATP synthase F1, beta subunit [Francisella philomiragia subsp. philomiragia ATCC 25017] (458 aa)
Score = 1564, Expect = 9.7e-172, Identities = 300/462 (64%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIG V+DV F+  +  P++YD L+VK A   L LE  Q IGD +VR IA+G ++GL R   V N N PI VPVG   LGR+ NVLG+PID    +       IH+ PP++D+ + + EI ETGIKV+DL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAKEHSG SVFAGVGERTREGND YYEM    V+DK ALV+GQMNEPPG R+RVAL+ LT+AE FRD + +DVL+FIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF+HLDA  VL R IA LGI+PA++PL+STSR LDP +VG +HY+ A  VQ +LQR+ EL+DIIAILG+DEL+DEDK  V+RAR+I+ FLSQPF VAE F+G  GK+V L DT+ SFK I++G++D LPEQAF+ VG+IQEA+EKAK L
  S:     1 MSTGKIIQVIGAVIDVEFSRDNT-PKVYDALNVKEA--NLVLEVQQQIGDGVVRTIAMGSSDGLRRGMVVENTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIQYTETRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELINNIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVALVYGQMNEPPGNRLRVALSGLTIAEGFRD-EKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTSRQLDPLVVGHDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKRTVDRARKIQRFLSQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL 458
>gi|15677764|ref|NP_274928.1| F0F1 ATP synthase subunit beta [Neisseria meningitidis MC58] >gi|81857552|sp|Q9JXQ2|ATPB_NEIMB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|7227192|gb|AAF42263.1| ATP synthase F1, beta subunit [Neisseria meningitidis MC58] (465 aa)
Score = 1564, Expect = 9.7e-172, Identities = 301/462 (65%), Positives = 366/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQ-----DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG VVDV F     +PR+YD L  KL    L LE  QL+GD +VR IA+G ++GL R   V+N   PI VPVGK  LGR+ +VLG P+D    +       IH+  P FD+ S+T E+ ETGIKVIDLL P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND Y+EM    V+DK A+V+GQMNEPPG R+RVALT LTMAEYFRD  ++     DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG+LQERI ST+TGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+LGI+PA++PL+STSR LDP ++G  HY VA GVQ+ LQ++ EL+DIIAILG+DEL+DEDK+ V RAR+I+ FLSQPF VAE F+G  GKYV L DTI  FK IL+G++D LPEQAF+ VG+I+EAVEKAK L
  S:     1 MSQGKIVQIIGAVVDVEFPRD-MIPRVYDAL--KLDENGLTLEVQQLLGDGVVRAIAMGSSDGLKRGMTVSNTGAPITVPVGKGTLGRIVDVLGTPVDEAGPIDTDKSRAIHQAAPKFDELSSTTELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEYFRDEKDENGKGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGRLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPMVLGQEHYDVARGVQSTLQKYKELRDIIAILGMDELSDEDKLTVMRARKIQRFLSQPFHVAEVFTGSPGKYVALRDTIAGFKAILNGEYDHLPEQAFYMVGSIEEAVEKAKTL 464
>gi|118573778|sp|Q5GRU7|ATPB_WOLTR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (480 aa)
Score = 1563, Expect = 1.0e-171, Identities = 305/463 (65%), Positives = 368/463 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLA--GEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKAT 471
           G+  +V   VVD+ F    +LPRI++ L  KL   G+EL LE +Q IGD+IVRCIA+  T G++RN++  +   PI VPVG++ LGR+FNV+G+ ID    L  K  L  IHR PPSF +Q    E+  TGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIAK H G SVFAGVGERTREGNDLY+EMI   VI+       +  LV+GQMNEPPGAR RVALTALTMAEYFRDH+NQDVL F+DNIFRFTQAGSE+SALLGRMPSAVGYQPTLAT+MG +QERIAST +GSITSVQAIYVPADDLTDPAPA TF+HLD+ TVL R IA +GI+PA++PL+STS+ L   IVG  HYKV   V+ ILQ +  LQDIIAILG+DEL+DEDKI V+RAR+I+ F SQPF VAE F+G+ GK+V LSDT+ SFK I++G++D LPE AF+ VG I EA++KA+ +K  T
  S:     4 GRTVKVTQAVVDLKF--EGELPRIFNALKSKLEYRGKELILEVSQHIGDNIVRCIAMDSTNGVSRNDEFVDTGAPISVPVGRSTLGRIFNVVGEVIDECGPLKGKYDLESIHRVPPSFTEQKIQEEVLVTGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKAHKGFSVFAGVGERTREGNDLYHEMITSNVINVNEHEKSQAVLVYGQMNEPPGARARVALTALTMAEYFRDHENQDVLFFVDNIFRFTQAGSEISALLGRMPSAVGYQPTLATDMGAMQERIASTTSGSITSVQAIYVPADDLTDPAPAATFSHLDSTTVLSRQIAEMGIYPAVDPLDSTSQSLSAEIVGEEHYKVTSEVKRILQTYKSLQDIIAILGMDELSDEDKITVDRARKIQKFFSQPFHVAEVFTGMPGKFVSLSDTVSSFKGIVEGEYDHLPEAAFYMVGNIDEAIKKAELIKDET 474
>gi|195402199|ref|XP_002059694.1| ATPsyn-beta [Drosophila virilis] >gi|194155908|gb|EDW71092.1| ATPsyn-beta [Drosophila virilis] (506 aa)
Score = 1563, Expect = 1.0e-171, Identities = 310/461 (67%), Positives = 361/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI---DKT---ALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           GK+  VIG VVDV F ++  LP I + L V      L LE AQ +G++ VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +P     PIH + P F D S   EI  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY EMI+ GVI   DKT   ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNI+G  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGK VPL  TI+ F +IL G++D LPE AF+ VG I+E VEKA RL K
  S:    39 GKIVAVIGAVVDVQFDDN--LPPILNALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGSPIRIPVGAETLGRIMNVIGEPIDERGPIPSAKTSPIHAEAPEFVDMSVEQEILVTGIKVVDLLAPYCKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSQILAGEYDHLPEIAFYMVGPIEEVVEKADRLAK 503
>gi|74197074|dbj|BAE35088.1| unnamed protein product [Mus musculus] (529 aa)
Score = 1563, Expect = 1.0e-171, Identities = 307/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|6729935|pdb|1MAB|B Chain B, Rat Liver F1-Atpase >gi|93279423|pdb|2F43|B Chain B, Rat Liver F1-Atpase (479 aa)
Score = 1563, Expect = 1.0e-171, Identities = 308/467 (65%), Positives = 364/467 (77%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G +D LPEQAF+ VG I+EAV KA +L +
  S:     5 KAGTATGQIVAVIGAVVDVQFDEG--LPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGDYDHLPEQAFYMVGPIEEAVAKADKLAE 475
>gi|154173677|ref|YP_001408809.1| F0F1 ATP synthase subunit beta [Campylobacter curvus 525.92] >gi|190358268|sp|A7H017.1|ATPB_CAMC5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|112803722|gb|EAU01066.1| ATP synthase F1, beta subunit [Campylobacter curvus 525.92] (465 aa)
Score = 1563, Expect = 1.1e-171, Identities = 300/460 (65%), Positives = 363/460 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE----ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           G + QV+GPVVDV F +   LP+I + + V    E     L LE A  +GD+ VR IA+  +EGL R  + T    PI VPVG+ VLGR+FNV+G  ID  E +       IHR PP F++QS   EIFETGIKV+DLL PYA+GGK+GLFGGAGVGKTV++ ELIHN+A +HSG SVFAGVGERTREGNDLY+EM +  V+DK AL +GQMNEPPGAR R+ALT LTMAEYFRD    DVL+FIDNIFRF+Q+G+E+SALLGR+PSAVGYQPTLA+EMG+ QERI STK GSITSVQA+YVPADDLTDPAPAT F HLDA TVL+R IA  GI+PA++PL+STSR+LDP I+G +HYKVA GVQ +LQ++ +LQDIIAILG+DEL++EDK+ V+RAR+I  FLSQPFFVAE F+G  GKYV L + I  FK ILDGK+D LPE AF+ VG I EA+ KA++LK
  S:     3 GVISQVMGPVVDVDFND--YLPKINEAIEVYFEVEGKKNRLILEVAAHLGDNRVRTIAMDMSEGLTRGLEATALGAPISVPVGEKVLGRIFNVVGDLIDEGEGVEFDKHWSIHRDPPPFEEQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYHEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGAEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPQILGEDHYKVARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVDRARKIERFLSQPFFVAEVFTGSPGKYVSLEENIAGFKGILDGKYDSLPEAAFYMVGNIDEALAKAEKLK 464
>gi|28940|emb|CAA27246.1| unnamed protein product [Homo sapiens] >gi|219654|dbj|BAA00016.1| F1 beta subunit [Homo sapiens] >gi|355039|prf||1202298A ATPase beta,F1 (539 aa)
Score = 1563, Expect = 1.1e-171, Identities = 307/465 (66%), Positives = 364/465 (78%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           K     G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMN+PPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L
  S:    65 KAGAATGRIVAVIGAVVDVQFDEG--LPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNQPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKL 533
>gi|148975564|ref|ZP_01812435.1| F0F1 ATP synthase subunit beta [Vibrionales bacterium SWAT-3] >gi|145964992|gb|EDK30243.1| F0F1 ATP synthase subunit beta [Vibrionales bacterium SWAT-3] (461 aa)
Score = 1563, Expect = 1.1e-171, Identities = 297/462 (64%), Positives = 368/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKL-AGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ +VIG VVDV F+ ++  PR+YD L V       L LE  Q +G +IVRCIA+G ++GL R   V N   PI VPVG+  LGR+ NVLG+PID   E+ +K    IHR+ PS+++++N+ E+ ETG+KVIDL+ P+A+GGKIGLFGGAGVGKTV + ELI+NIAK HSGLSVF GVGERTREGND YYEM + GV+DK A+V+GQMNEPPG R+RVALT LTMAE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STK GSITS+QA+YVPADDLTDP+PATTF HLDA  VL RNIAALG++PAI+PL+STSR LDP IVG  HY +A  VQ  LQR+ EL+DIIAILG+DEL+ EDK +V RAR+I  FL+QP+ VAE F+G  G +VPLS+T++ FK +L+G++DD+PEQAF + G+I E +EKAK L
  S:     1 MSVGKIVKVIGAVVDVEFSGNNS-PRVYDVLKVTSDEASSLVLEVQQQLGGNIVRCIAMGTSDGLRRGLTVENTGSPITVPVGEETLGRIMNVLGQPIDECGEIGQKENYEIHREAPSYEEKANSTELLETGVKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELINNIAKAHSGLSVFTGVGERTREGNDFYYEMKEAGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAERFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKQGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRNIAALGLYPAIDPLDSTSRQLDPLIVGQEHYDIAQTVQTTLQRYKELKDIIAILGMDELSTEDKQVVSRARKIERFLTQPYHVAEVFTGQKGVFVPLSETLRGFKGLLNGEYDDIPEQAFLYCGSIDEVLEKAKSL 461
>gi|50545874|ref|XP_500475.1| hypothetical protein [Yarrowia lipolytica] >gi|49646341|emb|CAG82701.1| unnamed protein product [Yarrowia lipolytica CLIB122] (556 aa)
Score = 1563, Expect = 1.1e-171, Identities = 303/454 (66%), Positives = 359/454 (79%)
  Q:    14 VIGPVVDVIFTESSQLPRIYDCLSV-KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           VIG VVDV F E   LP I + L++ +  G +L LE AQ +G++ VR IA+  TEGL R   V +   PI +PVG+  LGR+ NV G+PID +  +     LPIH  PP+F +QS T E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K  LVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +T+ GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD ++VG  HY VA  VQ  LQ +  LQDIIAILG+DEL+++DK+ VERAR+I+ FLSQPF VAE F+GI G+ V L DT++SFKEILDGKHD LPE AF+ VG I+E V KA++L
  S:    93 VIGAVVDVQF-EQDNLPAILNALTIDRGEGNKLVLEVAQHLGENTVRTIAMDGTEGLVRGTSVADTGAPITIPVGRGTLGRIINVCGEPIDERGPIEATKFLPIHADPPTFAEQSTTAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFCGVGERTREGNDLYREMKETGVINLEGESKVTLVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGALQERITTTQKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDIDVVGQEHYDVASNVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFTVAEVFTGIEGRLVSLKDTVRSFKEILDGKHDALPEAAFYMVGGIEEVVAKAEKL 551
>gi|121635590|ref|YP_975835.1| F0F1 ATP synthase subunit beta [Neisseria meningitidis FAM18] >gi|161869279|ref|YP_001598446.1| F0F1 ATP synthase subunit beta [Neisseria meningitidis 053442] >gi|166201721|sp|A1KW11.1|ATPB_NEIMF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081336|sp|A9M123.1|ATPB_NEIM0 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|120867296|emb|CAM11067.1| ATP synthase beta chain [Neisseria meningitidis FAM18] >gi|161594832|gb|ABX72492.1| ATP synthase beta chain [Neisseria meningitidis 053442] (465 aa)
Score = 1563, Expect = 1.2e-171, Identities = 301/462 (65%), Positives = 366/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQ-----DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ Q+IG VVDV F     +PR+YD L  KL    L LE  QL+GD +VR IA+G ++GL R   V+N   PI VPVGK  LGR+ +VLG P+D    +       IH+  P FD+ S+T E+ ETGIKVIDLL P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND Y+EM    V+DK A+V+GQMNEPPG R+RVALT LTMAEYFRD  ++     DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG+LQERI ST+TGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+LGI+PA++PL+STSR LDP ++G  HY VA GVQ+ LQ++ EL+DIIAILG+DEL+DEDK+ V RAR+I+ FLSQPF VAE F+G  GKYV L DTI  FK IL+G++D LPEQAF+ VG+I+EAVEKAK L
  S:     1 MSQGKIVQIIGAVVDVEFPRD-MIPRVYDAL--KLDENGLTLEVQQLLGDGVVRTIAMGSSDGLKRGMTVSNTGAPITVPVGKGTLGRIVDVLGTPVDEAGPIDTDKSRAIHQAAPKFDELSSTTELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEYFRDEKDENGKGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGRLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPMVLGQEHYDVARGVQSTLQKYKELRDIIAILGMDELSDEDKLTVMRARKIQRFLSQPFHVAEVFTGSPGKYVALRDTIAGFKAILNGEYDHLPEQAFYMVGSIEEAVEKAKTL 464
>gi|116512623|ref|YP_811530.1| F0F1 ATP synthase subunit beta [Lactococcus lactis subsp. cremoris SK11] >gi|123125393|sp|Q02XA5.1|ATPB_LACLS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116108277|gb|ABJ73417.1| F0F1-type ATP synthase, beta subunit [Lactococcus lactis subsp. cremoris SK11] (469 aa)
Score = 1563, Expect = 1.2e-171, Identities = 300/462 (64%), Positives = 366/462 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCL----SVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQL-PIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ QVIGPVVDV F   ++LP I + L     V     ++ LE A  +GD  VR IA+  T+GL R  +V +    + VPVG++ LGR+FNVLG  IDG E+ P   +  PIH+K P+FD+ S   E+  TGIKV+DLL PY +GGK+GLFGGAGVGKTVL+QELIHNIA+EH G+SVF GVGERTREGNDLY+EM + GVI+KTA+VFGQMNEPPGARMRVALT LT+AEYFRD   QDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERI STK GS+TS+QAIYVPADD TDPAPAT F HLDA T L+R +  +GI+PA++PL S+SR + P IVG  HY+VA+ VQ +LQR+ ELQDIIAILG+DEL+D++KI+V RARRI+ FLSQ F VAE+F+G  G YVP+  T+  FKEIL+GK+D++PE AF  VG I++ + KAK +
  S:     1 MSSGKITQVIGPVVDVEFGSDAKLPEINNALIVYKDVNGLKTKITLEVALELGDGAVRTIAMESTDGLTRGLEVLDTGKAVSVPVGESTLGRVFNVLGDVIDGGEDFPADAERNPIHKKAPTFDELSTANEVLVTGIKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMGIYPAVDPLASSSRAITPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKILVGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPIEDVLAKAKSM 467
>gi|145301172|ref|YP_001144013.1| F0F1 ATP synthase subunit beta [Aeromonas salmonicida subsp. salmonicida A449] >gi|166201688|sp|A4STP3.1|ATPB_AERS4 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|142853944|gb|ABO92265.1| F0F1 ATP synthase subunit beta [Aeromonas salmonicida subsp. salmonicida A449] (462 aa)
Score = 1563, Expect = 1.2e-171, Identities = 296/462 (64%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSV--KLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ G + Q+IG VVD+ F + + +P++YD + V  +  G+ L LE  Q IG  +VRCI +G ++GL R  +V N    I+VPVG + LGR+ NVLG+PID K  + ++ +  IHR  PS++DQSN+ ++ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM++  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI ST+TGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IAALGI+PA++PL+STSR LDP +VG  HY+ A GVQ +LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I  FLSQPFFVAE F+G  GKYVPL +TI+ F+ IL G++DDLPEQAF+ VG+I E VEK+K+L
  S:     1 MSNGFIVQIIGAVVDIEFPQDA-VPQVYDAVKVVSEGQGQGLVLEVQQQIGGGVVRCITMGSSDGLRRGLEVMNSGKSIQVPVGVSTLGRIMNVLGEPIDEKGPIGEEERWSIHRAAPSYEDQSNSNDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMMESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTRTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAALGIYPAVDPLDSTSRQLDPLVVGKEHYETARGVQTVLQRYKELKDIIAILGMDELSEEDKLTVARARKIERFLSQPFFVAEVFTGSPGKYVPLKETIRGFQGILKGEYDDLPEQAFYMVGSIDEVVEKSKKL 462
>gi|165977082|ref|YP_001652675.1| F0F1 ATP synthase subunit beta [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165877183|gb|ABY70231.1| ATP synthase beta chain [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (457 aa)
Score = 1563, Expect = 1.2e-171, Identities = 296/459 (64%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N  +PI+VPVG   LGR+ NVLG+PID K  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ  LQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D +PEQAF+  G+I E VE+A ++
  S:     4 GKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGLVRCIALGTSDGLKRGLKVENTGNPIQVPVGTKTLGRIMNVLGEPIDEKGPIGEEARWDIHRAAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPLVVGEEHYNVARGVQGTLQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSQGKYVSLKDTIRGFKGILEGEFDHIPEQAFYMAGSIDEVVERASKM 457
>gi|120600835|ref|YP_965409.1| F0F1 ATP synthase subunit beta [Shewanella sp. W3-18-1] >gi|124547713|ref|ZP_01706559.1| ATP synthase F1, beta subunit [Shewanella putrefaciens 200] >gi|146295036|ref|YP_001185460.1| F0F1 ATP synthase subunit beta [Shewanella putrefaciens CN-32] >gi|166222415|sp|A4YCH8.1|ATPB_SHEPC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|166222417|sp|A1RQB0.1|ATPB_SHESW ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|120560928|gb|ABM26855.1| ATP synthase F1, beta subunit [Shewanella sp. W3-18-1] >gi|124508977|gb|EAY53063.1| ATP synthase F1, beta subunit [Shewanella putrefaciens 200] >gi|145566726|gb|ABP77661.1| ATP synthase F1, beta subunit [Shewanella putrefaciens CN-32] (463 aa)
Score = 1563, Expect = 1.3e-171, Identities = 305/463 (65%), Positives = 368/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEE----LFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ G V QVIG VVDV F + + +P++YD L  K+ GE     L LE  Q +G  +VR IA+G ++GL R  +V N   PI VPVG   LGR+ NVLG+PID    + ++ +  IHR  PS++DQSNT E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI+NIAK HSGLSVFAGVGERTREGND YYEM   GV+DK A+V+GQMNEPPG R+RVAL+ LTMAE FRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLDA  VL R IA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ +LQR+ EL+DIIAILG+DEL+D+DK  V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D LPEQAF+ VG+I E +EKA + K
  S:     1 MSTGTVVQVIGAVVDVEFPQDA-VPQVYDAL--KITGEGACNGLVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVVNSGSPISVPVGTATLGRIMNVLGEPIDEAGPIGEEERYVIHRAAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDSGVLDKVAMVYGQMNEPPGNRLRVALSGLTMAEKFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDDDKTTVFRARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILNGEFDHLPEQAFYMVGSIDEVIEKANKKK 463
>gi|33151292|ref|NP_872645.1| F0F1 ATP synthase subunit beta [Haemophilus ducreyi 35000HP] >gi|81836085|sp|Q7VPP0|ATPB_HAEDU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|33147512|gb|AAP95034.1| ATP synthase beta chain [Haemophilus ducreyi 35000HP] (457 aa)
Score = 1563, Expect = 1.3e-171, Identities = 296/459 (64%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N  +PI+VPVG   LGR+ NVLG+PID K  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ  LQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D +PEQAF+  G+I E VE+A ++
  S:     4 GKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGLVRCIALGTSDGLKRGLKVENTGNPIQVPVGTKTLGRIMNVLGEPIDEKGPIGEEARWDIHRAAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPLVVGEEHYNVARGVQGTLQRYKELKDIIAILGMDELSEDDKLVVSRARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHIPEQAFYMAGSIDEVVERASKM 457
>gi|109900593|ref|YP_663848.1| F0F1 ATP synthase subunit beta [Pseudoalteromonas atlantica T6c] >gi|123063994|sp|Q15MU4.1|ATPB2_PSEA6 ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|109702874|gb|ABG42794.1| ATP synthase F1, beta subunit [Pseudoalteromonas atlantica T6c] (461 aa)
Score = 1562, Expect = 1.4e-171, Identities = 298/462 (64%), Positives = 372/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV Q+IG VVD+ F + S +P+IYD L +     + L LE  Q +G  +VR IALG T+GL R   V N    I+VPVGK  LGR+ +VLG PID    + ++ ++ IHR+ P+++DQS+++E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERIASTKTGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+LGI+PA++PL+STSR LDP ++G  HY  A GVQ++LQR+ EL+DIIAILG+DEL++EDK+ V RAR+I+ FLSQPFFVAE F+G  GKYV L DTI  FK IL+G+ DDLPEQAF+ VG+I+EA EKAK++
  S:     1 MSQGKVVQIIGAVVDIEFPQDS-VPKIYDALRITEGDLQGLTLEVQQQLGGGVVRTIALGTTDGLRRGLTVDNTGEAIQVPVGKATLGRIMDVLGNPIDEAGPIGEEERMSIHREAPTYEDQSSSIELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMNESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERIASTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVIGQEHYDTARGVQSVLQRYKELKDIIAILGMDELSEEDKLSVSRARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTISGFKGILEGEFDDLPEQAFYMVGSIEEASEKAKKM 461
>gi|148652009|ref|YP_001279102.1| F0F1 ATP synthase subunit beta [Psychrobacter sp. PRwf-1] >gi|172048450|sp|A5WBW1.1|ATPB_PSYWF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|148571093|gb|ABQ93152.1| ATP synthase F1, beta subunit [Psychrobacter sp. PRwf-1] (475 aa)
Score = 1562, Expect = 1.4e-171, Identities = 297/465 (63%), Positives = 376/465 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQ-----DVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKKA 470
           ++ G++ Q+IG V+DV F  +  +P++YD L V   G +  LE  Q +GD +VR IA+G TEGL R   VTN   PI VPVG+  LGR+ +VLG+PID +  +  + +  IHR+ PS+D+Q+N+ ++ ETGIKVIDLL P+A+GGK+GLFGGAGVGKTV + ELI+NIA +HSGLSVFAGVGERTREGND Y+EM + GV+D       K A+V+GQMNEPPG R+RVALT LTMAEYFRD  ++     DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI ST+TGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+ GI+PAI+PL+STSR LDP ++G  HY VA GVQ +LQR+ EL+DIIAILG+DEL+++DK++V RAR+I+ FLSQPF VAE F+G  GKYV L +TI SF++ILDGK+D+LPEQAF+  G I E V KA+++K A
  S:     1 MSSGRIVQIIGAVIDVEFNRTD-VPQVYDALVVD--GTDTTLEVQQQLGDGVVRTIAMGSTEGLKRGLPVTNTGAPITVPVGEATLGRIMDVLGRPIDEQGPVNSEDKWSIHRQAPSYDEQANSTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELINNIALKHSGLSVFAGVGERTREGNDFYHEMQEAGVVDVENFTNSKVAMVYGQMNEPPGNRLRVALTGLTMAEYFRDQKDENGKGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASQGIYPAIDPLDSTSRQLDPLVIGEEHYNVARGVQEVLQRYKELKDIIAILGMDELSEDDKMVVYRARKIQRFLSQPFHVAEVFTGAPGKYVTLRETISSFRDILDGKYDNLPEQAFYMAGGIDEVVAKAEKMKSA 474
>gi|90409883|ref|ZP_01217900.1| ATP synthase subunit B [Photobacterium profundum 3TCK] >gi|90329236|gb|EAS45493.1| ATP synthase subunit B [Photobacterium profundum 3TCK] (461 aa)
Score = 1562, Expect = 1.5e-171, Identities = 293/462 (63%), Positives = 371/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGE--ELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GK+ +VIG VVDV F + S +PR+YD L++ + G+   L LE  Q IG  +VRCIA+G ++G+ R     N   PI VPVG+  LGR+ NVLG PID   E+ +K   PIHR+PPS+++Q+N+ E+ ETG+KVIDL+ P+A+GGKIGLFGGAGVGKTV + ELI+NIAK HSGLSVF GVGERTREGND YYEM + GV+DK A+V+GQMNEPPG R+RVALT LT+AE FRD + +DVLLFIDNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI ST  GSITS+QA+YVPADDLTDP+PATTF HLDA  VL RNIAALG++PAI+PL+STSR LDP +VG  HY+VA GVQ +LQR+ EL+DIIAILG+DEL+++DK+ V RAR++  FL+QP+ VAE F+G  G +V L DT+  FK +L G++DD+PEQAF + G+I++ +EKAK +
  S:     1 MSTGKIVKVIGAVVDVEFDQDS-VPRVYDALNI-IDGDNSSLVLEVQQQIGSGVVRCIAMGSSDGMRRGLTAVNTGEPITVPVGEETLGRIMNVLGHPIDECGEIGEKTSYPIHREPPSYEEQANSTELLETGVKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELINNIAKAHSGLSVFTGVGERTREGNDFYYEMKEAGVLDKVAMVYGQMNEPPGNRLRVALTGLTIAERFRD-EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTHKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRNIAALGLYPAIDPLDSTSRQLDPLVVGTEHYEVARGVQTVLQRYKELKDIIAILGMDELSEDDKLTVARARKVERFLTQPYHVAEVFTGQPGIFVSLKDTLNGFKGLLSGEYDDVPEQAFLYCGSIEDVIEKAKTM 461
>gi|126134912|ref|XP_001383980.1| F1F0-ATPase complex, F1 beta subunit [Pichia stipitis CBS 6054] >gi|126091178|gb|ABN65951.1| F1F0-ATPase complex, F1 beta subunit [Pichia stipitis CBS 6054] (503 aa)
Score = 1562, Expect = 1.5e-171, Identities = 304/453 (67%), Positives = 358/453 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID-----KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAV 461
           GKV  VIG VVDV F E S LP I + L++K    +L LE AQ +G++ VR IA+  TEGL R   VT+   PI VPVG+  LGR+ NV+G+PID +  +  K + PIH +PPSF +QS   E+ ETGIKV+DLL PYARGGKIGLFGGAGVGKTV +QELI+NIAK H G SVF GVGERTREGNDLY EM + GVI+     K ALVFGQMNEPPGAR RVALT LT+AEYFRD + QDVLLF+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG LQERI +TK GS+TSVQA+YVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA++PL+S SRLLD  +VG  HY VA  VQ  LQ +  LQDIIAILG+DEL++ DK+ VERAR+I+ FLSQPF VAE F+GI G+ V L DT++SFKE+L GK+D LPE AF+ VG I++ V
  S:    36 GKVRAVIGAVVDVQFEEGS-LPAILNALTLKNGDNDLVLEVAQHLGENTVRAIAMDGTEGLVRGAPVTDTGAPISVPVGRGTLGRIINVVGEPIDERGPIECKQRNPIHAEPPSFVEQSTAAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGKEHYDVATNVQQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIQRFLSQPFAVAEVFTGIPGRLVRLQDTVRSFKEVLAGKYDHLPENAFYMVGGIEDVV 492
>gi|53728944|ref|ZP_00134548.2| COG0055: F0F1-type ATP synthase, beta subunit [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209110|ref|YP_001054335.1| F0F1 ATP synthase subunit beta [Actinobacillus pleuropneumoniae L20] >gi|190150977|ref|YP_001969502.1| ATP synthase subunit beta [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166201686|sp|A3N2U4.1|ATPB_ACTP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|126097902|gb|ABN74730.1| ATP synthase subunit beta [Actinobacillus pleuropneumoniae L20] >gi|189916108|gb|ACE62360.1| ATP synthase subunit beta [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (457 aa)
Score = 1562, Expect = 1.6e-171, Identities = 296/459 (64%), Positives = 366/459 (79%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           GK+ Q+IG V+DV F + + +P++YD L V+     L LE  Q +G  +VRCIALG ++GL R  KV N  +PI+VPVG   LGR+ NVLG+PID K  + ++ +  IHR  PS+++QSN+ E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM    V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERI STKTGSITSVQA+YVPADDLTDP+PATTF HLD+  VL RNIA+LGI+PA++PL+STSR LDP +VG  HY VA GVQ  LQR+ EL+DIIAILG+DEL+++DK++V RAR+I  FLSQPFFVAE F+G  GKYV L DTI+ FK IL+G+ D +PEQAF+  G+I E VE+A ++
  S:     4 GKIVQIIGAVIDVEFPQDA-VPKVYDALKVESG---LTLEVQQQLGGGLVRCIALGTSDGLKRGLKVENTGNPIQVPVGTKTLGRIMNVLGEPIDEKGPIGEEARWDIHRAAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTSRQLDPLVVGEEHYNVARGVQGTLQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHIPEQAFYMAGSIDEVVERASKM 457
>gi|3660251|pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan >gi|3660253|pdb|1NBM|F Chain F, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan (480 aa)
Score = 1562, Expect = 1.7e-171, Identities = 308/467 (65%), Positives = 364/467 (77%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K   T G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K    IH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:     9 KAGATTGRIVAVIGAVVDVQFDEG--LPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 479
>gi|87200415|ref|YP_497672.1| F0F1 ATP synthase subunit beta [Novosphingobium aromaticivorans DSM 12444] >gi|118573710|sp|Q2G5N5|ATPB_NOVAD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|87136096|gb|ABD26838.1| ATP synthase F1, beta subunit [Novosphingobium aromaticivorans DSM 12444] (481 aa)
Score = 1562, Expect = 1.7e-171, Identities = 304/461 (65%), Positives = 359/461 (77%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVI------------DKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           + GK+ QVIG VVDV F    +LP I   L     G  L LE AQ +G++ VR IA+  T+GL R + VTN    I VPVG   LGR+ NV+G+PID +  +  +   PIH K P F +QS    I  TGIKVIDLL PYARGGKIGLFGGAGVGKTVL+QELI+NIAK H G+SVFAGVGERTREGNDLY+E +  GVI             K ALVFGQMNEPPGAR RVAL+ LTMAEYFRD + QDVL F+DNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MGQLQERI ST  GSITSVQAIYVPADDLTDPAPAT+F HLDA T L+R I+ LGI+PA++PL+STSR+L P +VG  HY+ A  VQ  LQ++  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+GI GK+V + DT++SFK ++DG++D LPE AF+ VG I EAVEKAK+L
  S:     7 STGKISQVIGAVVDVTF--DGELPAILSALETDNNGNRLVLEVAQHLGENTVRTIAMDSTDGLTRGQPVTNTGAQISVPVGPKTLGRIMNVIGEPIDERGPVGAEQTAPIHAKAPEFIEQSTEAAILVTGIKVIDLLAPYARGGKIGLFGGAGVGKTVLIQELINNIAKGHGGVSVFAGVGERTREGNDLYHEFLDAGVIAKDADGNPTPDGSKVALVFGQMNEPPGARARVALSGLTMAEYFRDQEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGQLQERITSTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLNRAISELGIYPAVDPLDSTSRVLTPAVVGQEHYETARRVQETLQKYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGIPGKFVQVEDTVRSFKAVVDGEYDHLPEAAFYMVGGIDEAVEKAKKL 477
>gi|74204509|dbj|BAE35331.1| unnamed protein product [Mus musculus] (529 aa)
Score = 1562, Expect = 1.7e-171, Identities = 307/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVVKADKLAE 525
>gi|74220566|dbj|BAE31497.1| unnamed protein product [Mus musculus] (529 aa)
Score = 1561, Expect = 1.8e-171, Identities = 307/461 (66%), Positives = 363/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI+VPVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT L +AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKVPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLAVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|74318815|ref|YP_316555.1| F0F1 ATP synthase subunit beta [Thiobacillus denitrificans ATCC 25259] >gi|118573774|sp|Q3SF66|ATPB_THIDA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|74058310|gb|AAZ98750.1| F-type H+-transporting ATP synthase, beta subunit [Thiobacillus denitrificans ATCC 25259] (459 aa)
Score = 1561, Expect = 1.8e-171, Identities = 297/463 (64%), Positives = 367/463 (79%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLK 468
           ++ GK+ Q+IG VVDV F   + +P++ + L  K+   EL  E  Q +GD +VR IA+G T+GL R   V +  +PI VPVG+  LGR+ NVLG P+D    +  +  +PIHRK P++ DQ+ T+EI ETGIKVIDL+ P A+GGK+GLFGGAGVGKTV + ELI NIA +HSG SVFAGVGERTREGND Y+EM +GGV+DK ALV+GQMNEPPG R+RVALT LTMAEYFRD + +DVLLF+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG+LQERI STKTGSITS QA+YVPADDLTDP+PATTF HLDA  VL R +A LGI+PA++PL+STSR+LDP +VG  HY VA  VQ  LQ++ EL+DIIAILG+DEL+ EDK+ V RAR+++ FLSQPFFVAE F+G  GKYV L DTI  FK I++G++D LPEQAF+ VG I+EAVEKAK ++
  S:     1 MSNGKIVQIIGAVVDVEFPRDA-MPKVMEAL--KMQAPELTFEVQQQLGDGVVRTIAMGSTDGLRRGMDVLSTGNPIMVPVGQKTLGRIMNVLGDPVDEAGPIGAETTMPIHRKAPAYADQAATVEILETGIKVIDLIMPIAKGGKVGLFGGAGVGKTVTLMELIRNIAVQHSGFSVFAGVGERTREGNDFYHEMKEGGVLDKVALVYGQMNEPPGNRLRVALTGLTMAEYFRD-EGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLADEMGRLQERITSTKTGSITSFQAVYVPADDLTDPSPATTFAHLDATLVLSRQVAELGIYPAVDPLDSTSRILDPQVVGEEHYTVARKVQGTLQKYKELRDIIAILGMDELSPEDKLAVSRARKLQRFLSQPFFVAEVFTGAPGKYVTLKDTIAGFKAIVEGEYDHLPEQAFYMVGGIEEAVEKAKTIQ 459
>gi|86156234|gb|ABC86835.1| ATP synthase beta subunit [Pinctada fucata] (523 aa)
Score = 1561, Expect = 1.8e-171, Identities = 308/463 (66%), Positives = 362/463 (78%)
  Q:     7 TYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           T GKV  VIG VVDV F +S  LP I + L VK     L LE AQ +G++ VR IA+  TEG+ R  +  +   PI +PVG   LGR+ NV+G+PID +  +     LPIH + P F + S   EI ETGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI   VI       K +LV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R I+ LGI+PA+ PL+STSR+LDPN+VG  HY+VA GVQ ILQ F  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G AGKYVPL +TI  F++IL G +D LPE AF+ VG I+E V+KA+RL +
  S:    54 TPGKVVSVIGAVVDVQFEDS--LPPILNALEVKNRKPRLILEVAQHLGENTVRTIAMDGTEGVVRGMECIDSGFPIRIPVGPATLGRIINVIGEPIDERGPVQTDKLLPIHAEAPEFVEMSVEQEILETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMITSKVISLTDDTSKVSLVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVGPLDSTSRILDPNVVGQEHYRVARGVQKILQDFRSLQDIIAILGMDELSEEDKLTVTRARKIQRFLSQPFQVAEVFTGSAGKYVPLKETILGFQQILQGDYDHLPEVAFYMVGNIEEVVQKAERLAE 520
>gi|88860637|ref|ZP_01135274.1| ATP synthase subunit B [Pseudoalteromonas tunicata D2] >gi|88817232|gb|EAR27050.1| ATP synthase subunit B [Pseudoalteromonas tunicata D2] (461 aa)
Score = 1561, Expect = 1.9e-171, Identities = 299/462 (64%), Positives = 373/462 (80%)
  Q:     6 ITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVK---LAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRL 467
           ++ GKV Q+IG VVD+ F ++S +P +YD +++    LAG  L LE  Q +G  +VR IALG T+GL R   V N    I+VPVGK  LGR+ NVLG+PID    + ++ ++ IHR  PS+++QS+++E+ ETGIKVIDL+ P+A+GGK+GLFGGAGVGKTV + ELI NIA EHSG SVFAGVGERTREGND Y+EM +  V+DK +LV+GQMNEPPG R+RVALT LTMAE FRD + +DVL F+DNI+R+T AG+EVSALLGRMPSAVGYQPTLA EMG LQERIASTKTGSITS+QA+YVPADDLTDP+PATTF HLDA  VL R+IA+LGI+PA++PL+S+SR LDP ++G  HY  A GVQ +LQR+ EL+DIIAILG+DEL+DEDK +V RAR+I+ FLSQPFFVAE F+G +GKYV L DTI  FK IL+G +D LPEQAF+ VG+I EA+EKAK +
  S:     1 MSLGKVVQIIGAVVDIEFPQNS-VPAVYDAVNITDGDLAG--LTLEVQQQLGGGVVRGIALGTTDGLRRGATVQNTGKAIQVPVGKATLGRIMNVLGEPIDEAGPIGEEERMSIHRAAPSYEEQSSSIELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMNESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRD-EGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERIASTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSSSRQLDPLVIGQEHYDAARGVQTVLQRYKELKDIIAILGMDELSDEDKQLVSRARKIQRFLSQPFFVAEVFTGASGKYVSLKDTIAGFKGILNGDYDALPEQAFYMVGSIDEAIEKAKNM 461
>gi|28461221|ref|NP_786990.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta subunit [Bos taurus] >gi|114543|sp|P00829|ATPB_BOVIN ATP synthase subunit beta, mitochondrial precursor >gi|162711|gb|AAA30395.1| F-1-ATPase beta-subunit precursor >gi|94574271|gb|AAI16100.1| ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [Bos taurus] (528 aa)
Score = 1561, Expect = 1.9e-171, Identities = 308/467 (65%), Positives = 364/467 (77%)
  Q:     3 KENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           K   T G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI +PVG   LGR+ NV+G+PID +  +  K    IH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+GQMNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    55 KAGATTGRIVAVIGAVVDVQFDEG--LPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|74151565|dbj|BAE38888.1| unnamed protein product [Mus musculus] >gi|74189077|dbj|BAE39301.1| unnamed protein product [Mus musculus] (529 aa)
Score = 1561, Expect = 2.0e-171, Identities = 306/461 (66%), Positives = 364/461 (78%)
  Q:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVID------KTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQEAVEKAKRLKK 469
           G++  VIG VVDV F E   LP I + L V+     L LE AQ +G+  VR IA+  TEGL R +KV +   PI++PVG   LGR+ NV+G+PID +  +  K   PIH + P F + S   EI  TGIKV+DLL PYA+GGKIGLFGGAGVGKTVL+ ELI+N+AK H G SVFAGVGERTREGNDLY+EMI+ GVI+      K ALV+G+MNEPPGAR RVALT LT+AEYFRD + QDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGYQPTLAT+MG +QERI +TK GSITSVQAIYVPADDLTDPAPATTF HLDA TVL R IA LGI+PA++PL+STSR++DPNIVG  HY VA GVQ ILQ +  LQDIIAILG+DEL++EDK+ V RAR+I+ FLSQPF VAE F+G  GK VPL +TI+ F++IL G++D LPEQAF+ VG I+EAV KA +L +
  S:    61 GRIVAVIGAVVDVQFDEG--LPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGRMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE 525
>gi|1827812|pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B >gi|1827813|pdb|1COW|E Chain E, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B >gi|1827814|pdb|1COW|F Chain F, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B >gi|1942371|pdb|1EFR|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With The Peptide Antibiotic Efrapeptin >gi|1942372|pdb|1EFR|E Chain E, Bovine Mitochondrial F1-Atpase Complexed With The Peptide Antibiotic Efrapeptin >gi|1942373|pdb|1EFR|F Chain F, Bovine Mitochondrial F1-Atpase Complexed With The Peptide Antibiotic Efrapeptin >gi|1943083|pdb|1BMF|D Chain D, Bovine Mitochondrial F1-Atpase >gi|1943084|pdb|1BMF|E Chain E, Bovine Mitochondrial F1-Atpase >gi|1943085|pdb|1BMF|F Chain F, Bovine Mitochondrial F1-Atpase >gi|6573683|pdb|1QO1|D Chain D, Molecular Architecture Of The Rotary Motor In Atp Synthase From Yeast Mitochondria >gi|6573684|pdb|1QO1|E Chain E, Molecular Architecture Of The Rotary Motor In Atp Synthase From Yeast Mitochondria >gi|6573685|pdb|1QO1|F Chain F, Molecular Architecture Of The Rotary Motor In Atp Synthase From Yeast Mitochondria >gi|9256941|pdb|1E1Q|D Chain D, Bovine Mitochondrial F1-Atpase At 100k >gi|9256942|pdb|1E1Q|E Chain E, Bovine Mitochondrial F1-Atpase At 100k >gi|9256943|pdb|1E1Q|F Chain F, Bovine Mitochondrial F1-Atpase At 100k >