>gi|161723287|ref|NP_110349.2| 30S ribosomal protein S16 [Mycoplasma pneumoniae M129] (94 aa)
Score = 463, Expect = 5.0e-45, Identities = 88/88 (100%), Positives = 88/88 (100%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK 88
           MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK
  S:     7 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK 94
>gi|2500467|sp|P75131|RS16_MYCPN 30S ribosomal protein S16 >gi|1673845|gb|AAB95830.1| ribosomal protein S16 [Mycoplasma pneumoniae M129] (88 aa)
Score = 462, Expect = 6.9e-45, Identities = 88/88 (100%), Positives = 88/88 (100%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK 88
           MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK
  S:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK 88
>gi|108885115|ref|NP_073116.2| 30S ribosomal protein S16 [Mycoplasma genitalium G37] >gi|84626142|gb|AAC72466.2| ribosomal protein S16 [Mycoplasma genitalium G37] >gi|166078769|gb|ABY79387.1| ribosomal protein S16 [synthetic Mycoplasma genitalium JCVI-1.0] (95 aa)
Score = 396, Expect = 3.3e-37, Identities = 72/82 (87%), Positives = 78/82 (95%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           MRMGRVHYP YRIVAVDSRVKR+GKYIALIGHLNPALKENKCK+DE VAL+WLNKGA PTDTVRSLFS++GLWKKF+ESK K
  S:     7 MRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESKNK 88
>gi|1350943|sp|P47684|RS16_MYCGE 30S ribosomal protein S16 (89 aa)
Score = 395, Expect = 4.2e-37, Identities = 72/82 (87%), Positives = 78/82 (95%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           MRMGRVHYP YRIVAVDSRVKR+GKYIALIGHLNPALKENKCK+DE VAL+WLNKGA PTDTVRSLFS++GLWKKF+ESK K
  S:     1 MRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESKNK 82
>gi|66880454|ref|ZP_00405435.1| COG0228: Ribosomal protein S16 [Mycoplasma genitalium G-37] (52 aa)
Score = 258, Expect = 3.2e-21, Identities = 47/52 (90%), Positives = 50/52 (96%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEW 52
           MRMGRVHYP YRIVAVDSRVKR+GKYIALIGHLNPALKENKCK+DE VAL+W
  S:     1 MRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDW 52
>gi|31544830|ref|NP_853408.1| 30S ribosomal protein S16 [Mycoplasma gallisepticum R] >gi|31541676|gb|AAP56976.1| RpsP [Mycoplasma gallisepticum R] (91 aa)
Score = 253, Expect = 1.0e-20, Identities = 47/81 (58%), Positives = 63/81 (77%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           MR+GR   P+YR+V VDSRVKRDG YI LIGH++P    N  K++ A+A+EWL KGA+PTDTV+S+ S+ G+WK++  SKK
  S:    12 MRLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPINGTN--KLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASKK 90
>gi|6601576|gb|AAF19037.1| 30S ribosomal protein S16 [Mycoplasma gallisepticum] (80 aa)
Score = 253, Expect = 1.1e-20, Identities = 47/81 (58%), Positives = 63/81 (77%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           MR+GR   P+YR+V VDSRVKRDG YI LIGH++P    N  K++ A+A+EWL KGA+PTDTV+S+ S+ G+WK++  SKK
  S:     1 MRLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPINGAN--KLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASKK 79
>gi|33860208|sp|Q9RDV4|RS16_MYCGA 30S ribosomal protein S16 (80 aa)
Score = 253, Expect = 1.1e-20, Identities = 47/81 (58%), Positives = 63/81 (77%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           MR+GR   P+YR+V VDSRVKRDG YI LIGH++P    N  K++ A+A+EWL KGA+PTDTV+S+ S+ G+WK++  SKK
  S:     1 MRLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPINGTN--KLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASKK 79
>gi|83319787|ref|YP_424518.1| 30S ribosomal protein S16 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|109893889|sp|Q2SRU5|RS16_MYCCT 30S ribosomal protein S16 >gi|83283673|gb|ABC01605.1| 30S ribosomal protein S16 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (108 aa)
Score = 224, Expect = 2.3e-17, Identities = 43/79 (54%), Positives = 57/79 (72%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G+   P YRIVA DSRV R+G+YI L+G  NP   +++ KID+ + L+WLN GA+PTDTVRSL S+ G+ K   ESK
  S:     8 RIGKKQAPFYRIVAADSRVNRNGQYIELVGTFNPL--KDEVKIDKELTLKWLNNGAQPTDTVRSLLSKQGILKALHESK 84
>gi|23098987|ref|NP_692453.1| 30S ribosomal protein S16 [Oceanobacillus iheyensis HTE831] >gi|31076969|sp|Q8ER01|RS16_OCEIH 30S ribosomal protein S16 >gi|22777215|dbj|BAC13488.1| 30S ribosomal protein S16 [Oceanobacillus iheyensis HTE831] (90 aa)
Score = 224, Expect = 2.7e-17, Identities = 44/79 (55%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG+ I  IG  NP +   + KIDE  AL+W++KGAKP+DTVR+LFS  G+ KKF E K
  S:     9 RMGSKRNPFYRIVVADSRSPRDGRSIEQIGTYNPVVNPVEVKIDEEKALDWMSKGAKPSDTVRNLFSNEGIMKKFHEQK 87
>gi|16078662|ref|NP_389481.1| 30S ribosomal protein S16 [Bacillus subtilis subsp. subtilis str. 168] >gi|585937|sp|P21474|RS16_BACSU 30S ribosomal protein S16 (BS17) >gi|2309081|dbj|BAA21692.1| 30S ribosomal protein S16 [Bacillus subtilis] >gi|2633971|emb|CAB13472.1| ribosomal protein S16 (BS17) [Bacillus subtilis subsp. subtilis str. 168] (90 aa)
Score = 222, Expect = 4.5e-17, Identities = 42/80 (52%), Positives = 54/80 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YRIV  DSR  RDG++I  +G  NP  K  + KIDE +AL+WL  GAKP+DTVR+LFS  G+ +KF  +K+
  S:     9 RMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQ 88
>gi|52080201|ref|YP_078992.1| 30S ribosomal protein S16 [Bacillus licheniformis ATCC 14580] >gi|52785578|ref|YP_091407.1| 30S ribosomal protein S16 [Bacillus licheniformis ATCC 14580] >gi|81609175|sp|Q65JQ0|RS16_BACLD 30S ribosomal protein S16 >gi|52003412|gb|AAU23354.1| ribosomal protein S16 (BS17) [Bacillus licheniformis ATCC 14580] >gi|52348080|gb|AAU40714.1| RpsP [Bacillus licheniformis DSM 13] (90 aa)
Score = 221, Expect = 5.5e-17, Identities = 42/80 (52%), Positives = 55/80 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YRIV  DSR  RDG++I  +G  NP  K  + KIDE +AL+WL  GAKP+DTVR+LFS+ G+ +KF  +K+
  S:     9 RMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPLAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSKEGIMEKFHNAKQ 88
>gi|160901804|ref|YP_001567385.1| ribosomal protein S16 [Petrotoga mobilis SJ95] >gi|189029607|sp|A9BEZ8.1|RS16_PETMO 30S ribosomal protein S16 >gi|160359448|gb|ABX31062.1| ribosomal protein S16 [Petrotoga mobilis SJ95] (111 aa)
Score = 221, Expect = 6.0e-17, Identities = 43/79 (54%), Positives = 54/79 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMGR H P YRIV VDSR KR GKYI  IG+ +P    N+ K+DE  AL+WL KGA+PTDT R +  + G+ K++ E K
  S:     8 RMGRRHQPFYRIVIVDSRNKRSGKYIESIGYYDPLNNSNQYKVDEDKALDWLLKGAQPTDTARRILRKMGVMKRYDEIK 86
>gi|42560960|ref|NP_975411.1| 30S ribosomal protein S16 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|54039378|sp|P62233|RS16_MYCMS 30S ribosomal protein S16 >gi|42492457|emb|CAE77053.1| 30S RIBOSOMAL PROTEIN S16 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (108 aa)
Score = 220, Expect = 7.8e-17, Identities = 42/79 (53%), Positives = 55/79 (69%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G+   P YRIV  DSRV R+G+YI L+G  NP   +++ KID  + L+WLN GA+PTDTVRSL S+ G+ K   ESK
  S:     8 RIGKKQAPFYRIVVADSRVNRNGQYIELVGTFNPL--KDEVKIDNELTLKWLNNGAQPTDTVRSLLSKQGILKALHESK 84
>gi|157692278|ref|YP_001486740.1| 30S ribosomal protein S16 [Bacillus pumilus SAFR-032] >gi|194014907|ref|ZP_03053524.1| ribosomal protein S16 [Bacillus pumilus ATCC 7061] >gi|167011165|sp|A8FD63.1|RS16_BACP2 30S ribosomal protein S16 >gi|157681036|gb|ABV62180.1| ribosomal protein S16 [Bacillus pumilus SAFR-032] >gi|194013933|gb|EDW23498.1| ribosomal protein S16 [Bacillus pumilus ATCC 7061] (90 aa)
Score = 220, Expect = 8.1e-17, Identities = 41/79 (51%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G  NP L   + KI+E +AL+WL  GAKP+DTVR+LFS  G+ +KF  +K
  S:     9 RMGSKRSPFYRIVVADSRSPRDGRFIETVGTYNPVLSPAEVKINEELALKWLQNGAKPSDTVRNLFSSQGILEKFHNAK 87
>gi|116512366|ref|YP_809582.1| 30S ribosomal protein S16 [Lactococcus lactis subsp. cremoris SK11] >gi|122940068|sp|Q02Y12.1|RS16_LACLS 30S ribosomal protein S16 >gi|116108020|gb|ABJ73160.1| SSU ribosomal protein S16P [Lactococcus lactis subsp. cremoris SK11] (90 aa)
Score = 219, Expect = 1.1e-16, Identities = 42/79 (53%), Positives = 52/79 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDGK+I  +G  NP L EN+  + E   LEWL+ GA+P+DTVR+L S+ G+ KKF ESK
  S:     9 RMGSKKKPFYRINVADSRAPRDGKFIETVGTYNPLLTENQVTLKEERVLEWLSNGAQPSDTVRNLLSKAGVMKKFHESK 87
>gi|89098671|ref|ZP_01171553.1| ribosomal protein S16 (BS17) [Bacillus sp. NRRL B-14911] >gi|89086633|gb|EAR65752.1| ribosomal protein S16 (BS17) [Bacillus sp. NRRL B-14911] (90 aa)
Score = 218, Expect = 1.3e-16, Identities = 40/79 (50%), Positives = 55/79 (69%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G  NP  +  K +I+E +AL+W+N GAKP+DTVR+LFS+ G+ +KF  +K
  S:     9 RMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAQPAKVEINEELALKWMNDGAKPSDTVRNLFSKEGIMEKFHNAK 87
>gi|188159371|ref|ZP_02512579.2| 30S ribosomal protein S16 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (92 aa)
Score = 217, Expect = 1.5e-16, Identities = 40/79 (50%), Positives = 57/79 (72%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G+   P YRIVA DSR+ R+G+YI L+G  NP   +++ KID+ + L+WLN GA+PTDTVR+L S+ G+ K   E+K
  S:     8 RIGKKQAPFYRIVAADSRINRNGQYIELVGTFNPL--KDEVKIDKELTLKWLNNGAQPTDTVRTLLSKQGILKALHEAK 84
>gi|154686015|ref|YP_001421176.1| 30S ribosomal protein S16 [Bacillus amyloliquefaciens FZB42] >gi|166234391|sp|A7Z4L9.1|RS16_BACA2 30S ribosomal protein S16 >gi|154351866|gb|ABS73945.1| RpsP [Bacillus amyloliquefaciens FZB42] (90 aa)
Score = 217, Expect = 1.5e-16, Identities = 41/80 (51%), Positives = 54/80 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YRIV  DSR  RDG++I  +G  NP  K  + KI+E +AL+WL  GAKP+DTVR+LFS  G+ +KF  +K+
  S:     9 RMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKINEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQ 88
>gi|152976210|ref|YP_001375727.1| 30S ribosomal protein S16 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189044366|sp|A7GRH4.1|RS16_BACCN 30S ribosomal protein S16 >gi|152024962|gb|ABS22732.1| ribosomal protein S16 [Bacillus cereus subsp. cytotoxis NVH 391-98] (90 aa)
Score = 217, Expect = 1.6e-16, Identities = 42/80 (52%), Positives = 53/80 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR+V  DSR  RDG++I  IG  NP  +  + KIDE  AL+WL  GAKP+DTVR+LFS  G+ +KF  SK+
  S:     9 RMGAKKSPFYRVVVADSRSPRDGRFIEEIGTYNPVAQPAEVKIDEEAALKWLGNGAKPSDTVRNLFSSQGIMEKFHLSKQ 88
>gi|187605849|ref|ZP_02992034.1| ribosomal protein S16 [Exiguobacterium sp. AT1b] >gi|187482122|gb|EDU20141.1| ribosomal protein S16 [Exiguobacterium sp. AT1b] (91 aa)
Score = 217, Expect = 1.8e-16, Identities = 42/79 (53%), Positives = 56/79 (70%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK-ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +GH NP  K E + +I+E +AL+WL  GAKP+DTVR+LFS+ G+ +KF  +K
  S:     9 RMGAKKSPFYRIVVADSRSPRDGRFIEQVGHYNPVAKPEAEVRINEELALKWLADGAKPSDTVRNLFSKAGIMEKFHNAK 88
>gi|146318450|ref|YP_001198162.1| 30S ribosomal protein S16 [Streptococcus suis 05ZYH33] >gi|145689256|gb|ABP89762.1| 30S ribosomal protein S16 [Streptococcus suis 05ZYH33] (110 aa)
Score = 216, Expect = 2.3e-16, Identities = 42/79 (53%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP L EN   + E   LEWL KGA+P+DTVRSL S  G+ KKF E K
  S:    29 RMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLLAENSVTLKEERVLEWLAKGAQPSDTVRSLLSNAGVLKKFHEQK 107
>gi|55821524|ref|YP_139966.1| 30S ribosomal protein S16 [Streptococcus thermophilus LMG 18311] >gi|55823452|ref|YP_141893.1| 30S ribosomal protein S16 [Streptococcus thermophilus CNRZ1066] >gi|116628236|ref|YP_820855.1| 30S ribosomal protein S16 [Streptococcus thermophilus LMD-9] >gi|122267168|sp|Q03JG3.1|RS16_STRTD 30S ribosomal protein S16 >gi|81559090|sp|Q5LYM4|RS16_STRT1 30S ribosomal protein S16 >gi|81560284|sp|Q5M387|RS16_STRT2 30S ribosomal protein S16 >gi|55737509|gb|AAV61151.1| 30S ribosomal protein S16 [Streptococcus thermophilus LMG 18311] >gi|55739437|gb|AAV63078.1| 30S ribosomal protein S16 [Streptococcus thermophilus CNRZ1066] >gi|116101513|gb|ABJ66659.1| SSU ribosomal protein S16P [Streptococcus thermophilus LMD-9] (90 aa)
Score = 215, Expect = 2.6e-16, Identities = 40/79 (50%), Positives = 54/79 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP ++EN+  + E   LEWL+KGA+P+DTVR++ S+ G+ KKF ESK
  S:     9 RMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVEENQVTLKEERVLEWLSKGAQPSDTVRNILSKEGVMKKFHESK 87
>gi|125623773|ref|YP_001032256.1| 30S ribosomal protein S16 [Lactococcus lactis subsp. cremoris MG1363] >gi|166234429|sp|A2RJS1.1|RS16_LACLM 30S ribosomal protein S16 >gi|124492581|emb|CAL97526.1| 30S ribosomal protein S16 [Lactococcus lactis subsp. cremoris MG1363] (90 aa)
Score = 215, Expect = 2.9e-16, Identities = 41/79 (51%), Positives = 52/79 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDGK+I  +G  NP + EN+  + E   LEWL+ GA+P+DTVR+L S+ G+ KKF ESK
  S:     9 RMGSKKKPFYRINVADSRAPRDGKFIETVGTYNPLVTENQVTLKEERVLEWLSNGAQPSDTVRNLLSKAGVMKKFHESK 87
>gi|15644314|ref|NP_229366.1| ribosomal protein S16 [Thermotoga maritima MSB8] >gi|148270356|ref|YP_001244816.1| ribosomal protein S16 [Thermotoga petrophila RKU-1] >gi|170289018|ref|YP_001739256.1| ribosomal protein S16 [Thermotoga sp. RQ2] >gi|166228762|sp|A5IM17.1|RS16_THEP1 30S ribosomal protein S16 >gi|7388157|sp|Q9X1Q2|RS16_THEMA 30S ribosomal protein S16 >gi|4982135|gb|AAD36633.1|AE001802_2 ribosomal protein S16 [Thermotoga maritima MSB8] >gi|147735900|gb|ABQ47240.1| SSU ribosomal protein S16P [Thermotoga petrophila RKU-1] >gi|170176521|gb|ACB09573.1| ribosomal protein S16 [Thermotoga sp. RQ2] (95 aa)
Score = 214, Expect = 3.6e-16, Identities = 43/79 (54%), Positives = 56/79 (70%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG+ H P YRIV VDSR +RDG YI  +G+ NP LKE + KID   A+EW+ KGA+P+DTVR +F + G+ K+  E K
  S:     8 RMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNP-LKEGEIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMKRVHEIK 85
>gi|172057909|ref|YP_001814369.1| ribosomal protein S16 [Exiguobacterium sibiricum 255-15] >gi|171990430|gb|ACB61352.1| ribosomal protein S16 [Exiguobacterium sibiricum 255-15] (91 aa)
Score = 214, Expect = 4.2e-16, Identities = 41/79 (51%), Positives = 57/79 (72%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK-ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YR+V  DSR  RDG++I  IG+ NP  K E + K++E +AL+WL +GAKP+DTVR+LFS+ G+ +KF  +K
  S:     9 RMGANKSPFYRVVVADSRAPRDGRFIEQIGYYNPVAKPEAEVKLNEELALKWLAEGAKPSDTVRNLFSKAGIMEKFHNAK 88
>gi|15673551|ref|NP_267725.1| 30S ribosomal protein S16 [Lactococcus lactis subsp. lactis Il1403] >gi|14195195|sp|Q9CFB2|RS16_LACLA 30S ribosomal protein S16 >gi|12724572|gb|AAK05667.1|AE006387_10 30S ribosomal protein S16 [Lactococcus lactis subsp. lactis Il1403] (90 aa)
Score = 213, Expect = 4.8e-16, Identities = 41/79 (51%), Positives = 52/79 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDGK+I  +G  NP + E +  + E   LEWL+KGA+P+DTVR+L S+ G+ KKF ESK
  S:     9 RMGSKKKPFYRINVADSRAPRDGKFIETVGTYNPLVTEEQVTLKEERVLEWLSKGAQPSDTVRNLLSKAGVMKKFHESK 87
>gi|171778249|ref|ZP_02919455.1| hypothetical protein STRINF_00295 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282949|gb|EDT48373.1| hypothetical protein STRINF_00295 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (90 aa)
Score = 213, Expect = 5.1e-16, Identities = 39/79 (49%), Positives = 54/79 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP ++EN+  + E   LEWL+KGA+P+DTVR++ S+ G+ KKF +SK
  S:     9 RMGSKKKPFYRINVADSRTPRDGRFIETVGTYNPLIEENQVSLKEERVLEWLSKGAQPSDTVRNILSREGVMKKFHDSK 87
>gi|169350415|ref|ZP_02867353.1| hypothetical protein CLOSPI_01183 [Clostridium spiroforme DSM 1552] >gi|169292735|gb|EDS74868.1| hypothetical protein CLOSPI_01183 [Clostridium spiroforme DSM 1552] (90 aa)
Score = 213, Expect = 5.1e-16, Identities = 39/80 (48%), Positives = 53/80 (66%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           +RMG    P YRIVA DSR  RDG++I ++G  NP     +  I E   L+WLN GA+P+DTV++L S+ G+ KKF +SK
  S:     8 IRMGAKKAPFYRIVAADSRAPRDGRFIEMLGTYNPCTNPAQVTIKEEEVLKWLNNGAQPSDTVKNLLSKQGIMKKFADSK 87
>gi|65321172|ref|ZP_00394131.1| COG0228: Ribosomal protein S16 [Bacillus anthracis str. A2012] (90 aa)
Score = 213, Expect = 5.2e-16, Identities = 41/80 (51%), Positives = 53/80 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR+V  DSR  RDG++I  IG  NP  +  + KI+E  AL+WL  GAKP+DTVR+LFS  G+ +KF  SK+
  S:     9 RMGAKKTPFYRVVVADSRSPRDGRFIEEIGTYNPVAQPXEVKINEEAALKWLGNGAKPSDTVRNLFSNQGIMEKFHLSKQ 88
>gi|30021932|ref|NP_833563.1| 30S ribosomal protein S16 [Bacillus cereus ATCC 14579] >gi|30263847|ref|NP_846224.1| 30S ribosomal protein S16 [Bacillus anthracis str. Ames] >gi|42782936|ref|NP_980183.1| 30S ribosomal protein S16 [Bacillus cereus ATCC 10987] >gi|47529272|ref|YP_020621.1| 30S ribosomal protein S16 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186694|ref|YP_029946.1| 30S ribosomal protein S16 [Bacillus anthracis str. Sterne] >gi|49478410|ref|YP_037905.1| 30S ribosomal protein S16 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141645|ref|YP_085185.1| 30S ribosomal protein S16 [Bacillus cereus E33L] >gi|118479066|ref|YP_896217.1| 30S ribosomal protein S16 [Bacillus thuringiensis str. Al Hakam] >gi|163941582|ref|YP_001646466.1| 30S ribosomal protein S16 [Bacillus weihenstephanensis KBAB4] >gi|166234392|sp|A0RHL7.1|RS16_BACAH 30S ribosomal protein S16 >gi|50403616|sp|Q819W3|RS16_BACCR 30S ribosomal protein S16 >gi|50403617|sp|Q81WJ3|RS16_BACAN 30S ribosomal protein S16 >gi|54039373|sp|P62226|RS16_BACC1 30S ribosomal protein S16 >gi|81613624|sp|Q6HEX1|RS16_BACHK 30S ribosomal protein S16 >gi|81686569|sp|Q636I2|RS16_BACCZ 30S ribosomal protein S16 >gi|29897488|gb|AAP10764.1| SSU ribosomal protein S16P [Bacillus cereus ATCC 14579] >gi|30258491|gb|AAP27710.1| ribosomal protein S16 [Bacillus anthracis str. Ames] >gi|42738863|gb|AAS42791.1| ribosomal protein S16 [Bacillus cereus ATCC 10987] >gi|47504420|gb|AAT33096.1| ribosomal protein S16 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180621|gb|AAT55997.1| ribosomal protein S16 [Bacillus anthracis str. Sterne] >gi|49329966|gb|AAT60612.1| ribosomal protein S16 (30S ribosomal protein S16) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975114|gb|AAU16664.1| ribosomal protein S16 (30S ribosomal protein S16) [Bacillus cereus E33L] >gi|118418291|gb|ABK86710.1| SSU ribosomal protein S16P [Bacillus thuringiensis str. Al Hakam] >gi|163863779|gb|ABY44838.1| ribosomal protein S16 [Bacillus weihenstephanensis KBAB4] (90 aa)
Score = 212, Expect = 6.0e-16, Identities = 41/80 (51%), Positives = 53/80 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR+V  DSR  RDG++I  IG  NP  +  + KI+E  AL+WL  GAKP+DTVR+LFS  G+ +KF  SK+
  S:     9 RMGAKKTPFYRVVVADSRSPRDGRFIEEIGTYNPVAQPAEVKINEEAALKWLGNGAKPSDTVRNLFSNQGIMEKFHLSKQ 88
>gi|26553554|ref|NP_757488.1| ribosomal protein S16 [Mycoplasma penetrans HF-2] >gi|31076972|sp|Q8EWV0|RS16_MYCPE 30S ribosomal protein S16 >gi|26453560|dbj|BAC43892.1| ribosomal protein S16 [Mycoplasma penetrans HF-2] (132 aa)
Score = 212, Expect = 7.0e-16, Identities = 39/79 (49%), Positives = 54/79 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+GR   P +RIV +DSR +RDG YI  +G   P   E    I+E +AL WL KGA+P+DTV++L  + G+WKKF++SK
  S:     8 RLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
>gi|56419732|ref|YP_147050.1| 30S ribosomal protein S16 [Geobacillus kaustophilus HTA426] >gi|81558000|sp|Q5L0P8|RS16_GEOKA 30S ribosomal protein S16 >gi|56379574|dbj|BAD75482.1| 30S ribosomal protein S16 [Geobacillus kaustophilus HTA426] (90 aa)
Score = 211, Expect = 8.9e-16, Identities = 40/75 (53%), Positives = 51/75 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YRIV  DSR  RDG++I  IG  +P  +  + KIDE +AL+WL  GAKP+DTVRSL S+ G+ +KF
  S:     9 RMGTKKKPFYRIVVADSRSPRDGRFIETIGTYDPVAEPAQVKIDEELALKWLQNGAKPSDTVRSLLSKQGILEKF 83
>gi|167756884|ref|ZP_02429011.1| hypothetical protein CLORAM_02433 [Clostridium ramosum DSM 1402] >gi|167703059|gb|EDS17638.1| hypothetical protein CLORAM_02433 [Clostridium ramosum DSM 1402] (90 aa)
Score = 210, Expect = 1.0e-15, Identities = 40/80 (50%), Positives = 53/80 (66%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           +RMG    P YRIVA DSR  RDG++I L+G  +P     K  I E   L+WLN GA+P+DTV++L S+ G+ KKF +SK
  S:     8 LRMGAKKAPFYRIVAADSRAPRDGRFIELLGTYDPRTNPAKVTIKEEEVLKWLNNGAQPSDTVKNLLSKEGIIKKFADSK 87
>gi|138894718|ref|YP_001125171.1| ribosomal protein S16 (BS17) [Geobacillus thermodenitrificans NG80-2] >gi|196247663|ref|ZP_03146365.1| ribosomal protein S16 [Geobacillus sp. G11MC16] >gi|166234423|sp|A4IM72.1|RS16_GEOTN 30S ribosomal protein S16 >gi|134266231|gb|ABO66426.1| Ribosomal protein S16 (BS17) [Geobacillus thermodenitrificans NG80-2] >gi|196212447|gb|EDY07204.1| ribosomal protein S16 [Geobacillus sp. G11MC16] (90 aa)
Score = 210, Expect = 1.2e-15, Identities = 40/75 (53%), Positives = 51/75 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YRIV  DSR  RDG++I  IG  NP  +  + KI+E +AL+WL  GAKP+DTVRSL S+ G+ +KF
  S:     9 RMGAKKNPFYRIVVADSRSPRDGRFIETIGTYNPVAEPAEIKINEELALKWLQNGAKPSDTVRSLLSKQGILEKF 83
>gi|171326479|ref|ZP_02914952.1| ribosomal protein S16 [Geobacillus sp. WCH70] >gi|171087554|gb|EDT33932.1| ribosomal protein S16 [Geobacillus sp. WCH70] (90 aa)
Score = 209, Expect = 1.4e-15, Identities = 40/75 (53%), Positives = 51/75 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YRIV  DSR  RDG++I  IG  NP  +  + KIDE +AL+WL  GAKP+DTVR+L S+ G+ +KF
  S:     9 RMGAKKKPFYRIVVADSRSPRDGRFIETIGTYNPITEPAEIKIDEELALKWLQNGAKPSDTVRNLLSKQGILEKF 83
>gi|167730406|emb|CAO81318.1| Ribosomal protein S16 [Candidatus Cloacamonas acidaminovorans] (97 aa)
Score = 208, Expect = 1.8e-15, Identities = 44/81 (54%), Positives = 55/81 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           RMG ++ P YRIVAVDSR KRDGKYI  IG  +P    +K KID   AL WL  GA+P+DTVRSL  + G+ + +  SK+K
  S:     8 RMGAINQPFYRIVAVDSRKKRDGKYIECIGWYDPKPDPSKIKIDTERALYWLGVGAQPSDTVRSLLRKAGVLQIWHNSKQK 88
>gi|56964058|ref|YP_175789.1| 30S ribosomal protein S16 [Bacillus clausii KSM-K16] >gi|81600844|sp|Q5WFN2|RS16_BACSK 30S ribosomal protein S16 >gi|56910301|dbj|BAD64828.1| 30S ribosomal protein S16 [Bacillus clausii KSM-K16] (90 aa)
Score = 207, Expect = 2.5e-15, Identities = 41/79 (51%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YR+V  DSR  RDG++I  IG  NP  +  +  I E  ALEW+ KGAKP+DTVRSLFS  GL +K    K
  S:     9 RMGSKKAPFYRVVVADSRFPRDGRFIEEIGTYNPIAQPAQVNIKEDKALEWMKKGAKPSDTVRSLFSNAGLMEKLHNEK 87
>gi|50365359|ref|YP_053784.1| 30S ribosomal protein S16 [Mesoplasma florum L1] >gi|81612874|sp|Q6F0S3|RS16_MESFL 30S ribosomal protein S16 >gi|50363915|gb|AAT75900.1| 30S ribosomal protein S16 [Mesoplasma florum L1] (89 aa)
Score = 207, Expect = 2.6e-15, Identities = 41/79 (51%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G+   P YRIVA DSRV R+G+YI LIG  +P   E   KI+  +AL+WL  GA+PT+TVR L SQ G+ K   E+K
  S:     8 RIGKKQAPFYRIVAADSRVNRNGQYIELIGTFDPLKSE--VKINNELALKWLQNGAQPTETVRELLSQQGVMKALHEAK 84
>gi|15924228|ref|NP_371762.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926821|ref|NP_374354.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus N315] >gi|21282850|ref|NP_645938.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MW2] >gi|49483401|ref|YP_040625.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486077|ref|YP_043298.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651807|ref|YP_186113.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus COL] >gi|82750842|ref|YP_416583.1| 30S ribosomal protein S16 [Staphylococcus aureus RF122] >gi|87161596|ref|YP_493828.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus USA300] >gi|88194945|ref|YP_499745.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267729|ref|YP_001246672.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus JH9] >gi|150393787|ref|YP_001316462.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus JH1] >gi|151221360|ref|YP_001332182.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979559|ref|YP_001441818.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu3] >gi|168727449|ref|ZP_02759726.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123291812|sp|Q2FZ45.1|RS16_STAA8 30S ribosomal protein S16 >gi|166201639|sp|A7X1K6.1|RS16_STAA1 30S ribosomal protein S16 >gi|172048856|sp|A6QGD8.1|RS16_STAAE 30S ribosomal protein S16 >gi|189029620|sp|A6U157.1|RS16_STAA2 30S ribosomal protein S16 >gi|189029621|sp|A5ISC3.1|RS16_STAA9 30S ribosomal protein S16 >gi|54039401|sp|P66440|RS16_STAAN 30S ribosomal protein S16 >gi|54039402|sp|P66441|RS16_STAAW 30S ribosomal protein S16 >gi|54042138|sp|P66439|RS16_STAAM 30S ribosomal protein S16 >gi|73917919|sp|Q5HGJ4|RS16_STAAC 30S ribosomal protein S16 >gi|73917920|sp|Q6GHJ7|RS16_STAAR 30S ribosomal protein S16 >gi|73917921|sp|Q6G9X5|RS16_STAAS 30S ribosomal protein S16 >gi|109894805|sp|Q2FHK0|RS16_STAA3 30S ribosomal protein S16 >gi|109894806|sp|Q2YXH8|RS16_STAAB 30S ribosomal protein S16 >gi|13701038|dbj|BAB42333.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus N315] >gi|14247008|dbj|BAB57400.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu50] >gi|21204289|dbj|BAB94986.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MW2] >gi|49241530|emb|CAG40216.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244520|emb|CAG42949.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285993|gb|AAW38087.1| ribosomal protein S16 [Staphylococcus aureus subsp. aureus COL] >gi|82656373|emb|CAI80791.1| 30S ribosomal protein S16 [Staphylococcus aureus RF122] >gi|87127570|gb|ABD22084.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202503|gb|ABD30313.1| ribosomal protein S16 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740798|gb|ABQ49096.1| SSU ribosomal protein S16P [Staphylococcus aureus subsp. aureus JH9] >gi|149946239|gb|ABR52175.1| ribosomal protein S16 [Staphylococcus aureus subsp. aureus JH1] >gi|150374160|dbj|BAF67420.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721694|dbj|BAF78111.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu3] (91 aa)
Score = 207, Expect = 2.7e-15, Identities = 42/80 (52%), Positives = 54/80 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           R+G    P YRIV  D+R  RDG+ I  IG  NP +    + K+DEA+AL+WLN GAKPTDTV ++ S+ G+ KKF E KK
  S:     9 RLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKK 89
>gi|22537505|ref|NP_688356.1| 30S ribosomal protein S16 [Streptococcus agalactiae 2603V/R] >gi|25011470|ref|NP_735865.1| 30S ribosomal protein S16 [Streptococcus agalactiae NEM316] >gi|76788217|ref|YP_329999.1| 30S ribosomal protein S16 [Streptococcus agalactiae A909] >gi|76797719|ref|ZP_00779987.1| ribosomal protein S16 [Streptococcus agalactiae 18RS21] >gi|77406391|ref|ZP_00783452.1| ribosomal protein S16 [Streptococcus agalactiae H36B] >gi|77412598|ref|ZP_00788884.1| ribosomal protein S16 [Streptococcus agalactiae CJB111] >gi|54039403|sp|P66443|RS16_STRA5 30S ribosomal protein S16 >gi|54042139|sp|P66442|RS16_STRA3 30S ribosomal protein S16 >gi|109894807|sp|Q3K0F4|RS16_STRA1 30S ribosomal protein S16 >gi|22534385|gb|AAN00229.1|AE014254_9 ribosomal protein S16 [Streptococcus agalactiae 2603V/R] >gi|24413008|emb|CAD47087.1| 30S ribosomal protein S16 [Streptococcus agalactiae NEM316] >gi|76563274|gb|ABA45858.1| ribosomal protein S16 [Streptococcus agalactiae A909] >gi|76586943|gb|EAO63433.1| ribosomal protein S16 [Streptococcus agalactiae 18RS21] >gi|77161349|gb|EAO72374.1| ribosomal protein S16 [Streptococcus agalactiae CJB111] >gi|77175015|gb|EAO77823.1| ribosomal protein S16 [Streptococcus agalactiae H36B] (90 aa)
Score = 206, Expect = 2.9e-15, Identities = 39/79 (49%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  I E   LEWL+KGA+P+DTVR+L S+ G+  KF + K
  S:     9 RMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVAENQVTIKEERVLEWLSKGAQPSDTVRNLLSKAGVMTKFHDQK 87
>gi|116492614|ref|YP_804349.1| 30S ribosomal protein S16 [Pediococcus pentosaceus ATCC 25745] >gi|122265922|sp|Q03FW5.1|RS16_PEDPA 30S ribosomal protein S16 >gi|116102764|gb|ABJ67907.1| SSU ribosomal protein S16P [Pediococcus pentosaceus ATCC 25745] (90 aa)
Score = 205, Expect = 3.7e-15, Identities = 37/79 (46%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YR+V  DSR  RDG++IA +G  NP  +    K++E   L WLN GA+P+DTV+++FS+ G+ KK+ E+K
  S:     9 RMGSKKRPFYRVVVADSRSPRDGRFIAQVGTYNPLTEPASVKLEEEEILNWLNNGAQPSDTVKNIFSKAGIMKKYHEAK 87
>gi|42519387|ref|NP_965317.1| 30S ribosomal protein S16 [Lactobacillus johnsonii NCC 533] >gi|116629443|ref|YP_814615.1| 30S ribosomal protein S16 [Lactobacillus gasseri ATCC 33323] >gi|122273619|sp|Q044E5.1|RS16_LACGA 30S ribosomal protein S16 >gi|54039376|sp|P62231|RS16_LACJO 30S ribosomal protein S16 >gi|41583675|gb|AAS09283.1| 30S ribosomal protein S16 [Lactobacillus johnsonii NCC 533] >gi|116095025|gb|ABJ60177.1| SSU ribosomal protein S16P [Lactobacillus gasseri ATCC 33323] (90 aa)
Score = 204, Expect = 4.9e-15, Identities = 37/79 (46%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR+ RDG++I  +G+ NP    ++ K++E    EWL KGA+P+DTVRSL S+ GL  ++ ++K
  S:     9 RMGSKRKPFYRIVVADSRMPRDGRFIEEVGYYNPLTNPDEVKLEEDKIFEWLEKGAQPSDTVRSLLSKAGLMTRYHDAK 87
>gi|81428330|ref|YP_395330.1| 30S ribosomal protein S16 [Lactobacillus sakei subsp. sakei 23K] >gi|109893886|sp|Q38XR0|RS16_LACSS 30S ribosomal protein S16 >gi|78609972|emb|CAI55019.1| 30S ribosomal protein S16 [Lactobacillus sakei subsp. sakei 23K] (91 aa)
Score = 204, Expect = 6.0e-15, Identities = 36/79 (45%), Positives = 54/79 (68%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G+ NP  +    K++E V ++WL KGA+P+DTVR+L S+ G+ +K+ E++
  S:     9 RMGSKKRPFYRIVVADSRSPRDGRFIQQVGYYNPLTEPVDLKLEEEVIMDWLQKGAQPSDTVRNLLSKQGIMQKYHEAR 87
>gi|148544378|ref|YP_001271748.1| SSU ribosomal protein S16P [Lactobacillus reuteri F275] >gi|184153742|ref|YP_001842083.1| 30S ribosomal protein S16 [Lactobacillus reuteri F275] >gi|194466488|ref|ZP_03072475.1| ribosomal protein S16 [Lactobacillus reuteri 100-23] >gi|167011169|sp|A5VKN7.1|RS16_LACRF 30S ribosomal protein S16 >gi|148531412|gb|ABQ83411.1| SSU ribosomal protein S16P [Lactobacillus reuteri F275] >gi|183225086|dbj|BAG25603.1| 30S ribosomal protein S16 [Lactobacillus reuteri F275] >gi|194453524|gb|EDX42421.1| ribosomal protein S16 [Lactobacillus reuteri 100-23] (91 aa)
Score = 204, Expect = 6.1e-15, Identities = 37/79 (46%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G  NP     + K DE   +EWL KGA+P+DTVR++    G+ KK+ E+K
  S:     9 RMGSKKRPFYRIVVADSRAPRDGRFITSVGTYNPLTTPKEVKFDEDAVMEWLQKGAQPSDTVRNMLQAAGVMKKYHEAK 87
>gi|184155700|ref|YP_001844040.1| 30S ribosomal protein S16 [Lactobacillus fermentum IFO 3956] >gi|183227044|dbj|BAG27560.1| 30S ribosomal protein S16 [Lactobacillus fermentum IFO 3956] (91 aa)
Score = 203, Expect = 6.3e-15, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G  NP     + K DE   +EWL KGA+P+DTVR++  + G+ KK+ E+K
  S:     9 RMGSKKRPFYRIVVADSRSPRDGRFITSLGTYNPLTTPKQVKFDEDAVMEWLQKGAQPSDTVRNMLQKAGVMKKYHEAK 87
>gi|16800977|ref|NP_471245.1| 30S ribosomal protein S16 [Listeria innocua Clip11262] >gi|20140100|sp|Q92AL1|RS16_LISIN 30S ribosomal protein S16 >gi|16414412|emb|CAC97141.1| ribosomal protein S16 [Listeria innocua] (90 aa)
Score = 202, Expect = 8.6e-15, Identities = 40/79 (50%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG+ I  IG  NP L   + KIDE   L+W++ GAKP+DTVR+L S+ G+ +KF   K
  S:     9 RMGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQK 87
>gi|15674875|ref|NP_269049.1| 30S ribosomal protein S16 [Streptococcus pyogenes M1 GAS] >gi|19745916|ref|NP_607052.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS8232] >gi|21910103|ref|NP_664371.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS315] >gi|28896199|ref|NP_802549.1| 30S ribosomal protein S16 [Streptococcus pyogenes SSI-1] >gi|50914013|ref|YP_059985.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS10394] >gi|71903295|ref|YP_280098.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS6180] >gi|71910461|ref|YP_282011.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS5005] >gi|94988335|ref|YP_596436.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS9429] >gi|94990216|ref|YP_598316.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS10270] >gi|94992213|ref|YP_600312.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS2096] >gi|94994134|ref|YP_602232.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS10750] >gi|139473985|ref|YP_001128701.1| 30S ribosomal protein S16 [Streptococcus pyogenes str. Manfredo] >gi|123080128|sp|Q1J786.1|RS16_STRPF 30S ribosomal protein S16 >gi|123080415|sp|Q1JMC0.1|RS16_STRPC 30S ribosomal protein S16 >gi|123258028|sp|Q1JHG4.1|RS16_STRPD 30S ribosomal protein S16 >gi|123382321|sp|Q1JCE0.1|RS16_STRPB 30S ribosomal protein S16 >gi|166201640|sp|A2RF55.1|RS16_STRPG 30S ribosomal protein S16 >gi|54039405|sp|P66447|RS16_STRP3 30S ribosomal protein S16 >gi|54039406|sp|P66448|RS16_STRP8 30S ribosomal protein S16 >gi|54042141|sp|P66446|RS16_STRP1 30S ribosomal protein S16 >gi|73917922|sp|Q5XCR1|RS16_STRP6 30S ribosomal protein S16 >gi|109894808|sp|Q48U63|RS16_STRPM 30S ribosomal protein S16 >gi|13622012|gb|AAK33770.1| 30S ribosomal protein S16 [Streptococcus pyogenes M1 GAS] >gi|19748071|gb|AAL97551.1| 30S ribosomal protein S1 [Streptococcus pyogenes MGAS8232] >gi|21904295|gb|AAM79174.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS315] >gi|28811450|dbj|BAC64382.1| 30S ribosomal protein S16 [Streptococcus pyogenes SSI-1] >gi|50903087|gb|AAT86802.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS10394] >gi|71802390|gb|AAX71743.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS6180] >gi|71853243|gb|AAZ51266.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS5005] >gi|94541843|gb|ABF31892.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS9429] >gi|94543724|gb|ABF33772.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS10270] >gi|94545721|gb|ABF35768.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS2096] >gi|94547642|gb|ABF37688.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS10750] >gi|134272232|emb|CAM30484.1| 30S ribosomal protein S16 [Streptococcus pyogenes str. Manfredo] (90 aa)
Score = 202, Expect = 8.6e-15, Identities = 38/79 (48%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  I E   LEWL+KGA+P+DTVR++ S+ G+  KF + K
  S:     9 RMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVAENQITIKEDRVLEWLSKGAQPSDTVRNILSKAGVMAKFHDQK 87
>gi|114567017|ref|YP_754171.1| 30S ribosomal protein S16 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317984|sp|Q0AWV4.1|RS16_SYNWW 30S ribosomal protein S16 >gi|114337952|gb|ABI68800.1| SSU ribosomal protein S16P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (88 aa)
Score = 202, Expect = 9.4e-15, Identities = 38/80 (47%), Positives = 50/80 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR+V  DSR  RDG++I  +G+ NP+      KIDE  AL+WL  GAKP+DT RSL  + G+  +F E +K
  S:     9 RMGAKKSPFYRLVVADSRYPRDGRFIEELGYYNPSTTPATVKIDEEKALKWLASGAKPSDTARSLLQKQGIMARFAEIRK 88
>gi|24379319|ref|NP_721274.1| 30S ribosomal protein S16 [Streptococcus mutans UA159] >gi|31076960|sp|Q8DUN9|RS16_STRMU 30S ribosomal protein S16 >gi|24377242|gb|AAN58580.1|AE014928_1 30S ribosomal protein S16 [Streptococcus mutans UA159] (91 aa)
Score = 202, Expect = 9.9e-15, Identities = 37/79 (46%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   LEWL  GA+P+DTVR++ S+ G+ +KF E+K
  S:     9 RMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVTENQVTLKEDRILEWLGNGAQPSDTVRNILSKAGIMQKFHEAK 87
>gi|192812207|ref|ZP_03040875.1| ribosomal protein S16 [Geobacillus sp. Y412MC10] >gi|192798614|gb|EDV75126.1| ribosomal protein S16 [Geobacillus sp. Y412MC10] (90 aa)
Score = 202, Expect = 1.0e-14, Identities = 40/81 (49%), Positives = 52/81 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           RMG    P YR+V  DSR  RDG++I  IG+ NP  +  + KIDE  AL WL  GA+ +DTVR+L S+ G+ KKF E K +
  S:     9 RMGAHKAPFYRVVVSDSRSPRDGRFIEEIGYYNPVAQPAEVKIDEEKALNWLQNGAQASDTVRNLLSKAGVMKKFHELKHQ 89
>gi|169335864|ref|ZP_02863057.1| hypothetical protein ANASTE_02296 [Anaerofustis stercorihominis DSM 17244] >gi|169258602|gb|EDS72568.1| hypothetical protein ANASTE_02296 [Anaerofustis stercorihominis DSM 17244] (80 aa)
Score = 201, Expect = 1.2e-14, Identities = 42/73 (57%), Positives = 46/73 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG    P YRIV  D R  RDGK IAL+GH  P + E   +ID   A EWLNKGAKPTDTV  LF Q G+ K
  S:     9 RMGAKKQPYYRIVVADERTARDGKSIALLGHYKP-VGEKSVEIDAEKAKEWLNKGAKPTDTVAKLFKQNGITK 80
>gi|160915187|ref|ZP_02077400.1| hypothetical protein EUBDOL_01195 [Eubacterium dolichum DSM 3991] >gi|158432986|gb|EDP11275.1| hypothetical protein EUBDOL_01195 [Eubacterium dolichum DSM 3991] (90 aa)
Score = 201, Expect = 1.4e-14, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIVA DSR  RDG++I  IG  NP        +DE +A++WL  GA+P+DTVR+L S+ G+ K+  + K
  S:     9 RMGSKGKPFYRIVAADSRFPRDGRFIETIGTYNPTTNPASVSVDEELAMKWLKNGAQPSDTVRNLLSKQGVMKRLHDEK 87
>gi|18272398|sp|P81290|RS16_BACST 30S ribosomal protein S16 (BS15) (89 aa)
Score = 200, Expect = 1.6e-14, Identities = 41/75 (54%), Positives = 50/75 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YRIV  DSR  RDG++I  IG  NP  +  + KIDE +AL+WL  GAKP+DT RSL S+ GL +KF
  S:     9 RMGAKKKPFYRIVVADSRSPRDGRFIETIGTYNPVAEPAEIKIDEELALKWLQNGAKPSDT-RSLLSKQGLLEKF 82
>gi|104774248|ref|YP_619228.1| 30S ribosomal protein S16 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514338|ref|YP_813244.1| 30S ribosomal protein S16 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274930|sp|Q049R6.1|RS16_LACDB 30S ribosomal protein S16 >gi|122983929|sp|Q1G9L2.1|RS16_LACDA 30S ribosomal protein S16 >gi|103423329|emb|CAI98172.1| 30S ribosomal protein S16 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093653|gb|ABJ58806.1| SSU ribosomal protein S16P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (90 aa)
Score = 200, Expect = 1.6e-14, Identities = 38/79 (48%), Positives = 48/79 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G+ NP  +  + K+DE    EWL KGA+P+DTVRS  S  GL  K  + K
  S:     9 RMGAKRKPFYRIVVADSRAPRDGRFIEEVGYYNPVSQPKELKLDEDKIFEWLKKGAQPSDTVRSFLSSAGLMAKLHDEK 87
>gi|125718126|ref|YP_001035259.1| 30S ribosomal protein S16 [Streptococcus sanguinis SK36] >gi|166201641|sp|A3CNF4.1|RS16_STRSV 30S ribosomal protein S16 >gi|125498043|gb|ABN44709.1| 30S ribosomal protein S16, putative [Streptococcus sanguinis SK36] (90 aa)
Score = 200, Expect = 1.6e-14, Identities = 38/79 (48%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   LEWL  GA+P+DTVR++ S+ G+ KKF +SK
  S:     9 RMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRILEWLGNGAQPSDTVRNILSKEGVLKKFHDSK 87
>gi|243177|gb|AAB21088.1| ribosomal protein S16 [Bacillus stearothermophilus, Peptide, 88 aa] (88 aa)
Score = 200, Expect = 1.7e-14, Identities = 41/75 (54%), Positives = 50/75 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YRIV  DSR  RDG++I  IG  NP  +  + KIDE +AL+WL  GAKP+DT RSL S+ GL +KF
  S:     8 RMGAKKKPFYRIVVADSRSPRDGRFIETIGTYNPVAEPAEIKIDEELALKWLQNGAKPSDT-RSLLSKQGLLEKF 81
>gi|28378334|ref|NP_785226.1| 30S ribosomal protein S16 [Lactobacillus plantarum WCFS1] >gi|31076914|sp|Q88WJ5|RS16_LACPL 30S ribosomal protein S16 >gi|28271169|emb|CAD64074.1| ribosomal protein S16 [Lactobacillus plantarum WCFS1] (90 aa)
Score = 200, Expect = 1.7e-14, Identities = 37/79 (46%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++IA +G  NP  +  + K++E   L WLN GA+P+DTV+++ S+ G+ KK+ E+K
  S:     9 RMGSKKNPFYRIVVADSRSPRDGRFIAQVGTYNPLTEPAQVKLEEEDILGWLNNGAQPSDTVKNILSKAGIMKKYHEAK 87
>gi|121533795|ref|ZP_01665622.1| ribosomal protein S16 [Thermosinus carboxydivorans Nor1] >gi|121307786|gb|EAX48701.1| ribosomal protein S16 [Thermosinus carboxydivorans Nor1] (95 aa)
Score = 200, Expect = 1.7e-14, Identities = 37/80 (46%), Positives = 54/80 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YRIV  D+R  RDG++I  +GH +   +    K+DE  A++WL KGA+PT+TV++LFS+ G+ KK+ E K+
  S:     9 RMGAKKSPFYRIVVADARSPRDGRFIETLGHYDSTTEPATIKVDEEKAIDWLQKGAQPTETVKALFSKAGVLKKWDEIKR 88
>gi|15615046|ref|NP_243349.1| 30S ribosomal protein S16 [Bacillus halodurans C-125] >gi|14195198|sp|Q9KA11|RS16_BACHD 30S ribosomal protein S16 >gi|10175103|dbj|BAB06202.1| 30S ribosomal protein S16 [Bacillus halodurans C-125] (90 aa)
Score = 199, Expect = 2.1e-14, Identities = 39/79 (49%), Positives = 52/79 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YR+V  DSR  RDG++I  IG  NP  +  K ++ E  AL+W+ KGAKP+DTVR+LFS+ GL +K   +K
  S:     9 RMGSKKAPFYRVVVADSRSPRDGRFIEEIGTYNPLTQPAKVELKEDRALDWMLKGAKPSDTVRNLFSKAGLMEKLHNAK 87
>gi|169827099|ref|YP_001697257.1| 30S ribosomal protein S16 [Lysinibacillus sphaericus C3-41] >gi|168991587|gb|ACA39127.1| 30S ribosomal protein S16 [Lysinibacillus sphaericus C3-41] (90 aa)
Score = 199, Expect = 2.1e-14, Identities = 39/79 (49%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  D+R  RDG+ I  +G  NP  +     IDE  AL+WL  GAKP+DTVR+LFS+ G+ +KF   K
  S:     9 RMGAKKSPFYRIVVADARSPRDGRQIETVGTYNPLTQPATVNIDEEKALKWLADGAKPSDTVRNLFSEQGIMEKFHNQK 87
>gi|58337565|ref|YP_194150.1| 30S ribosomal protein S16 [Lactobacillus acidophilus NCFM] >gi|75432900|sp|Q5FJK5|RS16_LACAC 30S ribosomal protein S16 >gi|58254882|gb|AAV43119.1| 30S ribosomal protein S16 [Lactobacillus acidophilus NCFM] (90 aa)
Score = 199, Expect = 2.3e-14, Identities = 38/79 (48%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R G    P YRIV  DSR+ RDG++I  +G+ NP  +  + K+DE    EWL KGA+P+DTVRSL S  GL  K  ++K
  S:     9 RAGAKRKPFYRIVVADSRMPRDGRFIEQVGYYNPVSQPKELKLDEDKIFEWLQKGAQPSDTVRSLLSGAGLMAKLHDAK 87
>gi|163762493|ref|ZP_02169558.1| Ribosomal protein S16-like protein [Bacillus selenitireducens MLS10] >gi|160357232|gb|EDP83880.1| Ribosomal protein S16-like protein [Bacillus selenitireducens MLS10] (90 aa)
Score = 198, Expect = 2.4e-14, Identities = 39/81 (48%), Positives = 52/81 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           RMG    P YR+V  DSR  RDG++I  IG  NP     + K+DE  AL+W+  GAKP+DTVR+LFS+ GL +K   +K +
  S:     9 RMGAKKSPFYRVVVADSRSPRDGRFIEEIGTYNPLTNPVEFKVDEESALKWMLDGAKPSDTVRNLFSKAGLMEKLHNAKNE 89
>gi|170017572|ref|YP_001728491.1| ribosomal protein S16 [Leuconostoc citreum KM20] >gi|169804429|gb|ACA83047.1| Ribosomal protein S16 [Leuconostoc citreum KM20] (137 aa)
Score = 198, Expect = 2.6e-14, Identities = 36/77 (46%), Positives = 48/77 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YR+V  DSR  RDG++I  +G  NP  +  + K+DEA  L WL+ GA+P+DT R+L S  G+  KF E
  S:     9 RMGAKKRPFYRVVIADSRSPRDGRFIETVGTYNPIAQPAEIKLDEAKILTWLSNGAQPSDTARNLLSNAGILAKFAE 85
>gi|153167606|ref|ZP_01927746.1| ribosomal protein S16 [Listeria monocytogenes FSL N1-017] >gi|133726885|gb|EBA28583.1| ribosomal protein S16 [Listeria monocytogenes FSL N1-017] (89 aa)
Score = 198, Expect = 2.9e-14, Identities = 39/79 (49%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YRIV  DSR  RDG+ I  IG  NP L   + KIDE   L+W++ GAKP+DTVR+L S+ G+ +KF   K
  S:     9 RIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQK 87
>gi|168266217|ref|ZP_02688182.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J2-071] (89 aa)
Score = 198, Expect = 3.0e-14, Identities = 39/79 (49%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YRIV  DSR  RDG+ I  IG  NP L   + KIDE   L+W++ GAKP+DTVR+L S+ G+ +KF   K
  S:     9 RIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQK 87
>gi|16803837|ref|NP_465322.1| 30S ribosomal protein S16 [Listeria monocytogenes EGD-e] >gi|46908029|ref|YP_014418.1| 30S ribosomal protein S16 [Listeria monocytogenes str. 4b F2365] >gi|116873232|ref|YP_850013.1| 30S ribosomal protein S16 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153175004|ref|ZP_01930425.1| ribosomal protein S16 [Listeria monocytogenes FSL N3-165] >gi|153179821|ref|ZP_01933011.1| ribosomal protein S16 [Listeria monocytogenes F6900] >gi|153186698|ref|ZP_01936903.1| ribosomal protein S16 [Listeria monocytogenes J0161] >gi|153191279|ref|ZP_01938527.1| ribosomal protein S16 [Listeria monocytogenes J2818] >gi|153198553|ref|ZP_01942524.1| ribosomal protein S16 [Listeria monocytogenes 10403S] >gi|153202771|ref|ZP_01944234.1| ribosomal protein S16 [Listeria monocytogenes HPB2262] >gi|167014982|ref|ZP_02277515.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J1-194] >gi|167212545|ref|ZP_02282852.1| 30S ribosomal protein S16 [Listeria monocytogenes LO28] >gi|167214679|ref|ZP_02284986.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL R2-503] >gi|167217808|ref|ZP_02287444.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J1-175] >gi|167404736|ref|ZP_02309515.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J2-003] >gi|167454367|ref|ZP_02320590.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J2-064] >gi|123461191|sp|A0AJQ2.1|RS16_LISW6 30S ribosomal protein S16 >gi|20140051|sp|Q8Y699|RS16_LISMO 30S ribosomal protein S16 >gi|67461451|sp|Q71YL9|RS16_LISMF 30S ribosomal protein S16 >gi|16411251|emb|CAC99875.1| ribosomal protein S16 [Listeria monocytogenes] >gi|46881299|gb|AAT04595.1| ribosomal protein S16 [Listeria monocytogenes str. 4b F2365] >gi|116742110|emb|CAK21234.1| rpsP [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126940985|gb|EBA18888.1| ribosomal protein S16 [Listeria monocytogenes J0161] >gi|127631932|gb|EBA21657.1| ribosomal protein S16 [Listeria monocytogenes 10403S] >gi|127765316|gb|EBA25665.1| ribosomal protein S16 [Listeria monocytogenes J2818] >gi|133729787|gb|EBA31485.1| ribosomal protein S16 [Listeria monocytogenes FSL N3-165] >gi|133732555|gb|EBA34253.1| ribosomal protein S16 [Listeria monocytogenes F6900] >gi|133735089|gb|EBA36787.1| ribosomal protein S16 [Listeria monocytogenes HPB2262] (90 aa)
Score = 198, Expect = 3.0e-14, Identities = 39/79 (49%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YRIV  DSR  RDG+ I  IG  NP L   + KIDE   L+W++ GAKP+DTVR+L S+ G+ +KF   K
  S:     9 RIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQK 87
>gi|116618579|ref|YP_818950.1| SSU ribosomal protein S16P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271221|sp|Q03W45.1|RS16_LEUMM 30S ribosomal protein S16 >gi|116097426|gb|ABJ62577.1| SSU ribosomal protein S16P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (139 aa)
Score = 197, Expect = 3.8e-14, Identities = 37/79 (46%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YR+V  DSR  RDG++I  +G  NP  +  + K+DE   L WL  GA+P+DTVR+L S  G+  K+ ESK
  S:     9 RMGAKKRPFYRVVIADSRSPRDGRFIETVGTYNPISQPAEIKLDEEKILSWLGNGAQPSDTVRNLLSNAGILAKYNESK 87
>gi|83589816|ref|YP_429825.1| SSU ribosomal protein S16P [Moorella thermoacetica ATCC 39073] >gi|109893888|sp|Q2RJV7|RS16_MOOTA 30S ribosomal protein S16 >gi|83572730|gb|ABC19282.1| SSU ribosomal protein S16P [Moorella thermoacetica ATCC 39073] (90 aa)
Score = 197, Expect = 4.0e-14, Identities = 34/80 (42%), Positives = 53/80 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR+V  DSR  RDG+ +  IG+ NP  +  + K+DE  AL WL  GA+P++TVR+L  + G+W+K++ +++
  S:     9 RMGAKKAPFYRLVVADSRSPRDGRVVEEIGYYNPVKQPVEIKVDEEKALHWLTTGAQPSETVRALLKKAGVWQKYIAARE 88
>gi|195978239|ref|YP_002123483.1| 30S ribosomal protein S16 RpsP [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974944|gb|ACG62470.1| 30S ribosomal protein S16 RpsP [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (81 aa)
Score = 196, Expect = 4.8e-14, Identities = 37/78 (47%), Positives = 49/78 (62%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           MG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   L+WL KGA+P+DTVRSL S+ G+  KF + K
  S:     1 MGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVAENQVTLKEDRVLDWLGKGAQPSDTVRSLLSKAGVMAKFHDQK 78
>gi|95930753|ref|ZP_01313486.1| ribosomal protein S16 [Desulfuromonas acetoxidans DSM 684] >gi|95133233|gb|EAT14899.1| ribosomal protein S16 [Desulfuromonas acetoxidans DSM 684] (89 aa)
Score = 196, Expect = 5.0e-14, Identities = 38/84 (45%), Positives = 52/84 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVA 85
           R G    P Y+IV  D R  RDG+YI  +G  NP ++     ++E  AL WLNKGA+P++TVR +  Q G+W+KF +   KPVA
  S:     9 RGGAKKKPFYQIVVADERCPRDGRYIENLGQYNPLVEPKMVALNEERALAWLNKGAQPSETVRQILRQEGVWEKFTQ---KPVA 89
>gi|27467831|ref|NP_764468.1| 30S ribosomal protein S16 [Staphylococcus epidermidis ATCC 12228] >gi|57866689|ref|YP_188387.1| 30S ribosomal protein S16 [Staphylococcus epidermidis RP62A] >gi|31076941|sp|Q8CSV0|RS16_STAES 30S ribosomal protein S16 >gi|81674909|sp|Q5HPV3|RS16_STAEQ 30S ribosomal protein S16 >gi|27315376|gb|AAO04510.1|AE016747_7 30S ribosomal protein S16 [Staphylococcus epidermidis ATCC 12228] >gi|57637347|gb|AAW54135.1| ribosomal protein S16 [Staphylococcus epidermidis RP62A] (91 aa)
Score = 195, Expect = 5.4e-14, Identities = 40/79 (50%), Positives = 53/79 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPA-LKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YRIV  D+R  RDG+ I  +G  NPA +   + KIDE +AL+WL+ GAKPTDTV ++ S+ G+ KKF E K
  S:     9 RLGSKRNPFYRIVVADARSPRDGRIIEQLGTYNPAHVNAPEVKIDEELALKWLHDGAKPTDTVHNILSREGILKKFDEQK 88
>gi|161507706|ref|YP_001577662.1| 30S ribosomal protein S16 [Lactobacillus helveticus DPC 4571] >gi|172048319|sp|A8YVT4.1|RS16_LACH4 30S ribosomal protein S16 >gi|160348695|gb|ABX27369.1| 30S ribosomal protein S16 [Lactobacillus helveticus DPC 4571] (90 aa)
Score = 195, Expect = 6.0e-14, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R G    P YRIV  DSR+ RDG++I  +G+ NP  +  + K+DE    +WL KGA+P+DTVRSL S  GL  K  ++K
  S:     9 RAGAKRKPFYRIVVADSRMPRDGRFIEQVGYYNPVSQPKELKLDEDKIFDWLQKGAQPSDTVRSLLSGAGLMTKLHDAK 87
>gi|157151083|ref|YP_001450604.1| 30S ribosomal protein S16 [Streptococcus gordonii str. Challis substr. CH1] >gi|189029622|sp|A8AXU4.1|RS16_STRGC 30S ribosomal protein S16 >gi|157075877|gb|ABV10560.1| ribosomal protein S16 [Streptococcus gordonii str. Challis substr. CH1] (90 aa)
Score = 195, Expect = 6.2e-14, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   L WL  GA+P+DTVR++ S+ G+ KKF +SK
  S:     9 RMGSKKKPYYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWLENGAQPSDTVRNILSKEGVLKKFHDSK 87
>gi|73662838|ref|YP_301619.1| 30S ribosomal protein S16 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581618|sp|Q49X24|RS16_STAS1 30S ribosomal protein S16 >gi|72495353|dbj|BAE18674.1| 30S ribosomal protein S16 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (88 aa)
Score = 195, Expect = 6.5e-14, Identities = 40/79 (50%), Positives = 52/79 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPA-LKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YRIVA D+R  RDG+ I  IG  NP  +   + KIDE +AL+WL  GAKPTDTV ++ S+ G+ KKF + K
  S:     9 RLGSKRNPFYRIVAADARAPRDGRNIEQIGTYNPNNVNAAEVKIDEELALKWLKNGAKPTDTVHNILSREGILKKFDDQK 88
>gi|90961607|ref|YP_535523.1| 30S ribosomal protein S16 [Lactobacillus salivarius UCC118] >gi|123391363|sp|Q1WU95.1|RS16_LACS1 30S ribosomal protein S16 >gi|90820801|gb|ABD99440.1| SSU ribosomal protein S16P [Lactobacillus salivarius UCC118] (91 aa)
Score = 194, Expect = 7.6e-14, Identities = 36/79 (45%), Positives = 48/79 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G  NP        + E   + WLN GA+P+DTVR++ S+ G+ KKF E+K
  S:     9 RMGSKKRPFYRIVVADSRSPRDGRFIETVGTYNPLTDPETVTLKEEKVMNWLNNGAQPSDTVRNILSRNGVMKKFHEAK 87
>gi|148997148|ref|ZP_01824802.1| ribosomal protein S16 [Streptococcus pneumoniae SP11-BS70] >gi|168575435|ref|ZP_02721371.1| ribosomal protein S16 [Streptococcus pneumoniae MLV-016] >gi|194398586|ref|YP_002037420.1| 30S ribosomal protein S16 [Streptococcus pneumoniae G54] >gi|147756848|gb|EDK63888.1| ribosomal protein S16 [Streptococcus pneumoniae SP11-BS70] >gi|183578408|gb|EDT98936.1| ribosomal protein S16 [Streptococcus pneumoniae MLV-016] >gi|194358253|gb|ACF56701.1| 30S ribosomal protein S16 [Streptococcus pneumoniae G54] (90 aa)
Score = 194, Expect = 8.6e-14, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   L WL  GA+P+DTVR++ S+ G+ KKF +SK
  S:     9 RMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLTWLANGAQPSDTVRNILSKEGVLKKFHDSK 87
>gi|15900669|ref|NP_345273.1| 30S ribosomal protein S16 [Streptococcus pneumoniae TIGR4] >gi|15902726|ref|NP_358276.1| 30S ribosomal protein S16 [Streptococcus pneumoniae R6] >gi|111658337|ref|ZP_01409025.1| hypothetical protein SpneT_02000477 [Streptococcus pneumoniae TIGR4] >gi|116516029|ref|YP_816168.1| 30S ribosomal protein S16 [Streptococcus pneumoniae D39] >gi|148985875|ref|ZP_01818969.1| ribosomal protein S16 [Streptococcus pneumoniae SP3-BS71] >gi|148989856|ref|ZP_01821150.1| ribosomal protein S16 [Streptococcus pneumoniae SP6-BS73] >gi|148992438|ref|ZP_01822133.1| ribosomal protein S16 [Streptococcus pneumoniae SP9-BS68] >gi|149003395|ref|ZP_01828284.1| ribosomal protein S16 [Streptococcus pneumoniae SP14-BS69] >gi|149007656|ref|ZP_01831273.1| ribosomal protein S16 [Streptococcus pneumoniae SP18-BS74] >gi|149010598|ref|ZP_01831969.1| ribosomal protein S16 [Streptococcus pneumoniae SP19-BS75] >gi|149021640|ref|ZP_01835671.1| ribosomal protein S16 [Streptococcus pneumoniae SP23-BS72] >gi|168484433|ref|ZP_02709385.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1873-00] >gi|168486213|ref|ZP_02710721.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1087-00] >gi|168488444|ref|ZP_02712643.1| ribosomal protein S16 [Streptococcus pneumoniae SP195] >gi|168490863|ref|ZP_02715006.1| ribosomal protein S16 [Streptococcus pneumoniae CDC0288-04] >gi|168492926|ref|ZP_02717069.1| ribosomal protein S16 [Streptococcus pneumoniae CDC3059-06] >gi|169832621|ref|YP_001694234.1| ribosomal protein S16 [Streptococcus pneumoniae Hungary19A-6] >gi|122278946|sp|Q04LD0.1|RS16_STRP2 30S ribosomal protein S16 >gi|54039404|sp|P66445|RS16_STRR6 30S ribosomal protein S16 >gi|54042140|sp|P66444|RS16_STRPN 30S ribosomal protein S16 >gi|14972250|gb|AAK74913.1| ribosomal protein S16 [Streptococcus pneumoniae TIGR4] >gi|15458270|gb|AAK99486.1| 30S Ribosomal protein S16 [Streptococcus pneumoniae R6] >gi|116076605|gb|ABJ54325.1| ribosomal protein S16 [Streptococcus pneumoniae D39] >gi|147758578|gb|EDK65576.1| ribosomal protein S16 [Streptococcus pneumoniae SP14-BS69] >gi|147760811|gb|EDK67782.1| ribosomal protein S16 [Streptococcus pneumoniae SP18-BS74] >gi|147765079|gb|EDK72008.1| ribosomal protein S16 [Streptococcus pneumoniae SP19-BS75] >gi|147922021|gb|EDK73145.1| ribosomal protein S16 [Streptococcus pneumoniae SP3-BS71] >gi|147924798|gb|EDK75882.1| ribosomal protein S16 [Streptococcus pneumoniae SP6-BS73] >gi|147928755|gb|EDK79768.1| ribosomal protein S16 [Streptococcus pneumoniae SP9-BS68] >gi|147930101|gb|EDK81087.1| ribosomal protein S16 [Streptococcus pneumoniae SP23-BS72] >gi|168995123|gb|ACA35735.1| ribosomal protein S16 [Streptococcus pneumoniae Hungary19A-6] >gi|172042337|gb|EDT50383.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1873-00] >gi|183570774|gb|EDT91302.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1087-00] >gi|183573046|gb|EDT93574.1| ribosomal protein S16 [Streptococcus pneumoniae SP195] >gi|183574768|gb|EDT95296.1| ribosomal protein S16 [Streptococcus pneumoniae CDC0288-04] >gi|183576937|gb|EDT97465.1| ribosomal protein S16 [Streptococcus pneumoniae CDC3059-06] (90 aa)
Score = 194, Expect = 8.8e-14, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   L WL  GA+P+DTVR++ S+ G+ KKF +SK
  S:     9 RMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSK 87
>gi|70726677|ref|YP_253591.1| 30S ribosomal protein S16 [Staphylococcus haemolyticus JCSC1435] >gi|82581617|sp|Q4L5U0|RS16_STAHJ 30S ribosomal protein S16 >gi|68447401|dbj|BAE04985.1| 30S ribosomal protein S16 [Staphylococcus haemolyticus JCSC1435] (91 aa)
Score = 192, Expect = 1.2e-13, Identities = 40/79 (50%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPA-LKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YRIV  D+R  RDG+ I  IG  NPA +   + KIDE +AL+WL  GAKPTDTV ++ S+ G+ K F E K
  S:     9 RLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPASVNAPEVKIDEELALKWLKDGAKPTDTVHNILSKQGILKTFDEQK 88
>gi|169191331|ref|ZP_02851191.1| ribosomal protein S16 [Paenibacillus sp. JDR-2] >gi|169002042|gb|EDS48945.1| ribosomal protein S16 [Paenibacillus sp. JDR-2] (90 aa)
Score = 190, Expect = 2.2e-13, Identities = 38/81 (46%), Positives = 51/81 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           RMG    P YR+V  +SR  RDG++I  IG  NP  +  +  IDE  AL+WL  GA+ +DTVR L S+ G+ KKF E K++
  S:     9 RMGAHKAPFYRVVVSNSRSPRDGRFIEEIGTYNPVAQPAQVTIDEEKALKWLQTGAQASDTVRDLLSKAGVLKKFHELKQQ 89
>gi|116333582|ref|YP_795109.1| 30S ribosomal protein S16 [Lactobacillus brevis ATCC 367] >gi|122269731|sp|Q03RU4.1|RS16_LACBA 30S ribosomal protein S16 >gi|116098929|gb|ABJ64078.1| SSU ribosomal protein S16P [Lactobacillus brevis ATCC 367] (91 aa)
Score = 190, Expect = 2.3e-13, Identities = 34/79 (43%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YR+V  DSR  RDG++I  +G  NP  +  +  + E   L WLN GA+P+DTV++L S  G+ K++ E+K
  S:     9 RMGSKKRPFYRVVVADSRSPRDGRFIEQVGTYNPVTEPAQVTLKEESILNWLNNGAQPSDTVKTLLSNAGIMKQYHEAK 87
>gi|116490845|ref|YP_810389.1| SSU ribosomal protein S16P [Oenococcus oeni PSU-1] >gi|122276973|sp|Q04FP8.1|RS16_OENOB 30S ribosomal protein S16 >gi|116091570|gb|ABJ56724.1| SSU ribosomal protein S16P [Oenococcus oeni PSU-1] (96 aa)
Score = 190, Expect = 2.3e-13, Identities = 36/78 (46%), Positives = 49/78 (62%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           MG    P YRIV  DSR +RDG++I  +G+ NP  K  + K+++     WL KGA+PT+TVR+  S  GL KK  E+K
  S:    10 MGTKKRPFYRIVVADSRARRDGRFIEEVGYYNPITKPAEIKLNDDQIFNWLMKGAQPTNTVRNFLSDAGLMKKLHEAK 87
>gi|148265783|ref|YP_001232489.1| 30S ribosomal protein S16 [Geobacter uraniireducens Rf4] >gi|189044383|sp|A5G7Z8.1|RS16_GEOUR 30S ribosomal protein S16 >gi|146399283|gb|ABQ27916.1| SSU ribosomal protein S16P [Geobacter uraniireducens Rf4] (88 aa)
Score = 189, Expect = 3.3e-13, Identities = 34/76 (44%), Positives = 48/76 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G    P Y++V  D R KRDG++I  +G  +P       K++EA  LEWL KGA+PTDTV+ +  + G+W+KFV
  S:     9 RAGAKRKPFYQVVVADERCKRDGRFIENVGTYDPNQNPAVFKLEEAKTLEWLGKGAQPTDTVKQILKKAGIWEKFV 84
>gi|116495083|ref|YP_806817.1| ribosomal protein S16 [Lactobacillus casei ATCC 334] >gi|191638587|ref|YP_001987753.1| 30S ribosomal protein S16 [Lactobacillus casei] >gi|122263500|sp|Q038J7.1|RS16_LACC3 30S ribosomal protein S16 >gi|116105233|gb|ABJ70375.1| SSU ribosomal protein S16P [Lactobacillus casei ATCC 334] >gi|190712889|emb|CAQ66895.1| 30S ribosomal protein S16 [Lactobacillus casei BL23] (91 aa)
Score = 188, Expect = 3.4e-13, Identities = 35/79 (44%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G+ NP       K++E   L WL KGA+P+DTVR+L    G+ +K+ E++
  S:     9 RMGSKRKPFYRIVVADSRSPRDGRFIEAVGYYNPLTNPVDLKLNEEDILNWLQKGAQPSDTVRNLLGSKGIMQKYHEAR 87
>gi|161484950|ref|NP_712572.2| 30S ribosomal protein S16 [Leptospira interrogans serovar Lai str. 56601] >gi|161621775|ref|YP_001514.2| 30S ribosomal protein S16 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|31076973|sp|Q8F3L1.2|RS16_LEPIN 30S ribosomal protein S16 >gi|54039377|sp|P62232|RS16_LEPIC 30S ribosomal protein S16 (88 aa)
Score = 188, Expect = 3.5e-13, Identities = 35/81 (43%), Positives = 50/81 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G  H P YRIVA DSR  RDGK++ ++GH +PA  + +   ++   L WL  GA+PT TV +LF   G+W ++  + KK
  S:     8 RTGTKHDPHYRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFNKEKILTWLKNGAQPTGTVLNLFKNAGIWAEYKTTLKK 88
>gi|169824223|ref|YP_001691834.1| 30S ribosomal protein S16 [Finegoldia magna ATCC 29328] >gi|167831028|dbj|BAG07944.1| 30S ribosomal protein S16 [Finegoldia magna ATCC 29328] (83 aa)
Score = 188, Expect = 3.7e-13, Identities = 35/73 (47%), Positives = 45/73 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG    P YRIV  DSR  RDGK+I  IG+ NP ++E   K+D     +W+  GAKPTDTV  LF   G+++
  S:     9 RMGAKKKPFYRIVVADSRCPRDGKFIEEIGYYNPLVEEKTVKVDSEKVQQWIKNGAKPTDTVDRLFKNNGVYE 81
>gi|24196149|gb|AAN49590.1|AE011407_13 ribosomal protein S16 [Leptospira interrogans serovar Lai str. 56601] >gi|45600667|gb|AAS70151.1| 30S ribosomal protein S16 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (114 aa)
Score = 188, Expect = 3.7e-13, Identities = 35/82 (42%), Positives = 50/82 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
            R G  H P YRIVA DSR  RDGK++ ++GH +PA  + +   ++   L WL  GA+PT TV +LF   G+W ++  + KK
  S:    33 QRTGTKHDPHYRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFNKEKILTWLKNGAQPTGTVLNLFKNAGIWAEYKTTLKK 114
>gi|187935075|ref|YP_001885444.1| ribosomal protein S16 [Clostridium botulinum B str. Eklund 17B] >gi|188590191|ref|YP_001920591.1| ribosomal protein S16 [Clostridium botulinum E3 str. Alaska E43] >gi|187723228|gb|ACD24449.1| ribosomal protein S16 [Clostridium botulinum B str. Eklund 17B] >gi|188500472|gb|ACD53608.1| ribosomal protein S16 [Clostridium botulinum E3 str. Alaska E43] (81 aa)
Score = 188, Expect = 3.9e-13, Identities = 37/73 (50%), Positives = 47/73 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG    P YRIV  DSR  RDG++I  IG+ NP  +  + KI+E  A +WL  GA+PTD V+ LF+Q GL K
  S:     9 RMGCKKAPFYRIVVADSRSPRDGRFIEEIGYYNPITEPAEVKINEEKASKWLQDGAQPTDVVKKLFTQAGLSK 81
>gi|154249333|ref|YP_001410158.1| ribosomal protein S16 [Fervidobacterium nodosum Rt17-B1] >gi|171769330|sp|A7HKR8.1|RS16_FERNB 30S ribosomal protein S16 >gi|154153269|gb|ABS60501.1| ribosomal protein S16 [Fervidobacterium nodosum Rt17-B1] (90 aa)
Score = 187, Expect = 4.5e-13, Identities = 36/81 (44%), Positives = 53/81 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           RMG+   P YRIV VD + KRDG Y+  +G+ NP  +  + K+D   A+EW+ KGA+P++TV  L  + GL++K  E+K K
  S:     8 RMGKKKQPFYRIVVVDQKKKRDGAYVESLGYYNPLKEPYEVKVDIDRAVEWMLKGAQPSETVSKLLGKLGLYEKLEEAKSK 88
>gi|110004275|emb|CAK98613.1| 30s ribosomal protein s16 [Spiroplasma citri] (119 aa)
Score = 187, Expect = 4.7e-13, Identities = 43/86 (50%), Positives = 55/86 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKS 87
           R+G+     YRIVA D+RVKRDG+YI LIG  NP       KI+  +A +WL  GA+PTDTVR+L S+ GL  K     +K VAK+
  S:     8 RIGKKKAAFYRIVATDARVKRDGEYIELIGTYNPI--NGDVKINHDLAYKWLLTGAQPTDTVRNLLSKEGLMTKL--HNEKYVAKT 89
>gi|157362995|ref|YP_001469762.1| ribosomal protein S16 [Thermotoga lettingae TMO] >gi|167011173|sp|A8F3G4.1|RS16_THELT 30S ribosomal protein S16 >gi|157313599|gb|ABV32698.1| ribosomal protein S16 [Thermotoga lettingae TMO] (98 aa)
Score = 187, Expect = 5.4e-13, Identities = 36/79 (45%), Positives = 52/79 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG+ H P YRIV VDSR +RDG YI  +G+ NP  K  + K++   A+EW+ KGA+P++T  ++ S+ G+  K  E K
  S:     8 RMGKRHMPFYRIVVVDSRKRRDGAYIESLGYYNPLRKPAEIKVNVERAVEWILKGAQPSETAANILSKAGVLAKVHEMK 86
>gi|29376248|ref|NP_815402.1| ribosomal protein S16 [Enterococcus faecalis V583] >gi|50403619|sp|Q834F9|RS16_ENTFA 30S ribosomal protein S16 >gi|29343711|gb|AAO81472.1| ribosomal protein S16 [Enterococcus faecalis V583] (91 aa)
Score = 186, Expect = 5.9e-13, Identities = 36/79 (45%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRIV  DSR  RDG++I  +G  NP     +  + E + L+WL+KGA+P+DTVR++ S+ G+ KK  E+K
  S:     9 RMGSKKSPFYRIVVADSRSPRDGRFIETVGTYNPLKDPAEVVLKEDLVLDWLSKGAQPSDTVRNILSKEGVMKKHHEAK 87
>gi|167630251|ref|YP_001680750.1| 30S ribosomal protein S16 [Heliobacterium modesticaldum Ice1] >gi|167592991|gb|ABZ84739.1| 30S ribosomal protein s16 [Heliobacterium modesticaldum Ice1] (90 aa)
Score = 186, Expect = 6.5e-13, Identities = 34/79 (43%), Positives = 51/79 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P YR+V  DSR  RDG++I  IG+ NP  +    +IDE  A++WL+ GA+P+DTV++L ++ G+  K  E K
  S:     9 RLGMKKAPFYRVVVADSRSPRDGRFIEEIGYYNPTKEPAILQIDEEKAIKWLSSGAQPSDTVKALLNKAGILDKMAEKK 87
>gi|116328323|ref|YP_798043.1| 30S ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331049|ref|YP_800767.1| 30S ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281201|sp|Q04SW1.1|RS16_LEPBJ 30S ribosomal protein S16 >gi|122283888|sp|Q050Y5.1|RS16_LEPBL 30S ribosomal protein S16 >gi|116121067|gb|ABJ79110.1| 30S Ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124738|gb|ABJ76009.1| 30S Ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (88 aa)
Score = 185, Expect = 8.0e-13, Identities = 34/81 (41%), Positives = 49/81 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G  H P YRIVA D R  RDGK++ ++GH +PA  + +    +   L WL  GA+PT+TV +LF   G+W ++  + KK
  S:     8 RTGTKHDPHYRIVAADGRAPRDGKFVDIVGHYHPAQIKEQTTFHKEKILTWLKNGARPTETVLNLFKSAGIWAEYKTALKK 88
>gi|54039381|sp|P62237|RS16_SPIKU 30S ribosomal protein S16 >gi|34849436|gb|AAP58935.1| ribosomal protein S16 [Spiroplasma kunkelii] (119 aa)
Score = 185, Expect = 8.7e-13, Identities = 43/86 (50%), Positives = 55/86 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKS 87
           R+G+     YRIVA D+RVKRDG+YI LIG  NP       KI+  +A +WL  GA+PTDTVR+L S+ GL  K     +K VAK+
  S:     8 RIGKKKAAFYRIVATDARVKRDGEYIELIGTYNPI--NGYVKINYDLAYKWLLTGAQPTDTVRNLLSKEGLMNKL--HNEKYVAKT 89
>gi|39995749|ref|NP_951700.1| 30S ribosomal protein S16 [Geobacter sulfurreducens PCA] >gi|50403605|sp|P62230|RS16_GEOSL 30S ribosomal protein S16 >gi|39982513|gb|AAR33973.1| ribosomal protein S16 [Geobacter sulfurreducens PCA] (95 aa)
Score = 184, Expect = 1.1e-12, Identities = 33/76 (43%), Positives = 47/76 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G    P Y+I+  D R +RDG++I  +G  +P       K +EA  LEWL KGA+PTDTV+ +  + G+W+KFV
  S:    16 RAGAKKKPFYQIIVADVRSRRDGRFIENVGTYDPNQNPAAVKFEEAKTLEWLGKGAQPTDTVKQILKKAGIWEKFV 91
>gi|150016060|ref|YP_001308314.1| ribosomal protein S16 [Clostridium beijerinckii NCIMB 8052] >gi|189044373|sp|A6LSM8.1|RS16_CLOB8 30S ribosomal protein S16 >gi|149902525|gb|ABR33358.1| ribosomal protein S16 [Clostridium beijerinckii NCIMB 8052] (81 aa)
Score = 184, Expect = 1.1e-12, Identities = 36/73 (49%), Positives = 47/73 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG    P YRI+  DSR  RDGK+I  IG+ NP  +  + KI+E  A EWL+ GA+PT+ V+ LF+  GL K
  S:     9 RMGAKKAPFYRIIVADSRAPRDGKFIDEIGYYNPLTEPVEVKINEEKANEWLSNGAQPTEVVKRLFNNAGLTK 81
>gi|78224067|ref|YP_385814.1| 30S ribosomal protein S16 [Geobacter metallireducens GS-15] >gi|109893883|sp|Q39RN5|RS16_GEOMG 30S ribosomal protein S16 >gi|78195322|gb|ABB33089.1| SSU ribosomal protein S16P [Geobacter metallireducens GS-15] (88 aa)
Score = 184, Expect = 1.3e-12, Identities = 34/76 (44%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G    P Y+IV  D R +RDG++I  +G  +P       K +E  ALEWL KGA+PTDTV+ +    GLW+KF 
  S:     9 RAGAKKKPFYQIVIADVRSRRDGRFIENVGTYDPNQNPAAVKFEEGKALEWLGKGAQPTDTVKQMLKTAGLWEKFT 84
>gi|146320644|ref|YP_001200355.1| 30S ribosomal protein S16 [Streptococcus suis 98HAH33] >gi|145691450|gb|ABP91955.1| 30S ribosomal protein S16 [Streptococcus suis 98HAH33] (110 aa)
Score = 183, Expect = 1.6e-12, Identities = 37/79 (46%), Positives = 46/79 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P YRI   +SR  RDG++I  +G  NP   EN   + +   L WL KGA+P+DTVRSL S  G+ KK  E K
  S:    29 RMGSKKKPFYRINVANSRAPRDGRFIETVGTYNPLWAENSVTLKKKRVLNWLAKGAQPSDTVRSLLSNAGVLKKSHEQK 107
>gi|134299901|ref|YP_001113397.1| ribosomal protein S16 [Desulfotomaculum reducens MI-1] >gi|172044315|sp|A4J669.1|RS16_DESRM 30S ribosomal protein S16 >gi|134052601|gb|ABO50572.1| SSU ribosomal protein S16P [Desulfotomaculum reducens MI-1] (89 aa)
Score = 182, Expect = 2.0e-12, Identities = 36/71 (50%), Positives = 47/71 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV  DSR  RDG++I  IG+ +P  K  + KIDEA A +WL KGA+ +DT +SLF + G+
  S:     9 RMGAKKNPFYRIVVADSRSPRDGRFIEEIGYYDPIKKPAEVKIDEAKAQDWLKKGAQLSDTAKSLFVKAGI 79
>gi|145219742|ref|YP_001130451.1| 30S ribosomal protein S16 [Prosthecochloris vibrioformis DSM 265] >gi|145205906|gb|ABP36949.1| SSU ribosomal protein S16P [Prosthecochloris vibrioformis DSM 265] (217 aa)
Score = 182, Expect = 2.0e-12, Identities = 34/71 (47%), Positives = 42/71 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA DSR  RDGK++ ++GH  P  K +   ID      W+  GA+PT TVRSL   TGL
  S:     8 RAGRKKLPVYQIVAADSRAPRDGKFLEVVGHYQPTAKPHTVTIDRERVAYWMQTGAQPTATVRSLIRMTGL 78
>gi|145954977|ref|ZP_01803981.1| hypothetical protein CdifQ_04001385 [Clostridium difficile QCD-32g58] (93 aa)
Score = 181, Expect = 2.3e-12, Identities = 35/80 (43%), Positives = 51/80 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YRIV  DSR  RDGK+I  IG+ NP  +  + +I++  A++WL  GA+PT+ V+ L  + G+ +KF  SK+
  S:    12 RMGANKKPFYRIVVADSRAPRDGKFIEEIGYYNPISEPKQVRINDEKAIKWLATGAQPTEVVKKLLVKNGVIEKFEASKQ 91
>gi|126698850|ref|YP_001087747.1| 30S ribosomal protein S16 [Clostridium difficile 630] >gi|168696417|ref|ZP_02728694.1| 30S ribosomal protein S16 [Clostridium difficile QCD-37x79] >gi|168714821|ref|ZP_02747098.1| 30S ribosomal protein S16 [Clostridium difficile QCD-63q42] >gi|168725093|ref|ZP_02757370.1| 30S ribosomal protein S16 [Clostridium difficile QCD-76w55] >gi|168730848|ref|ZP_02763125.1| 30S ribosomal protein S16 [Clostridium difficile QCD-97b34] >gi|196127299|ref|ZP_03119048.1| 30S ribosomal protein S16 [Clostridium difficile ATCC 43255] >gi|196160760|ref|ZP_03121321.1| 30S ribosomal protein S16 [Clostridium difficile CIP 107932] >gi|196165603|ref|ZP_03126134.1| 30S ribosomal protein S16 [Clostridium difficile QCD-23m63] >gi|122974132|sp|Q18BB8.1|RS16_CLOD6 30S ribosomal protein S16 >gi|115250287|emb|CAJ68109.1| 30S ribosomal protein S16 [Clostridium difficile 630] (90 aa)
Score = 181, Expect = 2.3e-12, Identities = 35/80 (43%), Positives = 51/80 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YRIV  DSR  RDGK+I  IG+ NP  +  + +I++  A++WL  GA+PT+ V+ L  + G+ +KF  SK+
  S:     9 RMGANKKPFYRIVVADSRAPRDGKFIEEIGYYNPISEPKQVRINDEKAIKWLATGAQPTEVVKKLLVKNGVIEKFEASKQ 88
>gi|160892787|ref|ZP_02073577.1| hypothetical protein CLOL250_00318 [Clostridium sp. L2-50] >gi|156865828|gb|EDO59259.1| hypothetical protein CLOL250_00318 [Clostridium sp. L2-50] (81 aa)
Score = 181, Expect = 2.4e-12, Identities = 34/73 (46%), Positives = 46/73 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG   +P YR++  DSR  RDG++I  IG  +P  + +  KIDE  A +WL  GA+PT+TV  LF Q G+ K
  S:     9 RMGYKKHPFYRVIVADSRFPRDGRFIEEIGTYDPNQEPSVVKIDEEAAKKWLQTGAQPTETVAKLFKQAGIEK 81
>gi|168188033|ref|ZP_02622668.1| ribosomal protein S16 [Clostridium botulinum C str. Eklund] >gi|169294124|gb|EDS76257.1| ribosomal protein S16 [Clostridium botulinum C str. Eklund] (85 aa)
Score = 181, Expect = 2.4e-12, Identities = 33/75 (44%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YR+V  DSR  RDG+++  IG+ NP  +    KIDE  A++W+  GA+PTD V+ LF + G+ +K 
  S:     9 RMGAKKAPFYRVVVADSRSPRDGRFVEEIGYYNPISEPKTIKIDEEKAIKWVKNGAQPTDVVKRLFKEAGIDEKL 83
>gi|118443168|ref|YP_878285.1| 30S ribosomal protein S16 [Clostridium novyi NT] >gi|166234415|sp|A0Q0Y3.1|RS16_CLONN 30S ribosomal protein S16 >gi|118133624|gb|ABK60668.1| ribosomal protein S16 [Clostridium novyi NT] (85 aa)
Score = 181, Expect = 2.4e-12, Identities = 33/75 (44%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YR+V  DSR  RDG+++  IG+ NP  +    KIDE  A++W+  GA+PTD V+ LF + G+ +K 
  S:     9 RMGAKKAPFYRVVVADSRSPRDGRFVEEIGYYNPISEPKAIKIDEEKAIKWVKNGAQPTDVVKRLFKEAGIDEKL 83
>gi|182683693|ref|YP_001835440.1| 30S ribosomal protein S16 [Streptococcus pneumoniae CGSP14] >gi|182629027|gb|ACB89975.1| 30S ribosomal protein S16 [Streptococcus pneumoniae CGSP14] (95 aa)
Score = 181, Expect = 2.6e-12, Identities = 34/74 (45%), Positives = 46/74 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           RMG    P YRI   DSR  RDG++I  +G  NP + EN+  + E   L WL  GA+P+DTVR++ S+ G+ KK
  S:     9 RMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKK 82
>gi|188585995|ref|YP_001917540.1| SSU ribosomal protein S16P [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350682|gb|ACB84952.1| SSU ribosomal protein S16P [Natranaerobius thermophilus JW/NM-WN-LF] (82 aa)
Score = 181, Expect = 2.6e-12, Identities = 34/74 (45%), Positives = 47/74 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           RMG    P+YRIV  D R  RDG++I  +GH NP  +    +I+E  A +WL +GAKP+  VRSL +Q G+ +K
  S:     9 RMGAKKQPSYRIVVADVRAPRDGRFIEELGHYNPTTEPVTLEINEEKAKKWLQEGAKPSQKVRSLLTQAGVVEK 82
>gi|21673992|ref|NP_662057.1| 30S ribosomal protein S16 [Chlorobium tepidum TLS] >gi|25009176|sp|Q8KD88|RS16_CHLTE 30S ribosomal protein S16 >gi|21647138|gb|AAM72399.1| ribosomal protein S16 [Chlorobium tepidum TLS] (134 aa)
Score = 180, Expect = 3.0e-12, Identities = 35/71 (49%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D R  RDGK++ ++GH NP  K +   I++     WLN GA+PTDTV SL   TGL
  S:     8 RAGRKKMPFYQIVAADGRAPRDGKFLEVLGHYNPTAKPHTVTIEKDRVAYWLNVGAQPTDTVHSLIRGTGL 78
>gi|150390507|ref|YP_001320556.1| 30S ribosomal protein S16 [Alkaliphilus metalliredigens QYMF] >gi|167011162|sp|A6TRS9.1|RS16_ALKMQ 30S ribosomal protein S16 >gi|149950369|gb|ABR48897.1| ribosomal protein S16 [Alkaliphilus metalliredigens QYMF] (81 aa)
Score = 180, Expect = 3.2e-12, Identities = 35/73 (47%), Positives = 46/73 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG    P YRIV  D+R  RDG++I  IG+ NP  +  + KID   A +WL  GA+PTDTV+ LF + G+ K
  S:     9 RMGAKKRPFYRIVVADARAPRDGRFIEEIGYYNPVSEPKEIKIDGEKAEKWLGNGAQPTDTVKYLFKKNGIIK 81
>gi|189346908|ref|YP_001943437.1| ribosomal protein S16 [Chlorobium limicola DSM 245] >gi|189341055|gb|ACD90458.1| ribosomal protein S16 [Chlorobium limicola DSM 245] (133 aa)
Score = 180, Expect = 3.4e-12, Identities = 34/71 (47%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA DSR  RDGK++ ++GH  P  K +   I +     W+  GA+PTDTVRSL   TGL
  S:     8 RTGRKKLPFYQIVAADSRAPRDGKFLEIVGHYQPTAKPHAVTIKKDRVSYWMQTGAQPTDTVRSLIRSTGL 78
>gi|153954027|ref|YP_001394792.1| 30S ribosomal protein S16 [Clostridium kluyveri DSM 555] >gi|189044374|sp|A5N813.1|RS16_CLOK5 30S ribosomal protein S16 >gi|146346908|gb|EDK33444.1| RpsP [Clostridium kluyveri DSM 555] (85 aa)
Score = 179, Expect = 3.8e-12, Identities = 33/71 (46%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV  DSR  RDG+++  IG+ NP  +    K DE  A++W+  GA+PTD V+ LF + GL
  S:     9 RMGAKKAPFYRIVVADSRSPRDGRFVEEIGYYNPVTEPTIIKFDEEKAVKWIKNGAQPTDIVKKLFDKAGL 79
>gi|18310694|ref|NP_562628.1| 30S ribosomal protein S16 [Clostridium perfringens str. 13] >gi|110799336|ref|YP_696399.1| 30S ribosomal protein S16 [Clostridium perfringens ATCC 13124] >gi|110801993|ref|YP_698999.1| 30S ribosomal protein S16 [Clostridium perfringens SM101] >gi|168207937|ref|ZP_02633942.1| ribosomal protein S16 [Clostridium perfringens E str. JGS1987] >gi|168210655|ref|ZP_02636280.1| ribosomal protein S16 [Clostridium perfringens B str. ATCC 3626] >gi|168214189|ref|ZP_02639814.1| ribosomal protein S16 [Clostridium perfringens CPE str. F4969] >gi|168216999|ref|ZP_02642624.1| ribosomal protein S16 [Clostridium perfringens NCTC 8239] >gi|169342746|ref|ZP_02863786.1| ribosomal protein S16 [Clostridium perfringens C str. JGS1495] >gi|182625869|ref|ZP_02953635.1| ribosomal protein S16 [Clostridium perfringens D str. JGS1721] >gi|122958813|sp|Q0TPP1.1|RS16_CLOP1 30S ribosomal protein S16 >gi|123146051|sp|Q0SSA8.1|RS16_CLOPS 30S ribosomal protein S16 >gi|20140042|sp|Q8XJP4|RS16_CLOPE 30S ribosomal protein S16 >gi|18145375|dbj|BAB81418.1| 30S ribosomal protein S16 [Clostridium perfringens str. 13] >gi|110673983|gb|ABG82970.1| ribosomal protein S16 [Clostridium perfringens ATCC 13124] >gi|110682494|gb|ABG85864.1| ribosomal protein S16 [Clostridium perfringens SM101] >gi|169299252|gb|EDS81322.1| ribosomal protein S16 [Clostridium perfringens C str. JGS1495] >gi|170660753|gb|EDT13436.1| ribosomal protein S16 [Clostridium perfringens E str. JGS1987] >gi|170711268|gb|EDT23450.1| ribosomal protein S16 [Clostridium perfringens B str. ATCC 3626] >gi|170714276|gb|EDT26458.1| ribosomal protein S16 [Clostridium perfringens CPE str. F4969] >gi|177908903|gb|EDT71395.1| ribosomal protein S16 [Clostridium perfringens D str. JGS1721] >gi|182380891|gb|EDT78370.1| ribosomal protein S16 [Clostridium perfringens NCTC 8239] (81 aa)
Score = 179, Expect = 3.9e-12, Identities = 36/71 (50%), Positives = 46/71 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK-ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YR+V  DSR  RDG++I  IG+ NP  K E + KID   A +WL  GA+PTD V+ LF+Q G+
  S:     9 RMGAHKAPFYRVVVADSRSPRDGRFIEEIGYYNPIAKPEAEVKIDAEKAAKWLGNGAQPTDIVKKLFNQAGI 80
>gi|119357326|ref|YP_911970.1| 30S ribosomal protein S16 [Chlorobium phaeobacteroides DSM 266] >gi|166234410|sp|A1BGL9.1|RS16_CHLPD 30S ribosomal protein S16 >gi|119354675|gb|ABL65546.1| SSU ribosomal protein S16P [Chlorobium phaeobacteroides DSM 266] (135 aa)
Score = 179, Expect = 4.4e-12, Identities = 34/71 (47%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D+R  RDGK++ +IGH  P  K +   I +     W+  GA+PTDTVRSL   TGL
  S:     8 RTGRKKLPIYQIVAADARSPRDGKFLEVIGHYQPTAKPHAVTIKKDRVAYWMQTGAQPTDTVRSLIRSTGL 78
>gi|78186828|ref|YP_374871.1| 30S ribosomal protein S16 [Pelodictyon luteolum DSM 273] >gi|109894780|sp|Q3B4A3|RS16_PELLD 30S ribosomal protein S16 >gi|78166730|gb|ABB23828.1| SSU ribosomal protein S16P [Pelodictyon luteolum DSM 273] (195 aa)
Score = 179, Expect = 4.5e-12, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D+R  RDGK++ ++GH  P  K +   +D      W+  GA+PT TVRSL  +TGL
  S:     8 RAGRKKLPVYQIVAADARAPRDGKFLEVVGHYQPTAKPHVVTLDRERVAYWMQTGAQPTSTVRSLIQKTGL 78
>gi|94267669|ref|ZP_01290955.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] >gi|94270961|ref|ZP_01291862.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] >gi|93450605|gb|EAT01726.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] >gi|93451907|gb|EAT02635.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] (82 aa)
Score = 179, Expect = 4.7e-12, Identities = 34/70 (48%), Positives = 43/70 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
           RMGR   P YRIV  DS  KRDG+Y+ ++G  +P  K     +      +WL +GAKPTDTVRSL  Q+G
  S:     9 RMGRKKQPYYRIVVADSEAKRDGRYLEIVGTYDPMQKPAAVTLKRDRVDDWLARGAKPTDTVRSLLKQSG 78
>gi|77919818|ref|YP_357633.1| 30S ribosomal protein S16 [Pelobacter carbinolicus DSM 2380] >gi|109894779|sp|Q3A2E4|RS16_PELCD 30S ribosomal protein S16 >gi|77545901|gb|ABA89463.1| SSU ribosomal protein S16P [Pelobacter carbinolicus DSM 2380] (86 aa)
Score = 178, Expect = 5.8e-12, Identities = 33/78 (42%), Positives = 45/78 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R G    P Y++V  D R  RDG++I  +G  +P    +   + E   LEWLNKGA+PTDTVR L    G+W KF ++
  S:     9 RGGAKKKPFYQVVVADERFPRDGRFIEQLGQYDPRQNPSMVTLKEDKTLEWLNKGAQPTDTVRRLLRTQGVWAKFKQA 86
>gi|72161066|ref|YP_288723.1| SSU ribosomal protein S16P [Thermobifida fusca YX] >gi|109894815|sp|Q47S67|RS16_THEFY 30S ribosomal protein S16 >gi|71914798|gb|AAZ54700.1| SSU ribosomal protein S16P [Thermobifida fusca YX] (146 aa)
Score = 178, Expect = 6.1e-12, Identities = 34/75 (45%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG+V  P YRIV  D+R KRDGK I  IG  +P  + +  +++      WL+ GA+PTD VR +   TG W+KF
  S:     9 RMGKVRTPQYRIVVADARAKRDGKAIEEIGKYHPKEEPSLIEVNSERVQYWLSVGAQPTDPVRHILKLTGDWQKF 83
>gi|166031989|ref|ZP_02234818.1| hypothetical protein DORFOR_01691 [Dorea formicigenerans ATCC 27755] >gi|166028442|gb|EDR47199.1| hypothetical protein DORFOR_01691 [Dorea formicigenerans ATCC 27755] (81 aa)
Score = 178, Expect = 6.2e-12, Identities = 34/73 (46%), Positives = 44/73 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRIV  DSR  RDGK+I  IG  +P L+ +   +DE  A  WLN GA+PT+ V  +F   G+ K
  S:     9 RMGQKKAPFYRIVVADSRAPRDGKFIEEIGTYDPNLEPSGISVDEEAAKRWLNTGAQPTEVVGKIFKAAGIEK 81
>gi|89895344|ref|YP_518831.1| 30S ribosomal protein S16 [Desulfitobacterium hafniense Y51] >gi|109645689|ref|ZP_01369609.1| ribosomal protein S16 [Desulfitobacterium hafniense DCB-2] >gi|123279902|sp|Q24UA5.1|RS16_DESHY 30S ribosomal protein S16 >gi|89334792|dbj|BAE84387.1| 30S ribosomal protein S16 [Desulfitobacterium hafniense Y51] >gi|109643638|gb|EAT53191.1| ribosomal protein S16 [Desulfitobacterium hafniense DCB-2] (88 aa)
Score = 177, Expect = 6.5e-12, Identities = 34/80 (42%), Positives = 48/80 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR++  DS   RDG++I  IG  +P  +     IDE  A++WL  GA+P+DT +SL  + G+  K+ ESKK
  S:     9 RMGAKKNPFYRLIVADSNAPRDGRFIEEIGFYDPTKQPEVLNIDEEKAMKWLATGAQPSDTAKSLLRKAGVLAKYHESKK 88
>gi|51892604|ref|YP_075295.1| 30S ribosomal protein S16 [Symbiobacterium thermophilum IAM 14863] >gi|81610544|sp|Q67PE2|RS16_SYMTH 30S ribosomal protein S16 >gi|51856293|dbj|BAD40451.1| 30S ribosomal protein S16 [Symbiobacterium thermophilum IAM 14863] (88 aa)
Score = 177, Expect = 6.9e-12, Identities = 35/80 (43%), Positives = 49/80 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG    P YR+V  ++   RDG+++  IG+ +P        IDE  AL WL KGA PT+T R+L S+ G+ KKF E++K
  S:     9 RMGMKKTPFYRLVVTEATSPRDGRFVEEIGYYDPTKNPVVLNIDEEKALNWLLKGATPTETTRALLSKAGVLKKFDEARK 88
>gi|125973287|ref|YP_001037197.1| 30S ribosomal protein S16 [Clostridium thermocellum ATCC 27405] >gi|166234416|sp|A3DDH5.1|RS16_CLOTH 30S ribosomal protein S16 >gi|125713512|gb|ABN52004.1| SSU ribosomal protein S16P [Clostridium thermocellum ATCC 27405] (81 aa)
Score = 177, Expect = 7.2e-12, Identities = 34/71 (47%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YR+V  DSR  RDG++I  IG  NP  + ++ KID   A +WL  GA+PTDTVR+L  + G+
  S:     9 RMGAKKRPFYRVVVADSRYPRDGRFIEEIGTYNPLTEPSEIKIDTEKAQKWLKNGAQPTDTVRALLKKVGV 79
>gi|62422971|ref|ZP_00378146.1| COG0228: Ribosomal protein S16 [Brevibacterium linens BL2] (136 aa)
Score = 177, Expect = 7.8e-12, Identities = 34/73 (46%), Positives = 45/73 (61%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           MG++  P YR+V  DSR +RDGK I  IG  +P    +  +ID   A  WL+ GA+PTD VR+L   TG W+K
  S:     1 MGKIRAPFYRVVVADSRTRRDGKAIEQIGIYHPTRNPSVIEIDSERAQHWLSVGAQPTDQVRTLLKLTGDWQK 73
>gi|164688562|ref|ZP_02212590.1| hypothetical protein CLOBAR_02207 [Clostridium bartlettii DSM 16795] >gi|164602975|gb|EDQ96440.1| hypothetical protein CLOBAR_02207 [Clostridium bartlettii DSM 16795] (82 aa)
Score = 176, Expect = 8.5e-12, Identities = 34/74 (45%), Positives = 47/74 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           RMG    P YRIV  DSR  RDG++I  IG+ NP  +  + KI++  A +WL  GA+PT+TV+ LF   G+ +K
  S:     9 RMGANKKPFYRIVVADSRAPRDGRFIEEIGYYNPVSEPKQIKINDEKANKWLGVGAQPTETVKKLFQSQGIIEK 82
>gi|160880540|ref|YP_001559508.1| ribosomal protein S16 [Clostridium phytofermentans ISDg] >gi|189044375|sp|A9KLM5.1|RS16_CLOPH 30S ribosomal protein S16 >gi|160429206|gb|ABX42769.1| ribosomal protein S16 [Clostridium phytofermentans ISDg] (81 aa)
Score = 176, Expect = 9.1e-12, Identities = 32/73 (43%), Positives = 46/73 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YR++  DSR  RDGK+IA IG  +P  + +   +DE  A +WL  GA+PT+T+  LF + G+ K
  S:     9 RMGQKKAPFYRVIVADSRSPRDGKFIAEIGTYDPTQEPSAFNVDEEAAKKWLADGAQPTETINRLFKKAGIVK 81
>gi|19704724|ref|NP_604286.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22096106|sp|Q8RDV8|RS16_FUSNN 30S ribosomal protein S16 >gi|19715044|gb|AAL95585.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (87 aa)
Score = 176, Expect = 9.3e-12, Identities = 38/81 (46%), Positives = 54/81 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R+G    P+YRIVA+++  KRDG  IA +G+  P L+++K  + E   L +L  GA+PT TV+S+  + GLW KF ESKKK
  S:     8 RLGDKKRPSYRIVAMEALSKRDGGAIAYLGNYFP-LEDSKVVLKEEEILNYLKNGAQPTRTVKSILVKAGLWAKFEESKKK 87
>gi|153810631|ref|ZP_01963299.1| hypothetical protein RUMOBE_01015 [Ruminococcus obeum ATCC 29174] >gi|149833027|gb|EDM88109.1| hypothetical protein RUMOBE_01015 [Ruminococcus obeum ATCC 29174] (81 aa)
Score = 175, Expect = 1.1e-11, Identities = 35/73 (47%), Positives = 47/73 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRIV  DSR KRDGK IA IG  +P ++ +  K++E  A +WL  GA+PTD V  +F + G+ K
  S:     9 RMGQKKAPFYRIVVADSRSKRDGKCIAEIGTYDPNIEPSAYKVNEEEAKKWLAAGAQPTDVVARIFKEAGIEK 81
>gi|183221047|ref|YP_001839043.1| 30S ribosomal protein S16 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911141|ref|YP_001962696.1| 30S Ribosomal protein S16 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775817|gb|ABZ94118.1| 30S Ribosomal protein S16 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779469|gb|ABZ97767.1| 30S ribosomal protein S16 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (102 aa)
Score = 175, Expect = 1.3e-11, Identities = 37/76 (48%), Positives = 44/76 (57%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
            R G    P YRIVA D R  RDGK+I  IGH +P A    K   +E   L WL KGA+PTDTV +L  +  +W KF
  S:    24 QRTGTKADPHYRIVAADIRAPRDGKFIEAIGHFHPTASAVKKATFNEEKTLSWLKKGAQPTDTVLALLKKDDVWSKF 100
>gi|183601835|ref|ZP_02963204.1| 30S ribosomal protein S16 [Bifidobacterium animalis subsp. lactis HN019] >gi|183218720|gb|EDT89362.1| 30S ribosomal protein S16 [Bifidobacterium animalis subsp. lactis HN019] (156 aa)
Score = 175, Expect = 1.3e-11, Identities = 35/75 (46%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG+  Y  YR+V +DSR KRDG+ I  IG  NP  + +  +I    A  WL  GA+PTD V +L   TG W+KF
  S:     9 RMGKKFYAVYRVVVMDSRTKRDGRAIEEIGLYNPNTQPSTIEIKSDRAQYWLGVGAQPTDQVLNLLKITGDWQKF 83
>gi|153813989|ref|ZP_01966657.1| hypothetical protein RUMTOR_00196 [Ruminococcus torques ATCC 27756] >gi|145848385|gb|EDK25303.1| hypothetical protein RUMTOR_00196 [Ruminococcus torques ATCC 27756] (81 aa)
Score = 175, Expect = 1.3e-11, Identities = 33/73 (45%), Positives = 46/73 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRIV  DSR  RDG++I  IG  +P    ++ K+DE +A +WLN GA+PT+ V  +F   G+ K
  S:     9 RMGQKKAPFYRIVVADSRSPRDGRFIEEIGTYDPTKDPSEFKVDEELAKKWLNNGAQPTEVVGKIFKAAGIEK 81
>gi|145620452|ref|ZP_01776483.1| ribosomal protein S16 [Geobacter bemidjiensis Bem] >gi|144943277|gb|EDJ78371.1| ribosomal protein S16 [Geobacter bemidjiensis Bem] (88 aa)
Score = 175, Expect = 1.4e-11, Identities = 31/76 (40%), Positives = 46/76 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G    P Y++V  D R +RDG++I  +G  +P        ++E   LEWL KGA+PTDTV+ +  + G+W+KFV
  S:     9 RAGANKKPFYQVVVADCRCRRDGRFIENVGTYDPNKNPAVYNLEEGKTLEWLGKGAQPTDTVKQILKKVGIWEKFV 84
>gi|158320497|ref|YP_001513004.1| 30S ribosomal protein S16 [Alkaliphilus oremlandii OhILAs] >gi|167011163|sp|A8MHC1.1|RS16_ALKOO 30S ribosomal protein S16 >gi|158140696|gb|ABW19008.1| ribosomal protein S16 [Alkaliphilus oremlandii OhILAs] (81 aa)
Score = 175, Expect = 1.4e-11, Identities = 33/71 (46%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV  D+R  RDG++I  IG+ NP  +  + KI+   A +WL  GA+PTDTV+ LF + G+
  S:     9 RMGAHKKPFYRIVVADARSPRDGRFIEEIGYYNPVSEPKEIKINNEKAEKWLKNGAQPTDTVKDLFKKNGI 79
>gi|191164562|ref|ZP_03026425.1| ribosomal protein S16 [Geobacter sp. M21] >gi|190994334|gb|EDV69799.1| ribosomal protein S16 [Geobacter sp. M21] >gi|197089153|gb|ACH40424.1| ribosomal protein S16 [Geobacter bemidjiensis Bem] (88 aa)
Score = 174, Expect = 1.5e-11, Identities = 31/76 (40%), Positives = 46/76 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G    P Y++V  D R +RDG++I  +G  +P        ++E   LEWL KGA+PTDTV+ +  + G+W+KFV
  S:     9 RAGAKKKPFYQVVVADCRCRRDGRFIENVGTYDPNKNPAVYNLEEGKTLEWLGKGAQPTDTVKQILKKVGIWEKFV 84
>gi|193216615|ref|YP_001999857.1| ribosomal protein S16 [Mycoplasma arthritidis 158L3-1] >gi|193001938|gb|ACF07153.1| ribosomal protein S16 [Mycoplasma arthritidis 158L3-1] (85 aa)
Score = 174, Expect = 1.5e-11, Identities = 33/80 (41%), Positives = 53/80 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           R+G+  +  Y+IVA D+R  RDGK+I  +GH +P  K  K  +++ +  ++L++GAKPTDTVR+L  Q   +  ++ SKK
  S:     8 RVGKKFHAQYKIVAADARSPRDGKFIEELGHYDPHAK--KLTLNKELLTKYLDQGAKPTDTVRTLLKQEQFYSNYIASKK 85
>gi|160947511|ref|ZP_02094678.1| hypothetical protein PEPMIC_01445 [Peptostreptococcus micros ATCC 33270] >gi|158446645|gb|EDP23640.1| hypothetical protein PEPMIC_01445 [Peptostreptococcus micros ATCC 33270] (84 aa)
Score = 174, Expect = 1.5e-11, Identities = 33/72 (45%), Positives = 41/72 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLW 73
           RMG    P YRIV  DSR  RDGK+I  IG+ NP  +  + K+D      W+  GAKPTDTV  LF    ++
  S:     9 RMGSKKKPFYRIVVADSRAPRDGKFIEEIGYYNPLTESKEIKVDAEKVNAWIKNGAKPTDTVNRLFKNNNIY 80
>gi|25028516|ref|NP_738570.1| 30S ribosomal protein S16 [Corynebacterium efficiens YS-314] >gi|31076975|sp|Q8FP30|RS16_COREF 30S ribosomal protein S16 >gi|23493801|dbj|BAC18770.1| putative 30S ribosomal protein S16 [Corynebacterium efficiens YS-314] (168 aa)
Score = 174, Expect = 1.6e-11, Identities = 34/76 (44%), Positives = 46/76 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
            R+G++  P YR+V  D+R KRDGK I  IG   P    +  KID   A  WL+ GA+PT++V +L   TG W+KF
  S:     8 QRLGKIRTPHYRVVVADARTKRDGKVIENIGIYEPKQDPSVIKIDSERAQYWLSVGAQPTESVAALLKVTGDWQKF 83
>gi|169830840|ref|YP_001716822.1| ribosomal protein S16 [Candidatus Desulforudis audaxviator MP104C] >gi|169637684|gb|ACA59190.1| ribosomal protein S16 [Candidatus Desulforudis audaxviator MP104C] (92 aa)
Score = 174, Expect = 1.6e-11, Identities = 33/75 (44%), Positives = 49/75 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG    P YRIV  D+R  RDG++I  IG+ +P  +  +  +DEA A  WL +GA+ T+TVRSLF ++G+ ++ 
  S:     9 RMGAKRDPFYRIVVSDARSPRDGRFIEQIGYYDPLEEPARISVDEAKARVWLQQGAQMTETVRSLFKKSGVLERL 83
>gi|117928768|ref|YP_873319.1| SSU ribosomal protein S16P [Acidothermus cellulolyticus 11B] >gi|166234383|sp|A0LV73.1|RS16_ACIC1 30S ribosomal protein S16 >gi|117649231|gb|ABK53333.1| SSU ribosomal protein S16P [Acidothermus cellulolyticus 11B] (174 aa)
Score = 174, Expect = 1.7e-11, Identities = 32/86 (37%), Positives = 50/86 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKS 87
           RMG++  P YRIV  D+R KRDG+ I  IG  +P  + +  +++      WL+ GA+PT+ V++L   TG W++F      P  K+
  S:     9 RMGKIRAPYYRIVVADARTKRDGRAIEEIGQYDPKQEPSLIRVNSERVAYWLSVGAQPTEPVKALLKVTGDWQRFTGEPAPPPMKT 94
>gi|167037688|ref|YP_001665266.1| 30S ribosomal protein S16 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856522|gb|ABY94930.1| ribosomal protein S16 [Thermoanaerobacter pseudethanolicus ATCC 33223] (86 aa)
Score = 173, Expect = 2.0e-11, Identities = 34/71 (47%), Positives = 46/71 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P YRIV  DSR  RDG++I  IG+ NP  +  + KID   A +WL+ GA+P+DTV+SLF + G+
  S:     9 RFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAQPAEIKIDVEKAKKWLSVGAQPSDTVKSLFKKEGI 79
>gi|182417256|ref|ZP_02948609.1| ribosomal protein S16 [Clostridium butyricum 5521] >gi|182378902|gb|EDT76415.1| ribosomal protein S16 [Clostridium butyricum 5521] (81 aa)
Score = 173, Expect = 2.1e-11, Identities = 34/73 (46%), Positives = 45/73 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG    P YR+V  DSR  RDGK+I  IG+ NP  +  + K++E    EWL  GA+PT+ V+ LF+  GL K
  S:     9 RMGAHKAPFYRVVVADSRSPRDGKFIEEIGYYNPLTEPVEFKVNEEKVNEWLANGAQPTEVVKRLFNNAGLTK 81
>gi|167040349|ref|YP_001663334.1| 30S ribosomal protein S16 [Thermoanaerobacter sp. X514] >gi|166854589|gb|ABY92998.1| ribosomal protein S16 [Thermoanaerobacter sp. X514] (86 aa)
Score = 173, Expect = 2.2e-11, Identities = 34/71 (47%), Positives = 46/71 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P YRIV  DSR  RDG++I  IG+ NP  +  + KID   A +WL+ GA+P+DTV+SLF + G+
  S:     9 RFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAQPAEIKIDVEKAKKWLSVGAQPSDTVKSLFKKEGI 79
>gi|177672458|ref|ZP_02945220.1| ribosomal protein S16 [Micrococcus luteus NCTC 2665] >gi|172070916|gb|EDT56965.1| ribosomal protein S16 [Micrococcus luteus NCTC 2665] (156 aa)
Score = 172, Expect = 2.5e-11, Identities = 32/75 (42%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YR+V +DSR +RDG+ I  IG  +P  + +  +ID   A  WL+ GA+PT+ V +L   TG W+KF
  S:     9 RFGKIRAPFYRVVVMDSRTRRDGRAIEEIGKYHPTEEPSFIEIDSERAQYWLSVGAQPTEQVAALLKITGDWQKF 83
>gi|193212764|ref|YP_001998717.1| ribosomal protein S16 [Chlorobaculum parvum NCIB 8327] >gi|193086241|gb|ACF11517.1| ribosomal protein S16 [Chlorobaculum parvum NCIB 8327] (134 aa)
Score = 172, Expect = 2.6e-11, Identities = 34/71 (47%), Positives = 42/71 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D R  RDGK++ +IGH NP  K +   I++     WLN GA+PT T  SL   TGL
  S:     8 RAGRKKMPFYQIVAADGRAPRDGKFLEVIGHYNPTAKPHAVTIEKDRVAYWLNVGAQPTATAHSLIRATGL 78
>gi|154503295|ref|ZP_02040355.1| hypothetical protein RUMGNA_01119 [Ruminococcus gnavus ATCC 29149] >gi|153795962|gb|EDN78382.1| hypothetical protein RUMGNA_01119 [Ruminococcus gnavus ATCC 29149] (81 aa)
Score = 172, Expect = 2.8e-11, Identities = 33/73 (45%), Positives = 44/73 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRIV  D+R  RDGK+I  IG  +P    +  K+DE  A +WLN GA+PT+ V  +F   G+ K
  S:     9 RMGQKKAPFYRIVVADARAPRDGKFIEEIGTYDPNQNPSVFKVDEEAAKKWLNNGAQPTEVVGKIFKAAGIEK 81
>gi|111225151|ref|YP_715945.1| 30S ribosomal protein S16 [Frankia alni ACN14a] >gi|123338088|sp|Q0RDP2.1|RS16_FRAAA 30S ribosomal protein S16 >gi|111152683|emb|CAJ64424.1| 30S ribosomal protein S16 [Frankia alni ACN14a] (148 aa)
Score = 172, Expect = 3.1e-11, Identities = 32/75 (42%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  D+R KRDG+ I  IG  +P    +  K+D   A  WL+ GA+PT+ V ++   TG W+KF
  S:     9 RLGKMREPHYRIVVADARTKRDGRVIEAIGQYHPKSDPSIIKVDAERAQHWLSVGAQPTEPVLAILKVTGDWQKF 83
>gi|19553255|ref|NP_601257.1| 30S ribosomal protein S16 [Corynebacterium glutamicum ATCC 13032] >gi|62390891|ref|YP_226293.1| 30S ribosomal protein S16 [Corynebacterium glutamicum ATCC 13032] >gi|145296018|ref|YP_001138839.1| 30S ribosomal protein S16 [Corynebacterium glutamicum R] >gi|166234417|sp|A4QFC1.1|RS16_CORGB 30S ribosomal protein S16 >gi|23822126|sp|Q8NNX3|RS16_CORGL 30S ribosomal protein S16 >gi|21324824|dbj|BAB99447.1| Ribosomal protein S16 [Corynebacterium glutamicum ATCC 13032] >gi|41326230|emb|CAF20392.1| 30S RIBOSOMAL PROTEIN S16 [Corynebacterium glutamicum ATCC 13032] >gi|140845938|dbj|BAF54937.1| hypothetical protein [Corynebacterium glutamicum R] (165 aa)
Score = 172, Expect = 3.2e-11, Identities = 33/76 (43%), Positives = 46/76 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
            R+G++  P YR+V  D+R KRDGK I  IG   P  + +  KI+   A  WL+ GA+PT+ V +L   TG W+KF
  S:     8 QRLGKIRTPHYRVVIADARTKRDGKVIENIGIYEPKAEPSVIKINSERAQHWLSVGAQPTEAVAALLKVTGDWQKF 83
>gi|20807908|ref|NP_623079.1| 30S ribosomal protein S16 [Thermoanaerobacter tengcongensis MB4] >gi|22096103|sp|Q8R9X1|RS16_THETN 30S ribosomal protein S16 >gi|20516475|gb|AAM24683.1| Ribosomal protein S16 [Thermoanaerobacter tengcongensis MB4] (82 aa)
Score = 171, Expect = 3.2e-11, Identities = 34/71 (47%), Positives = 46/71 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P YRIV  DSR  RDG++I  IG+ NP  +  + KID   A +WL+ GA+P+DTV+SLF + G+
  S:     9 RFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAEPAEIKIDVEKAKKWLSVGAQPSDTVKSLFRKEGI 79
>gi|187778959|ref|ZP_02995432.1| hypothetical protein CLOSPO_02554 [Clostridium sporogenes ATCC 15579] >gi|187772584|gb|EDU36386.1| hypothetical protein CLOSPO_02554 [Clostridium sporogenes ATCC 15579] (82 aa)
Score = 171, Expect = 3.4e-11, Identities = 30/71 (42%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YR+V  DSR  RDG+++  IG+ NP  + +  K+DE    +W+  GA+PTDTV+ L  + G+
  S:     9 RMGAKKAPFYRVVVADSRSPRDGRFVEEIGYYNPITEPSTIKLDEEKVQKWMKNGAQPTDTVKKLIEKAGI 79
>gi|119025227|ref|YP_909072.1| 30S ribosomal protein S16 [Bifidobacterium adolescentis ATCC 15703] >gi|166234395|sp|A0ZZV7.1|RS16_BIFAA 30S ribosomal protein S16 >gi|118764811|dbj|BAF38990.1| 30S ribosomal protein S16 [Bifidobacterium adolescentis ATCC 15703] (149 aa)
Score = 171, Expect = 3.6e-11, Identities = 34/75 (45%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG+  Y  YR+V +DSR KRDG+ I  IG  NP  + +   I+   A  WL  GA+PT+ V +L   TG W+KF
  S:     9 RMGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQPSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKF 83
>gi|134102490|ref|YP_001108151.1| 30S ribosomal protein S16 [Saccharopolyspora erythraea NRRL 2338] >gi|166201349|sp|A4FMF1.1|RS16_SACEN 30S ribosomal protein S16 >gi|133915113|emb|CAM05226.1| 30S ribosomal protein S16 [Saccharopolyspora erythraea NRRL 2338] (148 aa)
Score = 171, Expect = 3.7e-11, Identities = 29/75 (38%), Positives = 48/75 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  D+R +R+G+ I  IG  +P  + ++ ++D   A  WL  GA+PT+ V+++   TG W+KF
  S:     9 RIGKIREPHYRIVVADARTRRNGRAIETIGQYHPMEEPSRIEVDSERAQYWLGVGAQPTEPVQNILEITGDWQKF 83
>gi|118467618|ref|YP_886775.1| 30S ribosomal protein S16 [Mycobacterium smegmatis str. MC2 155] >gi|166201317|sp|A0QV37.1|RS16_MYCS2 30S ribosomal protein S16 >gi|118168905|gb|ABK69801.1| 30S ribosomal protein S16 [Mycobacterium smegmatis str. MC2 155] (156 aa)
Score = 171, Expect = 3.7e-11, Identities = 31/75 (41%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRI+  D+R +RDG+ I +IG  +P  + +  +ID   A  WL  GA+PT+ V +L   TG W+KF
  S:     9 RLGKIRNPQYRIIVADARTRRDGRAIEVIGRYHPKEEPSLIQIDSERAQYWLGVGAQPTEPVLALLKITGDWQKF 83
>gi|153932874|ref|YP_001384623.1| 30S ribosomal protein S16 [Clostridium botulinum A str. ATCC 19397] >gi|153934843|ref|YP_001388140.1| 30S ribosomal protein S16 [Clostridium botulinum A str. Hall] >gi|168180671|ref|ZP_02615335.1| ribosomal protein S16 [Clostridium botulinum NCTC 2916] >gi|168184654|ref|ZP_02619318.1| ribosomal protein S16 [Clostridium botulinum Bf] >gi|166234413|sp|A7FW12.1|RS16_CLOB1 30S ribosomal protein S16 >gi|152928918|gb|ABS34418.1| ribosomal protein S16 [Clostridium botulinum A str. ATCC 19397] >gi|152930757|gb|ABS36256.1| ribosomal protein S16 [Clostridium botulinum A str. Hall] >gi|182668584|gb|EDT80563.1| ribosomal protein S16 [Clostridium botulinum NCTC 2916] >gi|182672274|gb|EDT84235.1| ribosomal protein S16 [Clostridium botulinum Bf] (82 aa)
Score = 171, Expect = 3.8e-11, Identities = 30/71 (42%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YR+V  DSR  RDG+++  IG+ NP  + +  K+DE    +W+  GA+PTDTV+ L  + G+
  S:     9 RMGAKKAPFYRVVVADSRSPRDGRFVEEIGYYNPITEPSTIKLDEEKVQKWIKNGAQPTDTVKKLIEKAGI 79
>gi|167748891|ref|ZP_02421018.1| hypothetical protein ANACAC_03665 [Anaerostipes caccae DSM 14662] >gi|167651861|gb|EDR95990.1| hypothetical protein ANACAC_03665 [Anaerostipes caccae DSM 14662] (86 aa)
Score = 171, Expect = 3.9e-11, Identities = 34/73 (46%), Positives = 44/73 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YR+V  DSR  RDGK+I  IG  +P    +  K DE  A +WL++GA+PTDTV  L    G+ K
  S:    14 RMGQKKSPFYRVVVADSRSPRDGKFIEEIGTYDPNQDPSVIKFDEDAAKKWLSQGAQPTDTVAKLLKVAGIEK 86
>gi|148380406|ref|YP_001254947.1| ribosomal protein S16 [Clostridium botulinum A str. ATCC 3502] >gi|153940846|ref|YP_001391746.1| 30S ribosomal protein S16 [Clostridium botulinum F str. Langeland] >gi|170757274|ref|YP_001781991.1| ribosomal protein S16 [Clostridium botulinum B1 str. Okra] >gi|170761170|ref|YP_001787760.1| ribosomal protein S16 [Clostridium botulinum A3 str. Loch Maree] >gi|166234414|sp|A7GG36.1|RS16_CLOBL 30S ribosomal protein S16 >gi|148289890|emb|CAL83998.1| 30S ribosomal protein S16 [Clostridium botulinum A str. ATCC 3502] >gi|152936742|gb|ABS42240.1| ribosomal protein S16 [Clostridium botulinum F str. Langeland] >gi|169122486|gb|ACA46322.1| ribosomal protein S16 [Clostridium botulinum B1 str. Okra] >gi|169408159|gb|ACA56570.1| ribosomal protein S16 [Clostridium botulinum A3 str. Loch Maree] (82 aa)
Score = 171, Expect = 4.1e-11, Identities = 30/71 (42%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YR+V  DSR  RDG+++  IG+ NP  + +  K+DE    +W+  GA+PTDTV+ L  + G+
  S:     9 RMGAKKAPFYRVVVADSRSPRDGRFVEEIGYYNPITEPSTIKLDEEKVQKWIKNGAQPTDTVKKLIEKAGI 79
>gi|160933329|ref|ZP_02080717.1| hypothetical protein CLOLEP_02174 [Clostridium leptum DSM 753] >gi|156867206|gb|EDO60578.1| hypothetical protein CLOLEP_02174 [Clostridium leptum DSM 753] (80 aa)
Score = 170, Expect = 4.9e-11, Identities = 32/69 (46%), Positives = 44/69 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           RMG    P YRIV  DSR  RDG++I  IG  NP ++  + K+D   A +W+  GA+PTDTV++LF + 
  S:     9 RMGAKKAPYYRIVVADSRYPRDGRFIEEIGFYNPMVEPAEVKVDAEKAKKWIANGAQPTDTVKALFKKN 77
>gi|78044705|ref|YP_360265.1| ribosomal protein S16 [Carboxydothermus hydrogenoformans Z-2901] >gi|109893870|sp|Q3AC69|RS16_CARHZ 30S ribosomal protein S16 >gi|77996820|gb|ABB15719.1| ribosomal protein S16 [Carboxydothermus hydrogenoformans Z-2901] (86 aa)
Score = 170, Expect = 5.1e-11, Identities = 33/75 (44%), Positives = 48/75 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG  + P YR+V  D+R  RDG+ I  IG+ +P  +     I+E  AL+WL KGA+ T+T R+LF + G+ +KF
  S:     9 RMGAKNNPFYRVVVADARSPRDGRVIDEIGYYDPVKQPAAVVINEEKALDWLKKGAQLTETARALFRKAGVLQKF 83
>gi|54020035|ref|YP_115608.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 232] >gi|71893634|ref|YP_279080.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae J] >gi|72080625|ref|YP_287683.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 7448] >gi|81603674|sp|Q601V7|RS16_MYCH2 30S ribosomal protein S16 >gi|109894771|sp|Q4A879|RS16_MYCH7 30S ribosomal protein S16 >gi|109894772|sp|Q4AA52|RS16_MYCHJ 30S ribosomal protein S16 >gi|53987208|gb|AAV27409.1| 30s ribosomal protein S16 [Mycoplasma hyopneumoniae 232] >gi|71851761|gb|AAZ44369.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae J] >gi|71913749|gb|AAZ53660.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 7448] (88 aa)
Score = 169, Expect = 5.7e-11, Identities = 33/79 (41%), Positives = 50/79 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           RMG    P Y+IV  D+R  RDG++I  +G+ NP  K  K  +++     WL+ GA+ T TVR++FS+ G++K F+E K
  S:     8 RMGSKFNPFYKIVVADARAPRDGRFIEALGYYNPQQKFAKVNLEK--TYRWLHIGAQVTQTVRNIFSKKGVFKNFLEQK 84
>gi|28493428|ref|NP_787589.1| 30S ribosomal protein S16 [Tropheryma whipplei str. Twist] >gi|54039443|sp|Q83G64|RS16_TROWT 30S ribosomal protein S16 >gi|28476469|gb|AAO44558.1| 30S ribosomal protein S16 [Tropheryma whipplei str. Twist] (148 aa)
Score = 169, Expect = 6.0e-11, Identities = 36/85 (42%), Positives = 49/85 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAK 86
           R+G+V  P YRIV  DSR KRDGK I  +G  +P    +  +ID   A  WL+ GAKPT    +L   TG W +F   ++ PV++
  S:     9 RIGKVKRPFYRIVVADSRTKRDGKVIEQVGKYHPVQNPSFIEIDSPRAQYWLSVGAKPTQQALALLKLTGDWARFC-GEENPVSR 92
>gi|50842922|ref|YP_056149.1| 30S ribosomal protein S16 [Propionibacterium acnes KPA171202] >gi|81611485|sp|Q6A7S4|RS16_PROAC 30S ribosomal protein S16 >gi|50840524|gb|AAT83191.1| 30S ribosomal protein S16 [Propionibacterium acnes KPA171202] (147 aa)
Score = 169, Expect = 6.3e-11, Identities = 32/76 (42%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R+G++  P YR+V +DSR KRDG+ I  IG  +P    +   ID      WL  GA+PT+ V +L  +TG W+KF 
  S:     9 RLGKIRTPHYRVVVMDSRAKRDGRAIEEIGQYHPKADPSVIVIDSERVQYWLGVGAQPTEAVVALLKRTGDWQKFT 84
>gi|28572460|ref|NP_789240.1| 30S ribosomal protein S16 [Tropheryma whipplei TW08/27] >gi|54039444|sp|Q83I06|RS16_TROW8 30S ribosomal protein S16 >gi|28410592|emb|CAD66978.1| 30s ribosomal protein S16 [Tropheryma whipplei TW08/27] (148 aa)
Score = 169, Expect = 6.5e-11, Identities = 36/85 (42%), Positives = 49/85 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAK 86
           R+G+V  P YRIV  DSR KRDGK I  +G  +P    +  +ID   A  WL+ GAKPT    +L   TG W +F   ++ PV++
  S:     9 RIGKVKRPFYRIVVADSRTKRDGKVIEQVGKYHPVQNPSFIEIDSPRAQYWLSVGAKPTQQALALLKLTGDWARFC-GEENPVSR 92
>gi|118726867|ref|ZP_01575483.1| ribosomal protein S16 [Clostridium cellulolyticum H10] >gi|118663759|gb|EAV70404.1| ribosomal protein S16 [Clostridium cellulolyticum H10] (81 aa)
Score = 169, Expect = 6.9e-11, Identities = 32/71 (45%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YR+V  DSR  RDG++I  IG  NP ++  + KID     +W+  GA+PTDTV+SL  + G+
  S:     9 RMGAKKNPFYRVVVADSRYPRDGRFIEEIGTYNPIVEPVQFKIDAEKVQKWIKNGAQPTDTVKSLLKKQGI 79
>gi|62906872|sp|P80379|RS16_THETH 30S ribosomal protein S16 >gi|14278025|pdb|1GIX|S Chain S, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826135|pdb|1JGO|S Chain S, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826160|pdb|1JGP|S Chain S, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826185|pdb|1JGQ|S Chain S, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|28373714|pdb|1ML5|S Chain S, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 >gi|12056104|emb|CAC21226.1| ribosomal protein S16 [Thermus thermophilus] (91 aa)
Score = 168, Expect = 7.9e-11, Identities = 34/69 (49%), Positives = 45/69 (65%)
  Q:     7 HYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           HYP YRIV  D+R KRDGKYI  IG+ +P     +  K+D   A  WL+ GA+PTDT R L  Q G++++
  S:    16 HYPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 85
>gi|163814208|ref|ZP_02205600.1| hypothetical protein COPEUT_00362 [Coprococcus eutactus ATCC 27759] >gi|158450657|gb|EDP27652.1| hypothetical protein COPEUT_00362 [Coprococcus eutactus ATCC 27759] (81 aa)
Score = 168, Expect = 8.2e-11, Identities = 32/73 (43%), Positives = 45/73 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG   +P YR++  DSR  RDG++I  IG  +P  + +  KIDE  A +WL  GA+PT++V  L  Q G+ K
  S:     9 RMGYKKHPFYRVIVADSRSPRDGRFIEEIGTYDPNQEPSVVKIDEEAAKKWLATGAQPTESVAKLLKQAGIEK 81
>gi|34763934|ref|ZP_00144832.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886291|gb|EAA23569.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (87 aa)
Score = 168, Expect = 9.2e-11, Identities = 35/81 (43%), Positives = 54/81 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R+G    P+YRIVA+++  KRDG  +A +G+  P L++++  + E   L +L  GA+PT TV+S+  + G+W KF ESKKK
  S:     8 RLGDKKRPSYRIVAMEALSKRDGGAVAYLGNYFP-LEDSRVVLKEEEILNFLKNGAQPTRTVKSILVKAGVWAKFEESKKK 87
>gi|38234109|ref|NP_939876.1| 30S ribosomal protein S16 [Corynebacterium diphtheriae NCTC 13129] >gi|54039375|sp|P62228|RS16_CORDI 30S ribosomal protein S16 >gi|38200371|emb|CAE50058.1| 30S ribosomal protein S16 [Corynebacterium diphtheriae] (157 aa)
Score = 167, Expect = 9.5e-11, Identities = 33/75 (44%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YR+V  D+R +RDGK I  IG   P    +  KID   A  WL  GA+PT+ V +L   TG W+KF
  S:     9 RLGKIRTPHYRVVVADARTRRDGKVIENIGIYEPKQDPSVIKIDSERAQYWLGVGAQPTEPVLALLKVTGDWQKF 83
>gi|160938806|ref|ZP_02086157.1| hypothetical protein CLOBOL_03700 [Clostridium bolteae ATCC BAA-613] >gi|158437769|gb|EDP15529.1| hypothetical protein CLOBOL_03700 [Clostridium bolteae ATCC BAA-613] (80 aa)
Score = 167, Expect = 9.7e-11, Identities = 34/71 (47%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG+   P YRIV  DSR  RDGK+IA IG  +P  + +  K DE  A +WL  GA+PT+TV  L    G+
  S:     9 RMGQKKAPFYRIVVADSRSPRDGKFIAEIGTYDPTREPSVIKFDEEAAKKWLATGAQPTETVGKLLKIAGI 79
>gi|189500234|ref|YP_001959704.1| ribosomal protein S16 [Chlorobium phaeobacteroides BS1] >gi|189495675|gb|ACE04223.1| ribosomal protein S16 [Chlorobium phaeobacteroides BS1] (134 aa)
Score = 167, Expect = 1.0e-10, Identities = 32/71 (45%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D+R  RDGK++ +IGH  P  K +   +D+     WL  GA+PT T  SL   TGL
  S:     8 RAGRKKLPVYQIVAADARAPRDGKFLEVIGHYQPTAKPHAITLDKERVAYWLGVGAQPTTTAHSLIRATGL 78
>gi|167344029|ref|ZP_02289870.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J1-208] (71 aa)
Score = 167, Expect = 1.0e-10, Identities = 33/63 (52%), Positives = 40/63 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVR 64
           R+G    P YRIV  DSR  RDG+ I  IG  NP L   + KIDE   L+W++ GAKP+DTVR
  S:     9 RIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVR 71
>gi|29829186|ref|NP_823820.1| 30S ribosomal protein S16 [Streptomyces avermitilis MA-4680] >gi|54039441|sp|Q82JW0|RS16_STRAW 30S ribosomal protein S16 >gi|29606292|dbj|BAC70355.1| putative ribosomal protein S16 [Streptomyces avermitilis MA-4680] (142 aa)
Score = 167, Expect = 1.0e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR +RDG+ I  IG  +P    ++ ++D      WL  GA+PT+ V ++  +TG W+KF
  S:     9 RLGKIRSPHYRIVVADSRTRRDGRAIEEIGLYHPVQNPSRMEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKF 83
>gi|169630310|ref|YP_001703959.1| 30s ribosomal protein S16 [Mycobacterium abscessus] >gi|169242277|emb|CAM63305.1| 30s ribosomal protein S16 [Mycobacterium abscessus] (155 aa)
Score = 167, Expect = 1.1e-10, Identities = 31/75 (41%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRI   D+R +R+G+ I +IG  +P  + +  +ID   A  WL+ GA+PTD V +L   TG W+KF
  S:     9 RLGKIRNPQYRIQVADARTRREGRAIEVIGRYHPKEEPSLIEIDSERAQYWLSVGAQPTDPVLALLKITGDWQKF 83
>gi|154509172|ref|ZP_02044814.1| hypothetical protein ACTODO_01693 [Actinomyces odontolyticus ATCC 17982] >gi|153798806|gb|EDN81226.1| hypothetical protein ACTODO_01693 [Actinomyces odontolyticus ATCC 17982] (144 aa)
Score = 167, Expect = 1.1e-10, Identities = 33/74 (44%), Positives = 44/74 (59%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           MG++H   YR+V VDSR KRDG+ I  +G+ +P    +  +ID   A  WL  GA+P+D VR L   TG   KF
  S:     1 MGKIHAAQYRVVVVDSRKKRDGRVIEEVGYYDPQPNPSIIRIDSERAQYWLGVGAQPSDQVRKLLVLTGDIAKF 74
>gi|150021671|ref|YP_001307025.1| ribosomal protein S16 [Thermosipho melanesiensis BI429] >gi|166228761|sp|A6LNY9.1|RS16_THEM4 30S ribosomal protein S16 >gi|149794192|gb|ABR31640.1| ribosomal protein S16 [Thermosipho melanesiensis BI429] (95 aa)
Score = 167, Expect = 1.1e-10, Identities = 33/80 (41%), Positives = 50/80 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKK 81
           RMG+   P YRIV VD R +RDG YI  +G+ +P        +D   A++W+ KGA+P+ TV++L  + G++KK  E K+
  S:     8 RMGKKKQPFYRIVVVDQRKRRDGAYIESLGYYDPIKDPYILNVDVDKAVDWILKGAQPSQTVKNLLRKAGVFKKVDEIKR 87
>gi|159036840|ref|YP_001536093.1| ribosomal protein S16 [Salinispora arenicola CNS-205] >gi|189029612|sp|A8M677.1|RS16_SALAI 30S ribosomal protein S16 >gi|157915675|gb|ABV97102.1| ribosomal protein S16 [Salinispora arenicola CNS-205] (158 aa)
Score = 166, Expect = 1.4e-10, Identities = 30/76 (39%), Positives = 45/76 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           +RMG++  P YRIV  DSR KRDG+ I  +G   P    +  ++       WL+ GA+P++ V+ L  +TG W+KF
  S:     8 LRMGKIRNPQYRIVIADSRTKRDGRAIEFVGIYQPKEDPSVIEVKSDRVQYWLSVGAQPSEAVQRLLEKTGDWQKF 83
>gi|6094160|sp|O86868|RS16_STRLI 30S ribosomal protein S16 >gi|3336919|emb|CAB06804.1| 30S ribosomal protein S16 [Streptomyces lividans] (139 aa)
Score = 166, Expect = 1.4e-10, Identities = 30/75 (40%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR +RDG+ I  IG  +P    +  ++D      WL  GA+PT+ V ++  +TG W+KF
  S:     9 RLGKIRSPHYRIVVADSRTRRDGRAIEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKF 83
>gi|21223946|ref|NP_629725.1| 30S ribosomal protein S16 [Streptomyces coelicolor A3(2)] >gi|6094159|sp|O69879|RS16_STRCO 30S ribosomal protein S16 >gi|3191984|emb|CAA19383.1| 30S ribosomal protein S16 [Streptomyces coelicolor A3(2)] (139 aa)
Score = 166, Expect = 1.4e-10, Identities = 30/75 (40%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR +RDG+ I  IG  +P    +  ++D      WL  GA+PT+ V ++  +TG W+KF
  S:     9 RLGKIRSPHYRIVVADSRTRRDGRAIEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKF 83
>gi|152965366|ref|YP_001361150.1| ribosomal protein S16 [Kineococcus radiotolerans SRS30216] >gi|189029602|sp|A6W7U7.1|RS16_KINRD 30S ribosomal protein S16 >gi|151359883|gb|ABS02886.1| ribosomal protein S16 [Kineococcus radiotolerans SRS30216] (131 aa)
Score = 166, Expect = 1.5e-10, Identities = 33/75 (44%), Positives = 43/75 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG++  P YRIV  DSR KRDG+ I  IG  NP    +  ++       WL  GA+PT+ V +L   TG W+KF
  S:     9 RMGQIRAPFYRIVVADSRNKRDGRSIEEIGLYNPMTDPSTIEVKSERVQYWLGVGAQPTEQVAALLKVTGDWQKF 83
>gi|83944831|ref|ZP_00957197.1| ribosomal protein S16 [Oceanicaulis alexandrii HTCC2633] >gi|83851613|gb|EAP89468.1| ribosomal protein S16 [Oceanicaulis alexandrii HTCC2633] (140 aa)
Score = 166, Expect = 1.5e-10, Identities = 33/73 (45%), Positives = 44/73 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           R G    P YRIV  DSR+ RDG++I  IGH NP L    EN+  +D   A EW+ KGA+P+D V       G+++
  S:     9 RGGAKKRPYYRIVVTDSRMPRDGRFIEKIGHYNPMLPKDHENRISVDTEKAAEWIKKGAQPSDRVARFLKDAGVYE 84
>gi|46198981|ref|YP_004648.1| 30S ribosomal protein S16 [Thermus thermophilus HB27] >gi|55981004|ref|YP_144301.1| 30S ribosomal protein S16 [Thermus thermophilus HB8] >gi|50403623|sp|P62238|RS16_THET2 30S ribosomal protein S16 >gi|62900937|sp|Q5SJH3|RS16_THET8 30S ribosomal protein S16 >gi|10120996|pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus >gi|10835600|pdb|1FJG|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin >gi|13096409|pdb|1HR0|P Chain P, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit >gi|13399807|pdb|1HNW|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline >gi|13399829|pdb|1HNX|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin >gi|13399851|pdb|1HNZ|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B >gi|14278071|pdb|1IBK|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin >gi|14278092|pdb|1IBL|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin >gi|14278116|pdb|1IBM|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site >gi|14278545|pdb|1I94|P Chain P, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 >gi|14278566|pdb|1I95|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine >gi|14278587|pdb|1I96|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) >gi|14278609|pdb|1I97|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline >gi|20663901|pdb|1J5E|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit >gi|27065891|pdb|1N32|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin >gi|27065918|pdb|1N33|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin >gi|27065945|pdb|1N34|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position >gi|27065971|pdb|1N36|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position >gi|58177415|pdb|1XMO|P Chain P, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center >gi|58177438|pdb|1XMQ|P Chain P, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center >gi|58177479|pdb|1XNQ|P Chain P, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center >gi|58177502|pdb|1XNR|P Chain P, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center >gi|66361069|pdb|1YL4|S Chain S, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. 30s Subunit. The Coordinates For The 50s Subunit Are In The Pdb Entry 1yl3 >gi|88192251|pdb|2B64|P Chain P, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf1 And Is Described In Remark 400. >gi|88192314|pdb|2B9M|P Chain P, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf2 And Is Described In Remark 400. >gi|88192370|pdb|2B9O|P Chain P, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site. This File Contains The 30s Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site And Is Described In Remark 400. >gi|110591338|pdb|2F4V|P Chain P, 30s Ribosome + Designer Antibiotic >gi|116667669|pdb|2HHH|P Chain P, Crystal Structure Of Kasugamycin Bound To The 30s Ribosomal Subunit >gi|116668212|pdb|2J00|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, A-, P- And E- Site Trnas And Paromomycin For Molecule I. >gi|116668273|pdb|2J02|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4) This File Contains The 30s Subunit, Mrna, A-, P- And E- Site Trnas And Paromomycin For Molecule Ii. >gi|119389727|pdb|2HGI|S Chain S, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgj. >gi|119389784|pdb|2HGP|S Chain S, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgq. >gi|119389840|pdb|2HGR|S Chain S, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgu. >gi|149241290|pdb|2E5L|P Chain P, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction >gi|149242723|pdb|2OW8|QQ Chain q, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 2ow8, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsa. >gi|149243633|pdb|2UU9|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Gug-Codon In The A-Site And Paromomycin. >gi|149243660|pdb|2UUA|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guc-Codon In The A-Site And Paromomycin. >gi|149243687|pdb|2UUB|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guu-Codon In The A-Site And Paromomycin. >gi|149243714|pdb|2UUC|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Gua-Codon In The A-Site And Paromomycin. >gi|149243853|pdb|2UXC|P Chain P, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Ucgu In The Context Of The Thermus Thermophilus 30s Subunit. >gi|157836423|pdb|2UXB|P Chain P, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Gggu In The Context Of The Thermus Thermophilus 30s Subunit. >gi|157836500|pdb|2V46|P Chain P, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 1. >gi|157836556|pdb|2V48|P Chain P, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 3 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 2. >gi|158430915|pdb|2UXD|P Chain P, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Cggg In The Context Of The Thermus Thermophilus 30s Subunit. >gi|160285954|pdb|2QNH|QQ Chain q, Interactions And Dynamics Of The Shine-Dalgarno Helix In The 70s Ribosome. This File, 2qnh, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsp. >gi|186972864|pdb|2VQE|P Chain P, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding >gi|186972887|pdb|2VQF|P Chain P, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding >gi|46196605|gb|AAS81021.1| SSU ribosomal protein S16P [Thermus thermophilus HB27] >gi|55772417|dbj|BAD70858.1| 30S ribosomal protein S16 [Thermus thermophilus HB8] (88 aa)
Score = 166, Expect = 1.5e-10, Identities = 35/74 (47%), Positives = 46/74 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G  H P YRIV  D+R KRDGKYI  IG+ +P     +  K+D   A  WL+ GA+PTDT R L  Q G++++
  S:     8 RFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|111023494|ref|YP_706466.1| 30S ribosomal protein S16 [Rhodococcus sp. RHA1] >gi|123045452|sp|Q0S2C8.1|RS16_RHOSR 30S ribosomal protein S16 >gi|110823024|gb|ABG98308.1| 30S ribosomal protein S16 [Rhodococcus sp. RHA1] (153 aa)
Score = 166, Expect = 1.5e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR +R+G+ I  IG  +P  + +  ++D   A  WL  GA+PT+ V ++   TG W+KF
  S:     9 RLGKIRNPQYRIVVADSRTRRNGRAIETIGKYHPKEEPSLIEVDSERAQYWLGVGAQPTEPVEAILKITGDWQKF 83
>gi|154486609|ref|ZP_02028016.1| hypothetical protein BIFADO_00426 [Bifidobacterium adolescentis L2-32] >gi|154084472|gb|EDN83517.1| hypothetical protein BIFADO_00426 [Bifidobacterium adolescentis L2-32] (140 aa)
Score = 166, Expect = 1.6e-10, Identities = 33/74 (44%), Positives = 44/74 (59%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           MG+  Y  YR+V +DSR KRDG+ I  IG  NP  + +   I+   A  WL  GA+PT+ V +L   TG W+KF
  S:     1 MGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQPSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKF 74
>gi|34811544|pdb|1PNS|P Chain P, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. >gi|34811600|pdb|1PNX|P Chain P, Crystal Structure Of The Wild Type Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx, Contains Only Molecules Of The 30s Ribosomal Subunit. The 50s Subunit Is In The Pdb File 1pny. >gi|56966338|pdb|1VOQ|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966391|pdb|1VOS|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966444|pdb|1VOV|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966497|pdb|1VOX|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966550|pdb|1VOZ|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. (83 aa)
Score = 165, Expect = 1.6e-10, Identities = 35/74 (47%), Positives = 46/74 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G  H P YRIV  D+R KRDGKYI  IG+ +P     +  K+D   A  WL+ GA+PTDT R L  Q G++++
  S:     8 RFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|148272547|ref|YP_001222108.1| 30S ribosomal protein S16 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|166234412|sp|A5CQQ8.1|RS16_CLAM3 30S ribosomal protein S16 >gi|147830477|emb|CAN01412.1| 30S ribosomal protein S16 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (137 aa)
Score = 165, Expect = 1.7e-10, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR KRDG+ I  IG  +P  + +  ++    A  WL+ GA+PT+ V +L   TG W +F
  S:     9 RLGKIRAPYYRIVVADSRTKRDGRVIEEIGKYHPTEEPSFIEVQSERAQYWLSVGAQPTEQVEALLKLTGDWGRF 83
>gi|145593856|ref|YP_001158153.1| ribosomal protein S16 [Salinispora tropica CNB-440] >gi|189029614|sp|A4X4H5.1|RS16_SALTO 30S ribosomal protein S16 >gi|145303193|gb|ABP53775.1| SSU ribosomal protein S16P [Salinispora tropica CNB-440] (154 aa)
Score = 165, Expect = 1.7e-10, Identities = 30/76 (39%), Positives = 45/76 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           +RMG++  P YRIV  DSR KRDG+ I  +G   P    +  ++       WL+ GA+P++ V+ L  +TG W+KF
  S:     8 LRMGKIRNPQYRIVIADSRTKRDGRAIEFVGIYQPKHDPSVIEVKSDRVQYWLSVGAQPSEAVQRLLEKTGDWQKF 83
>gi|171741401|ref|ZP_02917208.1| hypothetical protein BIFDEN_00484 [Bifidobacterium dentium ATCC 27678] >gi|171277015|gb|EDT44676.1| hypothetical protein BIFDEN_00484 [Bifidobacterium dentium ATCC 27678] (140 aa)
Score = 165, Expect = 1.8e-10, Identities = 33/74 (44%), Positives = 44/74 (59%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           MG+  Y  YR+V +DSR KRDG+ I  IG  NP  + +   I+   A  WL  GA+PT+ V +L   TG W+KF
  S:     1 MGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQPSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKF 74
>gi|86742275|ref|YP_482675.1| SSU ribosomal protein S16P [Frankia sp. CcI3] >gi|109893882|sp|Q2J6Z6|RS16_FRASC 30S ribosomal protein S16 >gi|86569137|gb|ABD12946.1| SSU ribosomal protein S16P [Frankia sp. CcI3] (148 aa)
Score = 165, Expect = 1.9e-10, Identities = 31/76 (40%), Positives = 45/76 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
            R+G++  P YRIV  D+R KRDG+ I  IG  +P    +  K+D      WL+ GA+PT+ V ++   TG W+KF
  S:     8 QRLGKMREPHYRIVVADARTKRDGRVIESIGQYHPKSDPSIIKVDAERVGHWLSVGAQPTEPVLAILKVTGDWQKF 83
>gi|148324571|gb|EDK89821.1| ribosomal protein S16 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (87 aa)
Score = 165, Expect = 1.9e-10, Identities = 34/81 (41%), Positives = 54/81 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R+G    P+YRIVA+++  KRDG  +A +G+  P L++++  + E   L +L  GA+PT TV+S+  + G+W KF E+KKK
  S:     8 RLGDKKRPSYRIVAMEALSKRDGGAVAYLGNYFP-LEDSRVVLKEEEILNFLKNGAQPTRTVKSILVKAGVWAKFEETKKK 87
>gi|148655436|ref|YP_001275641.1| ribosomal protein S16 [Roseiflexus sp. RS-1] >gi|166201347|sp|A5UST8.1|RS16_ROSS1 30S ribosomal protein S16 >gi|148567546|gb|ABQ89691.1| SSU ribosomal protein S16P [Roseiflexus sp. RS-1] (95 aa)
Score = 165, Expect = 2.1e-10, Identities = 32/86 (37%), Positives = 48/86 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKS 87
           RMG+   P+YR+V  DSR  RDGK+I ++GH NP  +  +  +       WL+ GA+P++TV  L  Q G+     + K  P A +
  S:     8 RMGKTKQPSYRLVVADSRAPRDGKFIEIVGHYNPVRQPKELHVKADRVRYWLSVGAQPSETVVRLLKQVGVLD--ADGKPTPTATT 91
>gi|54026128|ref|YP_120370.1| 30S ribosomal protein S16 [Nocardia farcinica IFM 10152] >gi|81602540|sp|Q5YS35|RS16_NOCFA 30S ribosomal protein S16 >gi|54017636|dbj|BAD59006.1| putative ribosomal protein S16 [Nocardia farcinica IFM 10152] (144 aa)
Score = 164, Expect = 2.1e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YR+V  D+R +RDG+ I  IG  +P  + +  +ID      WL+ GA+PT+ V+ L   TG W+KF
  S:     9 RLGKIRNPQYRVVVADARTRRDGRAIESIGKYHPKEEPSLIEIDSERVQYWLSVGAQPTEPVQRLLEITGDWQKF 83
>gi|170781186|ref|YP_001709518.1| 30S ribosomal protein S16 [Clavibacter michiganensis subsp. sepedonicus] >gi|189044372|sp|B0REM8.1|RS16_CLAMS 30S ribosomal protein S16 >gi|169155754|emb|CAQ00875.1| 30S ribosomal protein S16 [Clavibacter michiganensis subsp. sepedonicus] (135 aa)
Score = 164, Expect = 2.3e-10, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR KRDG+ I  IG  +P  + +  ++    A  WL+ GA+PT+ V +L   TG W +F
  S:     9 RLGKIRAPYYRIVVADSRAKRDGRVIEEIGKYHPTEEPSFIEVQSERAQYWLSVGAQPTEQVEALLKLTGDWGRF 83
>gi|153807915|ref|ZP_01960583.1| hypothetical protein BACCAC_02201 [Bacteroides caccae ATCC 43185] >gi|149129524|gb|EDM20738.1| hypothetical protein BACCAC_02201 [Bacteroides caccae ATCC 43185] (183 aa)
Score = 164, Expect = 2.5e-10, Identities = 33/75 (44%), Positives = 44/75 (58%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
            R GR  Y  Y IV  DSR  RDGK+I  IG  NP        ++   AL W+ KGA+P+DTVR++ S+ G++ K
  S:     8 QRHGRKSYAFYSIVIADSRAPRDGKFIEKIGTYNPNTNPATVDLNFDAALAWVLKGAQPSDTVRNILSREGVYMK 82
>gi|29346681|ref|NP_810184.1| 30S ribosomal protein S16 [Bacteroides thetaiotaomicron VPI-5482] >gi|14195208|sp|Q9RQ15|RS16_BACTN 30S ribosomal protein S16 >gi|6015979|gb|AAF01482.1|AF137263_1 30S ribosomal protein S16-like protein [Bacteroides thetaiotaomicron] >gi|29338578|gb|AAO76378.1| 30S ribosomal protein S16 [Bacteroides thetaiotaomicron VPI-5482] (184 aa)
Score = 164, Expect = 2.5e-10, Identities = 33/75 (44%), Positives = 44/75 (58%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
            R GR  Y  Y IV  DSR  RDGK+I  IG  NP        ++   AL W+ KGA+P+DTVR++ S+ G++ K
  S:     8 QRHGRKSYAFYSIVIADSRAPRDGKFIEKIGTYNPNTNPATVDLNFDAALAWVLKGAQPSDTVRNILSREGVYMK 82
>gi|160885844|ref|ZP_02066847.1| hypothetical protein BACOVA_03848 [Bacteroides ovatus ATCC 8483] >gi|156108657|gb|EDO10402.1| hypothetical protein BACOVA_03848 [Bacteroides ovatus ATCC 8483] (184 aa)
Score = 164, Expect = 2.6e-10, Identities = 33/75 (44%), Positives = 44/75 (58%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
            R GR  Y  Y IV  DSR  RDGK+I  IG  NP        ++   AL W+ KGA+P+DTVR++ S+ G++ K
  S:     8 QRHGRKSYAFYSIVIADSRAPRDGKFIEKIGTYNPNTNPATVDLNFDAALAWVLKGAQPSDTVRNILSREGVYMK 82
>gi|158313000|ref|YP_001505508.1| ribosomal protein S16 [Frankia sp. EAN1pec] >gi|158108405|gb|ABW10602.1| ribosomal protein S16 [Frankia sp. EAN1pec] (161 aa)
Score = 163, Expect = 2.7e-10, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  D+R KRDG+ I  IG  +P    +  K+D      WL+ GA+PT+ V ++   TG W+KF
  S:    24 RLGKMREPHYRIVVADARTKRDGRVIEAIGQYHPKSDPSIIKVDPDRVGHWLSVGAQPTEPVLAILKVTGDWQKF 98
>gi|167758975|ref|ZP_02431102.1| hypothetical protein CLOSCI_01321 [Clostridium scindens ATCC 35704] >gi|167663382|gb|EDS07512.1| hypothetical protein CLOSCI_01321 [Clostridium scindens ATCC 35704] (81 aa)
Score = 163, Expect = 2.8e-10, Identities = 31/73 (42%), Positives = 43/73 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRI+  DSR  RDGK+I  IG  +P    +  K+DE  A +WL+ GA+PT+ V  +    G+ K
  S:     9 RMGQKKAPFYRIIVADSRSPRDGKFIDEIGTYDPNCDPSAIKVDEEAAKKWLSNGAQPTEAVSKILKAAGIEK 81
>gi|15806312|ref|NP_295018.1| 30S ribosomal protein S16 [Deinococcus radiodurans R1] >gi|14195209|sp|Q9RUT7|RS16_DEIRA 30S ribosomal protein S16 >gi|6459040|gb|AAF10863.1|AE001976_6 ribosomal protein S16 [Deinococcus radiodurans R1] (84 aa)
Score = 163, Expect = 2.8e-10, Identities = 34/71 (47%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G  H P YRIV  D R  RDG YI  +GH +P    EN  KID   A  W+ +GA+PTDT R L    G+
  S:     8 RFGSAHNPHYRIVVADVRRPRDGGYIESLGHYDPRKTSENFLKIDVERANHWIAQGAQPTDTARRLLRSQGV 79
>gi|119868048|ref|YP_938000.1| SSU ribosomal protein S16P [Mycobacterium sp. KMS] >gi|126434533|ref|YP_001070224.1| SSU ribosomal protein S16P [Mycobacterium sp. JLS] >gi|166201318|sp|A3PXV6.1|RS16_MYCSJ 30S ribosomal protein S16 >gi|166201319|sp|A1UEF2.1|RS16_MYCSK 30S ribosomal protein S16 >gi|119694137|gb|ABL91210.1| SSU ribosomal protein S16P [Mycobacterium sp. KMS] >gi|126234333|gb|ABN97733.1| SSU ribosomal protein S16P [Mycobacterium sp. JLS] (168 aa)
Score = 163, Expect = 3.0e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  D+R +RDG+ I +IG  +P  + +  +++   A  WL  GA+PT+ V  L   TG W+KF
  S:     9 RLGKIRNPQYRIVVADARTRRDGRSIEVIGRYHPKEEPSLIELNSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 83
>gi|149278166|ref|ZP_01884304.1| 30S ribosomal protein S16 [Pedobacter sp. BAL39] >gi|149230932|gb|EDM36313.1| 30S ribosomal protein S16 [Pedobacter sp. BAL39] (185 aa)
Score = 163, Expect = 3.2e-10, Identities = 33/78 (42%), Positives = 47/78 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG-LWKKFVE 78
            R G+   P + +V  DSR  RDGK+I  +G  NP       +I+    L+W+NKGA+PTDT R++ S  G L+KK +E
  S:     8 QRFGKKGKPFFHVVVADSRSPRDGKFIERLGSYNPNTNPATIEINFEKTLDWVNKGAEPTDTCRAILSYKGVLYKKHLE 86
>gi|108798933|ref|YP_639130.1| SSU ribosomal protein S16P [Mycobacterium sp. MCS] >gi|108769352|gb|ABG08074.1| SSU ribosomal protein S16P [Mycobacterium sp. MCS] (210 aa)
Score = 163, Expect = 3.4e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  D+R +RDG+ I +IG  +P  + +  +++   A  WL  GA+PT+ V  L   TG W+KF
  S:    51 RLGKIRNPQYRIVVADARTRRDGRSIEVIGRYHPKEEPSLIELNSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 125
>gi|146297159|ref|YP_001180930.1| ribosomal protein S16 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166234405|sp|A4XLF4.1|RS16_CALS8 30S ribosomal protein S16 >gi|145410735|gb|ABP67739.1| SSU ribosomal protein S16P [Caldicellulosiruptor saccharolyticus DSM 8903] (81 aa)
Score = 163, Expect = 3.4e-10, Identities = 34/71 (47%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG  + P YRIV  DSR  RDGK I  IG+ NP       K+D   A +WL+ GA+PTDTV+ L  + G+
  S:     9 RMGAKNNPFYRIVVADSRSPRDGKTIDEIGYYNPLKNPADIKVDVEKAKKWLSNGAQPTDTVKILLKKVGV 79
>gi|159901133|ref|YP_001547380.1| ribosomal protein S16 [Herpetosiphon aurantiacus ATCC 23779] >gi|159894172|gb|ABX07252.1| ribosomal protein S16 [Herpetosiphon aurantiacus ATCC 23779] (191 aa)
Score = 163, Expect = 3.5e-10, Identities = 33/71 (46%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG  H P YR+V  DS   RDGK+I  IGH NP  +     I E  A  WL+ GA+P+DTV  L    G+
  S:     8 RMGMKHKPAYRVVIADSHAPRDGKFIETIGHYNPQAQPKVVFIKEDRARYWLSVGAQPSDTVVRLLKNLGV 78
>gi|194333841|ref|YP_002015701.1| ribosomal protein S16 [Prosthecochloris aestuarii DSM 271] >gi|194311659|gb|ACF46054.1| ribosomal protein S16 [Prosthecochloris aestuarii DSM 271] (135 aa)
Score = 162, Expect = 3.5e-10, Identities = 32/71 (45%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D+R  RDGK++ +IG   P  K +   ID+     WL  GA+PT T +SL   TGL
  S:     8 RAGRKKMPVYQIVAADARAPRDGKFLEVIGRYQPTAKPHSITIDKERVEYWLGVGAQPTTTAQSLLRATGL 78
>gi|47459265|ref|YP_016127.1| 30S ribosomal protein S16 [Mycoplasma mobile 163K] >gi|81614201|sp|Q6KHL4|RS16_MYCMO 30S ribosomal protein S16 >gi|47458594|gb|AAT27916.1| 30S ribosomal protein s16 [Mycoplasma mobile 163K] (87 aa)
Score = 162, Expect = 3.7e-10, Identities = 31/81 (38%), Positives = 53/81 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           RMG      YRIVA D+R  RDG++I  +G+ NP  K+   KI++ +  +WL+ GAKPT+T ++LF +  + +++ + ++K
  S:     8 RMGSKFNAFYRIVAADARAPRDGRFIEELGYYNPFSKD--LKIEKELVFKWLDLGAKPTETTKTLFKKEKIMEQYHQKRQK 86
>gi|118617621|ref|YP_905953.1| 30S ribosomal protein S16 RpsP [Mycobacterium ulcerans Agy99] >gi|183981812|ref|YP_001850103.1| 30S ribosomal protein S16 RpsP [Mycobacterium marinum M] >gi|166201321|sp|A0PQ63.1|RS16_MYCUA 30S ribosomal protein S16 >gi|118569731|gb|ABL04482.1| 30S ribosomal protein S16 RpsP [Mycobacterium ulcerans Agy99] >gi|183175138|gb|ACC40248.1| 30S ribosomal protein S16 RpsP [Mycobacterium marinum M] (161 aa)
Score = 162, Expect = 3.9e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRI   D+R +RDG+ I +IG  +P  + +  +I+   A  WL+ GA+PT+ V  L   TG W+KF
  S:     9 RLGKIRNPQYRIAVADARTRRDGRSIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|167766677|ref|ZP_02438730.1| hypothetical protein CLOSS21_01183 [Clostridium sp. SS2/1] >gi|167711614|gb|EDS22193.1| hypothetical protein CLOSS21_01183 [Clostridium sp. SS2/1] (81 aa)
Score = 162, Expect = 4.1e-10, Identities = 32/73 (43%), Positives = 42/73 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YR+V  D+R  RDG++I  IG  +P    +  K DE  A +WL  GA+PTDTV  L    G+ K
  S:     9 RMGQKKAPFYRVVVADARSPRDGRFIEEIGTYDPNQDPSVIKFDEEAAKKWLATGAQPTDTVAKLLKAAGIEK 81
>gi|154492661|ref|ZP_02032287.1| hypothetical protein PARMER_02296 [Parabacteroides merdae ATCC 43184] >gi|154086966|gb|EDN86011.1| hypothetical protein PARMER_02296 [Parabacteroides merdae ATCC 43184] (182 aa)
Score = 162, Expect = 4.2e-10, Identities = 37/82 (45%), Positives = 46/82 (56%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG--LWKKFVESKKK 82
            R GR  Y  Y+IV  DSR  RDGK+I  IG  NP        ++   AL WL  GA+PTDT R++ S+ G  L K  +E  KK
  S:     8 QRHGRKSYAFYQIVVADSRAPRDGKFIERIGSYNPNTNPATVDLNFERALYWLQVGAQPTDTTRNILSREGVCLKKHLLEGVKK 91
>gi|193216161|ref|YP_001997360.1| ribosomal protein S16 [Chloroherpeton thalassium ATCC 35110] >gi|193089638|gb|ACF14913.1| ribosomal protein S16 [Chloroherpeton thalassium ATCC 35110] (135 aa)
Score = 162, Expect = 4.3e-10, Identities = 30/81 (37%), Positives = 52/81 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG-LWKKFVESKKK 82
           R+GR   P Y+IVA D+R +RDG+++ ++G   P  K ++   +    + WL+ GA+PTDT ++L  +TG L++ ++  K K
  S:     8 RIGRKKLPIYQIVAADARARRDGRFLEVLGRYEPTRKPHQLTFNRERLMYWLSVGAQPTDTAKALIRRTGMLYENYMRIKGK 89
>gi|118463389|ref|YP_882936.1| 30S ribosomal protein S16 [Mycobacterium avium 104] >gi|166201315|sp|A0QJ48.1|RS16_MYCA1 30S ribosomal protein S16 >gi|118164676|gb|ABK65573.1| 30S ribosomal protein S16 [Mycobacterium avium 104] (170 aa)
Score = 162, Expect = 4.5e-10, Identities = 30/75 (40%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRI   D+R +RDG+ I +IG  +P    +  +I+   A  WL+ GA+PT+ V  L   TG W+KF
  S:     9 RLGKIRNPQYRIAVADARTRRDGRSIEIIGRYHPKEDPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|120403179|ref|YP_953008.1| ribosomal protein S16 [Mycobacterium vanbaalenii PYR-1] >gi|166201322|sp|A1T752.1|RS16_MYCVP 30S ribosomal protein S16 >gi|119955997|gb|ABM13002.1| SSU ribosomal protein S16P [Mycobacterium vanbaalenii PYR-1] (158 aa)
Score = 162, Expect = 4.6e-10, Identities = 31/75 (41%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YRI   D+R +RDG+ I +IG  +P  + +  +ID   A  WL  GA+PT+ V  L   TG W+KF
  S:     9 RFGKIRNPQYRIAVADARNRRDGRAIEVIGRYHPKEEPSVIEIDSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 83
>gi|41409075|ref|NP_961911.1| 30S ribosomal protein S16 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|54039379|sp|P62234|RS16_MYCPA 30S ribosomal protein S16 >gi|41397434|gb|AAS05294.1| RpsP [Mycobacterium avium subsp. paratuberculosis K-10] (171 aa)
Score = 162, Expect = 4.6e-10, Identities = 30/75 (40%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRI   D+R +RDG+ I +IG  +P    +  +I+   A  WL+ GA+PT+ V  L   TG W+KF
  S:     9 RLGKIRNPQYRIAVADARTRRDGRSIEIIGRYHPKEDPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|147678058|ref|YP_001212273.1| ribosomal protein S16 [Pelotomaculum thermopropionicum SI] >gi|189029606|sp|A5D1G1.1|RS16_PELTS 30S ribosomal protein S16 >gi|146274155|dbj|BAF59904.1| ribosomal protein S16 [Pelotomaculum thermopropionicum SI] (88 aa)
Score = 161, Expect = 5.3e-10, Identities = 32/74 (43%), Positives = 46/74 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           RMG    P YRIV  DSR  RDG++I  IG+ +P  K     ++   AL+WL KGA+ +DT ++L ++ G+ KK
  S:     9 RMGAKKAPFYRIVVADSRSPRDGRFIEEIGYYDPLKKPAVINVNAERALDWLKKGAQLSDTAKALLTKAGVLKK 82
>gi|50955115|ref|YP_062403.1| 30S ribosomal protein S16 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|71649418|sp|Q6AE98|RS16_LEIXX 30S ribosomal protein S16 >gi|50951597|gb|AAT89298.1| 30S ribosomal protein S16 [Leifsonia xyli subsp. xyli str. CTCB07] (153 aa)
Score = 161, Expect = 5.6e-10, Identities = 31/75 (41%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YRIV  DSR KRDG+ I  IG  +P  + ++ ++D   A  WL  G++PT+ V  L   TG W  F
  S:     9 RLGKIRAPHYRIVVADSRTKRDGRVIEEIGLYHPTEEPSRIEVDSDRAQYWLGVGSQPTEQVLVLLKLTGDWGTF 83
>gi|15610046|ref|NP_217425.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Rv] >gi|15842452|ref|NP_337489.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis CDC1551] >gi|31794085|ref|NP_856578.1| 30S ribosomal protein S16 [Mycobacterium bovis AF2122/97] >gi|121638790|ref|YP_979014.1| 30S ribosomal protein S16 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662753|ref|YP_001284276.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Ra] >gi|148824098|ref|YP_001288852.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis F11] >gi|167969538|ref|ZP_02551815.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Ra] >gi|194545052|ref|YP_002080081.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis C] >gi|166201316|sp|A1KMQ3.1|RS16_MYCBP 30S ribosomal protein S16 >gi|166201320|sp|A5U6R4.1|RS16_MYCTA 30S ribosomal protein S16 >gi|54039399|sp|P66436|RS16_MYCBO 30S ribosomal protein S16 >gi|54042136|sp|P66435|RS16_MYCTU 30S ribosomal protein S16 >gi|1403431|emb|CAA98346.1| PROBABLE 30S RIBOSOMAL PROTEIN S16 RPSP [Mycobacterium tuberculosis H37Rv] >gi|13882756|gb|AAK47303.1| ribosomal protein S16 [Mycobacterium tuberculosis CDC1551] >gi|31619680|emb|CAD96620.1| PROBABLE 30S RIBOSOMAL PROTEIN S16 RPSP [Mycobacterium bovis AF2122/97] >gi|121494438|emb|CAL72919.1| Probable 30S ribosomal protein S16 rpsP [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124602059|gb|EAY61069.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis C] >gi|134151061|gb|EBA43106.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis str. Haarlem] >gi|148506905|gb|ABQ74714.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Ra] >gi|148722625|gb|ABR07250.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis F11] (162 aa)
Score = 160, Expect = 6.3e-10, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YR+   D+R +RDG+ I +IG  +P  + +  +I+   A  WL+ GA+PT+ V  L   TG W+KF
  S:     9 RLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|149371983|ref|ZP_01891302.1| 30S ribosomal protein S16 [unidentified eubacterium SCB49] >gi|149355123|gb|EDM43684.1| 30S ribosomal protein S16 [unidentified eubacterium SCB49] (168 aa)
Score = 160, Expect = 6.7e-10, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
            R G+   P Y IVA D+R KRDGKY+  +G  NP +   +  +D   +++WL  GA+PTDT R++ S  G+  K
  S:     8 QRHGKKGKPFYWIVAADARAKRDGKYLEKLGTYNPNMNPAQIDLDVDGSVKWLQNGAQPTDTARAILSYKGVMMK 82
>gi|15827853|ref|NP_302116.1| 30S ribosomal protein S16 [Mycobacterium leprae TN] >gi|3122810|sp|O33014|RS16_MYCLE 30S ribosomal protein S16 >gi|2251155|emb|CAB10626.1| 30s ribosomal protein s16 [Mycobacterium leprae] >gi|13093405|emb|CAC30569.1| 30S ribosomal protein S16 [Mycobacterium leprae] (160 aa)
Score = 160, Expect = 7.6e-10, Identities = 29/75 (38%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YR++  D+R +RDG+ I +IG  +P  + +   I+      WL+ GAKPT+ V  L   TG W+KF
  S:     9 RLGKIRNPQYRVIVADARTRRDGRSIEVIGRYHPKEEPSLIDINSERTQYWLSVGAKPTEPVLKLLKITGDWQKF 83
>gi|78188775|ref|YP_379113.1| 30S ribosomal protein S16 [Chlorobium chlorochromatii CaD3] >gi|109893871|sp|Q3ASF5|RS16_CHLCH 30S ribosomal protein S16 >gi|78170974|gb|ABB28070.1| SSU ribosomal protein S16P [Chlorobium chlorochromatii CaD3] (136 aa)
Score = 160, Expect = 7.8e-10, Identities = 31/71 (43%), Positives = 42/71 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IV  DSR  RDGK++ ++GH  P LK +   + +     W++ GA+PT TV SL   TGL
  S:     8 RAGRKKMPVYQIVVADSRSPRDGKFLEVVGHYQPTLKPHSITLKKDRVEYWMHCGAQPTATVNSLIRATGL 78
>gi|108804226|ref|YP_644163.1| SSU ribosomal protein S16P [Rubrobacter xylanophilus DSM 9941] >gi|123177378|sp|Q1AW77.1|RS16_RUBXD 30S ribosomal protein S16 >gi|108765469|gb|ABG04351.1| ribosomal protein S16 [Rubrobacter xylanophilus DSM 9941] (85 aa)
Score = 160, Expect = 7.8e-10, Identities = 32/74 (43%), Positives = 46/74 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  D+R  RDGK+I  +G  +P  + ++ K+D   A EWL KGA+PTD VR+L   +G+ ++
  S:     9 RHGAKGKPFYRIVVADARSPRDGKFIDRVGTYDPRKEPSEIKVDAEKAREWLRKGAQPTDQVRNLLRISGVLEE 82
>gi|163787265|ref|ZP_02181712.1| 30S ribosomal protein S16 [Flavobacteriales bacterium ALC-1] >gi|159877153|gb|EDP71210.1| 30S ribosomal protein S16 [Flavobacteriales bacterium ALC-1] (171 aa)
Score = 159, Expect = 8.1e-10, Identities = 31/71 (43%), Positives = 42/71 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y IVA DSR KRDGKY+  +G  NP       ++D   A++WL  GA+PTDT +++ S  G
  S:     8 QRHGKKGKPYYWIVAADSRAKRDGKYLEKLGAYNPNTNPATIELDVNGAVQWLQNGAQPTDTAKAILSYKG 78
>gi|68536270|ref|YP_250975.1| 30S ribosomal protein S16 [Corynebacterium jeikeium K411] >gi|109893875|sp|Q4JV00|RS16_CORJK 30S ribosomal protein S16 >gi|68263869|emb|CAI37357.1| 30S ribosomal protein S16 [Corynebacterium jeikeium K411] (172 aa)
Score = 159, Expect = 8.4e-10, Identities = 31/75 (41%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G++  P YR+V  D+R KR GK I  +G   P  + +  +ID   A  WL  GA+PT+ V +L   TG W+KF
  S:     9 RLGKIRTPEYRVVVQDARTKRSGKVIENLGIYQPTQEPSLIQIDSDRAQYWLGVGAQPTEPVLALLKITGDWQKF 83
>gi|86606915|ref|YP_475678.1| ribosomal protein S16 [Synechococcus sp. JA-3-3Ab] >gi|109894810|sp|Q2JSG0|RS16_SYNJA 30S ribosomal protein S16 >gi|86555457|gb|ABD00415.1| ribosomal protein S16 [Synechococcus sp. JA-3-3Ab] (155 aa)
Score = 159, Expect = 8.5e-10, Identities = 31/75 (41%), Positives = 49/75 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+   PTYRIVA++S+ +R+G+ +  +G+ NP  KE    ++ A  L+WL  GA+PTDTV SL  + G+++  
  S:     8 RYGKRRQPTYRIVAIESKARREGRPLEELGYYNPRTKET--VLETAGLLKWLRCGAQPTDTVDSLLRKAGIYEML 80
>gi|94985583|ref|YP_604947.1| 30S ribosomal protein S16 [Deinococcus geothermalis DSM 11300] >gi|123381889|sp|Q1IYA6.1|RS16_DEIGD 30S ribosomal protein S16 >gi|94555864|gb|ABF45778.1| ribosomal protein S16 [Deinococcus geothermalis DSM 11300] (82 aa)
Score = 159, Expect = 8.9e-10, Identities = 34/71 (47%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G  H P YRIV  DSR  RDG YI  +GH +P    EN  KI+   A  WL+ GA+PT T R L    G+
  S:     8 RFGSTHNPHYRIVVTDSRRPRDGGYIENLGHYDPRKTTENYLKINAERAAYWLSVGAQPTQTARRLLKAQGV 79
>gi|167769125|ref|ZP_02441178.1| hypothetical protein ANACOL_00448 [Anaerotruncus colihominis DSM 17241] >gi|167668765|gb|EDS12895.1| hypothetical protein ANACOL_00448 [Anaerotruncus colihominis DSM 17241] (80 aa)
Score = 159, Expect = 9.1e-10, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV  DSR  RDG++I  IG  +P    +  K+D   A +WL+ GA+PTDTV++L    G+
  S:     9 RMGAKKAPFYRIVVADSRYPRDGRFIEEIGTYDPTKDPSVIKVDAEKAKKWLSNGAQPTDTVKALLKIEGV 79
>gi|83856349|ref|ZP_00949878.1| ribosomal protein S16 [Croceibacter atlanticus HTCC2559] >gi|83850149|gb|EAP88017.1| ribosomal protein S16 [Croceibacter atlanticus HTCC2559] (191 aa)
Score = 159, Expect = 9.7e-10, Identities = 31/72 (43%), Positives = 42/72 (58%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
            R G+   P Y IVA DSR KRDG+Y+  +G  NP        +D   ++ WLN GA+PTDT R++ S  G+
  S:     8 QRHGKKGKPFYWIVAADSRSKRDGRYLEKLGTYNPNTNPAIIDLDIDTSVTWLNNGAQPTDTARAILSYKGV 79
>gi|116671029|ref|YP_831962.1| SSU ribosomal protein S16P [Arthrobacter sp. FB24] >gi|116611138|gb|ABK03862.1| SSU ribosomal protein S16P [Arthrobacter sp. FB24] (157 aa)
Score = 159, Expect = 9.7e-10, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YRIV +D+R KRDG+ I  IG  +P  + +  ++D   A  WL  GA+P++ V ++   TG W+KF
  S:    26 RFGKMRAPYYRIVVMDARSKRDGRAIEEIGKYHPTEEPSYIEVDTDRAQYWLGVGAQPSEQVAAILKITGDWQKF 100
>gi|195867989|ref|ZP_03079985.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660323|gb|EDX53584.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (101 aa)
Score = 159, Expect = 9.9e-10, Identities = 34/87 (39%), Positives = 56/87 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV----ESKKKPVAKSK 88
           R+G    P +RIV +D++ K +G YI  +GH +P L   K  + +   L  L  GA+P++TV+++ SQ G+WK+F+     +KK+ VA +K
  S:    11 RVGTHKKPFFRIVVMDAKAKANGAYIENLGHYDPVL--GKVVLKKEAILAQLQNGAQPSETVKNILSQEGIWKEFIALKDANKKRKVALAK 99
>gi|83816028|ref|YP_445749.1| ribosomal protein S16 [Salinibacter ruber DSM 13855] >gi|109894800|sp|Q2S232|RS16_SALRD 30S ribosomal protein S16 >gi|83757422|gb|ABC45535.1| ribosomal protein S16 [Salinibacter ruber DSM 13855] (205 aa)
Score = 158, Expect = 1.0e-09, Identities = 31/65 (47%), Positives = 41/65 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSL 66
           R+GR   P Y IVA D R  RDG+YI  IG   P  +  + +++E  AL WL  GA+P+DTVRS+
  S:     9 RIGRKKIPVYSIVAADQRNARDGRYIEDIGRYFPLREPAEVRLEEDRALYWLENGAQPSDTVRSI 73
>gi|88711236|ref|ZP_01105324.1| 30S ribosomal protein S16 [Flavobacteriales bacterium HTCC2170] >gi|88710177|gb|EAR02409.1| 30S ribosomal protein S16 [Flavobacteriales bacterium HTCC2170] (212 aa)
Score = 158, Expect = 1.0e-09, Identities = 31/72 (43%), Positives = 43/72 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
            R G+   P Y IVA DSR KRDGK++  +G  NP       ++    ++EWLN GA+PTDT R++ S  G+
  S:     8 QRHGKKGKPFYWIVAADSRAKRDGKFLEKLGIYNPNTNPATIEVKVDNSVEWLNNGAQPTDTARAILSYKGV 79
>gi|185179111|ref|ZP_02555486.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024455|ref|ZP_02570461.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039228|ref|ZP_02527845.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 8] >gi|188518393|ref|ZP_02556407.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524251|ref|ZP_02557754.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530614|ref|ZP_02545985.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|184209008|gb|EDU06051.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018749|gb|EDU56789.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998120|gb|EDU67217.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659896|gb|EDX53276.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (98 aa)
Score = 158, Expect = 1.0e-09, Identities = 34/87 (39%), Positives = 56/87 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV----ESKKKPVAKSK 88
           R+G    P +RIV +D++ K +G YI  +GH +P L   K  + +   L  L  GA+P++TV+++ SQ G+WK+F+     +KK+ VA +K
  S:     8 RVGTHKKPFFRIVVMDAKAKANGAYIENLGHYDPVL--GKVVLKKEAILAQLQNGAQPSETVKNILSQEGIWKEFIALKDANKKRKVALAK 96
>gi|23464906|ref|NP_695509.1| 30S ribosomal protein S16 [Bifidobacterium longum NCC2705] >gi|31076979|sp|Q8G7G1|RS16_BIFLO 30S ribosomal protein S16 >gi|23325498|gb|AAN24145.1| 30S ribosomal protein S16 [Bifidobacterium longum NCC2705] (153 aa)
Score = 158, Expect = 1.1e-09, Identities = 33/75 (44%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+  Y  YR+V VDSR KRDGK I  IG  NP  + +  +I    A  WL  GA+P++ V  L + TG W+K+
  S:     9 RQGKKFYAFYRVVVVDSRKKRDGKVIEEIGTYNPNTQPSTIQIKSDRAQYWLGVGAQPSEPVFKLLNITGDWQKY 83
>gi|189465497|ref|ZP_03014282.1| hypothetical protein BACINT_01855 [Bacteroides intestinalis DSM 17393] >gi|189437771|gb|EDV06756.1| hypothetical protein BACINT_01855 [Bacteroides intestinalis DSM 17393] (176 aa)
Score = 158, Expect = 1.1e-09, Identities = 33/74 (44%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  D R  RDGK+I  IG  NP        +    AL+W+ KGA+PTDTVR++ S+ G++ K
  S:     9 RHGRKSYAFYSIVIADVRAPRDGKFIEKIGTYNPNTNPATVDLKFDRALDWVMKGAQPTDTVRNILSREGVYMK 82
>gi|145224754|ref|YP_001135432.1| ribosomal protein S16 [Mycobacterium gilvum PYR-GCK] >gi|189029604|sp|A4TE69.1|RS16_MYCGI 30S ribosomal protein S16 >gi|145217240|gb|ABP46644.1| SSU ribosomal protein S16P [Mycobacterium gilvum PYR-GCK] (170 aa)
Score = 158, Expect = 1.1e-09, Identities = 31/75 (41%), Positives = 43/75 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YRI   D+R +RDG+ I +IG  +P    +  +ID   A  WL  GA+PT+ V  L   TG W+KF
  S:     9 RFGKIRNPQYRISVADARNRRDGRAIEVIGRYHPKEDPSIIEIDSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 83
>gi|46190758|ref|ZP_00121059.2| COG0228: Ribosomal protein S16 [Bifidobacterium longum DJO10A] >gi|189439915|ref|YP_001954996.1| Ribosomal protein S16 [Bifidobacterium longum DJO10A] >gi|189428350|gb|ACD98498.1| Ribosomal protein S16 [Bifidobacterium longum DJO10A] (153 aa)
Score = 158, Expect = 1.1e-09, Identities = 33/75 (44%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+  Y  YR+V VDSR KRDGK I  IG  NP  + +  +I    A  WL  GA+P++ V  L + TG W+K+
  S:     9 RQGKKFYAFYRVVVVDSRKKRDGKVIEEIGTYNPNTQPSTIQIKSDRAQYWLGVGAQPSEPVFKLLNITGDWQKY 83
>gi|85860174|ref|YP_462376.1| SSU ribosomal protein S16P [Syntrophus aciditrophicus SB] >gi|109894809|sp|Q2LVU9|RS16_SYNAS 30S ribosomal protein S16 >gi|85723265|gb|ABC78208.1| SSU ribosomal protein S16P [Syntrophus aciditrophicus SB] (83 aa)
Score = 158, Expect = 1.2e-09, Identities = 30/71 (42%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV  DS   RDG+++ ++G+ +P     +  + E+  LEWL+KGAKPT TV  L  + G+
  S:     9 RMGAKKKPFYRIVVSDSESPRDGRFLEIVGNYDPGKDPAEVNVKESRLLEWLSKGAKPTLTVSQLLQKKGI 79
>gi|37138275|sp|O07348|RS16_THEAQ 30S ribosomal protein S16 (88 aa)
Score = 158, Expect = 1.3e-09, Identities = 34/74 (45%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G  H P YRIV  D R KRDG YI  IG+ +P     +  K+D   A  WL+ GA+PTDT R L  Q G++++
  S:     8 RFGSKHNPHYRIVVTDVRRKRDGAYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|119962569|ref|YP_948178.1| ribosomal protein S16 [Arthrobacter aurescens TC1] >gi|119949428|gb|ABM08339.1| ribosomal protein S16 [Arthrobacter aurescens TC1] (191 aa)
Score = 158, Expect = 1.3e-09, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YRIV +D+R KRDG+ I  IG  +P  + +  ++    A  WL+ GA+PT+ V ++   TG W+KF
  S:    61 RFGKMRAPYYRIVVMDARAKRDGRAIEEIGKYHPTEEPSYIEVASERAQYWLSVGAQPTEQVAAILKITGDWQKF 135
>gi|196236275|ref|ZP_03135074.1| ribosomal protein S16 [Thermus aquaticus Y51MC23] >gi|196219767|gb|EDY14387.1| ribosomal protein S16 [Thermus aquaticus Y51MC23] (87 aa)
Score = 157, Expect = 1.3e-09, Identities = 34/74 (45%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G  H P YRIV  D R KRDG YI  IG+ +P     +  K+D   A  WL+ GA+PTDT R L  Q G++++
  S:     8 RFGSKHNPHYRIVVTDVRRKRDGAYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|163839828|ref|YP_001624233.1| SSU ribosomal protein S16P [Renibacterium salmoninarum ATCC 33209] >gi|162953304|gb|ABY22819.1| SSU ribosomal protein S16P [Renibacterium salmoninarum ATCC 33209] (147 aa)
Score = 157, Expect = 1.4e-09, Identities = 30/75 (40%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YRIV  DSR KRDG+ I  IG  +P    +  +++   A  WL+ GA+P++ V  +   TG W+KF
  S:    13 RFGKMRAPYYRIVVADSRTKRDGRAIEEIGKYHPTEDPSYIEVNSERAQYWLSVGAQPSEQVAQILKITGDWQKF 87
>gi|150008337|ref|YP_001303080.1| 30S ribosomal protein S16 [Parabacteroides distasonis ATCC 8503] >gi|166201327|sp|A6LCP4.1|RS16_PARD8 30S ribosomal protein S16 >gi|149936761|gb|ABR43458.1| ribosomal protein S16 [Parabacteroides distasonis ATCC 8503] (182 aa)
Score = 157, Expect = 1.4e-09, Identities = 36/82 (43%), Positives = 46/82 (56%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG--LWKKFVESKKK 82
            R GR  Y  Y+IV  DSR  RDG++I  IG  NP        ++   AL WL  GA+PTDT R++ S+ G  L K  +E  KK
  S:     8 QRHGRKGYAFYQIVIADSRAPRDGRFIERIGSYNPNTNPATVDLNFERALYWLQVGAQPTDTTRNILSREGVCLKKHLLEGVKK 91
>gi|160889399|ref|ZP_02070402.1| hypothetical protein BACUNI_01823 [Bacteroides uniformis ATCC 8492] >gi|156860916|gb|EDO54347.1| hypothetical protein BACUNI_01823 [Bacteroides uniformis ATCC 8492] (167 aa)
Score = 157, Expect = 1.5e-09, Identities = 33/74 (44%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  D R  RDGK+I  IG  NP        +    AL+W+ KGA+PTDTVR++ S+ G++ K
  S:     9 RHGRKSYAFYSIVIADVRAPRDGKFIEKIGTYNPNTNPATVDLKFDRALDWVLKGAQPTDTVRNILSREGVYMK 82
>gi|13358133|ref|NP_078407.1| ribosomal protein S16 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|14195206|sp|Q9PPS1|RS16_UREPA 30S ribosomal protein S16 >gi|11357038|pir||E82874 ribosomal protein S16 UU568 [imported] - Ureaplasma urealyticum >gi|6899576|gb|AAF30982.1|AE002155_4 ribosomal protein S16 [Ureaplasma parvum serovar 3 str. ATCC 700970] (101 aa)
Score = 157, Expect = 1.6e-09, Identities = 36/87 (41%), Positives = 57/87 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV----ESKKKPVAKSK 88
           R+G    P +RIV +D++ K +G YI  +GH +P L +   K  EA+ L  L  GA+P++TV+++ SQ G+WK+F+     +KK+  A SK
  S:    11 RVGTHKKPFFRIVVMDAKTKANGAYIENLGHYDPVLGQVVLK-KEAI-LAQLQNGAQPSETVKNILSQEGIWKEFIALKDANKKRKAALSK 99
>gi|86135391|ref|ZP_01053972.1| 30S ribosomal protein S16 [Tenacibaculum sp. MED152] >gi|85819564|gb|EAQ40721.1| 30S ribosomal protein S16 [Polaribacter dokdonensis MED152] (187 aa)
Score = 157, Expect = 1.6e-09, Identities = 30/71 (42%), Positives = 43/71 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y IVA D+R KRDG+Y+  IG  NP +   +  +D   A++WL  GA+PTDT +++ S  G
  S:     8 QRHGKKGKPFYWIVAADARAKRDGRYLEKIGTYNPNVNPAEINLDVDGAVKWLQNGAQPTDTAKAILSYKG 78
>gi|170762426|ref|YP_001752653.1| ribosomal protein S16 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920109|ref|ZP_02690748.2| ribosomal protein S16 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508440|ref|ZP_02689592.2| ribosomal protein S16 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701802|ref|ZP_02553530.2| ribosomal protein S16 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168828003|gb|ACA33265.1| ribosomal protein S16 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902471|gb|EDT48760.1| ribosomal protein S16 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675850|gb|EDT87755.1| ribosomal protein S16 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701083|gb|EDU19365.1| ribosomal protein S16 [Ureaplasma parvum serovar 6 str. ATCC 27818] (98 aa)
Score = 157, Expect = 1.7e-09, Identities = 36/87 (41%), Positives = 57/87 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV----ESKKKPVAKSK 88
           R+G    P +RIV +D++ K +G YI  +GH +P L +   K  EA+ L  L  GA+P++TV+++ SQ G+WK+F+     +KK+  A SK
  S:     8 RVGTHKKPFFRIVVMDAKTKANGAYIENLGHYDPVLGQVVLK-KEAI-LAQLQNGAQPSETVKNILSQEGIWKEFIALKDANKKRKAALSK 96
>gi|167762158|ref|ZP_02434285.1| hypothetical protein BACSTE_00510 [Bacteroides stercoris ATCC 43183] >gi|167699801|gb|EDS16380.1| hypothetical protein BACSTE_00510 [Bacteroides stercoris ATCC 43183] (184 aa)
Score = 157, Expect = 1.7e-09, Identities = 33/74 (44%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  D R  RDGK+I  IG  NP        +    AL+W+ KGA+PTDTVR++ S+ G++ K
  S:     9 RHGRKSYAFYSIVIADVRAPRDGKFIEKIGTYNPNTNPATVDLKFDRALDWVLKGAQPTDTVRNILSREGVYMK 82
>gi|188994031|ref|YP_001928283.1| 30S ribosomal protein S16 [Porphyromonas gingivalis ATCC 33277] >gi|188593711|dbj|BAG32686.1| 30S ribosomal protein S16 [Porphyromonas gingivalis ATCC 33277] (192 aa)
Score = 156, Expect = 1.8e-09, Identities = 31/71 (43%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR  Y  Y+IV  DSR  RDGK+I  IG  NP        ++   AL W+  GA+PTDT R++ S+ G+
  S:     9 RHGRKGYAFYKIVVADSRAPRDGKFIERIGSYNPNTNPATIDLNFERALYWIGVGAQPTDTARNILSREGV 79
>gi|160943021|ref|ZP_02090259.1| hypothetical protein FAEPRAM212_00498 [Faecalibacterium prausnitzii M21/2] >gi|158445715|gb|EDP22718.1| hypothetical protein FAEPRAM212_00498 [Faecalibacterium prausnitzii M21/2] (80 aa)
Score = 156, Expect = 1.8e-09, Identities = 30/71 (42%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R+G    P YR+V  DSR  RDG++I  IG  +P  + ++ KID   A +W+  GA+PTDTVR L  ++ +
  S:     9 RVGAKKAPFYRVVVADSRFPRDGRFIEEIGTYDPNKEPSEVKIDAEKAKQWIANGAQPTDTVRVLLKKSNV 79
>gi|168014120|ref|XP_001759603.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162689142|gb|EDQ75515.1| predicted protein [Physcomitrella patens subsp. patens] (83 aa)
Score = 156, Expect = 1.8e-09, Identities = 30/72 (41%), Positives = 48/72 (66%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           +R+GR   P YRI+  +SR +RDGK++ ++GH NP   +N  K   +D      WL+ GA+P+DTVR++  + G+
  S:     6 VRIGRKKLPYYRIIIANSRSRRDGKFLEMVGHYNPMPDKNGEKDILVDSERIKYWLSVGAQPSDTVRNILYKQGV 80
>gi|34541696|ref|NP_906175.1| 30S ribosomal protein S16 [Porphyromonas gingivalis W83] >gi|50403610|sp|Q7MT66|RS16_PORGI 30S ribosomal protein S16 >gi|34398014|gb|AAQ67074.1| ribosomal protein S16 [Porphyromonas gingivalis W83] (192 aa)
Score = 156, Expect = 1.9e-09, Identities = 31/71 (43%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR  Y  Y+IV  DSR  RDGK+I  IG  NP        ++   AL W+  GA+PTDT R++ S+ G+
  S:     9 RHGRKGYAFYKIVVADSRAPRDGKFIERIGSYNPNTNPATIDLNFERALYWIGVGAQPTDTARNILSREGV 79
>gi|86141704|ref|ZP_01060228.1| 30S ribosomal protein S16 [Flavobacterium sp. MED217] >gi|85831267|gb|EAQ49723.1| 30S ribosomal protein S16 [Leeuwenhoekiella blandensis MED217] (180 aa)
Score = 156, Expect = 2.0e-09, Identities = 30/72 (41%), Positives = 43/72 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
            R G+   P Y +VA D+R KRDGK++A +G  NP        ID   +++WL  GA+PT+T + L S TG+
  S:     8 QRHGKKGKPFYWVVAADARAKRDGKFLAKLGVYNPTTNPATIDIDVDSSVKWLQNGAQPTETAKRLLSYTGV 79
>gi|188568862|ref|ZP_02829152.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 2] >gi|188592678|ref|ZP_02694496.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 10] (98 aa)
Score = 156, Expect = 2.1e-09, Identities = 30/79 (37%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P +RIV +D++ K +G YI  +GH +P L   K  + +   L  L  GA+P++TV+++ SQ G+WK+F+  K
  S:     8 RVGTHKKPFFRIVVMDAKAKANGAYIENLGHYDPVL--GKVVLKKEAILAQLQNGAQPSETVKNILSQEGIWKEFIALK 84
>gi|171920541|ref|ZP_02695728.2| ribosomal protein S16 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903238|gb|EDT49527.1| ribosomal protein S16 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (101 aa)
Score = 156, Expect = 2.1e-09, Identities = 30/79 (37%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G    P +RIV +D++ K +G YI  +GH +P L   K  + +   L  L  GA+P++TV+++ SQ G+WK+F+  K
  S:    11 RVGTHKKPFFRIVVMDAKAKANGAYIENLGHYDPVL--GKVVLKKEAILAQLQNGAQPSETVKNILSQEGIWKEFIALK 87
>gi|153854838|ref|ZP_01996061.1| hypothetical protein DORLON_02066 [Dorea longicatena DSM 13814] >gi|149752540|gb|EDM62471.1| hypothetical protein DORLON_02066 [Dorea longicatena DSM 13814] (81 aa)
Score = 156, Expect = 2.1e-09, Identities = 30/73 (41%), Positives = 42/73 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRI+  DSR  RDG++I  IG  +P    +  K+DE  A +WL  GA+PT+ V  +    G+ K
  S:     9 RMGQKKAPFYRIIVADSRSPRDGRFIDEIGTYDPNCDPSVIKVDEEAAKKWLANGAQPTEAVAKILKAAGIEK 81
>gi|167751816|ref|ZP_02423943.1| hypothetical protein ALIPUT_00057 [Alistipes putredinis DSM 17216] >gi|167660057|gb|EDS04187.1| hypothetical protein ALIPUT_00057 [Alistipes putredinis DSM 17216] (184 aa)
Score = 156, Expect = 2.2e-09, Identities = 33/76 (43%), Positives = 46/76 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG-LWKKFV 77
           R G+  +  Y IVA DSR  RDGK+I  +G  NP        ++   AL+WL KGA+PTDT R++ S  G ++KK +
  S:     9 RHGKKGFAFYHIVAADSRAPRDGKFIEKLGTYNPNTNPATIDLNFEKALDWLLKGAQPTDTCRAILSYKGVMYKKHL 85
>gi|71842288|ref|YP_277376.1| ribosomal protein S16 [Emiliania huxleyi] >gi|122239713|sp|Q4G391|RR16_EMIHU Chloroplast 30S ribosomal protein S16 >gi|60101531|gb|AAX13875.1| ribosomal protein S16 [Emiliania huxleyi] (81 aa)
Score = 155, Expect = 2.4e-09, Identities = 33/72 (45%), Positives = 43/72 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLW 73
           R GR   P YRIV  DSRVKRDGK +  +G  NP   E   K +  V  E L  GA+PT+TVR++F +  ++
  S:     8 RFGRKAQPCYRIVVTDSRVKRDGKALEEVGFYNPLTDETHLKFNRIV--ERLKTGAQPTETVRNIFLKAKVF 77
>gi|15895032|ref|NP_348381.1| ribosomal protein S16 [Clostridium acetobutylicum ATCC 824] >gi|20140172|sp|Q97I97|RS16_CLOAB 30S ribosomal protein S16 >gi|15024724|gb|AAK79721.1|AE007684_9 Ribosomal protein S16 [Clostridium acetobutylicum ATCC 824] (81 aa)
Score = 155, Expect = 2.6e-09, Identities = 30/74 (40%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           RMG    P YRIV  DSR  RDGK+I  +G+ NP  +    K+D      W+  GA+P++TV+ L  ++G+  K
  S:     8 RMGAKKAPFYRIVVADSRSPRDGKFIEELGYYNPTTEPVTFKVDADKVNAWMKNGAQPSETVKKLLDKSGVTTK 81
>gi|169177502|ref|ZP_02839056.1| ribosomal protein S16 [Arthrobacter chlorophenolicus A6] >gi|169014539|gb|EDS61085.1| ribosomal protein S16 [Arthrobacter chlorophenolicus A6] (181 aa)
Score = 155, Expect = 2.6e-09, Identities = 30/75 (40%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G++  P YRIV +DSR KRDG+ I  IG   P  + +  ++    A  WL+ GA+P++ V ++   TG W+KF
  S:    54 RFGKMRAPYYRIVVMDSRAKRDGRAIEEIGKYPPTEEPSYIEVASERAQYWLSVGAQPSEQVAAILKITGDWQKF 128
>gi|116750419|ref|YP_847106.1| ribosomal protein S16 [Syntrophobacter fumaroxidans MPOB] >gi|116750461|ref|YP_847148.1| ribosomal protein S16 [Syntrophobacter fumaroxidans MPOB] >gi|116699483|gb|ABK18671.1| SSU ribosomal protein S16P [Syntrophobacter fumaroxidans MPOB] >gi|116699525|gb|ABK18713.1| SSU ribosomal protein S16P [Syntrophobacter fumaroxidans MPOB] (86 aa)
Score = 155, Expect = 2.6e-09, Identities = 33/70 (47%), Positives = 39/70 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
           R GR   P YRIV   S   RDG++I  IG  NP     + KID      WL +GAKPTDTVR+L  + G
  S:     9 RGGRKKRPFYRIVVASSEAPRDGRFIERIGTYNPLPDTAEVKIDSDRLQYWLQQGAKPTDTVRNLIQKYG 78
>gi|167997527|ref|XP_001751470.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162697451|gb|EDQ83787.1| predicted protein [Physcomitrella patens subsp. patens] (82 aa)
Score = 155, Expect = 2.8e-09, Identities = 30/72 (41%), Positives = 50/72 (69%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP---ALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           +R+GR   P YRI+  +SR +RDGK++ ++GH NP    +  N  +I E + + WL+ GA+P+DTVR++  + G+
  S:     6 VRIGRKKLPYYRIIIANSRSRRDGKFLEMVGHYNPMPGTILLNAVEI-EFLRMYWLSVGAQPSDTVRNILYKQGV 79
>gi|84683442|ref|ZP_01011345.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2654] >gi|84668185|gb|EAQ14652.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2654] (130 aa)
Score = 154, Expect = 3.1e-09, Identities = 33/74 (44%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL+KGA+PTD V  +    G+ +K
  S:     7 RGGTKKRPFYRIVAADSRMARDGRFIEKLGTYNPLLPKDSEERVKMDLDAVKAWLDKGAQPTDRVARMLEAAGVLEK 83
>gi|182435682|ref|YP_001823401.1| putative 30S ribosomal protein S16 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464198|dbj|BAG18718.1| putative 30S ribosomal protein S16 [Streptomyces griseus subsp. griseus NBRC 13350] (146 aa)
Score = 154, Expect = 3.2e-09, Identities = 28/73 (38%), Positives = 45/73 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           R+G++  P YRIV  DSR +RDG+ I  IG  +P    ++ +++   A  WL+ GA+PT+ V ++   TG W+
  S:     9 RLGKIRSPHYRIVVADSRTRRDGRAIEEIGLYHPVQNPSRIEVNSERAQYWLSVGAQPTEPVLAILKLTGDWQ 81
>gi|89889426|ref|ZP_01200937.1| putative 30S ribosomal protein S16 (rpsP) [Flavobacteria bacterium BBFL7] >gi|89517699|gb|EAS20355.1| putative 30S ribosomal protein S16 (rpsP) [Flavobacteria bacterium BBFL7] (165 aa)
Score = 154, Expect = 3.2e-09, Identities = 31/72 (43%), Positives = 41/72 (56%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
            R G+   P Y IVA D+R KRDGKY+  IG  NP        +D   A++WL  GA+PTDT R++    G+
  S:     8 QRHGKKGKPFYWIVAADARSKRDGKYLDKIGTYNPNTNPATINLDVDGAVKWLENGAQPTDTARAILGYKGV 79
>gi|15828940|ref|NP_326300.1| 30S ribosomal protein S16 [Mycoplasma pulmonis UAB CTIP] >gi|20140193|sp|Q98Q97|RS16_MYCPU 30S ribosomal protein S16 >gi|14089883|emb|CAC13642.1| 30S RIBOSOMAL PROTEIN S16 [Mycoplasma pulmonis] (88 aa)
Score = 154, Expect = 3.3e-09, Identities = 32/79 (40%), Positives = 49/79 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
           R+G+     Y+IV  DSR  RDG++I  +G+ NP  K    K  EA+ + WLN+G KP+DTV+ L ++  +W++F   K
  S:     8 RVGKKFNVIYKIVVADSRAPRDGRFIEEVGNYNPHSKSLNLK-KEAI-ISWLNQGVKPSDTVKRLLTREKVWEEFTSLK 84
>gi|150024449|ref|YP_001295275.1| 30S ribosomal protein S16 [Flavobacterium psychrophilum JIP02/86] >gi|166234420|sp|A6GWI4.1|RS16_FLAPJ 30S ribosomal protein S16 >gi|149770990|emb|CAL42457.1| 30S ribosomal protein S16 [Flavobacterium psychrophilum JIP02/86] (180 aa)
Score = 154, Expect = 3.5e-09, Identities = 30/71 (42%), Positives = 42/71 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y +VA D+R KRDGKY+  IG  NP        ++   A++WL+ GA+PTDT R++ S  G
  S:     8 QRHGKKGKPFYWVVAADARSKRDGKYLEKIGTYNPNTNPATVDLNLDAAVKWLHNGAQPTDTARAILSYKG 78
>gi|167751040|ref|ZP_02423167.1| hypothetical protein EUBSIR_02025 [Eubacterium siraeum DSM 15702] >gi|167655958|gb|EDS00088.1| hypothetical protein EUBSIR_02025 [Eubacterium siraeum DSM 15702] (79 aa)
Score = 154, Expect = 3.7e-09, Identities = 30/66 (45%), Positives = 41/66 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           RMG    P YR+V  DSR  RDG++I  IG+ +P  + +   ID+  A +WL  GA+PTDTV+ L 
  S:     8 RMGAKKAPFYRVVVADSRYPRDGRFIEEIGYYDPTKEPSVVSIDKEKADKWLANGAQPTDTVKKLL 73
>gi|118579531|ref|YP_900781.1| 30S ribosomal protein S16 [Pelobacter propionicus DSM 2379] >gi|166201329|sp|A1AN03.1|RS16_PELPD 30S ribosomal protein S16 >gi|118502241|gb|ABK98723.1| SSU ribosomal protein S16P [Pelobacter propionicus DSM 2379] (85 aa)
Score = 154, Expect = 3.8e-09, Identities = 30/74 (40%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y++V  D R +RDG++I  +G  +P       K++E   L WL+KGA+PTDTVR L  + G+  K
  S:     9 RAGAKKRPFYQVVVADERSRRDGRFIENMGTYDPTKNPAVFKLNEEKILAWLSKGAQPTDTVRQLLKKAGILDK 82
>gi|168002589|ref|XP_001753996.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162694972|gb|EDQ81318.1| predicted protein [Physcomitrella patens subsp. patens] (81 aa)
Score = 153, Expect = 4.2e-09, Identities = 31/72 (43%), Positives = 48/72 (66%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE----WLNKGAKPTDTVRSLFSQTGL 72
           +R+GR   P YRI+   SR +RDG+++ ++GH NP   +N  K D  V +E    WL+ GA+P+DTVR +  + G+
  S:     6 VRLGRKKLPYYRIIIAPSRARRDGRFLEMVGHYNPMPDKNGQK-DIQVNVERVKYWLSVGAQPSDTVRDILYKQGV 80
>gi|163733914|ref|ZP_02141356.1| 30S ribosomal protein S16 [Roseobacter litoralis Och 149] >gi|161393025|gb|EDQ17352.1| 30S ribosomal protein S16 [Roseobacter litoralis Och 149] (122 aa)
Score = 153, Expect = 4.2e-09, Identities = 33/74 (44%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL +GA+PTD V  +    GL +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDAERVQYWLGQGAQPTDRVSRMLEAAGLKEK 85
>gi|110678634|ref|YP_681641.1| 30S ribosomal protein S16 [Roseobacter denitrificans OCh 114] >gi|122972957|sp|Q16AN8.1|RS16_ROSDO 30S ribosomal protein S16 >gi|109454750|gb|ABG30955.1| ribosomal protein S16 [Roseobacter denitrificans OCh 114] (122 aa)
Score = 153, Expect = 4.4e-09, Identities = 33/74 (44%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL +GA+PTD V  +    GL +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDAERVQYWLGQGAQPTDRVARMLEAAGLREK 85
>gi|146299061|ref|YP_001193652.1| 30S ribosomal protein S16 [Flavobacterium johnsoniae UW101] >gi|189044381|sp|A5FKD9.1|RS16_FLAJO 30S ribosomal protein S16 >gi|146153479|gb|ABQ04333.1| SSU ribosomal protein S16P [Flavobacterium johnsoniae UW101] (188 aa)
Score = 153, Expect = 4.7e-09, Identities = 30/71 (42%), Positives = 43/71 (60%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y +VA D+R KRDGKY+  IG  NP       +++   A++WL+ GA+PTDT R++ S  G
  S:     8 QRHGKKGKPFYWVVAADARSKRDGKYLEKIGTYNPNTNPATVELNLDSAVKWLHNGAQPTDTARAILSYKG 78
>gi|194340913|gb|EDX21879.1| 30S ribosomal protein S16 [Streptomyces sp. Mg1] (145 aa)
Score = 153, Expect = 4.8e-09, Identities = 27/73 (36%), Positives = 45/73 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           R+G++  P YRIV  D+R +RDG+ I  IG  +P    ++ +++   A  WL+ GA+PT+ V ++   TG W+
  S:     9 RLGKIRQPHYRIVVADARTRRDGRAIEEIGIYHPTYNPSRIEVNAERAQYWLSVGAQPTEAVLAILKLTGDWQ 81
>gi|119953472|ref|YP_945681.1| SSU ribosomal protein S16P [Borrelia turicatae 91E135] >gi|119862243|gb|AAX18011.1| SSU ribosomal protein S16P [Borrelia turicatae 91E135] (83 aa)
Score = 153, Expect = 4.8e-09, Identities = 29/71 (40%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV +DS   RDG+ I  +G+ +P  K+N+ KI+E    +W+ KGA P+DTV+ + ++   
  S:     9 RMGAKKRPYYRIVVMDSASPRDGRAIEELGYYHPVEKQNQVKINENKFRDWIGKGAIPSDTVKKILNKNNF 79
>gi|157738181|ref|YP_001490865.1| 30S ribosomal protein S16 [Arcobacter butzleri RM4018] >gi|167011164|sp|A8EW72.1|RS16_ARCB4 30S ribosomal protein S16 >gi|157700035|gb|ABV68195.1| 30S ribosomal protein S16 [Arcobacter butzleri RM4018] (75 aa)
Score = 153, Expect = 5.0e-09, Identities = 32/68 (47%), Positives = 42/68 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           RMGR   P YRIV  DSR +RD  +I  IG+ NP ++    KIDE     WL+ GAKP++ V+ L S+
  S:     8 RMGRNKKPFYRIVVTDSRKRRDSGWIESIGYFNPVVEPKVLKIDEERYNYWLSVGAKPSEKVKKLASK 75
>gi|156741647|ref|YP_001431776.1| ribosomal protein S16 [Roseiflexus castenholzii DSM 13941] >gi|189029611|sp|A7NJT8.1|RS16_ROSCS 30S ribosomal protein S16 >gi|156232975|gb|ABU57758.1| ribosomal protein S16 [Roseiflexus castenholzii DSM 13941] (93 aa)
Score = 153, Expect = 5.1e-09, Identities = 27/71 (38%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G+   P+YR+V  DSR  RDG++I ++GH NP  +  +  +       WL  GA+P++TV  L  Q G+
  S:     8 RTGKTKKPSYRLVVADSRAPRDGRFIEIVGHYNPVRQPKELNVKADRVRYWLGVGAQPSETVVRLLKQVGV 78
>gi|154245410|ref|YP_001416368.1| ribosomal protein S16 [Xanthobacter autotrophicus Py2] >gi|154159495|gb|ABS66711.1| ribosomal protein S16 [Xanthobacter autotrophicus Py2] (122 aa)
Score = 152, Expect = 5.1e-09, Identities = 36/82 (43%), Positives = 45/82 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P YRIV  D+R  RDG++I  IG  NP L    EN+  +D   A  WL KGA+PTD V       GL K+  ++K  P
  S:     9 RGGAKKRPYYRIVIADARSPRDGRFIEKIGTFNPLLAKDAENRVVLDADKAKAWLEKGAQPTDRVARFLDAAGLMKR--DAKNNP 91
>gi|110597445|ref|ZP_01385732.1| ribosomal protein S16 [Chlorobium ferrooxidans DSM 13031] >gi|110340989|gb|EAT59460.1| ribosomal protein S16 [Chlorobium ferrooxidans DSM 13031] (136 aa)
Score = 152, Expect = 5.8e-09, Identities = 31/71 (43%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IVA D+R  RDGK++ +IG   P  K +   + +     W+  GA+PT TVRSL   TGL
  S:     8 RAGRKKLPVYQIVASDARSPRDGKFLEVIGTYQPTAKPHAVTLKKDRVEYWMGVGAQPTATVRSLIRTTGL 78
>gi|86130778|ref|ZP_01049377.1| 30S ribosomal protein S16 [Cellulophaga sp. MED134] >gi|85818189|gb|EAQ39349.1| 30S ribosomal protein S16 [Dokdonia donghaensis MED134] (172 aa)
Score = 152, Expect = 6.2e-09, Identities = 31/71 (43%), Positives = 40/71 (56%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y IVA D+R KRDGKY+  IG  NP     +  +D   A+ WL  GA+PT+T + L S  G
  S:     8 QRHGKKGKPFYWIVAADARAKRDGKYLEKIGTYNPNTNPAQIDLDVDGAVTWLQNGAQPTETAKRLLSYKG 78
>gi|99082447|ref|YP_614601.1| 30S ribosomal protein S16 [Silicibacter sp. TM1040] >gi|123378659|sp|Q1GDC7.1|RS16_SILST 30S ribosomal protein S16 >gi|99038727|gb|ABF65339.1| SSU ribosomal protein S16P [Silicibacter sp. TM1040] (121 aa)
Score = 152, Expect = 6.5e-09, Identities = 33/74 (44%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL+KGA+PTD V  +    G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDIEKIQAWLDKGAQPTDRVARMLEAAGVREK 85
>gi|71894035|ref|YP_278143.1| 30S ribosomal protein S16 [Mycoplasma synoviae 53] >gi|109894773|sp|Q4A739|RS16_MYCS5 30S ribosomal protein S16 >gi|71850823|gb|AAZ43432.1| 30S ribosomal protein S16 [Mycoplasma synoviae 53] (84 aa)
Score = 152, Expect = 6.6e-09, Identities = 32/71 (45%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P Y+IV  D+R  RDGK+I  +GH NP+ K+    +D     +WL  GAKPT TV +LF    L
  S:     8 RMGSKFRPVYKIVVADARAPRDGKFIEALGHYNPSNKD--FVLDSEKTAKWLANGAKPTVTVWNLFKNNKL 76
>gi|88855267|ref|ZP_01129932.1| 30S ribosomal protein S16 [marine actinobacterium PHSC20C1] >gi|88815795|gb|EAR25652.1| 30S ribosomal protein S16 [marine actinobacterium PHSC20C1] (148 aa)
Score = 151, Expect = 6.9e-09, Identities = 30/75 (40%), Positives = 43/75 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG++  P YRIV  DSR KRDG+ I  IG  +P  + +  +++   A  WL  GA+P+  V ++   TG W  F
  S:     9 RMGKIRAPYYRIVIADSRKKRDGRVIEEIGKYHPTEEPSFIEVESERAQYWLGVGAQPSPQVEAILKLTGDWGIF 83
>gi|196020247|ref|XP_002119097.1| hypothetical protein TRIADDRAFT_35144 [Trichoplax adhaerens] >gi|190576971|gb|EDV18417.1| hypothetical protein TRIADDRAFT_35144 [Trichoplax adhaerens] (80 aa)
Score = 151, Expect = 7.0e-09, Identities = 33/75 (44%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR   P+YRIVA DSRVKRDGK I  +G  NP   E   K ++ +  + L  GA+PTDTV+++  +  ++  F
  S:     8 RYGRKGQPSYRIVAADSRVKRDGKAIEELGFYNPLNDETHLKYNQII--KHLKNGAQPTDTVQNILLKAKVFDFF 80
>gi|88802685|ref|ZP_01118212.1| 30S ribosomal protein S16 [Polaribacter irgensii 23-P] >gi|88781543|gb|EAR12721.1| 30S ribosomal protein S16 [Polaribacter irgensii 23-P] (180 aa)
Score = 151, Expect = 7.1e-09, Identities = 32/71 (45%), Positives = 41/71 (57%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y IVA D+R KRDGKY+  IG  NP        ++   A+EWL  GA PTDTV+++ S  G
  S:     8 QRHGKKGKPFYWIVAADARAKRDGKYLEKIGTYNPNTNPAVIDLNIDKAVEWLQNGALPTDTVKNILSYKG 78
>gi|11465818|ref|NP_053962.1| ribosomal protein S16 [Porphyra purpurea] >gi|1710695|sp|P51352|RR16_PORPU Chloroplast 30S ribosomal protein S16 >gi|1276818|gb|AAC08238.1| 30S ribosomal protein S16 [Porphyra purpurea] (82 aa)
Score = 151, Expect = 7.5e-09, Identities = 33/74 (44%), Positives = 47/74 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR   P+YRIVA+DSR KRDGK I  +G  NP    N+ +ID A  L+ L +GA+ T TV+++ ++  +  K
  S:     8 RYGRKQQPSYRIVAMDSRSKRDGKAIEELGFYNPIT--NETRIDIAKILKRLKQGAQTTRTVKNILNEAQIIAK 79
>gi|78356146|ref|YP_387595.1| 30S ribosomal protein S16 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|109893879|sp|Q313J6|RS16_DESDG 30S ribosomal protein S16 >gi|78218551|gb|ABB37900.1| SSU ribosomal protein S16P [Desulfovibrio desulfuricans G20] (79 aa)
Score = 151, Expect = 7.6e-09, Identities = 28/70 (40%), Positives = 43/70 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
           RMG      YRI+A++S  +R+G+ +  IG+ NP +   + KID     +WL +GA+PTDTVR+L  +  
  S:     9 RMGNKKRAFYRIIAINSEARREGRPLDYIGYYNPMVDPAEVKIDTEKVQKWLERGAEPTDTVRALLKKNA 78
>gi|171913606|ref|ZP_02929076.1| ribosomal protein S16 [Verrucomicrobium spinosum DSM 4136] (170 aa)
Score = 151, Expect = 8.3e-09, Identities = 27/65 (41%), Positives = 43/65 (66%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSL 66
           R G  + P YRIVA D R +RDG+++ ++G  +P   ++  ++D   A  W+ KGA+PT+TVRS+
  S:    95 REGTKNRPFYRIVAADQRFRRDGRFLEILGTYDPLKGKDNAEVDVEKANAWIAKGAQPTETVRSI 159
>gi|108796845|ref|YP_636455.1| ribosomal protein S16 [Staurastrum punctulatum] >gi|122233025|sp|Q32RS1|RR16_STAPU Chloroplast 30S ribosomal protein S16 >gi|61393613|gb|AAX45754.1| ribosomal protein S16 [Staurastrum punctulatum] (79 aa)
Score = 151, Expect = 8.4e-09, Identities = 29/74 (39%), Positives = 46/74 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR   PTYRI+A+D R +RDGK +  +G  +P   ++K +++    L  L  GA+PTDTV  +  + G+++K
  S:     8 RYGRKQQPTYRIIAIDVRCRRDGKALKEVGFYDPL--KDKTQLNVPAILTLLQHGAQPTDTVSHILQKAGVFEK 79
>gi|84501323|ref|ZP_00999528.1| ribosomal protein S16 [Oceanicola batsensis HTCC2597] >gi|84390614|gb|EAQ03102.1| ribosomal protein S16 [Oceanicola batsensis HTCC2597] (131 aa)
Score = 150, Expect = 9.3e-09, Identities = 33/74 (44%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E++ K+D      WL+KGA+PTD V       G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDIDKIKAWLDKGAQPTDRVSRFLEAAGVIEK 85
>gi|126663017|ref|ZP_01734015.1| 30S ribosomal protein S16 [Flavobacteria bacterium BAL38] >gi|126624675|gb|EAZ95365.1| 30S ribosomal protein S16 [Flavobacteria bacterium BAL38] (188 aa)
Score = 150, Expect = 9.5e-09, Identities = 30/71 (42%), Positives = 41/71 (57%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y +VA D+R KRDGK++  IG  NP        ++   A +WL  GA+PTDT R++ S TG
  S:     8 QRHGKKGKPFYWVVAADARSKRDGKFLEKIGTYNPNTNPATIDLNIEKAAQWLFNGAQPTDTARAILSYTG 78
>gi|60682204|ref|YP_212348.1| 30S ribosomal protein S16 [Bacteroides fragilis NCTC 9343] >gi|81314733|sp|Q5LBU1|RS16_BACFN 30S ribosomal protein S16 >gi|60493638|emb|CAH08427.1| putative 30S ribosomal protein S16 [Bacteroides fragilis NCTC 9343] (181 aa)
Score = 150, Expect = 9.7e-09, Identities = 31/74 (41%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  DSR  RDGK+   IG  NP        ++   AL W+  GA+P+DTVR++ S+ G++ K
  S:     9 RHGRKSYAFYSIVIADSRAPRDGKFTEKIGTYNPNTNPATVDLNFERALHWVLVGAQPSDTVRNILSREGVYMK 82
>gi|53714008|ref|YP_100000.1| 30S ribosomal protein S16 [Bacteroides fragilis YCH46] >gi|81608409|sp|Q64SR3|RS16_BACFR 30S ribosomal protein S16 >gi|52216873|dbj|BAD49466.1| 30S ribosomal protein S16 [Bacteroides fragilis YCH46] (181 aa)
Score = 150, Expect = 9.7e-09, Identities = 31/74 (41%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  DSR  RDGK+   IG  NP        ++   AL W+  GA+P+DTVR++ S+ G++ K
  S:     9 RHGRKSYAFYSIVIADSRAPRDGKFTEKIGTYNPNTNPATVDLNFERALHWVLVGAQPSDTVRNILSREGVYMK 82
>gi|154498107|ref|ZP_02036485.1| hypothetical protein BACCAP_02088 [Bacteroides capillosus ATCC 29799] >gi|150273097|gb|EDN00254.1| hypothetical protein BACCAP_02088 [Bacteroides capillosus ATCC 29799] (71 aa)
Score = 149, Expect = 1.2e-08, Identities = 29/65 (44%), Positives = 39/65 (60%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           MG    P YRIV  DSR  RDG++I  IG  NP +   + K+D   A  W+  GA+PT+TV++L 
  S:     1 MGAKKAPFYRIVVADSRYPRDGRFIEEIGTYNPLVTPAEIKVDADRAQAWIKTGAQPTETVKALL 65
>gi|162448034|ref|YP_001621166.1| small subunit ribosomal protein S16 [Acholeplasma laidlawii PG-8A] >gi|189044365|sp|A9NHG0.1|RS16_ACHLI 30S ribosomal protein S16 >gi|161986141|gb|ABX81790.1| small subunit ribosomal protein S16 [Acholeplasma laidlawii PG-8A] (80 aa)
Score = 149, Expect = 1.2e-08, Identities = 29/74 (39%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA D++  RDGK++ ++G   P   +    +D      W+N GA+PTDTV+SLF +  +  K
  S:     9 RFGNHKRPFYRIVAADAKAPRDGKFLEIVGTYEPI--KGAVAVDSEKVQAWMNNGAQPTDTVKSLFKKFNVLNK 80
>gi|167997525|ref|XP_001751469.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162697450|gb|EDQ83786.1| predicted protein [Physcomitrella patens subsp. patens] (97 aa)
Score = 149, Expect = 1.3e-08, Identities = 30/71 (42%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR + P YRI   DSR  RDGK++ ++GH NP   ++  K   ++      WL+ GA+P+DTVR L ++ G+
  S:     8 RFGRKNLPFYRIFVADSRSPRDGKHLEVVGHYNPLPGKDGMKRIGVNSDRIKYWLSVGAQPSDTVRRLLNKAGI 81
>gi|184200708|ref|YP_001854915.1| 30S ribosomal protein S16 [Kocuria rhizophila DC2201] >gi|183580938|dbj|BAG29409.1| 30S ribosomal protein S16 [Kocuria rhizophila DC2201] (142 aa)
Score = 149, Expect = 1.3e-08, Identities = 30/75 (40%), Positives = 42/75 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           RMG++  P YR+V VDSR KRDG+ I  +G   P    +   +       WL  GA+P++ V +L   TG W+KF
  S:     9 RMGKIRDPRYRVVVVDSRKKRDGRVIEEVGVYQPTENPSYINLVSDRVQYWLGVGAQPSEAVLALMKITGDWQKF 83
>gi|120437355|ref|YP_863041.1| 30S ribosomal protein S16 [Gramella forsetii KT0803] >gi|117579505|emb|CAL67974.1| 30S ribosomal protein S16 [Gramella forsetii KT0803] (198 aa)
Score = 149, Expect = 1.3e-08, Identities = 29/71 (40%), Positives = 42/71 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P + IVA D+R KRDGK++  +G  NP       ++D   A++WL  GA+PTDT R++ S  G
  S:     8 QRHGKKGKPFFWIVAADTRAKRDGKFLDKLGIYNPNTNPATIELDVDGAVKWLQNGAQPTDTARAILSYKG 78
>gi|46579252|ref|YP_010060.1| 30S ribosomal protein S16 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603185|ref|YP_967585.1| 30S ribosomal protein S16 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166234418|sp|A1VFE2.1|RS16_DESVV 30S ribosomal protein S16 >gi|50403604|sp|P62229|RS16_DESVH 30S ribosomal protein S16 >gi|46448666|gb|AAS95319.1| ribosomal protein S16 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563414|gb|ABM29158.1| SSU ribosomal protein S16P [Desulfovibrio vulgaris subsp. vulgaris DP4] (79 aa)
Score = 149, Expect = 1.3e-08, Identities = 31/66 (46%), Positives = 40/66 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           RMG      YRIVAV+S  +RDG+ +  IG  NP +   + KID     +WL  GA+PTDTVR+L 
  S:     9 RMGNKKRAFYRIVAVNSETRRDGRPLEYIGFYNPMVDPAEVKIDAEKVQKWLALGAEPTDTVRNLI 74
>gi|189461978|ref|ZP_03010763.1| hypothetical protein BACCOP_02645 [Bacteroides coprocola DSM 17136] >gi|189431372|gb|EDV00357.1| hypothetical protein BACCOP_02645 [Bacteroides coprocola DSM 17136] (180 aa)
Score = 149, Expect = 1.4e-08, Identities = 30/74 (40%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  D+R  RDG++   IG  NP        ++   AL W+  GA+PTDTVR++ S+ G++ K
  S:     9 RNGRKGYAFYSIVIADARAPRDGRFTEKIGTYNPNTNPATVDLNFERALHWVMVGAQPTDTVRNILSREGVYMK 82
>gi|126646491|ref|ZP_01719008.1| 30S ribosomal protein S16 [Algoriphagus sp. PR1] >gi|126578123|gb|EAZ82343.1| 30S ribosomal protein S16 [Algoriphagus sp. PR1] (197 aa)
Score = 149, Expect = 1.5e-08, Identities = 29/71 (40%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR     Y +V  D+R  RDG++I  IG  NP        I+   AL+WL  GA+PTDTV+++ S  G+
  S:     9 RRGRKKMAIYDVVVADARAPRDGRFIEKIGSYNPNTDPASININNERALKWLLNGAQPTDTVKAMLSYRGI 79
>gi|163738190|ref|ZP_02145606.1| 30S ribosomal protein S16 [Phaeobacter gallaeciensis BS107] >gi|163743784|ref|ZP_02151157.1| ribosomal protein S16 [Phaeobacter gallaeciensis 2.10] >gi|161382933|gb|EDQ07329.1| ribosomal protein S16 [Phaeobacter gallaeciensis 2.10] >gi|161388806|gb|EDQ13159.1| 30S ribosomal protein S16 [Phaeobacter gallaeciensis BS107] (119 aa)
Score = 149, Expect = 1.5e-08, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL++GA+PTD +  +    G+  K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDMERVQHWLDQGAQPTDRIARMLEAAGVRAK 85
>gi|194336565|ref|YP_002018359.1| ribosomal protein S16 [Pelodictyon phaeoclathratiforme BU-1] >gi|194309042|gb|ACF43742.1| ribosomal protein S16 [Pelodictyon phaeoclathratiforme BU-1] (136 aa)
Score = 148, Expect = 1.5e-08, Identities = 29/71 (40%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P Y+IV  D+R  RDGK++ ++G   P  K +   I +   + W+  GA+PT TV SL   TGL
  S:     8 RAGRKKLPVYQIVVADARSPRDGKFLEVVGTYQPTAKPHAVTIKKDRIVYWMQTGAQPTATVNSLIRTTGL 78
>gi|163753130|ref|ZP_02160254.1| 30S ribosomal protein S16 [Kordia algicida OT-1] >gi|161326862|gb|EDP98187.1| 30S ribosomal protein S16 [Kordia algicida OT-1] (167 aa)
Score = 148, Expect = 1.5e-08, Identities = 29/71 (40%), Positives = 41/71 (57%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P Y IVA D R KRDG+Y+  +G  NP       +++   A++WL  GA+PTDT R++ S  G
  S:     8 QRHGKKGKPFYWIVAADGRAKRDGRYLEKLGIYNPNTNPATIELNLDGAVQWLQNGAQPTDTARAILSYKG 78
>gi|116784158|gb|ABK23236.1| unknown [Picea sitchensis] (117 aa)
Score = 148, Expect = 1.7e-08, Identities = 31/71 (43%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R+GR   P YRIV  DSR +RDG  I  +G+ +P      E + KI+   A  WL+ GA+P+DTV+ L  ++G+
  S:    10 RLGRKKRPFYRIVVADSRARRDGNQIETLGYYDPLAGKDDEKRLKINPERAKYWLSVGAQPSDTVQDLLFKSGV 83
>gi|150005281|ref|YP_001300025.1| 30S ribosomal protein S16 [Bacteroides vulgatus ATCC 8482] >gi|166234393|sp|A6L3Y9.1|RS16_BACV8 30S ribosomal protein S16 >gi|149933705|gb|ABR40403.1| 30S ribosomal protein S16 [Bacteroides vulgatus ATCC 8482] (183 aa)
Score = 148, Expect = 1.8e-08, Identities = 31/74 (41%), Positives = 41/74 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR  Y  Y IV  D R  RDGK+   IG  NP        ++   AL W+  GA+PTDTVR++ S+ G++ K
  S:     9 RNGRKSYAFYSIVIADVRAPRDGKFTEKIGTYNPNTNPATVDLNFERALHWVMCGAQPTDTVRNILSKEGVYMK 82
>gi|14195200|sp|Q9L9C8|RS16_THIFE 30S ribosomal protein S16 >gi|7769072|gb|AAF69243.1|AF173880_6 30S ribosomal protein S16-like protein [Acidithiobacillus ferrooxidans] (86 aa)
Score = 148, Expect = 1.8e-08, Identities = 29/71 (40%), Positives = 42/71 (59%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           P Y IV  DSR +RDG++I  +G  NP     + +ID+  A  WL++GA+P+DTV     + G+ K  V S
  S:    15 PFYHIVVADSRSRRDGRFIERLGFYNPIGAVAELRIDKERAAYWLSQGAQPSDTVAGFLKKEGVSKTGVAS 85
>gi|83951194|ref|ZP_00959927.1| ribosomal protein S16 [Roseovarius nubinhibens ISM] >gi|83839093|gb|EAP78389.1| ribosomal protein S16 [Roseovarius nubinhibens ISM] (134 aa)
Score = 148, Expect = 1.9e-08, Identities = 32/74 (43%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL +GA+PTD V       G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDMERVQYWLGQGAQPTDRVSRFLEAAGVVEK 85
>gi|149201385|ref|ZP_01878360.1| ribosomal protein S16 [Roseovarius sp. TM1035] >gi|149145718|gb|EDM33744.1| ribosomal protein S16 [Roseovarius sp. TM1035] (125 aa)
Score = 147, Expect = 2.0e-08, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E++ K+D      WL +GA+PTD +  +    G+  K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDIERVQHWLAQGAQPTDRISRMLEAAGIVAK 85
>gi|85374322|ref|YP_458384.1| ribosomal protein S16 [Erythrobacter litoralis HTCC2594] >gi|84787405|gb|ABC63587.1| ribosomal protein S16 [Erythrobacter litoralis HTCC2594] (206 aa)
Score = 147, Expect = 2.1e-08, Identities = 33/74 (44%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  D R  RDGKY+  IG  NP L    E + K+DE  A  WL  GAKP+D V       G+ ++
  S:     9 RGGAKKRPYYRIVVADERSPRDGKYLEQIGIYNPMLPKDDEGRVKLDEDRARHWLGVGAKPSDRVLRFLDAAGIMER 85
>gi|89053240|ref|YP_508691.1| 30S ribosomal protein S16 [Jannaschia sp. CCS1] >gi|109893885|sp|Q28UE6|RS16_JANSC 30S ribosomal protein S16 >gi|88862789|gb|ABD53666.1| SSU ribosomal protein S16P [Jannaschia sp. CCS1] (130 aa)
Score = 147, Expect = 2.1e-08, Identities = 30/70 (42%), Positives = 41/70 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E++ K+D      WL++GA+PTD +       G
  S:     9 RGGSKKRPFYRIVASDSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDMERVQHWLDQGAQPTDRISRFLEAAG 81
>gi|186454782|ref|ZP_02965097.1| ribosomal protein S16 [bacterium Ellin514] >gi|184208341|gb|EDU05385.1| ribosomal protein S16 [bacterium Ellin514] (85 aa)
Score = 147, Expect = 2.2e-08, Identities = 30/65 (46%), Positives = 39/65 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSL 66
           R+G  + P +RIV  D R  RDGK+I  IG   P  KEN   +D   A  W++KGA+P+DTV S 
  S:     9 RVGAKNTPVFRIVVADGRSPRDGKFIEEIGTYQPLKKENNFVLDVERANYWVSKGAQPSDTVASF 73
>gi|158425576|ref|YP_001526868.1| ribosomal protein S16 [Azorhizobium caulinodans ORS 571] >gi|172048025|sp|A8IKU6.1|RS16_AZOC5 30S ribosomal protein S16 >gi|158332465|dbj|BAF89950.1| ribosomal protein S16 [Azorhizobium caulinodans ORS 571] (121 aa)
Score = 147, Expect = 2.2e-08, Identities = 34/82 (41%), Positives = 45/82 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN---KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P YRIV  D+R  RDG++I  IG  NP L ++   +  +D   A  WL KGA+PTD V       GL K+  E++  P
  S:     9 RGGAKKRPYYRIVVADARSPRDGRFIEKIGTFNPLLAKDAAERVTLDTEKAKAWLEKGAQPTDRVARFLDAAGLLKR--EARNNP 91
>gi|149184775|ref|ZP_01863093.1| ribosomal protein S16 [Erythrobacter sp. SD-21] >gi|148832095|gb|EDL50528.1| ribosomal protein S16 [Erythrobacter sp. SD-21] (156 aa)
Score = 146, Expect = 2.8e-08, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN---KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  DSR  RDGKY+  IG  NP + ++   + K+DE  A  WL+ GA+P+D V       G+ ++
  S:     9 RGGAKKRPYYRIVVSDSRSSRDGKYLEQIGTYNPMMPKDSGERVKLDEDRARHWLSVGAQPSDRVHRFLDAAGILER 85
>gi|151568243|gb|EDN33897.1| hypothetical protein FTBG_01653 [Francisella tularensis subsp. tularensis FSC033] (77 aa)
Score = 146, Expect = 2.9e-08, Identities = 32/69 (46%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P YRIV  D R  RDG++I  +G  NP  K  E + K+D A A  WL KGA+P+D V SL  + 
  S:     3 RGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEA 73
>gi|187918550|ref|YP_001884113.1| SSU ribosomal protein S16P [Borrelia hermsii DAH] >gi|119861398|gb|AAX17193.1| SSU ribosomal protein S16P [Borrelia hermsii DAH] (83 aa)
Score = 146, Expect = 3.0e-08, Identities = 28/71 (39%), Positives = 43/71 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           RMG    P YRIV +DS   RDG+ I  +G+ +P   +N+ KI+E    +W+ KGA P+DTV+ + ++   
  S:     9 RMGAKKRPYYRIVVMDSASPRDGRAIEELGYYHPVEMQNQVKINEDKFRDWIGKGAIPSDTVKRILNKNNF 79
>gi|85706776|ref|ZP_01037868.1| ribosomal protein S16 [Roseovarius sp. 217] >gi|85668834|gb|EAQ23703.1| ribosomal protein S16 [Roseovarius sp. 217] (132 aa)
Score = 146, Expect = 3.1e-08, Identities = 30/71 (42%), Positives = 42/71 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E++ K+D      WL +GA+PTD +  +    G+
  S:     7 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDVERIQHWLAQGAQPTDRISRMLETAGV 80
>gi|56707320|ref|YP_169216.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669790|ref|YP_666347.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis FSC198] >gi|118498130|ref|YP_899180.1| 30S ribosomal protein S16 [Francisella tularensis subsp. novicida U112] >gi|134301359|ref|YP_001121327.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931089|ref|YP_001891073.1| 30S ribosomal protein S16 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194323357|ref|ZP_03057141.1| ribosomal protein S16 [Francisella tularensis subsp. novicida FTE] >gi|123169671|sp|Q14JS9.1|RS16_FRAT1 30S ribosomal protein S16 >gi|166234421|sp|A0Q861.1|RS16_FRATN 30S ribosomal protein S16 >gi|166234422|sp|A4IWA5.1|RS16_FRATW 30S ribosomal protein S16 >gi|81598033|sp|Q5NIC6|RS16_FRATT 30S ribosomal protein S16 >gi|54114499|gb|AAV29883.1| NT02FT0285 [synthetic construct] >gi|56603812|emb|CAG44783.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320123|emb|CAL08166.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis FSC 198] >gi|118424036|gb|ABK90426.1| 30S ribosomal protein S16 [Francisella tularensis subsp. novicida U112] >gi|134049136|gb|ABO46207.1| ribosomal protein S16 [Francisella tularensis subsp. tularensis WY96-3418] >gi|151571207|gb|EDN36861.1| ribosomal protein S16 [Francisella tularensis subsp. novicida GA99-3549] >gi|187711998|gb|ACD30295.1| 30S ribosomal protein S16 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194322721|gb|EDX20201.1| ribosomal protein S16 [Francisella tularensis subsp. novicida FTE] (82 aa)
Score = 145, Expect = 3.3e-08, Identities = 32/69 (46%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P YRIV  D R  RDG++I  +G  NP  K  E + K+D A A  WL KGA+P+D V SL  + 
  S:     8 RGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEA 78
>gi|171853920|emb|CAM11883.1| 30S ribosomal protein S16 [Candidatus Phytoplasma australiense] (91 aa)
Score = 145, Expect = 3.4e-08, Identities = 36/86 (41%), Positives = 54/86 (62%)
  Q:     1 MRMGR--VH-YPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAK 86
           MR+ R  VH  P YR+VA DSRV RDGK++ ++G  +  L  N  K+D     +WL+ GA+PT TV+ +  +  +++K  + KK   AK
  S:     5 MRLQRFGVHKRPFYRVVASDSRVTRDGKFLDIVGTYDTIL--NIIKLDNEKVQKWLSCGAQPTQTVKKILKKNFVFQKDNQIKKPQTAK 91
>gi|85708914|ref|ZP_01039980.1| ribosomal protein S16 [Erythrobacter sp. NAP1] >gi|85690448|gb|EAQ30451.1| ribosomal protein S16 [Erythrobacter sp. NAP1] (168 aa)
Score = 145, Expect = 3.5e-08, Identities = 33/74 (44%), Positives = 41/74 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  DSR  RDGKY+  IG  NP L    EN+ K++E  A  WL  GA P+D V       G+ ++
  S:     9 RGGAKKRPYYRIVVSDSRSPRDGKYLEQIGTYNPLLAKDDENRVKLNEDRAKYWLGVGATPSDRVMRFLDAAGIMER 85
>gi|167627275|ref|YP_001677775.1| 30S ribosomal protein S16 [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189044382|sp|B0TX16.1|RS16_FRAP2 30S ribosomal protein S16 >gi|167597276|gb|ABZ87274.1| 30S ribosomal protein S16 [Francisella philomiragia subsp. philomiragia ATCC 25017] (82 aa)
Score = 145, Expect = 3.5e-08, Identities = 32/69 (46%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P YRIV  D R  RDG++I  +G  NP  K  E + K+D A A  WL KGA+P+D V SL  + 
  S:     8 RGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEA 78
>gi|83941586|ref|ZP_00954048.1| ribosomal protein S16 [Sulfitobacter sp. EE-36] >gi|83847406|gb|EAP85281.1| ribosomal protein S16 [Sulfitobacter sp. EE-36] (128 aa)
Score = 145, Expect = 3.5e-08, Identities = 31/74 (41%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      W+++GA+PTD V  +    G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLAKDSEERVKMDVERVQYWISQGAQPTDRVARMLEAAGVKEK 85
>gi|83855063|ref|ZP_00948593.1| ribosomal protein S16 [Sulfitobacter sp. NAS-14.1] >gi|83842906|gb|EAP82073.1| ribosomal protein S16 [Sulfitobacter sp. NAS-14.1] (126 aa)
Score = 145, Expect = 3.7e-08, Identities = 31/74 (41%), Positives = 44/74 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      W+++GA+PTD V  +    G+ +K
  S:     7 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLAKDSEERVKMDVERVQYWISQGAQPTDRVARMLEAAGVKEK 83
>gi|78776652|ref|YP_392967.1| 30S ribosomal protein S16 [Sulfurimonas denitrificans DSM 1251] >gi|109894817|sp|Q30TE9|RS16_THIDN 30S ribosomal protein S16 >gi|78497192|gb|ABB43732.1| SSU ribosomal protein S16P [Sulfurimonas denitrificans DSM 1251] (76 aa)
Score = 145, Expect = 3.8e-08, Identities = 30/65 (46%), Positives = 38/65 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSL 66
           RMGR   P YRI   DSR +RDG +I LIGH NP + E    +D      WL+ GAK +D V+ +
  S:     9 RMGRKKQPFYRIAVTDSRKRRDGGWIELIGHHNPMVAEKTTVVDNERLDYWLSVGAKMSDRVKKI 73
>gi|196230888|ref|ZP_03129749.1| ribosomal protein S16 [Chthoniobacter flavus Ellin428] >gi|196225229|gb|EDY19738.1| ribosomal protein S16 [Chthoniobacter flavus Ellin428] (86 aa)
Score = 145, Expect = 3.8e-08, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           R G ++ P Y++V  D+R  RDGK+I L+G+ +P    +   +D +    W+  GA+P+DTVRS+ 
  S:     9 REGNLNNPYYKVVVADARSPRDGKFIELVGNYDPKKASDNANVDLSRIDYWIKNGAQPSDTVRSII 74
>gi|89069751|ref|ZP_01157087.1| ribosomal protein S16 [Oceanicola granulosus HTCC2516] >gi|89044697|gb|EAR50808.1| ribosomal protein S16 [Oceanicola granulosus HTCC2516] (130 aa)
Score = 145, Expect = 3.9e-08, Identities = 32/74 (43%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y IVA DSR+ RDG++I  +G  +P L    E++ K+D A    WL+ GA+PTD V       GL  K
  S:     9 RGGSKKRPFYSIVASDSRMPRDGRFIEKLGTYSPLLPKDSEDRVKMDTARVQHWLDAGAQPTDRVSRFLEAAGLVAK 85
>gi|194476607|ref|YP_002048786.1| 30S ribosomal protein S16 [Paulinella chromatophora] >gi|171191614|gb|ACB42576.1| 30S ribosomal protein S16 [Paulinella chromatophora] (121 aa)
Score = 145, Expect = 4.0e-08, Identities = 31/77 (40%), Positives = 49/77 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           R+G+    ++R+VA +S  +RDG+ +  +G  NP  KE +  ID A+ L  L +GA+PTD VRSL  + G+ KK ++
  S:     8 RLGKKREASFRLVACNSTSRRDGRPLQEMGFYNPRTKEMRLDID-ALRL-RLQQGAQPTDAVRSLLEKGGVIKKIIQ 82
>gi|108796743|ref|YP_636478.1| ribosomal protein S16 [Zygnema circumcarinatum] >gi|122233022|sp|Q32RP8|RR16_ZYGCR Chloroplast 30S ribosomal protein S16 >gi|61393727|gb|AAX45869.1| ribosomal protein S16 [Zygnema circumcarinatum] (87 aa)
Score = 144, Expect = 4.6e-08, Identities = 24/75 (32%), Positives = 49/75 (65%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR   PTYRI+A+D + +R G+ +  +G  +P  ++++  +D A  + ++ +GA+PTDTV  + ++ G++++ 
  S:     8 RYGRKQQPTYRIIAIDVKSRRQGRALKEVGFYDP--RKDQTHLDVATIITFIQQGAQPTDTVSHILNRAGVFEQI 80
>gi|152991964|ref|YP_001357685.1| 30S ribosomal protein S16 [Sulfurovum sp. NBC37-1] >gi|166201642|sp|A6Q769.1|RS16_SULNB 30S ribosomal protein S16 >gi|151423825|dbj|BAF71328.1| 30S ribosomal protein S16 [Sulfurovum sp. NBC37-1] (76 aa)
Score = 144, Expect = 4.7e-08, Identities = 30/65 (46%), Positives = 39/65 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSL 66
           RMGR   P YRIV  DSR +RDG +I  IGH NP  +  +  +DE     WL+ GA+ + TV+ L
  S:     8 RMGRKKKPFYRIVVTDSRKRRDGGWIEAIGHYNPVSENKELTLDEERLNYWLSVGAQMSPTVKRL 72
>gi|172040479|ref|YP_001800193.1| 30S ribosomal protein S16 [Corynebacterium urealyticum DSM 7109] >gi|171851783|emb|CAQ04759.1| 30S ribosomal protein S16 [Corynebacterium urealyticum DSM 7109] (169 aa)
Score = 144, Expect = 5.1e-08, Identities = 28/75 (37%), Positives = 42/75 (56%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
            R+G++  P YR+V  D+R +R G  I  +G   PA + +   I+   A  W+  GA+PTDT  +L   TG W+K
  S:     8 QRVGKIRTPQYRVVVQDARARRGGAVIENLGIYQPANQPSIIDINSERAQYWIGVGAQPTDTALALLKLTGDWQK 82
>gi|151572660|gb|EDN38314.1| ribosomal protein S16 [Francisella tularensis subsp. novicida GA99-3548] (82 aa)
Score = 144, Expect = 5.4e-08, Identities = 32/69 (46%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P YRIV  D R  RDG++I  +G  NP  K  E + K+D A A  WL KGA+P+D V SL  + 
  S:     8 RGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLVKGAQPSDRVASLIKEA 78
>gi|57234655|ref|YP_181311.1| 30S ribosomal protein S16 [Dehalococcoides ethenogenes 195] >gi|109893877|sp|Q3Z8Y8|RS16_DEHE1 30S ribosomal protein S16 >gi|57225103|gb|AAW40160.1| ribosomal protein S16 [Dehalococcoides ethenogenes 195] (82 aa)
Score = 143, Expect = 6.1e-08, Identities = 28/71 (39%), Positives = 38/71 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R+G    P YRI+  ++R  RD  Y  L+G  NP        I+   AL W+ KGA+PTDTV  L  + G+
  S:     8 RIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTNPETVVINAEKALYWIGKGAQPTDTVARLLKKAGV 78
>gi|190609941|dbj|BAG49071.1| 30S ribosomal protein S16 [Medicago truncatula] (125 aa)
Score = 143, Expect = 6.2e-08, Identities = 32/74 (43%), Positives = 50/74 (67%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVALE----WLNKGAKPTDTVRSLFSQTGLWKK 75
           R+G  H P YR+V  DS+  RDGK I ++G+ NP A K+++ +++  + LE    WL+ GA+P++ V SL  + GL  K
  S:     9 RLGCTHNPFYRVVVTDSKCARDGKNIEVVGYYNPLAAKDDEKRVN--IKLERVKYWLSVGAQPSEPVESLLFKAGLQVK 85
>gi|115522356|ref|YP_779267.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris BisA53] >gi|122297960|sp|Q07UU7.1|RS16_RHOP5 30S ribosomal protein S16 >gi|115516303|gb|ABJ04287.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris BisA53] (110 aa)
Score = 143, Expect = 6.2e-08, Identities = 31/82 (37%), Positives = 44/82 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +GH NP L    E + K+D      W+ KGA+P+D V       G+ K+  E++  P
  S:     9 RAGTKKRPVYHVVVADSRFPRDGRFIERLGHFNPLLPKDNEARLKLDLDKVKAWVAKGAQPSDRVARFLDAAGVMKR--EARNNP 91
>gi|75676964|ref|YP_319385.1| 30S ribosomal protein S16 [Nitrobacter winogradskyi Nb-255] >gi|109894777|sp|Q3SNV8|RS16_NITWN 30S ribosomal protein S16 >gi|74421834|gb|ABA06033.1| SSU ribosomal protein S16P [Nitrobacter winogradskyi Nb-255] (110 aa)
Score = 143, Expect = 7.0e-08, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +VA DSR  RDG++I  +GH NP + K+N  + K+D      WL KGA+P+D V       G+ K+
  S:     9 RAGTKKRPVYHVVAADSRYPRDGRFIERLGHFNPLMPKDNADRLKLDLDKVKAWLAKGAQPSDRVARFLDAAGVKKR 85
>gi|62257556|gb|AAX77723.1| unknown protein [synthetic construct] (117 aa)
Score = 143, Expect = 7.0e-08, Identities = 32/69 (46%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P YRIV  D R  RDG++I  +G  NP  K  E + K+D A A  WL KGA+P+D V SL  + 
  S:    34 RGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEA 104
>gi|88809130|ref|ZP_01124639.1| 30S ribosomal protein S16 [Synechococcus sp. WH 7805] >gi|88787072|gb|EAR18230.1| 30S ribosomal protein S16 [Synechococcus sp. WH 7805] (155 aa)
Score = 143, Expect = 7.1e-08, Identities = 29/76 (38%), Positives = 46/76 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G+ NP  KE   ++D     E L +GA+PTD VR+L  + GL +K V
  S:    25 RFGKKREASFRLVACNSTSRRDGRPLQELGYYNPRTKET--RLDAEALRERLGQGAQPTDAVRTLLEKGGLIEKTV 98
>gi|83313162|ref|YP_423426.1| 30S ribosomal protein S16 [Magnetospirillum magneticum AMB-1] >gi|109893887|sp|Q2VZV8|RS16_MAGMM 30S ribosomal protein S16 >gi|82948003|dbj|BAE52867.1| Ribosomal protein S16 [Magnetospirillum magneticum AMB-1] (123 aa)
Score = 142, Expect = 7.5e-08, Identities = 35/87 (40%), Positives = 49/87 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV--ESKKKPVAKSK 88
           R G    P Y+IV  D+R  RDG++I  +G  NP L  +  +   +DE     WL+ GA+PTD +   F+  GL  K V  E  K+P  K+K
  S:     9 RGGAKKRPFYKIVVADARAPRDGRFIEKVGTYNPMLPNDNGQRWILDEDRVKHWLSVGAQPTDRLVRFFADKGLVAKPVRAEQTKQPQPKAK 100
>gi|189425507|ref|YP_001952684.1| ribosomal protein S16 [Geobacter lovleyi SZ] >gi|189421766|gb|ACD96164.1| ribosomal protein S16 [Geobacter lovleyi SZ] (87 aa)
Score = 142, Expect = 7.8e-08, Identities = 26/79 (32%), Positives = 45/79 (56%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
            R G    P Y++V  D R +RDG++I  +G+ +P       K++    + WL+KGA+PTDTV  +  + G+ +K  ++
  S:     8 QRHGAKKRPFYQVVIADERSRRDGRFIENVGYYDPTKNPAVLKLNVEKVIAWLDKGAQPTDTVNQILKKEGILEKAAQA 86
>gi|154483575|ref|ZP_02026023.1| hypothetical protein EUBVEN_01279 [Eubacterium ventriosum ATCC 27560] >gi|149735485|gb|EDM51371.1| hypothetical protein EUBVEN_01279 [Eubacterium ventriosum ATCC 27560] (81 aa)
Score = 142, Expect = 7.8e-08, Identities = 29/73 (39%), Positives = 40/73 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           RMG+   P YRIV  DSR  RDG++I  +G  +P    +   + E    +WL  GA+PT+TV  L    G+ K
  S:     9 RMGKKRNPIYRIVVADSRAPRDGRFIEEVGTYDPNQDPSIFDLKEESVKKWLANGAQPTETVGKLLKIAGIEK 81
>gi|163744760|ref|ZP_02152120.1| 30S ribosomal protein S16 [Oceanibulbus indolifex HEL-45] >gi|161381578|gb|EDQ05987.1| 30S ribosomal protein S16 [Oceanibulbus indolifex HEL-45] (128 aa)
Score = 142, Expect = 8.8e-08, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      W+ KGA+PT+ V  +    G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDVEKIEAWIAKGAQPTERVTRMLEAAGVREK 85
>gi|159042904|ref|YP_001531698.1| 30S ribosomal protein S16 [Dinoroseobacter shibae DFL 12] >gi|189044379|sp|A8LMC0.1|RS16_DINSH 30S ribosomal protein S16 >gi|157910664|gb|ABV92097.1| ribosomal protein S16 [Dinoroseobacter shibae DFL 12] (130 aa)
Score = 142, Expect = 9.0e-08, Identities = 31/67 (46%), Positives = 40/67 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFS 68
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E++ K+D      WL +GAKPTD V  +  
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDLERVQYWLGEGAKPTDRVARMLE 78
>gi|126732670|ref|ZP_01748466.1| ribosomal protein S16 [Sagittula stellata E-37] >gi|126706800|gb|EBA05870.1| ribosomal protein S16 [Sagittula stellata E-37] (121 aa)
Score = 142, Expect = 9.3e-08, Identities = 31/74 (41%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      W++ GA+PTD V       G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDLERIQYWMSHGAQPTDRVSRFLEAAGVIEK 85
>gi|195959364|ref|ZP_03095573.1| 30S ribosomal protein S16 [Borrelia sp. SV1] (86 aa)
Score = 142, Expect = 9.6e-08, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV ++S   RDG+ I  +G+ +P  K+N+ KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRIVVMNSTSPRDGRAIEELGYYHPVEKQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|86607943|ref|YP_476705.1| ribosomal protein S16 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|109894811|sp|Q2JP53|RS16_SYNJB 30S ribosomal protein S16 >gi|86556485|gb|ABD01442.1| ribosomal protein S16 [Synechococcus sp. JA-2-3B'a(2-13)] (159 aa)
Score = 142, Expect = 9.6e-08, Identities = 27/75 (36%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+   P+YRI+A++S+ +R+ + +  +G+ NP  KE    +  A  L+WL  GA+PT+TV SL  + G+++  
  S:     8 RYGKKRQPSYRIIAIESKSRREARPLEELGYYNPRTKET--VLQTAGLLKWLRCGAQPTETVDSLLKKAGIYEML 80
>gi|148251975|ref|YP_001236560.1| 30S ribosomal protein S16 [Bradyrhizobium sp. BTAi1] >gi|166234396|sp|A5E910.1|RS16_BRASB 30S ribosomal protein S16 >gi|146404148|gb|ABQ32654.1| SSU ribosomal protein S16P [Bradyrhizobium sp. BTAi1] (110 aa)
Score = 141, Expect = 9.7e-08, Identities = 30/83 (36%), Positives = 46/83 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPV 84
           R G    P Y +V  DSR  RDG++I  +G+ NP +    E + K+D      WL KGA+P+D V       G+ K+  E+++ P+
  S:     9 RAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLMPKDNEARLKLDMEKVKGWLAKGAQPSDRVARFLDAAGVKKR--EARQNPI 92
>gi|23014874|ref|ZP_00054670.1| COG0228: Ribosomal protein S16 [Magnetospirillum magnetotacticum MS-1] (123 aa)
Score = 141, Expect = 9.9e-08, Identities = 35/87 (40%), Positives = 49/87 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV--ESKKKPVAKSK 88
           R G    P Y+IV  D+R  RDG++I  +G  NP L  +  +   +DE     WL+ GA+PTD +   F+  GL  K V  E  K+P  K+K
  S:     9 RGGAKKRPFYKIVVADARAPRDGRFIEKVGTYNPMLPNDNGQRWILDEDRVKHWLSVGAQPTDRLVRFFADKGLVAKPVRAEQTKQPKPKAK 100
>gi|126724937|ref|ZP_01740780.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2150] >gi|126706101|gb|EBA05191.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2150] (136 aa)
Score = 141, Expect = 1.0e-07, Identities = 30/74 (40%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P+Y IVA DSR+ RDG++I  +G  NP L    E + K++      W++KGA+P+D V       GL +K
  S:     9 RGGSKKRPSYAIVAADSRMPRDGRFIEKLGTYNPQLPKDSEERVKMNVERVQYWMSKGAQPSDRVSRFLEAAGLVEK 85
>gi|195962431|ref|ZP_03098636.1| 30S ribosomal protein S16 [Borrelia spielmanii A14S] (86 aa)
Score = 141, Expect = 1.0e-07, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV ++S   RDG+ I  +G+ +P  K+N+ KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRIVVMNSASPRDGRAIEELGYYHPVEKQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|85714454|ref|ZP_01045442.1| Ribosomal protein S16 [Nitrobacter sp. Nb-311A] >gi|85698901|gb|EAQ36770.1| Ribosomal protein S16 [Nitrobacter sp. Nb-311A] (110 aa)
Score = 141, Expect = 1.0e-07, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +VA DSR  RDG++I  +GH NP + K+N  + K+D      WL KGA+P+D V       G+ K+
  S:     9 RAGTKKRPVYHVVAADSRYPRDGRFIERLGHFNPLMPKDNADRLKLDLDKVKAWLAKGAQPSDRVARFLDAAGVKKR 85
>gi|91214929|ref|ZP_01251901.1| 30S ribosomal protein S16 [Psychroflexus torquis ATCC 700755] >gi|91186534|gb|EAS72905.1| 30S ribosomal protein S16 [Psychroflexus torquis ATCC 700755] (183 aa)
Score = 141, Expect = 1.1e-07, Identities = 27/71 (38%), Positives = 42/71 (59%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
            R G+   P + IVA D+R KRDGKY+  +G  NP  +    +++   +++WL  GA+PTDT + + S  G
  S:     8 QRHGKKGKPFFWIVAADARAKRDGKYLEKLGIYNPVTQPATIELNVDSSVKWLRNGAQPTDTAKRILSYKG 78
>gi|161353764|ref|YP_381206.2| 30S ribosomal protein S16 [Synechococcus sp. CC9605] >gi|109894814|sp|Q3AL81|RS16_SYNSC 30S ribosomal protein S16 (135 aa)
Score = 141, Expect = 1.1e-07, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     E L +GA+PTD VR+L  + GL +K V
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEAIRERLGQGAQPTDVVRTLLERGGLLEKTV 81
>gi|149196238|ref|ZP_01873293.1| ribosomal protein S16 [Lentisphaera araneosa HTCC2155] >gi|149140499|gb|EDM28897.1| ribosomal protein S16 [Lentisphaera araneosa HTCC2155] (119 aa)
Score = 141, Expect = 1.1e-07, Identities = 30/81 (37%), Positives = 50/81 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF--SQTGLWKKFVESKKK 82
           R G+ + P+YRIV +D+RV+RDG YI  +GH  P   E    ++ A    W+ +GA+P+ TV  +   ++TG   + ++ +KK
  S:     8 RTGKKNAPSYRIVVMDARVRRDGAYIEKLGHYAPLRDEEVVNVERAEY--WIARGAQPSSTVSDIIRRAKTGEATRGLKGQKK 88
>gi|110636543|ref|YP_676750.1| 30S ribosomal protein S16 [Cytophaga hutchinsonii ATCC 33406] >gi|123059068|sp|Q11YV6.1|RS16_CYTH3 30S ribosomal protein S16 >gi|110279224|gb|ABG57410.1| SSU ribosomal protein S16P [Cytophaga hutchinsonii ATCC 33406] (175 aa)
Score = 141, Expect = 1.2e-07, Identities = 28/72 (38%), Positives = 40/72 (55%)
  Q:     4 GRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           GR     Y IV  DSR  RDGK+I  +G  NP        +++ +  +W+ KGA PTDT R++ S+ G+  K
  S:    11 GRRKLALYDIVVSDSRSPRDGKFIQKLGTYNPNTNPATVVLNDELTFDWVMKGALPTDTARTILSERGVMLK 82
>gi|154251872|ref|YP_001412696.1| ribosomal protein S16 [Parvibaculum lavamentivorans DS-1] >gi|171769583|sp|A7HT06.1|RS16_PARL1 30S ribosomal protein S16 >gi|154155822|gb|ABS63039.1| ribosomal protein S16 [Parvibaculum lavamentivorans DS-1] (141 aa)
Score = 141, Expect = 1.2e-07, Identities = 37/87 (42%), Positives = 50/87 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES---KKKPVAKSK 88
           R G    P YR+V  D+R  RDG++I  IG  NP L K+N  + K+D   A  WL+ GA PTD V       G++ +   S   K KP AK++
  S:     9 RGGAKKRPFYRVVIADTRSPRDGRFIEKIGTFNPLLPKDNAERIKVDIERAKHWLSVGALPTDRVARFLDDAGVYTRKARSNPEKSKPKAKAQ 101
>gi|90421746|ref|YP_530116.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris BisB18] >gi|109894794|sp|Q21CT9|RS16_RHOPB 30S ribosomal protein S16 >gi|90103760|gb|ABD85797.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris BisB18] (110 aa)
Score = 141, Expect = 1.2e-07, Identities = 31/82 (37%), Positives = 44/82 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +GH NP L    E + K+D      W+ KGA+P+D V       G+ K+  E++  P
  S:     9 RAGTKKRPVYHVVVADSRFPRDGRFIERLGHFNPLLPKDSEARLKLDLDKVKAWVAKGAQPSDRVARFLDAAGVKKR--EARNNP 91
>gi|15792059|ref|NP_281882.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237012|ref|YP_178814.1| 30S ribosomal protein S16 [Campylobacter jejuni RM1221] >gi|86149903|ref|ZP_01068132.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151659|ref|ZP_01069873.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153527|ref|ZP_01071731.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596904|ref|ZP_01100140.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612199|ref|YP_001000406.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926675|ref|ZP_01810356.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CG8486] >gi|153952325|ref|YP_001398345.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. doylei 269.97] >gi|157414997|ref|YP_001482253.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005348|ref|ZP_02271106.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81-176] >gi|166234408|sp|A7H4B5.1|RS16_CAMJD 30S ribosomal protein S16 >gi|166234409|sp|A1VZ65.1|RS16_CAMJJ 30S ribosomal protein S16 >gi|172047103|sp|A8FLD9.1|RS16_CAMJ8 30S ribosomal protein S16 >gi|14195205|sp|Q9PPJ7|RS16_CAMJE 30S ribosomal protein S16 >gi|81557523|sp|Q5HV71|RS16_CAMJR 30S ribosomal protein S16 >gi|57165816|gb|AAW34595.1| ribosomal protein S16 [Campylobacter jejuni RM1221] >gi|85839721|gb|EAQ56981.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841288|gb|EAQ58536.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843253|gb|EAQ60464.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249405|gb|EAQ72365.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190593|gb|EAQ94566.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 84-25] >gi|107784832|gb|ABF83907.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. doylei] >gi|112360055|emb|CAL34847.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145845194|gb|EDK22289.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CG8486] >gi|152939771|gb|ABS44512.1| ribosomal protein S16 [Campylobacter jejuni subsp. doylei 269.97] >gi|157385961|gb|ABV52276.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81116] (75 aa)
Score = 140, Expect = 1.3e-07, Identities = 30/68 (44%), Positives = 40/68 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           RMGR   P YRIV  DSR +RDG +I  IG+ NP ++    K+D      W + GAK +D V S+ S+
  S:     8 RMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEPEVIKVDAERLAYWKSVGAKLSDKVASITSK 75
>gi|116073374|ref|ZP_01470636.1| 30S ribosomal protein S16 [Synechococcus sp. RS9916] >gi|116068679|gb|EAU74431.1| 30S ribosomal protein S16 [Synechococcus sp. RS9916] (134 aa)
Score = 140, Expect = 1.3e-07, Identities = 29/76 (38%), Positives = 46/76 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     E L++GA+PTD VRSL  + GL +K +
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDAEGLRERLSQGAQPTDAVRSLLEKGGLLEKTI 81
>gi|124003526|ref|ZP_01688375.1| 30S ribosomal protein S16 [Microscilla marina ATCC 23134] >gi|123991095|gb|EAY30547.1| 30S ribosomal protein S16 [Microscilla marina ATCC 23134] (184 aa)
Score = 140, Expect = 1.4e-07, Identities = 31/77 (40%), Positives = 45/77 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG-LWKKFVE 78
           R GR   P Y +V  D +  RDG++I  IG  NP        +D+  AL+W+  GA+PTDTV+++ S  G L +K +E
  S:     8 RRGRKKKPLYDVVIADRKAPRDGRFIEKIGTYNPHTVPATIVLDDERALKWVLDGAQPTDTVKAMLSYRGVLIRKHLE 85
>gi|33240808|ref|NP_875750.1| 30S ribosomal protein S16 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|54039437|sp|Q7VAU5|RS16_PROMA 30S ribosomal protein S16 >gi|33238337|gb|AAQ00403.1| Ribosomal protein S16 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (131 aa)
Score = 140, Expect = 1.5e-07, Identities = 30/76 (39%), Positives = 47/76 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE +    EA+ L  L++GA+PTD VRSL  + GL +K +
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDT-EALRL-RLSQGAQPTDAVRSLLEKGGLLEKTI 81
>gi|86747478|ref|YP_483974.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris HaA2] >gi|109894793|sp|Q2J397|RS16_RHOP2 30S ribosomal protein S16 >gi|86570506|gb|ABD05063.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris HaA2] (110 aa)
Score = 140, Expect = 1.5e-07, Identities = 31/82 (37%), Positives = 46/82 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +G+ NP +    E + K+D     +WL KGA+P+D V      TG+ K+  E++  P
  S:     9 RAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDITGVKKR--EARNNP 91
>gi|56551972|ref|YP_162811.1| 30S ribosomal protein S16 [Zymomonas mobilis subsp. mobilis ZM4] >gi|81598239|sp|Q5NNL0|RS16_ZYMMO 30S ribosomal protein S16 >gi|56543546|gb|AAV89700.1| ribosomal protein S16 [Zymomonas mobilis subsp. mobilis ZM4] (143 aa)
Score = 140, Expect = 1.5e-07, Identities = 32/74 (43%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  +SR  RDG +I  IG  NP L    EN+  +D   A  WL+ GA+PTD V       GL ++
  S:     9 RGGAKRRPFYRIVIANSRSPRDGSFIEKIGSYNPQLPKDNENRVIVDLDRARHWLSVGAQPTDRVARFLDAAGLLER 85
>gi|15595040|ref|NP_212829.1| 30S ribosomal protein S16 [Borrelia burgdorferi B31] >gi|167933450|ref|ZP_02520525.1| 30S ribosomal protein S16 [Borrelia burgdorferi ZS7] >gi|167943629|ref|ZP_02530703.1| 30S ribosomal protein S16 [Borrelia burgdorferi Bol26] >gi|168526078|ref|ZP_02719717.1| 30S ribosomal protein S16 [Borrelia burgdorferi 118a] >gi|168579735|ref|ZP_02723731.1| 30S ribosomal protein S16 [Borrelia burgdorferi 72a] >gi|168692333|ref|ZP_02725125.1| 30S ribosomal protein S16 [Borrelia burgdorferi 94a] >gi|195941514|ref|ZP_03086896.1| 30S ribosomal protein S16 [Borrelia burgdorferi 80a] >gi|195949027|ref|ZP_03090127.1| 30S ribosomal protein S16 [Borrelia burgdorferi WI91-23] >gi|195950989|ref|ZP_03092086.1| 30S ribosomal protein S16 [Borrelia burgdorferi 29805] >gi|195960433|ref|ZP_03096638.1| 30S ribosomal protein S16 [Borrelia burgdorferi 64b] >gi|3914890|sp|O51638|RS16_BORBU 30S ribosomal protein S16 >gi|2688633|gb|AAC67048.1| ribosomal protein S16 (rpsP) [Borrelia burgdorferi B31] (86 aa)
Score = 140, Expect = 1.5e-07, Identities = 30/77 (38%), Positives = 46/77 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YR+V ++S   RDG+ I  +G+ +P  K+N+ KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRVVVMNSTSPRDGRAIEELGYYHPVEKQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|195955136|ref|ZP_03093829.1| 30S ribosomal protein S16 [Borrelia burgdorferi CA-11.2a] (86 aa)
Score = 140, Expect = 1.5e-07, Identities = 30/77 (38%), Positives = 46/77 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YR+V ++S   RDG+ I  +G+ +P  K+N+ KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRVVVMNSTSPRDGRAIEELGYYHPVEKQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|22711968|ref|NP_683784.1| ribosomal protein S16 [Chaetosphaeridium globosum] >gi|25009147|sp|Q8MA02|RR16_CHAGL Chloroplast 30S ribosomal protein S16 >gi|22416972|gb|AAM96572.1| ribosomal protein S16 [Chaetosphaeridium globosum] (83 aa)
Score = 140, Expect = 1.6e-07, Identities = 27/74 (36%), Positives = 47/74 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR   PTYRI+A+D++ +R+GK +  +G  NP   +N  ++D    + +L  GAKPTDTV  + ++  ++++
  S:     8 RYGRKQQPTYRIIAIDAKNRREGKALKELGFYNPI--KNSIQLDVQNIILFLKNGAKPTDTVFDILNKHQVFEQ 79
>gi|51246652|ref|YP_066536.1| 30S ribosomal protein S16 [Desulfotalea psychrophila LSv54] >gi|81641227|sp|Q6AJF1|RS16_DESPS 30S ribosomal protein S16 >gi|50877689|emb|CAG37529.1| probable 30S ribosomal protein S16 [Desulfotalea psychrophila LSv54] (81 aa)
Score = 140, Expect = 1.6e-07, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           R+GR   P YR+V  DS  KRDGK++ ++G  +P        I++    +W+ +GA PT TV+SL 
  S:     9 RLGRKKMPFYRLVVADSEAKRDGKFLDIVGTYDPMQDPAVITINDEKLQDWVGRGALPTTTVKSLL 74
>gi|146276237|ref|YP_001166396.1| 30S ribosomal protein S16 [Rhodobacter sphaeroides ATCC 17025] >gi|166201342|sp|A4WNX7.1|RS16_RHOS5 30S ribosomal protein S16 >gi|145554478|gb|ABP69091.1| SSU ribosomal protein S16P [Rhodobacter sphaeroides ATCC 17025] (116 aa)
Score = 140, Expect = 1.6e-07, Identities = 33/87 (37%), Positives = 47/87 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK 88
           R G    P Y IVA DSR+ RDG+++  +G  NP L    E++ K++      WL++GA+PTD V       GL +K V +  K     K
  S:     9 RGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNVERVQYWLSQGAQPTDRVARFLEAAGLKEKAVRNNPKAAVPGK 98
>gi|110635667|ref|YP_675875.1| 30S ribosomal protein S16 [Mesorhizobium sp. BNC1] >gi|123353130|sp|Q11D15.1|RS16_MESSB 30S ribosomal protein S16 >gi|110286651|gb|ABG64710.1| SSU ribosomal protein S16P [Mesorhizobium sp. BNC1] (134 aa)
Score = 139, Expect = 1.7e-07, Identities = 33/81 (40%), Positives = 41/81 (50%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G    P Y IV  D R  RDG++I  IG  NP L ++  + K++E     WL  GA PTD V     Q GL K+   S  K
  S:     9 RAGSKKRPYYHIVVADVRAPRDGRFIEQIGSWNPMLPKDSERVKLNEERIKHWLANGALPTDRVLRFLDQAGLAKRPARSNPK 91
>gi|118045751|ref|ZP_01514408.1| ribosomal protein S16 [Chloroflexus aggregans DSM 9485] >gi|117997763|gb|EAV11947.1| ribosomal protein S16 [Chloroflexus aggregans DSM 9485] (89 aa)
Score = 139, Expect = 1.7e-07, Identities = 32/86 (37%), Positives = 47/86 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKS 87
           R G+   P+YRIV  DSR  RDGK+I  IG+  P  +    +++   A  WL  GA+PTD V  L  +  +    ++ + K VA+S
  S:     8 RTGKTKQPSYRIVVADSRSPRDGKFIETIGYYLPTRQPKVLEVNADRARYWLGVGAQPTDVVVKLLKRVNI----LDEQGKVVAES 89
>gi|73748407|ref|YP_307646.1| 30S ribosomal protein S16 [Dehalococcoides sp. CBDB1] >gi|147669187|ref|YP_001214005.1| 30S ribosomal protein S16 [Dehalococcoides sp. BAV1] >gi|189044378|sp|A5FRP7.1|RS16_DEHSB 30S ribosomal protein S16 >gi|109893878|sp|Q3ZWY8|RS16_DEHSC 30S ribosomal protein S16 >gi|73660123|emb|CAI82730.1| ribosomal protein S16 [Dehalococcoides sp. CBDB1] >gi|146270135|gb|ABQ17127.1| ribosomal protein S16 [Dehalococcoides sp. BAV1] (82 aa)
Score = 139, Expect = 1.8e-07, Identities = 27/71 (38%), Positives = 37/71 (52%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R+G    P YRI+  ++R  RD  Y  L+G  NP        I+    L W+ KGA+PTDTV  L  + G+
  S:     8 RIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTNPETVIINAEKVLYWIGKGAQPTDTVARLLKKAGI 78
>gi|57167722|ref|ZP_00366862.1| ribosomal protein S16 [Campylobacter coli RM2228] >gi|57020844|gb|EAL57508.1| ribosomal protein S16 [Campylobacter coli RM2228] (75 aa)
Score = 139, Expect = 1.8e-07, Identities = 30/68 (44%), Positives = 39/68 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           RMGR   P YRIV  DSR +RDG +I  IG+ NP ++    K D      W + GAK +D V S+ S+
  S:     8 RMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEPEVVKFDSERLAYWKSVGAKLSDKVASITSK 75
>gi|167942413|ref|ZP_02529487.1| 30S ribosomal protein S16 [Borrelia afzelii ACA-1] (86 aa)
Score = 139, Expect = 1.9e-07, Identities = 31/77 (40%), Positives = 45/77 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV ++S   RDG+ I  +G+ +P  K+N+ KI E    +W++KGA  +DTV+ L  +  L  K  E
  S:     9 RMGAKKRPYYRIVVMNSTSPRDGRAIEELGYYHPIEKQNQIKIKEDRMKDWISKGAILSDTVKMLLKKNNLNAKSQE 85
>gi|78185083|ref|YP_377518.1| 30S ribosomal protein S16 [Synechococcus sp. CC9902] >gi|109894813|sp|Q3AX02|RS16_SYNS9 30S ribosomal protein S16 >gi|78169377|gb|ABB26474.1| SSU ribosomal protein S16P [Synechococcus sp. CC9902] (130 aa)
Score = 139, Expect = 2.0e-07, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     E L +GA+PTD VR+L  + GL +K V
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEAIRERLGQGAQPTDIVRTLLERGGLIEKTV 81
>gi|119717484|ref|YP_924449.1| SSU ribosomal protein S16P [Nocardioides sp. JS614] >gi|119538145|gb|ABL82762.1| SSU ribosomal protein S16P [Nocardioides sp. JS614] (465 aa)
Score = 139, Expect = 2.0e-07, Identities = 31/75 (41%), Positives = 42/75 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G+V  P YRIV VD+R KRDG+ I  IG  +P    +   +    A  WL  GA+PT+ V  +   TG  +KF
  S:   291 RLGKVRVPQYRIVVVDARQKRDGRVIEEIGKYHPKEHPSYIDVVSDRAQYWLGVGAQPTEAVAKILKITGDLQKF 365
>gi|103488204|ref|YP_617765.1| ribosomal protein S16 [Sphingopyxis alaskensis RB2256] >gi|98978281|gb|ABF54432.1| SSU ribosomal protein S16P [Sphingopyxis alaskensis RB2256] (201 aa)
Score = 139, Expect = 2.0e-07, Identities = 33/81 (40%), Positives = 45/81 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G    P Y+IV  DSR  RDG++I  IG  NP L K+N  + K+D   A  W++ GA+PTD V       G+ ++   S  K
  S:     9 RGGSKKRPYYKIVVADSRSPRDGRFIERIGSYNPLLAKDNPERVKLDAERAKHWISVGAQPTDRVARFLDAAGVKERTARSNPK 92
>gi|78196886|gb|ABB34651.1| ribosomal protein S16 [Synechococcus sp. CC9605] (157 aa)
Score = 139, Expect = 2.0e-07, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     E L +GA+PTD VR+L  + GL +K V
  S:    30 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEAIRERLGQGAQPTDVVRTLLERGGLLEKTV 103
>gi|33866151|ref|NP_897710.1| 30S ribosomal protein S16 [Synechococcus sp. WH 8102] >gi|50403632|sp|Q7TTU5|RS16_SYNPX 30S ribosomal protein S16 >gi|33639126|emb|CAE08132.1| 30S Ribosomal protein S16 [Synechococcus sp. WH 8102] (140 aa)
Score = 139, Expect = 2.0e-07, Identities = 28/76 (36%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     E L +GA+PTD VR+L  + GL +K +
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEAIRERLGQGAQPTDVVRTLLERGGLIEKTI 81
>gi|167575683|ref|ZP_02368557.1| 30S ribosomal protein S16 [Borrelia valaisiana VS116] (86 aa)
Score = 138, Expect = 2.2e-07, Identities = 31/77 (40%), Positives = 45/77 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV +DS   RDG+ I  +G+ +P  K+ + KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRIVVMDSASPRDGRAIEELGYYHPVEKQKQIKIKEDRIKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|170787608|gb|EDT28652.1| ribosomal protein S16 [Oligotropha carboxidovorans OM5] (110 aa)
Score = 138, Expect = 2.2e-07, Identities = 29/74 (39%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +V  DSR  RDG++I  +G+ NP L    E + K+D      WL KGA+P+D V       G+ K+
  S:     9 RAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLLPKDNEARLKLDMDKVKAWLAKGAQPSDRVMRFLDAAGVAKR 85
>gi|91974989|ref|YP_567648.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris BisB5] >gi|123722181|sp|Q13DU2.1|RS16_RHOPS 30S ribosomal protein S16 >gi|91681445|gb|ABE37747.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris BisB5] (107 aa)
Score = 138, Expect = 2.3e-07, Identities = 30/82 (36%), Positives = 45/82 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +G+ NP +    E + K+D     +WL KGA+P+D V       G+ K+  E++  P
  S:     9 RAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGIKKR--EARNNP 91
>gi|148242808|ref|YP_001227965.1| 30S ribosomal protein S16 [Synechococcus sp. RCC307] >gi|166201644|sp|A5GUQ3.1|RS16_SYNR3 30S ribosomal protein S16 >gi|147851118|emb|CAK28612.1| 30S ribosomal protein S16 [Synechococcus sp. RCC307] (137 aa)
Score = 138, Expect = 2.3e-07, Identities = 30/76 (39%), Positives = 44/76 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE +   D   A   L +GA+P+DTVR+L  + GL  K V
  S:     8 RFGKKRETSFRIVACNSTSRRDGRPLQELGFYNPRTKETRLDTDALRA--RLEQGAQPSDTVRTLLERGGLLTKSV 81
>gi|53802420|ref|YP_112923.1| ribosomal protein S16 [Methylococcus capsulatus str. Bath] >gi|81682949|sp|Q60BS3|RS16_METCA 30S ribosomal protein S16 >gi|53756181|gb|AAU90472.1| ribosomal protein S16 [Methylococcus capsulatus str. Bath] (84 aa)
Score = 138, Expect = 2.3e-07, Identities = 26/61 (42%), Positives = 38/61 (62%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           P Y +V  +SR KRDG+YI  +G  NP  +  E + ++DE+    W+  GAKP+D V SL  +
  S:    15 PFYHVVVAESRSKRDGRYIERVGFFNPIARGQEERLRLDESRIAYWIGTGAKPSDRVVSLIKE 77
>gi|39933321|ref|NP_945597.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris CGA009] >gi|192288676|ref|YP_001989281.1| ribosomal protein S16 [Rhodopseudomonas palustris TIE-1] >gi|50403606|sp|P62236|RS16_RHOPA 30S ribosomal protein S16 (RRP-S16) >gi|39652946|emb|CAE25688.1| ribosomal protein S16 [Rhodopseudomonas palustris CGA009] >gi|192282425|gb|ACE98805.1| ribosomal protein S16 [Rhodopseudomonas palustris TIE-1] (106 aa)
Score = 138, Expect = 2.3e-07, Identities = 30/82 (36%), Positives = 45/82 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +G+ NP +    E + K+D     +WL KGA+P+D V       G+ K+  E++  P
  S:     9 RAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGVRKR--EARNNP 91
>gi|57242692|ref|ZP_00370629.1| ribosomal protein S16 [Campylobacter upsaliensis RM3195] >gi|57016621|gb|EAL53405.1| ribosomal protein S16 [Campylobacter upsaliensis RM3195] (75 aa)
Score = 138, Expect = 2.3e-07, Identities = 30/68 (44%), Positives = 39/68 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           RMGR   P YRIV  DSR +RDG +I  IG+ NP ++    K D      W + GAK +D V S+ S+
  S:     8 RMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEPEVVKFDAERLAYWKSVGAKLSDKVASITSK 75
>gi|167931970|ref|ZP_02519057.1| 30S ribosomal protein S16 [Borrelia burgdorferi 156a] (86 aa)
Score = 138, Expect = 2.6e-07, Identities = 30/77 (38%), Positives = 45/77 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YR+V + S   RDG+ I  +G+ +P  K+N+ KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRVVVMSSTSPRDGRAIEELGYYHPVEKQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|77464629|ref|YP_354133.1| 30S ribosomal protein S16 [Rhodobacter sphaeroides 2.4.1] >gi|126463469|ref|YP_001044583.1| 30S ribosomal protein S16 [Rhodobacter sphaeroides ATCC 17029] >gi|166201341|sp|A3PN95.1|RS16_RHOS1 30S ribosomal protein S16 >gi|109894796|sp|Q3IZ02|RS16_RHOS4 30S ribosomal protein S16 >gi|77389047|gb|ABA80232.1| SSU ribosomal protein S16P [Rhodobacter sphaeroides 2.4.1] >gi|126105133|gb|ABN77811.1| SSU ribosomal protein S16P [Rhodobacter sphaeroides ATCC 17029] (116 aa)
Score = 137, Expect = 3.0e-07, Identities = 33/87 (37%), Positives = 46/87 (52%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKSK 88
           R G    P Y IVA DSR+ RDG+++  +G  NP L    E++ K++      WL +GA+PTD V       GL +K V +  K     K
  S:     9 RGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNLERVQYWLAQGAQPTDRVARFLEAAGLKEKAVRNNPKAAVPGK 98
>gi|148377888|ref|YP_001256764.1| 30S ribosomal protein S16 [Mycoplasma agalactiae PG2] >gi|148291934|emb|CAL59325.1| 30S ribosomal protein S16 [Mycoplasma agalactiae PG2] (96 aa)
Score = 137, Expect = 3.0e-07, Identities = 29/75 (38%), Positives = 42/75 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R+G      Y+IV  D+R  RDG++I  IG  NP  K    +I+E  A++W+  GA+ T TV +LF    L +K 
  S:     8 RLGSKFNACYKIVVADARAPRDGRFIEAIGEYNPHSKA--LRINEEAAIQWIKNGAQLTQTVYNLFKTQKLNEKI 80
>gi|89257007|ref|YP_514369.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica] >gi|115315367|ref|YP_764090.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica OSU18] >gi|167009387|ref|ZP_02274318.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica FSC200] >gi|169656745|ref|YP_001429272.2| ribosomal protein S16 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|122324646|sp|Q0BKD1.1|RS16_FRATO 30S ribosomal protein S16 >gi|123401546|sp|Q2A1N3.1|RS16_FRATH 30S ribosomal protein S16 >gi|189044385|sp|A7NEB3.2|RS16_FRATF 30S ribosomal protein S16 >gi|89144838|emb|CAJ80177.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica LVS] >gi|115130266|gb|ABI83453.1| ribosomal protein S16 [Francisella tularensis subsp. holarctica OSU18] >gi|134254070|gb|EBA53164.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica 257] >gi|157122816|gb|EDO66945.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica FSC022] >gi|164551813|gb|ABU62316.2| ribosomal protein S16 [Francisella tularensis subsp. holarctica FTNF002-00] (82 aa)
Score = 137, Expect = 3.0e-07, Identities = 29/60 (48%), Positives = 37/60 (61%)
  Q:    11 YRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           YRIV  D R  RDG++I  +G  NP  K  E + K+D A A  WL KGA+P+D V SL  + 
  S:    17 YRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEA 78
>gi|13473696|ref|NP_105264.1| 30S ribosomal protein S16 [Mesorhizobium loti MAFF303099] >gi|20140183|sp|Q98E70|RS16_RHILO 30S ribosomal protein S16 >gi|14024447|dbj|BAB51050.1| ribosomal protein S16 [Mesorhizobium loti MAFF303099] (133 aa)
Score = 137, Expect = 3.0e-07, Identities = 30/81 (37%), Positives = 43/81 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G    P Y +V  D+R  RDG++I  +G  NP L ++  + K+D      WL+ GA+PTD V     + GL K+   S  K
  S:     9 RAGSKKRPYYHVVVADARSPRDGRFIESLGSWNPLLPKDGERVKVDADRVKHWLSHGAQPTDRVLRFLDEAGLAKRDARSNPK 91
>gi|148240066|ref|YP_001225453.1| 30S ribosomal protein S16 [Synechococcus sp. WH 7803] >gi|166201643|sp|A5GMJ1.1|RS16_SYNPW 30S ribosomal protein S16 >gi|147848605|emb|CAK24156.1| 30S ribosomal protein S16 [Synechococcus sp. WH 7803] (138 aa)
Score = 137, Expect = 3.1e-07, Identities = 28/76 (36%), Positives = 46/76 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     + L++GA+PTD VR+L  + GL +K V
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDAEALRQRLSQGAQPTDAVRTLLEKGGLIEKTV 81
>gi|27375593|ref|NP_767122.1| 30S ribosomal protein S16 [Bradyrhizobium japonicum USDA 110] >gi|31076937|sp|Q89X40|RS16_BRAJA 30S ribosomal protein S16 >gi|27348730|dbj|BAC45747.1| 30S ribosomal protein S16 [Bradyrhizobium japonicum USDA 110] (110 aa)
Score = 137, Expect = 3.1e-07, Identities = 30/82 (36%), Positives = 44/82 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +G+ NP L    E + K+D      W+ KGA+P+D V       G+ K+  E++  P
  S:     9 RAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLLPKDNEARLKLDMEKVKAWVAKGAQPSDRVSRFLDAAGVKKR--EARNNP 91
>gi|15889953|ref|NP_355634.1| 30S ribosomal protein S16 [Agrobacterium tumefaciens str. C58] >gi|22096127|sp|Q8UBZ9|RS16_AGRT5 30S ribosomal protein S16 >gi|15157913|gb|AAK88419.1| 30S ribosomal protein S16 [Agrobacterium tumefaciens str. C58] (126 aa)
Score = 137, Expect = 3.2e-07, Identities = 30/78 (38%), Positives = 46/78 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KENKCKIDEAVAL--EWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R G    P Y+IV  D+R  RDG+++  +G  NP L K+N  +++    L  EW+ KGA+PTD V    ++ GL ++   S
  S:     9 RGGSKKRPYYQIVVADARSPRDGRFLEKVGSWNPMLAKDNPLRVELKADLIKEWIAKGAQPTDRVLRFLAEAGLAERAARS 89
>gi|146337524|ref|YP_001202572.1| 30S ribosomal protein S16 [Bradyrhizobium sp. ORS278] >gi|166234397|sp|A4YKA0.1|RS16_BRASO 30S ribosomal protein S16 >gi|146190330|emb|CAL74326.1| 30S ribosomal protein S16 [Bradyrhizobium sp. ORS278] (110 aa)
Score = 137, Expect = 3.5e-07, Identities = 30/82 (36%), Positives = 44/82 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P Y +V  DSR  RDG++I  +G+ NP +    E + K+D      WL KGA+P+D V       G+ K+  E++  P
  S:     9 RAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLMPKDNEARLKLDMEKVKGWLAKGAQPSDRVARFLDTAGVKKR--EARNNP 91
>gi|33862623|ref|NP_894183.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9313] >gi|50403612|sp|Q7TV43|RS16_PROMM 30S ribosomal protein S16 >gi|33634539|emb|CAE20525.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9313] (122 aa)
Score = 136, Expect = 3.7e-07, Identities = 31/76 (40%), Positives = 47/76 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE +    EA+ L  L++GA+PTD VRSL  + GL +K V
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDT-EALRL-RLSQGAQPTDAVRSLLEKGGLIEKTV 81
>gi|124023655|ref|YP_001017962.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9303] >gi|166201333|sp|A2CB37.1|RS16_PROM3 30S ribosomal protein S16 >gi|123963941|gb|ABM78697.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9303] (122 aa)
Score = 136, Expect = 3.8e-07, Identities = 31/76 (40%), Positives = 47/76 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE +    EA+ L  L++GA+PTD VRSL  + GL +K V
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDT-EALRL-RLSQGAQPTDAVRSLLEKGGLIEKTV 81
>gi|114705072|ref|ZP_01437980.1| 30s ribosomal protein s16 [Fulvimarina pelagi HTCC2506] >gi|114539857|gb|EAU42977.1| 30s ribosomal protein s16 [Fulvimarina pelagi HTCC2506] (145 aa)
Score = 136, Expect = 3.8e-07, Identities = 28/71 (39%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y IVA D+R  RDG++I  +G  NP L ++  +  ++E     WL++GA+PTD V     Q G+
  S:     9 RAGSKKRPYYHIVAADTRTPRDGRFIEQLGAWNPMLPKDGQRVTLNEERIKYWLSEGAQPTDRVLRFLDQAGI 81
>gi|118591422|ref|ZP_01548820.1| probable 30s ribosomal protein s16 [Stappia aggregata IAM 12614] >gi|118436094|gb|EAV42737.1| probable 30s ribosomal protein s16 [Stappia aggregata IAM 12614] (132 aa)
Score = 136, Expect = 4.0e-07, Identities = 30/74 (40%), Positives = 39/74 (52%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  D R  RDG++I  +G  +P L    EN+  ++      WL+ GAKPTD V       GL K+
  S:     9 RGGSKKRPYYRIVVADIRSPRDGRFIEKVGSYDPMLPKDSENRVTLNVERIQHWLDNGAKPTDRVHRFLDAAGLLKR 85
>gi|84498355|ref|ZP_00997152.1| 30s ribosomal protein s16 [Janibacter sp. HTCC2649] >gi|84381855|gb|EAP97738.1| 30s ribosomal protein s16 [Janibacter sp. HTCC2649] (227 aa)
Score = 136, Expect = 4.0e-07, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           RMG++    YR+V +DSR KRDG+ I  IG  +P  + +  +ID   A  W + GA+PT+ V +L 
  S:     9 RMGKIRTAIYRVVVMDSRTKRDGRAIEEIGKYDPNQEPSLIEIDMERANHWRSLGAQPTEAVAALL 74
>gi|90994543|ref|YP_537033.1| 30S ribosomal protein S16 [Porphyra yezoensis] >gi|122232137|sp|Q1XDD5|RR16_PORYE Chloroplast 30S ribosomal protein S16 >gi|90819107|dbj|BAE92476.1| 30S ribosomal protein S16 [Porphyra yezoensis] (82 aa)
Score = 136, Expect = 4.1e-07, Identities = 28/71 (39%), Positives = 46/71 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P+YRIV +DSR KRDGK I  +G  NP    N+ +++ +  L+ L++GA+ T TV+++ ++  +
  S:     8 RYGRKKQPSYRIVVMDSRNKRDGKAIEELGFYNPI--NNETRVNISKILQRLSQGAQATKTVKNILNKAQI 76
>gi|189501569|ref|YP_001957286.1| ribosomal protein S16 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497010|gb|ACE05557.1| ribosomal protein S16 [Candidatus Amoebophilus asiaticus 5a2] (119 aa)
Score = 136, Expect = 4.1e-07, Identities = 25/69 (36%), Positives = 39/69 (56%)
  Q:     4 GRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           GR     Y IV  D R  RDG++I  +G+ NP    +   + E   ++WL  GA+PT+TV+++ S  G+
  S:    11 GRKKLALYDIVVADQRAPRDGRFIEKLGNYNPNTNPSTVVLHEDKVIQWLFNGAQPTNTVKNILSSQGI 79
>gi|153008413|ref|YP_001369628.1| 30S ribosomal protein S16 [Ochrobactrum anthropi ATCC 49188] >gi|166201325|sp|A6WXU5.1|RS16_OCHA4 30S ribosomal protein S16 >gi|151560301|gb|ABS13799.1| ribosomal protein S16 [Ochrobactrum anthropi ATCC 49188] (134 aa)
Score = 136, Expect = 4.1e-07, Identities = 30/78 (38%), Positives = 41/78 (52%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R G    P Y IV  D R  RDG++I  +G  NP L ++  + K+D      W+ +GA+PTD V     Q GL K+   S
  S:     9 RAGSKKRPYYHIVVADVRSPRDGRFIETVGAWNPMLAKDAERVKLDADRIQHWIAQGAQPTDRVLRFLDQAGLAKRPTRS 88
>gi|159903873|ref|YP_001551217.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9211] >gi|159889049|gb|ABX09263.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9211] (125 aa)
Score = 136, Expect = 4.2e-07, Identities = 28/76 (36%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D       L++GA+PTD VRSL  + GL +K +
  S:     8 RYGKKREASFRLVACNSTSRRDGRPLEELGFYNPRTKET--RLDTEALRTRLSQGAQPTDAVRSLLEKGGLIEKTI 81
>gi|159026481|emb|CAO86453.1| rpsP [Microcystis aeruginosa PCC 7806] >gi|190192162|dbj|BAG48297.1| 30S ribosomal protein S16 [Microcystis aeruginosa NIES-843] (82 aa)
Score = 136, Expect = 4.2e-07, Identities = 27/75 (36%), Positives = 47/75 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+    +YRIVA  S  +RDG+ +  +G  NP  + ++ ++DE   +  L +GA+PTDTVRS+ ++  +++K 
  S:     8 RFGKKREASYRIVAAVSTSRRDGRPLEELGFYNP--RTDEVRLDEEGIIRRLQQGAQPTDTVRSILTKQKIFEKI 80
>gi|189485025|ref|YP_001955966.1| S16-like 30S ribosomal protein [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170286984|dbj|BAG13505.1| S16-like 30S ribosomal protein [uncultured Termite group 1 bacterium phylotype Rs-D17] (84 aa)
Score = 136, Expect = 4.3e-07, Identities = 27/69 (39%), Positives = 42/69 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G+   P YR+VA+D R KRDG+ I ++G  +P  ++NK K++      WL  GAK ++TV +L  + 
  S:     9 RRGKPKRPYYRVVAIDQRAKRDGEPIEILGQYDPIAEDNKFKVNIERINYWLGIGAKASETVAALIKKN 77
>gi|56698085|ref|YP_168456.1| 30S ribosomal protein S16 [Silicibacter pomeroyi DSS-3] >gi|81558324|sp|Q5LNF2|RS16_SILPO 30S ribosomal protein S16 >gi|56679822|gb|AAV96488.1| ribosomal protein S16 [Silicibacter pomeroyi DSS-3] (121 aa)
Score = 136, Expect = 4.4e-07, Identities = 31/74 (41%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL++GA+ TD V  +    G+  K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDVERVQYWLSQGAQTTDRVARMLEAAGVVGK 85
>gi|196241262|ref|ZP_03140026.1| ribosomal protein S16 [Cyanothece sp. PCC 7425] >gi|196214654|gb|EDY09309.1| ribosomal protein S16 [Cyanothece sp. PCC 7425] (82 aa)
Score = 136, Expect = 4.7e-07, Identities = 26/74 (35%), Positives = 47/74 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G+    +YRIVA++SR +RDG+ +  +G+ NP   E   +++  V  + L +GA+PTDTVR +  +  ++++
  S:     8 RFGKKRAASYRIVAMNSRDRRDGRPLEELGYYNPMTDETNLRVEPLV--KRLKEGAQPTDTVRRILEKANIFEQ 79
>gi|94495532|ref|ZP_01302112.1| ribosomal protein S16 [Sphingomonas sp. SKA58] >gi|94424920|gb|EAT09941.1| ribosomal protein S16 [Sphingomonas sp. SKA58] (149 aa)
Score = 136, Expect = 4.7e-07, Identities = 32/81 (39%), Positives = 41/81 (50%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G    P YRIV  DSR  RDGK+I  IG  NP L    E +  +D   A  W+  GA+PTD V       G+ ++   +  K
  S:     9 RGGSKKRPYYRIVVADSRAPRDGKFIERIGSYNPVLPKGDEKRVVLDIERAKHWVAAGAQPTDRVARFLDAAGVKERAARNNPK 92
>gi|86137218|ref|ZP_01055796.1| ribosomal protein S16 [Roseobacter sp. MED193] >gi|85826542|gb|EAQ46739.1| ribosomal protein S16 [Roseobacter sp. MED193] (119 aa)
Score = 135, Expect = 4.8e-07, Identities = 29/74 (39%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG+++  +G  NP L    E + K+D      WL++GA+ TD +  +    G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFVEKLGTYNPLLPKDSEERVKMDMERVQYWLDQGAQVTDRIARMLEAAGVREK 85
>gi|126738056|ref|ZP_01753777.1| ribosomal protein S16 [Roseobacter sp. SK209-2-6] >gi|126720553|gb|EBA17258.1| ribosomal protein S16 [Roseobacter sp. SK209-2-6] (118 aa)
Score = 135, Expect = 5.0e-07, Identities = 31/74 (41%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIVA DSR+ RDG++I  +G  NP L    E + K+D      WL +GA+ TD V  +    G+ +K
  S:     9 RGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDLERVQYWLGEGAQVTDRVARMLEAAGVREK 85
>gi|150251438|ref|YP_001312171.1| ribosomal protein S16 [Cycas taitungensis] >gi|149941488|dbj|BAF64912.1| ribosomal protein S16 [Cycas taitungensis] (84 aa)
Score = 135, Expect = 5.3e-07, Identities = 27/75 (36%), Positives = 43/75 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR    TYRIVA++   +R+GK +  +G  +P   +    +     L +L KGA+PT+TV  +  + G++KKF
  S:     8 RCGRKQLATYRIVAINVESRREGKALQEVGFYDPMKDQTYSNV--PAILHFLEKGAQPTETVHDILEKAGIFKKF 80
>gi|114771308|ref|ZP_01448728.1| ribosomal protein S16 [alpha proteobacterium HTCC2255] >gi|114548233|gb|EAU51120.1| ribosomal protein S16 [alpha proteobacterium HTCC2255] (168 aa)
Score = 135, Expect = 5.8e-07, Identities = 28/74 (37%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YR+VA DSR+ RDG+Y+  +G  NP L    E++ +++      WL +GA+PT+ V       G+ +K
  S:     9 RGGSKKRPFYRVVAADSRMPRDGRYVEKLGTYNPLLAKDSEDRVQLNMERVNYWLGQGAQPTERVVRFLEAAGVMEK 85
>gi|116072342|ref|ZP_01469609.1| 30S ribosomal protein S16 [Synechococcus sp. BL107] >gi|116064864|gb|EAU70623.1| 30S ribosomal protein S16 [Synechococcus sp. BL107] (152 aa)
Score = 135, Expect = 6.0e-07, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D     E L +GA+PTD VR+L  + GL +K V
  S:    30 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEAIRERLGQGAQPTDIVRTLLERGGLIEKTV 103
>gi|124515661|gb|EAY57170.1| Ribosomal protein S16 [Leptospirillum sp. Group II UBA] (81 aa)
Score = 135, Expect = 6.2e-07, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           R GR   P YRIV  DSR  R+G+++ +IG  NP    ++ ++D      W+ KGA+P++TV  L 
  S:     9 RHGRRKQPVYRIVVADSRSPRNGRFLEVIGSYNPQ-NNDEVRLDSGKLDAWVEKGAQPSETVHRLI 73
>gi|62290687|ref|YP_222480.1| 30S ribosomal protein S16 [Brucella abortus bv. 1 str. 9-941] >gi|82700602|ref|YP_415176.1| 30S ribosomal protein S16 [Brucella melitensis biovar Abortus 2308] >gi|189024901|ref|YP_001935669.1| Antifreeze protein, type I [Brucella abortus S19] >gi|75496262|sp|Q57B65|RS16_BRUAB 30S ribosomal protein S16 >gi|109893866|sp|Q2YLK6|RS16_BRUA2 30S ribosomal protein S16 >gi|62196819|gb|AAX75119.1| RpsP, ribosomal protein S16 [Brucella abortus biovar 1 str. 9-941] >gi|82616703|emb|CAJ11788.1| Antifreeze protein, type I:Ribosomal protein S16 [Brucella melitensis biovar Abortus 2308] >gi|189020473|gb|ACD73195.1| Antifreeze protein, type I [Brucella abortus S19] (134 aa)
Score = 135, Expect = 6.2e-07, Identities = 27/74 (36%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +V  D R  RDG++I  +G  NP L ++  + K+D      W+ +GA+PTD V     Q G+ K+
  S:     9 RAGSKKRPYYHVVVADVRAPRDGRFIETVGSWNPVLPKDAERVKLDAERIQHWIAQGAQPTDRVLRFLDQAGIAKR 84
>gi|91201021|emb|CAJ74079.1| strongly similar to 30S ribosomal protein S16 [Candidatus Kuenenia stuttgartiensis] (85 aa)
Score = 134, Expect = 6.4e-07, Identities = 32/72 (44%), Positives = 45/72 (62%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKID---EAVALEWLNKGAKPTDTVRSLFSQTGL 72
           MRMGR + P YRI A D+  +RDG  I  +G  +P    N+ ++    E V   WL+ GAKPT+TV S+F + G+
  S:     8 MRMGRKNRPFYRIGAFDAHEERDGMSIENLGTYDPMESNNEKQVTLKRERVDY-WLSVGAKPTETVASIFKKLGI 81
>gi|123969016|ref|YP_001009874.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. AS9601] >gi|166201335|sp|A2BSK6.1|RS16_PROMS 30S ribosomal protein S16 >gi|123199126|gb|ABM70767.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. AS9601] (121 aa)
Score = 134, Expect = 6.4e-07, Identities = 28/74 (37%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PTD VR+L  + GL +K
  S:     8 RFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKE--TRLDTEALRTRLTQGAQPTDVVRTLLEKGGLLEK 79
>gi|17986511|ref|NP_539145.1| 30S ribosomal protein S16 [Brucella melitensis 16M] >gi|23502677|ref|NP_698804.1| 30S ribosomal protein S16 [Brucella suis 1330] >gi|148560221|ref|YP_001259661.1| 30S ribosomal protein S16 [Brucella ovis ATCC 25840] >gi|161619744|ref|YP_001593631.1| 30S ribosomal protein S16 [Brucella canis ATCC 23365] >gi|166234398|sp|A5VSG4.1|RS16_BRUO2 30S ribosomal protein S16 >gi|189044368|sp|A9M862.1|RS16_BRUC2 30S ribosomal protein S16 >gi|54039398|sp|P66434|RS16_BRUSU 30S ribosomal protein S16 >gi|54042135|sp|P66433|RS16_BRUME 30S ribosomal protein S16 >gi|17982114|gb|AAL51409.1| SSU ribosomal protein S16P [Brucella melitensis 16M] >gi|23348688|gb|AAN30719.1| ribosomal protein S16 [Brucella suis 1330] >gi|148371478|gb|ABQ61457.1| 30S ribosomal protein S16 [Brucella ovis ATCC 25840] >gi|161336555|gb|ABX62860.1| ribosomal protein S16 [Brucella canis ATCC 23365] (134 aa)
Score = 134, Expect = 6.4e-07, Identities = 27/74 (36%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +V  D R  RDG++I  +G  NP L ++  + K+D      W+ +GA+PTD V     Q G+ K+
  S:     9 RAGSKKRPYYHVVVADVRAPRDGRFIETVGSWNPVLPKDAERVKLDAERIQHWIAQGAQPTDRVLRFLDQAGIAKR 84
>gi|92119039|ref|YP_578768.1| 30S ribosomal protein S16 [Nitrobacter hamburgensis X14] >gi|123083532|sp|Q1QHI9.1|RS16_NITHX 30S ribosomal protein S16 >gi|91801933|gb|ABE64308.1| SSU ribosomal protein S16P [Nitrobacter hamburgensis X14] (110 aa)
Score = 134, Expect = 6.6e-07, Identities = 30/74 (40%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +V  DSR  RDG++I  +G+ NP + K+N  + KID      WL KGA+P+D V       G+ K+
  S:     9 RAGTKKRPVYHVVVADSRYPRDGRFIERLGYFNPLMPKDNADRLKIDLDKVKAWLAKGAQPSDRVARFLDAAGVKKR 85
>gi|124026410|ref|YP_001015525.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. NATL1A] >gi|166201332|sp|A2C451.1|RS16_PROM1 30S ribosomal protein S16 >gi|123961478|gb|ABM76261.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. NATL1A] (110 aa)
Score = 134, Expect = 6.6e-07, Identities = 28/76 (36%), Positives = 44/76 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PTD VR+L  + GL +K V
  S:     8 RFGKKRETSFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEALRTRLGQGAQPTDAVRTLLEKGGLLEKKV 81
>gi|94502309|ref|ZP_01308786.1| 30S ribosomal protein S16 [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|161833804|ref|YP_001598000.1| 30S ribosomal subunit protein S16 [Candidatus Sulcia muelleri GWSS] >gi|189029623|sp|A8Z653.1|RS16_SULMW 30S ribosomal protein S16 >gi|94451136|gb|EAT14084.1| 30S ribosomal protein S16 [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|152206294|gb|ABS30604.1| 30S ribosomal subunit protein S16 [Candidatus Sulcia muelleri GWSS] (112 aa)
Score = 134, Expect = 6.9e-07, Identities = 30/74 (40%), Positives = 41/74 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R GR     Y IV  +SR  R+GK++  IG  NP        I+   A+ WL KGA+PT TV+S F + G++ K
  S:     9 RKGRKKKAFYTIVVSNSRSPRNGKFLEKIGFYNPNTNPYTISINVDKAVNWLIKGAQPTCTVKSFFLKEGIYYK 82
>gi|72382691|ref|YP_292046.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. NATL2A] >gi|109894783|sp|Q46JI5|RS16_PROMT 30S ribosomal protein S16 >gi|72002541|gb|AAZ58343.1| SSU ribosomal protein S16P [Prochlorococcus marinus str. NATL2A] (110 aa)
Score = 134, Expect = 7.0e-07, Identities = 28/76 (36%), Positives = 44/76 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PTD VR+L  + GL +K V
  S:     8 RFGKKRETSFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEALRTRLGQGAQPTDAVRTLLEKGGLLEKKV 81
>gi|88606858|ref|YP_504687.1| 30S ribosomal protein S16 [Anaplasma phagocytophilum HZ] >gi|109893861|sp|Q2GLR4|RS16_ANAPZ 30S ribosomal protein S16 >gi|88597921|gb|ABD43391.1| ribosomal protein S16 [Anaplasma phagocytophilum HZ] (96 aa)
Score = 134, Expect = 7.2e-07, Identities = 36/87 (41%), Positives = 48/87 (55%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENK---CKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPVAKS 87
           MR+G    P YRIV  DSRV+RDGK I  IG  NP ++       K++      WL  GA+PTD V S F + G    F+E++    A +
  S:     8 MRLGAKKKPFYRIVVADSRVQRDGKCIEQIGFYNPMVECGAPGFLKVNAERLGYWLGVGAQPTDRV-SWFIKKG----FIEAQSGSAAST 92
>gi|121601853|ref|YP_988407.1| 30S ribosomal protein S16 [Bartonella bacilliformis KC583] >gi|166234394|sp|A1UR04.1|RS16_BARBK 30S ribosomal protein S16 >gi|120614030|gb|ABM44631.1| ribosomal protein S16 [Bartonella bacilliformis KC583] (120 aa)
Score = 134, Expect = 7.5e-07, Identities = 29/74 (39%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENK--CKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y IV  D+R  RDG+++  +G  +P L ++K   K++E     WLN+GA+PTD V       GL K+
  S:     9 RGGSKKRPYYHIVVADARSPRDGRFLERVGAWDPMLPKDKPRVKLNEDRIQHWLNQGAQPTDRVLRFLDAAGLKKR 84
>gi|51598949|ref|YP_073137.1| 30S ribosomal protein S16 [Borrelia garinii PBi] >gi|81609808|sp|Q660H6|RS16_BORGA 30S ribosomal protein S16 >gi|51573520|gb|AAU07545.1| ribosomal protein S16 [Borrelia garinii PBi] (86 aa)
Score = 134, Expect = 7.5e-07, Identities = 30/77 (38%), Positives = 45/77 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV ++S   RDG+ I  +G+ +P  K+ + KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRIVVMNSASPRDGRAIEELGYYHPVEKQKQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|163722574|ref|ZP_02130112.1| ribosomal protein S16 [Desulfatibacillum alkenivorans AK-01] >gi|161404328|gb|EDQ28558.1| ribosomal protein S16 [Desulfatibacillum alkenivorans AK-01] (87 aa)
Score = 134, Expect = 7.7e-07, Identities = 25/74 (33%), Positives = 38/74 (51%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  DS   RDG++I ++G  NP  +  +  + +     W+  GA PT TVR++    G + +
  S:     9 RHGAKKRPFYRIVVTDSESPRDGRFIEIVGTYNPVAEPAQIDLKDERIKHWMESGALPTHTVRNILKNQGFFSE 82
>gi|158337221|ref|YP_001518396.1| 30S ribosomal protein S16 [Acaryochloris marina MBIC11017] >gi|189044364|sp|B0CAL3.1|RS16_ACAM1 30S ribosomal protein S16 >gi|158307462|gb|ABW29079.1| 30S ribosomal protein S16 [Acaryochloris marina MBIC11017] (84 aa)
Score = 134, Expect = 7.9e-07, Identities = 29/73 (39%), Positives = 46/73 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           R G+    +YRIVA++SR +RDG+ +  +G+ NP   E +  +D A+A + L  GA+PTDTVR +  +  L +
  S:     8 RYGKKRAASYRIVAMNSRDRRDGRPLEELGYYNPITDETRLHVD-AIA-KRLKDGAQPTDTVRRILEKASLLE 78
>gi|150398291|ref|YP_001328758.1| 30S ribosomal protein S16 [Sinorhizobium medicae WSM419] >gi|166201637|sp|A6UE43.1|RS16_SINMW 30S ribosomal protein S16 >gi|150029806|gb|ABR61923.1| ribosomal protein S16 [Sinorhizobium medicae WSM419] (124 aa)
Score = 134, Expect = 8.0e-07, Identities = 28/78 (35%), Positives = 43/78 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R G    P Y+IV  D+R  RDG+++  +G  NP L    E + +++      W+++GA+PTD V     Q GL K+   S
  S:     9 RGGSKKRPYYQIVVADARSPRDGRFLEKLGSWNPMLAKDDEKRIELNAERVQHWIDQGAQPTDRVLRFLDQAGLAKRPARS 89
>gi|182680252|ref|YP_001834398.1| ribosomal protein S16 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182636135|gb|ACB96909.1| ribosomal protein S16 [Beijerinckia indica subsp. indica ATCC 9039] (120 aa)
Score = 134, Expect = 8.1e-07, Identities = 33/82 (40%), Positives = 45/82 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN---KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKP 83
           R G    P YRIV  D+R  RDG++I  IG  +P   +N   +  +D   A +WL KGA+PTD V  L     + K+  ES+  P
  S:     9 RGGAKKRPFYRIVVADARAPRDGRFIERIGTFDPLKAKNAPDRIVLDAEKAKDWLAKGAQPTDRVARLLDGLEIIKR--ESRNNP 91
>gi|196178299|gb|EDX73299.1| ribosomal protein S16 [Microcoleus chthonoplastes PCC 7420] (83 aa)
Score = 133, Expect = 8.2e-07, Identities = 25/74 (33%), Positives = 45/74 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G+    +YRIVA++S  +RDG+ +  +G  NP  + ++  ++     +WL  GA+PTDTVRS+  +  + ++
  S:     8 RFGKKREVSYRIVAIESSTRRDGRPLEELGFYNP--RTDQTTLNAPAIAKWLKNGAQPTDTVRSILKKANVLEQ 79
>gi|157413846|ref|YP_001484712.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9215] >gi|167011170|sp|A8G695.1|RS16_PROM2 30S ribosomal protein S16 >gi|157388421|gb|ABV51126.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9215] (121 aa)
Score = 133, Expect = 8.2e-07, Identities = 28/75 (37%), Positives = 43/75 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PTD VR+L  + GL +K 
  S:     8 RFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKE--TRLDTEALRTRLTQGAQPTDVVRTLLEKGGLLEKI 80
>gi|87301100|ref|ZP_01083941.1| 30S ribosomal protein S16 [Synechococcus sp. WH 5701] >gi|87284068|gb|EAQ76021.1| 30S ribosomal protein S16 [Synechococcus sp. WH 5701] (134 aa)
Score = 133, Expect = 8.4e-07, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG  +  +G  NP  KE   ++D       L++GA+PTDTVRSL  + GL +K +
  S:     8 RFGKKREASFRLVATNSTSRRDGLPLEELGFYNPRTKE--TRLDAEAIRVRLSQGAQPTDTVRSLLEKGGLIEKTI 81
>gi|195947704|ref|ZP_03088890.1| 30S ribosomal protein S16 [Borrelia garinii PBr] (86 aa)
Score = 133, Expect = 8.6e-07, Identities = 30/77 (38%), Positives = 45/77 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV ++S   RDG+ I  +G+ +P  K+ + KI E    +W++KGA  +DTV+ L ++  L  K  E
  S:     9 RMGAKKRPYYRIVVMNSASPRDGRAIEELGYYHPVEKQKQIKIKEDRIKDWISKGAILSDTVKMLLNKNNLNAKSQE 85
>gi|119510258|ref|ZP_01629395.1| 30S ribosomal protein S16 [Nodularia spumigena CCY9414] >gi|119465107|gb|EAW46007.1| 30S ribosomal protein S16 [Nodularia spumigena CCY9414] (86 aa)
Score = 133, Expect = 9.0e-07, Identities = 25/74 (33%), Positives = 47/74 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G+   P+YRI+A++S  +RDG+ +  +G  NP   E   ++D    ++ L +GA+PT+TVRS+  +  ++++
  S:     8 RFGKKREPSYRIIAINSLARRDGRPLEELGFYNPITDE--VRLDVPGIVKRLQQGAQPTETVRSILVKANVFEQ 79
>gi|148555569|ref|YP_001263151.1| 30S ribosomal protein S16 [Sphingomonas wittichii RW1] >gi|166201638|sp|A5V9P7.1|RS16_SPHWW 30S ribosomal protein S16 >gi|148500759|gb|ABQ69013.1| SSU ribosomal protein S16P [Sphingomonas wittichii RW1] (154 aa)
Score = 133, Expect = 9.3e-07, Identities = 32/81 (39%), Positives = 42/81 (51%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R G    P YRIV  D+R  RDG +I  IG  NP L ++  K   +D   A  WL+ GA+PTD V       G+ ++   S  K
  S:     9 RGGAKKRPYYRIVVADARSPRDGAFIEKIGAYNPLLAKDDPKRVVLDTDRAKHWLSVGAQPTDRVARFLDAAGVQERAARSNPK 92
>gi|114571435|ref|YP_758115.1| SSU ribosomal protein S16P [Maricaulis maris MCS10] >gi|122315004|sp|Q0AKL6.1|RS16_MARMM 30S ribosomal protein S16 >gi|114341897|gb|ABI67177.1| SSU ribosomal protein S16P [Maricaulis maris MCS10] (152 aa)
Score = 133, Expect = 9.3e-07, Identities = 30/68 (44%), Positives = 38/68 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           R G    P YRIV  DSR  RDG++I  IG  NP L ++  + ++D      W+ KGAKPTD V     Q
  S:     9 RGGAKKRPYYRIVVADSRSPRDGRFIEKIGSYNPMLPKDGQRVELDMEKVKAWIAKGAKPTDRVGRFIHQ 78
>gi|33861841|ref|NP_893402.1| 30S ribosomal protein S16 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|50403611|sp|Q7TU65|RS16_PROMP 30S ribosomal protein S16 >gi|33640209|emb|CAE19744.1| 30S Ribosomal protein S16 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (114 aa)
Score = 133, Expect = 9.4e-07, Identities = 29/76 (38%), Positives = 44/76 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PTD VR+L  + GL +K V
  S:     8 RFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEALRIRLTQGAQPTDVVRTLLEKGGLLEKKV 81
>gi|170784724|ref|YP_001718640.1| ribosomal protein S16 [Trachelium caeruleum] >gi|156598877|gb|ABU85691.1| ribosomal protein S16 [Trachelium caeruleum] >gi|157267472|gb|ABV26465.1| ribosomal protein S16 [Trachelium caeruleum] (97 aa)
Score = 133, Expect = 9.7e-07, Identities = 26/78 (33%), Positives = 48/78 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R GR  + TYRIVA+D R +R+G+ +  +G  +P    N+  ++    + +L +GA+PT+TVR +  ++   +K +E+
  S:     8 RCGRKQHATYRIVAIDVRSRREGRALRKVGFYDPI--NNQTYLNAPAIVYFLERGAQPTETVRDILKKSETVQKHLEA 83
>gi|123966679|ref|YP_001011760.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9515] >gi|166201334|sp|A2BXZ2.1|RS16_PROM5 30S ribosomal protein S16 >gi|123201045|gb|ABM72653.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9515] (114 aa)
Score = 133, Expect = 9.7e-07, Identities = 29/76 (38%), Positives = 44/76 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PTD VR+L  + GL +K V
  S:     8 RFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKE--TRLDTEALRIRLTQGAQPTDVVRTLLEKGGLLEKKV 81
>gi|188997082|ref|YP_001931333.1| ribosomal protein S16 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932149|gb|ACD66779.1| ribosomal protein S16 [Sulfurihydrogenibium sp. YO3AOP1] (80 aa)
Score = 133, Expect = 1.0e-06, Identities = 27/71 (38%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR  +P YR++ VDS+  R+ K I  IG  +P LK     + +  A+EW+NKGA+P++    +    GL
  S:     8 RAGRKKHPVYRMIVVDSKKPRETKAIEYIGTYDPILKTGNINVKK--AMEWINKGAQPSERALKILKAFGL 76
>gi|149915432|ref|ZP_01903959.1| 30S ribosomal protein S16 [Roseobacter sp. AzwK-3b] >gi|149810721|gb|EDM70562.1| 30S ribosomal protein S16 [Roseobacter sp. AzwK-3b] (142 aa)
Score = 133, Expect = 1.0e-06, Identities = 34/87 (39%), Positives = 49/87 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES---KKKPVAKSK 88
           R G    P Y IVA DSR+ RDG++I  +G  NP L    E + K+       WL++GA+P+D V  +    G+  K   +   K +P AK+K
  S:     9 RGGSKKRPHYSIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMKMERVQYWLDQGAQPSDRVSRMLEAAGVLAKKDRANLKKGEPGAKAK 101
>gi|195952675|ref|YP_002120965.1| ribosomal protein S16 [Hydrogenobaculum sp. Y04AAS1] >gi|195932287|gb|ACG56987.1| ribosomal protein S16 [Hydrogenobaculum sp. Y04AAS1] (78 aa)
Score = 132, Expect = 1.1e-06, Identities = 25/69 (36%), Positives = 42/69 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R GR H P YRIVA+DS+  R+G Y+ ++G  +P    N   +++    +W+ KGA+ +D V+++  Q 
  S:     3 RFGRTHNPIYRIVAMDSKSPREGHYLDILGTYDPK-SGNVINLNKEAIDQWIRKGAQLSDRVKAILKQA 70
>gi|145352776|ref|XP_001420713.1| Putative mitochondrial ribosomal protein S16 [Ostreococcus lucimarinus CCE9901] >gi|144580948|gb|ABO99006.1| Putative mitochondrial ribosomal protein S16 [Ostreococcus lucimarinus CCE9901] (102 aa)
Score = 132, Expect = 1.1e-06, Identities = 28/71 (39%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE----WLNKGAKPTDTVRSLFSQTGL 72
           R+G  + P YR+   DSR  RDGK+I ++GH +P  + +  K    + +E    WL+ GA+P++TV  L  Q G+
  S:     9 RVGARNAPRYRVFVADSRAPRDGKHIEIVGHYDPIAQRDGHK-HVGLNIERIKYWLSVGAQPSETVARLLGQAGV 82
>gi|163845402|ref|YP_001623057.1| 30S ribosomal protein S16 [Brucella suis ATCC 23445] >gi|189044369|sp|A9WWU9.1|RS16_BRUSI 30S ribosomal protein S16 >gi|163676125|gb|ABY40235.1| ribosomal protein S16 [Brucella suis ATCC 23445] (134 aa)
Score = 132, Expect = 1.1e-06, Identities = 27/74 (36%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y +V  D R  RDG++I  +G  NP L ++  + K+D      W+ +GA+PTD V     Q G+ K+
  S:     9 RAGSKKRPYYHVVVADVRAPRDGRFIETVGSWNPVLLKDAERVKLDAERIQHWIAQGAQPTDRVLRFLDQAGIAKR 84
>gi|56416411|ref|YP_153485.1| 30S ribosomal protein S16 [Anaplasma marginale str. St. Maries] >gi|81599208|sp|Q5PBU9|RS16_ANAMM 30S ribosomal protein S16 >gi|56387643|gb|AAV86230.1| 30S ribosomal protein S16 [Anaplasma marginale str. St. Maries] (89 aa)
Score = 132, Expect = 1.1e-06, Identities = 32/72 (44%), Positives = 42/72 (58%)
  Q:     1 MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           MR+G    P YR+V  DSRV+RDGK+I  +G  +P +   +    KID      WL  GA+PTD V S F + G 
  S:     8 MRLGAKKKPFYRVVVSDSRVQRDGKFIEHVGFYDPMVPCGEPGFLKIDAERLSYWLGVGAQPTDRV-SWFIKKGF 81
>gi|124112115|ref|YP_001019114.1| ribosomal protein S16 [Chlorokybus atmophyticus] >gi|124012223|gb|ABM87967.1| ribosomal protein S16 [Chlorokybus atmophyticus] (85 aa)
Score = 132, Expect = 1.1e-06, Identities = 24/78 (30%), Positives = 47/78 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R GR   P YR++A+DS+ +RDG+ I  +G  +P    +K ++D    + +L +GA+PT+TV  +  +  ++ +  ++
  S:     8 RYGRKQKPVYRVIAIDSKARRDGRAIKELGFYDPI--ADKTQLDVPTIIFYLKRGAQPTETVGHILQKAKVFDQVSQA 83
>gi|58616851|ref|YP_196050.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Gardel] >gi|75432652|sp|Q5FFA8|RS16_EHRRG 30S ribosomal protein S16 >gi|58416463|emb|CAI27576.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Gardel] (87 aa)
Score = 132, Expect = 1.1e-06, Identities = 35/71 (49%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN----KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P YR+V  DSRV RDG++I L+G  NP L KE+    K KID      WL+ GA+PT+ + S F + GL
  S:     9 RFGAKKRPFYRVVVADSRVARDGRFIELLGFYNPMLPKEHPSFLKVKIDRLKY--WLSVGAQPTERI-SWFIKKGL 81
>gi|196477002|gb|ACG76530.1| ribosomal protein S16 [Phenylobacterium zucineum HLK1] (178 aa)
Score = 132, Expect = 1.1e-06, Identities = 30/71 (42%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKE---NKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y IV  DS   RDG++I  +G  NP LK+   N+  + +    EWL KGA+PTD V    S+ G+
  S:     8 RGGAKKRPYYSIVIADSHSPRDGRFIEKVGSYNPLLKKDDPNRIVVKQERIQEWLGKGAQPTDRVARELSKLGI 81
>gi|116617090|ref|YP_817464.1| ribosomal protein S16 [Coffea arabica] >gi|122153603|sp|A0A317|RR16_COFAR Chloroplast 30S ribosomal protein S16 >gi|116242146|gb|ABJ89661.1| ribosomal protein S16 [Coffea arabica] (88 aa)
Score = 132, Expect = 1.1e-06, Identities = 26/75 (34%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR     +RIVA+D R +R+GK +  +G  +P   +N+  ++    L +L +GA+PT TV+ +F + G++K+ 
  S:     8 RCGRKQRAVFRIVAIDVRSRREGKDLQKVGFYDPI--KNQTYLNVTAILYFLEQGAQPTGTVQDIFKKAGVFKEL 80
>gi|177675456|ref|ZP_02945935.1| ribosomal protein S16 [Methylocella silvestris BL2] >gi|172069682|gb|EDT55790.1| ribosomal protein S16 [Methylocella silvestris BL2] (122 aa)
Score = 132, Expect = 1.1e-06, Identities = 29/78 (37%), Positives = 44/78 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVES 79
           R G    P YR+V  DSR+ RDG++I  +G  +P   ++  +   +D   A EW+ KGA+PTD V  L    G+  +  +S
  S:     9 RGGAKKRPFYRVVVADSRMPRDGRFIERLGVFDPLKAKDSAERVVLDAEKAKEWIAKGAQPTDRVARLLDGLGVLTREAQS 89
>gi|170750015|ref|YP_001756275.1| ribosomal protein S16 [Methylobacterium radiotolerans JCM 2831] >gi|170656537|gb|ACB25592.1| ribosomal protein S16 [Methylobacterium radiotolerans JCM 2831] (120 aa)
Score = 132, Expect = 1.1e-06, Identities = 31/74 (41%), Positives = 41/74 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPA-LKENKCKI--DEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P YRIV  D+R  RDG++I  +G  +P   K++  +I  D      WL KGA+PTD V     Q GL K+
  S:     9 RGGAKKRPYYRIVVADARAPRDGRFIDKVGAYDPMKAKDDPARIVLDNEKIQSWLAKGAQPTDRVLRFLDQAGLAKR 85
>gi|163847610|ref|YP_001635654.1| ribosomal protein S16 [Chloroflexus aurantiacus J-10-fl] >gi|187599130|ref|ZP_02985364.1| ribosomal protein S16 [Chloroflexus sp. Y-400-fl] >gi|189044371|sp|A9WEK3.1|RS16_CHLAA 30S ribosomal protein S16 >gi|163668899|gb|ABY35265.1| ribosomal protein S16 [Chloroflexus aurantiacus J-10-fl] >gi|187488562|gb|EDU26529.1| ribosomal protein S16 [Chloroflexus sp. Y-400-fl] (89 aa)
Score = 132, Expect = 1.2e-06, Identities = 28/71 (39%), Positives = 38/71 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G+   P+YRIV  DSR  RDGK+I  IG+  P  +    +I    A  WL  GA+PT+ V  L  +  +
  S:     8 RTGKTKQPSYRIVVADSRSPRDGKFIETIGYYLPTRQPKVLEIKADRARYWLGVGAQPTEVVVKLLKRVNV 78
>gi|114799489|ref|YP_758772.1| ribosomal protein S16 [Hyphomonas neptunium ATCC 15444] >gi|123129271|sp|Q0C671.1|RS16_HYPNA 30S ribosomal protein S16 >gi|114739663|gb|ABI77788.1| ribosomal protein S16 [Hyphomonas neptunium ATCC 15444] (147 aa)
Score = 132, Expect = 1.2e-06, Identities = 28/68 (41%), Positives = 40/68 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKE---NKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           R G    P Y IV  D+R  RDG++I  IG  +P L +   ++ K++   A EW+ KGA+PTD V    S+
  S:     9 RGGSKKRPFYSIVVADARAPRDGRFIEKIGTYDPRLAKDSGDRVKVNAEKAAEWIKKGAQPTDRVARFLSK 79
>gi|69933276|ref|ZP_00628478.1| Ribosomal protein S16 [Paracoccus denitrificans PD1222] >gi|119386588|ref|YP_917643.1| 30S ribosomal protein S16 [Paracoccus denitrificans PD1222] >gi|166201328|sp|A1B8V3.1|RS16_PARDP 30S ribosomal protein S16 >gi|119377183|gb|ABL71947.1| SSU ribosomal protein S16P [Paracoccus denitrificans PD1222] (124 aa)
Score = 132, Expect = 1.2e-06, Identities = 30/74 (40%), Positives = 42/74 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y IVA DSR+ RDG++I  +G  NP L    E++ K++      WL +GA+PTD V       G+ +K
  S:     9 RGGSKKRPHYAIVASDSRMPRDGRFIEKLGTYNPLLPKDSEDRIKMNLERVQYWLGQGAQPTDRVARFLEAAGVKEK 85
>gi|87125497|ref|ZP_01081342.1| 30S ribosomal protein S16 [Synechococcus sp. RS9917] >gi|86166797|gb|EAQ68059.1| 30S ribosomal protein S16 [Synechococcus sp. RS9917] (138 aa)
Score = 132, Expect = 1.3e-06, Identities = 30/83 (36%), Positives = 48/83 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPV 84
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D       L++GA+PTD VRSL  + GL    +E+K +P 
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDTEGLRARLSQGAQPTDAVRSLLEKGGL----IEAKVRPA 84
>gi|78779765|ref|YP_397877.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9312] >gi|109894782|sp|Q319K4|RS16_PROM9 30S ribosomal protein S16 >gi|78713264|gb|ABB50441.1| SSU ribosomal protein S16P [Prochlorococcus marinus str. MIT 9312] (121 aa)
Score = 131, Expect = 1.6e-06, Identities = 29/74 (39%), Positives = 45/74 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE +    EA+ +  L +GA+PTD VR+L  + GL +K
  S:     8 RFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKETRLNT-EALRI-RLTQGAQPTDVVRNLLEKGGLLEK 79
>gi|16127882|ref|NP_422446.1| ribosomal protein S16 [Caulobacter crescentus CB15] >gi|14195192|sp|P58122|RS16_CAUCR 30S ribosomal protein S16 >gi|13425408|gb|AAK25614.1| ribosomal protein S16 [Caulobacter crescentus CB15] (165 aa)
Score = 131, Expect = 1.7e-06, Identities = 30/71 (42%), Positives = 38/71 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKE---NKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y IV  DS   RDG++I  +G  NP LK+   N+  +      EWL KGA+PTD V    +  GL
  S:     8 RGGAKKRPYYSIVVADSHSPRDGRFIEKVGTYNPLLKKDDANRVTLKVESIQEWLKKGAQPTDRVARFLAAQGL 81
>gi|57238863|ref|YP_179999.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] >gi|58578792|ref|YP_197004.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] >gi|81557354|sp|Q5HC44|RS16_EHRRW 30S ribosomal protein S16 >gi|57160942|emb|CAH57848.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] >gi|58417418|emb|CAI26622.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] (87 aa)
Score = 131, Expect = 1.7e-06, Identities = 34/71 (47%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL-KEN----KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P YR+V  DSRV RDG++I L+G  NP L KE+    K K+D      WL+ GA+PT+ + S F + GL
  S:     9 RFGAKKRPFYRVVVADSRVARDGRFIELLGFYNPMLPKEHPSFLKVKVDRLK--YWLSVGAQPTERI-SWFIKKGL 81
>gi|87199426|ref|YP_496683.1| 30S ribosomal protein S16 [Novosphingobium aromaticivorans DSM 12444] >gi|109894778|sp|Q2G8H4|RS16_NOVAD 30S ribosomal protein S16 >gi|87135107|gb|ABD25849.1| SSU ribosomal protein S16P [Novosphingobium aromaticivorans DSM 12444] (145 aa)
Score = 131, Expect = 1.8e-06, Identities = 28/71 (39%), Positives = 40/71 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y+IV  +SR  RDGKY+  +G  NP L    EN+ ++ E     W+  GA+PTD V  +  + G+
  S:     9 RGGSKKRPYYKIVVSNSRAPRDGKYLEQVGTYNPLLAKDDENRVRLIEDRVRYWIGVGAQPTDRVARMLDKAGI 82
>gi|91787572|ref|YP_548524.1| SSU ribosomal protein S16P [Polaromonas sp. JS666] >gi|122967981|sp|Q12CW6.1|RS16_POLSJ 30S ribosomal protein S16 >gi|91696797|gb|ABE43626.1| SSU ribosomal protein S16P [Polaromonas sp. JS666] (83 aa)
Score = 130, Expect = 1.9e-06, Identities = 29/68 (42%), Positives = 37/68 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           R G  H P + IV  D RV+RDG++I  IG  NP  K  E   +I +     WL  GA+P+ TV  L  Q
  S:     8 RGGSKHRPFFNIVVADKRVRRDGRFIERIGFYNPIAKGGEEGLRIAQDRLTHWLGVGAQPSPTVERLVKQ 77
>gi|77165723|ref|YP_344248.1| ribosomal protein S16 [Nitrosococcus oceani ATCC 19707] >gi|109894776|sp|Q3J8X8|RS16_NITOC 30S ribosomal protein S16 >gi|76884037|gb|ABA58718.1| SSU ribosomal protein S16P [Nitrosococcus oceani ATCC 19707] (80 aa)
Score = 130, Expect = 1.9e-06, Identities = 28/59 (47%), Positives = 36/59 (61%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNP--ALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           P Y IV  D R KRDG+YI  +G  NP  A  E   +ID   A  WL++GA+P++ V  LF
  S:    15 PFYSIVVADKRSKRDGRYIEQLGFFNPIAAGGEVPLRIDMERANYWLSQGAQPSERVAQLF 75
>gi|84702191|ref|ZP_01016766.1| probable 30s ribosomal protein s16 [Parvularcula bermudensis HTCC2503] >gi|84691437|gb|EAQ17277.1| probable 30s ribosomal protein s16 [Parvularcula bermudensis HTCC2503] (139 aa)
Score = 130, Expect = 1.9e-06, Identities = 31/73 (42%), Positives = 40/73 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           R G    P Y IV  D+R+ RDG++I  IG  NP L    E + ++D   A  WL KGA+PT+ V    S   L K
  S:     9 RGGAKKRPYYFIVVADARMPRDGRFIEKIGAYNPLLAKDNEMRVQVDAERAQYWLEKGAQPTERVARFLSALDLVK 84
>gi|15966995|ref|NP_387348.1| 30S ribosomal protein S16 [Sinorhizobium meliloti 1021] >gi|20140123|sp|Q92L43|RS16_RHIME 30S ribosomal protein S16 >gi|15076268|emb|CAC47821.1| Probable 30S ribosomal protein S16 [Sinorhizobium meliloti 1021] (124 aa)
Score = 130, Expect = 2.0e-06, Identities = 27/74 (36%), Positives = 41/74 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y+IV  D+R  RDG+++  +G  NP L    E + +++      W+ +GA+PTD V     Q GL K+
  S:     9 RGGSKKRPYYQIVVADARSPRDGRFLEKLGSWNPMLAKDDEKRIELNAERVQHWIAQGAQPTDRVMRFLDQAGLAKR 85
>gi|84515966|ref|ZP_01003327.1| ribosomal protein S16 [Loktanella vestfoldensis SKA53] >gi|84510408|gb|EAQ06864.1| ribosomal protein S16 [Loktanella vestfoldensis SKA53] (126 aa)
Score = 130, Expect = 2.0e-06, Identities = 29/74 (39%), Positives = 41/74 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y IVA DSR+ RDG++I  +G   P L    E++ ++D      WL +GA+PTD V  +    G+  K
  S:     7 RGGSKKRPHYAIVAADSRMPRDGRFIEKLGTYAPMLPKDSEDRVRMDMDRIQYWLGQGAQPTDRVARMLEAAGVMPK 83
>gi|126734923|ref|ZP_01750669.1| ribosomal protein S16 [Roseobacter sp. CCS2] >gi|126715478|gb|EBA12343.1| ribosomal protein S16 [Roseobacter sp. CCS2] (133 aa)
Score = 130, Expect = 2.1e-06, Identities = 28/70 (40%), Positives = 39/70 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTG 71
           R G    P Y IVA DSR+ RDG++I  +G  NP L    E + K++      WL +GA+PTD +  +    G
  S:     7 RGGSKKRPFYAIVAADSRMPRDGRFIEKLGTYNPMLPKDSEERVKMNMERIKYWLGEGAQPTDRISRMLEAAG 79
>gi|156598077|gb|ABU85304.1| ribosomal protein S16 [Cycas micronesica] (84 aa)
Score = 130, Expect = 2.1e-06, Identities = 26/75 (34%), Positives = 43/75 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR    TYRIVA++   +R+GK +  +G  +P   +    +     L +L KGA+PT+TV  +  + G+++KF
  S:     8 RCGRKQLATYRIVAINVESRREGKALQEVGFYDPMKDQTYSNV--PAILHFLEKGAQPTETVHDISEKAGIFQKF 80
>gi|16331102|ref|NP_441830.1| 30S ribosomal protein S16 [Synechocystis sp. PCC 6803] >gi|2500468|sp|P74410|RS16_SYNY3 30S ribosomal protein S16 >gi|1653595|dbj|BAA18508.1| 30S ribosomal protein S16 [Synechocystis sp. PCC 6803] (82 aa)
Score = 130, Expect = 2.2e-06, Identities = 25/75 (33%), Positives = 48/75 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R G+    +YRIVA+ S  +RDG+ +  +G  NP  + ++ ++D    ++ L +GA+PTDTVRS+ ++  ++++ 
  S:     8 RFGKKREVSYRIVAMHSTTRRDGRPLEELGFYNP--RTDETRLDVPAIVKRLKEGAQPTDTVRSILTKAQVFEQL 80
>gi|57240407|ref|ZP_00368356.1| ribosomal protein S16 [Campylobacter lari RM2100] >gi|57018748|gb|EAL55521.1| ribosomal protein S16 [Campylobacter lari RM2100] (75 aa)
Score = 129, Expect = 2.4e-06, Identities = 28/68 (41%), Positives = 39/68 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           +MGR   P YRIV  DSR +RDG +I  IG+ NP ++    K D      W + GAK +D V ++ S+
  S:     8 KMGRKKRPFYRIVVTDSRKRRDGSWIESIGYYNPMVEPEVVKFDAERLAYWKSVGAKLSDRVAAITSK 75
>gi|28198018|ref|NP_778332.1| 30S ribosomal protein S16 [Xylella fastidiosa Temecula1] >gi|71899240|ref|ZP_00681402.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|182680644|ref|YP_001828804.1| ribosomal protein S16 [Xylella fastidiosa M23] >gi|31076886|sp|Q87F56|RS16_XYLFT 30S ribosomal protein S16 >gi|28056078|gb|AAO27981.1| 30S ribosomal protein S16 [Xylella fastidiosa Temecula1] >gi|71730973|gb|EAO33042.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|182630754|gb|ACB91530.1| ribosomal protein S16 [Xylella fastidiosa M23] (86 aa)
Score = 129, Expect = 2.5e-06, Identities = 26/61 (42%), Positives = 38/61 (62%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           P Y+I+  DSR KRDG+ I  +GH NP  +  E++  ++ A    W+  GA+ TD VRSL  +
  S:    15 PFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNMARVEHWVRNGAQLTDKVRSLLKE 77
>gi|126696808|ref|YP_001091694.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9301] >gi|166201331|sp|A3PEB8.1|RS16_PROM0 30S ribosomal protein S16 >gi|126543851|gb|ABO18093.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9301] (121 aa)
Score = 129, Expect = 2.7e-06, Identities = 27/74 (36%), Positives = 43/74 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G+    ++RIVA +S  +RDG+ +  +G  NP  KE   ++D       L +GA+PT+ VR+L  + GL +K
  S:     8 RFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKE--TRLDTEALRTRLTQGAQPTNVVRTLLEKGGLLEK 79
>gi|42523590|ref|NP_968970.1| 30S ribosomal protein S16 [Bdellovibrio bacteriovorus HD100] >gi|54039374|sp|P62227|RS16_BDEBA 30S ribosomal protein S16 >gi|39575796|emb|CAE79963.1| 30S ribosomal protein S16 [Bdellovibrio bacteriovorus HD100] (82 aa)
Score = 129, Expect = 2.7e-06, Identities = 28/66 (42%), Positives = 40/66 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLF 67
           RMG  H P YR+   DSR    GK++ ++G   P+ K N  K ++D A   EW+ KGA+PTD V+ + 
  S:     9 RMGAKHEPKYRVTVADSRRYVTGKFLDILGTYIPSPKGNDKKIELDLAKVEEWIKKGAQPTDRVKHVI 76
>gi|15836712|ref|NP_297400.1| 30S ribosomal protein S16 [Xylella fastidiosa 9a5c] >gi|14195201|sp|Q9PH39|RS16_XYLFA 30S ribosomal protein S16 >gi|9104887|gb|AAF82920.1|AE003864_8 30S ribosomal protein S16 [Xylella fastidiosa 9a5c] (86 aa)
Score = 129, Expect = 2.7e-06, Identities = 26/61 (42%), Positives = 38/61 (62%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           P Y+I+  DSR KRDG+ I  +GH NP  +  E++  ++ A    W+  GA+ TD VRSL  +
  S:    15 PFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNMARVEHWVKNGAQLTDKVRSLLKE 77
>gi|15236166|ref|NP_195188.1| SSR16 (ribosomal protein S16); structural constituent of ribosome [Arabidopsis thaliana] >gi|15724282|gb|AAL06534.1|AF412081_1 AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|3096931|emb|CAA18841.1| putative ribosomal protein S16 [Arabidopsis thaliana] >gi|7270412|emb|CAB80179.1| putative ribosomal protein S16 [Arabidopsis thaliana] >gi|15010612|gb|AAK73965.1| AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|15081652|gb|AAK82481.1| AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|15529192|gb|AAK97690.1| AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|21592570|gb|AAM64519.1| putative ribosomal protein S16 [Arabidopsis thaliana] >gi|23505749|gb|AAN28734.1| At4g34620/T4L20_200 [Arabidopsis thaliana] (113 aa)
Score = 129, Expect = 2.9e-06, Identities = 29/71 (40%), Positives = 44/71 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE------WLNKGAKPTDTVRSLFSQTGL 72
           R+G  H P YR+V  D + +RDGK I ++G  +P   +      + V+L+      WL+ GA+PTDTV S+  + GL
  S:     9 RLGCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDA---DRVSLKFDRIKYWLSVGAQPTDTVESMLFRAGL 82
>gi|68053015|sp|Q589B0|RR16_SILLA Chloroplast 30S ribosomal protein S16 >gi|62149325|dbj|BAD93467.1| ribosomal protein S16 [Silene latifolia] (88 aa)
Score = 129, Expect = 2.9e-06, Identities = 25/75 (33%), Positives = 46/75 (61%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR     YRIVA+D R +R+G+ +  +G  +P   +N+  ++    L+++ KGA+PT+TV  +  +  ++K+F
  S:     8 RCGRKQRAVYRIVAIDVRSRREGRDLQKVGFYDPI--KNQTYLNVPAILDFIQKGAQPTETVYDILKRAEVFKEF 80
>gi|114320045|ref|YP_741728.1| SSU ribosomal protein S16P [Alkalilimnicola ehrlichei MLHE-1] >gi|114226439|gb|ABI56238.1| SSU ribosomal protein S16P [Alkalilimnicola ehrlichei MLHE-1] (117 aa)
Score = 129, Expect = 2.9e-06, Identities = 28/66 (42%), Positives = 37/66 (56%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP--ALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           R G    P Y IV  DSR  RDG++I  +G  NP  A KE   ++D   A  WL+KGA+P++    L 
  S:    37 RTGAKKRPFYHIVVTDSRNPRDGRFIERLGFFNPIAAGKEEPLRVDVERARHWLDKGARPSERAAQLL 104
>gi|187734783|ref|YP_001876895.1| ribosomal protein S16 [Akkermansia muciniphila ATCC BAA-835] >gi|187424835|gb|ACD04114.1| ribosomal protein S16 [Akkermansia muciniphila ATCC BAA-835] (80 aa)
Score = 129, Expect = 3.0e-06, Identities = 26/66 (39%), Positives = 38/66 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           R G    P Y+IV VDSR +RDG+YI  +G  +P  +     I+     +WL  GA+P++TV S+ 
  S:     9 RQGSKDRPYYKIVVVDSRARRDGRYIEQVGSYDPMKEGVNYTINLEKVDKWLANGAQPSETVNSMI 74
>gi|75755641|ref|YP_319747.1| ribosomal protein S16 [Acorus calamus] >gi|161622292|ref|YP_001586164.1| ribosomal protein S16 [Acorus americanus] >gi|74381691|emb|CAI53776.1| ribosomal protein S16 [Acorus calamus] >gi|156573655|gb|ABU85161.1| ribosomal protein S16 [Acorus americanus] >gi|160369835|gb|ABX38726.1| ribosomal protein S16 [Acorus americanus] (86 aa)
Score = 129, Expect = 3.1e-06, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R GR     YRIVA+D R +R+G+ +  +G  +P   +N+  ++  V L +L KGA+PT+TV  +  +  ++K+   ++ K
  S:     8 RCGRKQRAIYRIVAIDVRSRREGRDLCKVGFYDPI--KNQTYLNVPVILNFLEKGAQPTETVHDILKKAEVFKELQGNQTK 86
>gi|71275922|ref|ZP_00652205.1| Ribosomal protein S16 [Xylella fastidiosa Dixon] >gi|71900008|ref|ZP_00682153.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|170729324|ref|YP_001774757.1| 30S ribosomal protein S16 [Xylella fastidiosa M12] >gi|71163299|gb|EAO13018.1| Ribosomal protein S16 [Xylella fastidiosa Dixon] >gi|71730218|gb|EAO32304.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|167964117|gb|ACA11127.1| 30S ribosomal protein S16 [Xylella fastidiosa M12] (86 aa)
Score = 128, Expect = 3.1e-06, Identities = 26/61 (42%), Positives = 38/61 (62%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNPALK--ENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           P Y+I+  DSR KRDG+ I  +GH NP  +  E++  ++ A    W+  GA+ TD VRSL  +
  S:    15 PFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNVARVEHWVRNGAQLTDKVRSLLKE 77
>gi|113954183|ref|YP_729981.1| 30S ribosomal protein S16 [Synechococcus sp. CC9311] >gi|123132665|sp|Q0IC41.1|RS16_SYNS3 30S ribosomal protein S16 >gi|113881534|gb|ABI46492.1| ribosomal protein S16 [Synechococcus sp. CC9311] (128 aa)
Score = 128, Expect = 3.1e-06, Identities = 28/76 (36%), Positives = 44/76 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFV 77
           R G+    ++R+VA +S  +RDG+ +  +G  NP  KE   ++D       L++GA+PTD VR L  + GL +K V
  S:     8 RFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKET--RLDAEALRVRLSQGAQPTDAVRFLLEKGGLLEKTV 81
>gi|91762615|ref|ZP_01264580.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1002] >gi|91718417|gb|EAS85067.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1002] (134 aa)
Score = 128, Expect = 3.1e-06, Identities = 29/71 (40%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE------WLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y++V  DSR  RDG++I  +G  NP L ++K    E V LE      WL +GA+PT  V  +  + G+
  S:     8 RGGTKKRPVYKVVIADSRRARDGRFIEKVGFFNPLLPKDK---KERVGLEAERIKYWLGQGAQPTTRVARILGENGI 81
>gi|71082961|ref|YP_265680.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1062] >gi|109894781|sp|Q4FP12|RS16_PELUB 30S ribosomal protein S16 >gi|71062074|gb|AAZ21077.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1062] (177 aa)
Score = 128, Expect = 3.3e-06, Identities = 29/71 (40%), Positives = 41/71 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE------WLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y++V  DSR  RDG++I  +G  NP L ++K    E V LE      WL +GA+PT  V  +  + G+
  S:     8 RGGTKKRPVYKVVIADSRRARDGRFIEKVGFFNPLLPKDK---KERVGLEAERIKYWLGQGAQPTTRVARILGENGI 81
>gi|51209882|ref|YP_063546.1| 30S ribosomal protein S16 [Gracilaria tenuistipitata var. liui] >gi|68053127|sp|Q6B914|RR16_GRATL Chloroplast 30S ribosomal protein S16 >gi|50657636|gb|AAT79621.1| 30S ribosomal protein S16 [Gracilaria tenuistipitata var. liui] (78 aa)
Score = 128, Expect = 3.3e-06, Identities = 28/68 (41%), Positives = 40/68 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQ 69
           R GR   P+YRI+ +DSR  RDG+ I  IG  +P    NK KI+     + + +GA+PT  V+ + SQ
  S:     8 RFGRKRQPSYRIIVIDSRKPRDGRPIEEIGFYSPL--NNKSKINLIQVKKRIYQGAQPTKKVQQIISQ 73
>gi|118488915|gb|ABK96266.1| unknown [Populus trichocarpa x Populus deltoides] (110 aa)
Score = 128, Expect = 3.4e-06, Identities = 31/71 (43%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVAL--EWLNKGAKPTDTVRSLFSQTGL 72
           R+G  +   YRIVA DS   RDGK++ ++G  +P A K +  ++   V L   WL+ GA+PTDTVR +  + GL
  S:     9 RLGCKNRAFYRIVAADSHTPRDGKHLQVLGFYDPLAAKGDARRLGLNVDLVKYWLSVGAQPTDTVRGILMRAGL 82
>gi|111115527|ref|YP_710145.1| 30S ribosomal protein S16 [Borrelia afzelii PKo] >gi|123145645|sp|Q0SMF9.1|RS16_BORAP 30S ribosomal protein S16 >gi|110890801|gb|ABH01969.1| ribosomal protein S16 [Borrelia afzelii PKo] (86 aa)
Score = 128, Expect = 3.5e-06, Identities = 30/77 (38%), Positives = 44/77 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVE 78
           RMG    P YRIV ++S   RDG+ I  +G+ +   K+N+ KI E    +W++KGA  +DTV+ L  +  L  K  E
  S:     9 RMGAKKRPYYRIVVMNSTSPRDGRAIEELGYYHLIEKQNQLKIKEDRMKDWISKGAILSDTVKMLLKKNNLNAKSQE 85
>gi|145652228|gb|ABP88161.1| hypothetical protein [Borrelia lonestari] (75 aa)
Score = 128, Expect = 3.5e-06, Identities = 26/60 (43%), Positives = 36/60 (60%)
  Q:     3 MGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDT 62
           MG    P YRIV +DS   RDG+ I  +G+ +P   +N+ KI+E     W+ KGA P+DT
  S:     1 MGAKKRPYYRIVVMDSASPRDGRAIEELGYYHPIESQNQIKINEEKFNNWIGKGAIPSDT 60
>gi|190609949|dbj|BAG49075.1| 30S ribosomal protein S16 [Populus alba] (110 aa)
Score = 128, Expect = 3.7e-06, Identities = 31/71 (43%), Positives = 45/71 (63%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNP-ALKENKCKIDEAVAL--EWLNKGAKPTDTVRSLFSQTGL 72
           R+G  +   YRIVA DS   RDGK++ ++G  +P A K +  ++   V L   WL+ GA+PTDTVR +  + GL
  S:     9 RLGCKNRAFYRIVAADSHTPRDGKHLQVLGFYDPLAAKGDARRLGLNVDLVKYWLSVGAQPTDTVRGILMRAGL 82
>gi|190893806|ref|YP_001980348.1| 30S ribosomal protein S16 [Rhizobium etli CIAT 652] >gi|190699085|gb|ACE93170.1| 30S ribosomal protein S16 [Rhizobium etli CIAT 652] (123 aa)
Score = 128, Expect = 3.8e-06, Identities = 28/83 (33%), Positives = 46/83 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPV 84
           R G    P Y +V  D+R  RDG+++  +G  NP L    E + +++      WL+ GA+PTD V    ++ G+ K+  E+K  P+
  S:     9 RGGSKKRPYYHVVLADARSPRDGRFLENLGSWNPMLAKDDEKRVQLNAERIKHWLDNGAQPTDRVLRFLNEAGVAKR--EAKNNPI 92
>gi|161784172|ref|YP_001595490.1| ribosomal protein S16 [Lemna minor] >gi|88696750|gb|ABD48475.1| ribosomal protein S16 [Lemna minor] (78 aa)
Score = 128, Expect = 3.8e-06, Identities = 28/73 (38%), Positives = 43/73 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWK 74
           R GR     YRIVA+D R +R+G+ +  +G  +P   +NK   +    L++L KGA+PT TV  +F +  L+K
  S:     8 RCGRKQRAIYRIVAIDVRSRREGRDLRRVGFYDPI--KNKTYSNVPAILDFLEKGAQPTRTVHDIFKKAELFK 78
>gi|159484984|ref|XP_001700529.1| plastid ribosomal protein S16 [Chlamydomonas reinhardtii] >gi|158272169|gb|EDO97973.1| plastid ribosomal protein S16 [Chlamydomonas reinhardtii] (128 aa)
Score = 128, Expect = 3.8e-06, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLF 67
           R GR   P YR+VA+DS+ +RDG+ +  +G  +P  KE    ++     EWL KGA P++TV +L 
  S:    43 RFGRKKLPFYRLVAIDSKKRRDGEPLEYLGWYDPLKKE--TNLNAPAIKEWLAKGALPSETVENLL 106
>gi|86359539|ref|YP_471431.1| 30S ribosomal protein S16 [Rhizobium etli CFN 42] >gi|109894791|sp|Q2K382|RS16_RHIEC 30S ribosomal protein S16 >gi|86283641|gb|ABC92704.1| 30S ribosomal protein S16 [Rhizobium etli CFN 42] (122 aa)
Score = 128, Expect = 3.8e-06, Identities = 28/83 (33%), Positives = 46/83 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKKPV 84
           R G    P Y +V  D+R  RDG+++  +G  NP L    E + +++      WL+ GA+PTD V    ++ G+ K+  E+K  P+
  S:     9 RGGSKKRPYYHVVLADARSPRDGRFLENLGSWNPMLAKDDEKRVQLNAERIKHWLDNGAQPTDRVLRFLNEAGVAKR--EAKNNPI 92
>gi|28202162|ref|NP_777403.1| ribosomal protein S16 [Anthoceros formosae] >gi|41688687|sp|Q85CF2|RR16_ANTFO Chloroplast 30S ribosomal protein S16 >gi|27807864|dbj|BAC55339.1| ribosomal protein S16 [Anthoceros formosae] >gi|27807971|dbj|BAC55430.1| ribosomal protein S16 [Anthoceros formosae] (84 aa)
Score = 128, Expect = 4.0e-06, Identities = 23/75 (30%), Positives = 48/75 (64%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR    TYRIVA+D++ +R+G+ +  +G  N  L++++ ++D    +  + +GA+PT+TV  +  + G++++ 
  S:     8 RYGRKQQNTYRIVAIDAQSRREGRALEEVGFYN--LRKDQTQLDILAIVNLIREGAQPTETVYDILRKAGIFERI 80
>gi|78103234|ref|YP_358558.1| ribosomal protein S16 [Phalaenopsis aphrodite subsp. formosana] >gi|122245681|sp|Q3BAR0|RR16_PHAAO Chloroplast 30S ribosomal protein S16 >gi|58802764|gb|AAW82484.1| ribosomal protein S16 [Phalaenopsis aphrodite subsp. formosana] (94 aa)
Score = 127, Expect = 4.1e-06, Identities = 27/75 (36%), Positives = 44/75 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR     YRIVA+D R +R+G+ +  +G  +P   +N+   +    L +L KGA+PT+TV  +  +T  +K+F
  S:     8 RCGRKQRAIYRIVAIDVRSRREGRDLQKVGFYDPI--KNQTYSNVPAILYFLEKGAQPTETVYDILRKTEFFKEF 80
>gi|126643179|ref|YP_001086163.1| 30S ribosomal protein S16 [Acinetobacter baumannii ATCC 17978] >gi|169632272|ref|YP_001706008.1| 30S ribosomal protein S16 [Acinetobacter baumannii SDF] >gi|169794511|ref|YP_001712304.1| 30S ribosomal protein S16 [Acinetobacter baumannii AYE] >gi|184159681|ref|YP_001848020.1| 30S ribosomal protein S16 [Acinetobacter baumannii ACICU] >gi|166234382|sp|A3M9G7.1|RS16_ACIBT 30S ribosomal protein S16 >gi|169147438|emb|CAM85299.1| 30S ribosomal protein S16 [Acinetobacter baumannii] >gi|169151064|emb|CAO99720.1| 30S ribosomal protein S16 [Acinetobacter baumannii] >gi|183211275|gb|ACC58673.1| 30S ribosomal protein S16 [Acinetobacter baumannii ACICU] (83 aa)
Score = 127, Expect = 4.3e-06, Identities = 27/69 (39%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL--KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P Y+IV  DSR  RDG++I  IG  NP    +  K ++D      W+++GA+P++ V SL +Q 
  S:     8 RGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQGQAEKLRLDADRFAHWVSQGAQPSERVASLAAQA 78
>gi|114763700|ref|ZP_01443094.1| 30S ribosomal protein S16 [Roseovarius sp. HTCC2601] >gi|114543701|gb|EAU46714.1| 30S ribosomal protein S16 [Roseovarius sp. HTCC2601] (124 aa)
Score = 127, Expect = 4.4e-06, Identities = 29/74 (39%), Positives = 40/74 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK 75
           R G    P Y IVA DSR+ RDG+++  +G  NP L    E +  +D      WL +GA+PTD V       G+ +K
  S:     9 RGGSKKRPHYAIVASDSRMPRDGRFVEKLGTYNPLLAKDDERRVVMDLERVQYWLGQGAQPTDRVARFLESAGVAEK 85
>gi|37522207|ref|NP_925584.1| 30S ribosomal protein S16 [Gloeobacter violaceus PCC 7421] >gi|54039434|sp|Q7NH99|RS16_GLOVI 30S ribosomal protein S16 >gi|35213207|dbj|BAC90579.1| 30S ribosomal protein S16 [Gloeobacter violaceus PCC 7421] (89 aa)
Score = 127, Expect = 4.5e-06, Identities = 28/72 (38%), Positives = 40/72 (55%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENK----CKIDEAVALEWLNKGAKPTDTVRSLFSQTGLW 73
           R+G    P YRIV  DSR +RDG  I  IG  +P     K      +D   A  WL+ GA+P++TV+ L  +  ++
  S:     3 RIGAKKKPVYRIVVTDSRSRRDGAVIEEIGFYDPRANTEKGLPEVTLDVEAARRWLSHGARPSETVQGLLKRAQVY 78
>gi|167045710|gb|ABZ10357.1| putative ribosomal protein S16 [uncultured marine bacterium HF4000_APKG2098] (146 aa)
Score = 127, Expect = 4.6e-06, Identities = 29/65 (44%), Positives = 39/65 (60%)
  Q:     9 PTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE------WLNKGAKPTDTVRSLFSQTGLW 73
           P YRIV  DSR  RDG++I  +G  NP L + K    E V LE      W++KGAKPT  V  +  +  ++
  S:    15 PVYRIVVADSRFPRDGRFIEKVGFFNPLLPKTK---KERVNLEVERIKHWISKGAKPTLRVSRILGEAEVY 82
>gi|90421128|ref|ZP_01229030.1| ribosomal protein S16 [Aurantimonas sp. SI85-9A1] >gi|90334620|gb|EAS48400.1| ribosomal protein S16 [Aurantimonas sp. SI85-9A1] (140 aa)
Score = 127, Expect = 4.6e-06, Identities = 25/71 (35%), Positives = 39/71 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKEN--KCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y +V  D+R  RDG+++  +G  NP L ++  +  ++E     WL +GA+PTD V     Q G+
  S:     9 RAGSKKRPYYHVVVADARSPRDGRFVEQLGSWNPMLPKDAQRVTLNEERIKHWLAEGAQPTDRVLRFLDQAGI 81
>gi|193078541|gb|ABO13561.2| 30S ribosomal protein S16 [Acinetobacter baumannii ATCC 17978] (98 aa)
Score = 127, Expect = 4.8e-06, Identities = 27/69 (39%), Positives = 40/69 (57%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL--KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQT 70
           R G    P Y+IV  DSR  RDG++I  IG  NP    +  K ++D      W+++GA+P++ V SL +Q 
  S:    23 RGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQGQAEKLRLDADRFAHWVSQGAQPSERVASLAAQA 93
>gi|159161142|ref|YP_001542429.1| ribosomal protein S16 [Ceratophyllum demersum] >gi|148508425|gb|ABQ81432.1| ribosomal protein S16 [Ceratophyllum demersum] (86 aa)
Score = 127, Expect = 4.9e-06, Identities = 27/81 (33%), Positives = 47/81 (58%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK 82
           R GR     YRIVA+D R +R+G+ +  +G  +P   +N+  ++    L +L  GA+PT+TV  +  + G++++   SK K
  S:     8 RCGRKQRAIYRIVAIDVRSRREGRDLRKVGFYDPI--KNQTYLNVPAILHFLETGAQPTETVHDILKKAGVFEELRVSKTK 86
>gi|162148862|ref|YP_001603323.1| 30S ribosomal protein S16 [Gluconacetobacter diazotrophicus PAl 5] >gi|187597460|ref|ZP_02983718.1| ribosomal protein S16 [Gluconacetobacter diazotrophicus PAl 5] >gi|189044384|sp|A9HS66.1|RS16_GLUDA 30S ribosomal protein S16 >gi|161787439|emb|CAP57034.1| putative 30S ribosomal protein S16 [Gluconacetobacter diazotrophicus PAl 5] >gi|187490406|gb|EDU28349.1| ribosomal protein S16 [Gluconacetobacter diazotrophicus PAl 5] (113 aa)
Score = 127, Expect = 4.9e-06, Identities = 33/87 (37%), Positives = 44/87 (50%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK----IDEAVALEWLNKGAKPTDTVRSLFSQTGLWKK--FVESKKKPVAKSK 88
           R G    P Y IV  DSR  RDG++I  +G  NP L  +       ++E +   WL++GA PTD V       GL  K  + E  KK   K +
  S:     9 RAGAKKRPYYHIVIADSRSPRDGRFIEKVGAYNPMLPSDHADRVRLVNERIT-HWLSQGALPTDRVARFLGNAGLAPKPAYTEQPKKSAPKKR 100
>gi|116784771|gb|ABK23466.1| unknown [Picea sitchensis] (132 aa)
Score = 127, Expect = 5.0e-06, Identities = 29/70 (41%), Positives = 44/70 (62%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCK---IDEAVALEWLNKGAKPTDTVRSLFSQTG 71
           R G  + P YRIVA DSR  RDGK++ ++G+ NP   ++  K   ++   A  WL+ GA+P+D V+ L  + G
  S:    10 RFGCSNRPFYRIVAADSRSPRDGKHLEVLGYYNPLPVKDGGKRMGLNFDRAKYWLSVGAQPSDPVQRLLFRAG 82
>gi|158522320|ref|YP_001530190.1| ribosomal protein S16 [Desulfococcus oleovorans Hxd3] >gi|158511146|gb|ABW68113.1| ribosomal protein S16 [Desulfococcus oleovorans Hxd3] (82 aa)
Score = 127, Expect = 5.0e-06, Identities = 25/71 (35%), Positives = 39/71 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R GR   P YR+V  D R  RDG++I  +G  NP +   +  + +     WL +GA+ T TV+S+  + G+
  S:     9 RCGRKKRPFYRMVVADERYARDGRFIEKVGTYNPLVNPAEVVVAKDRVEHWLGQGAQATRTVKSILKKEGV 79
>gi|196186464|gb|EDX81440.1| ribosomal protein S16, putative [Brevundimonas sp. BAL3] (180 aa)
Score = 126, Expect = 5.7e-06, Identities = 30/68 (44%), Positives = 37/68 (54%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVAL----EWLNKGAKPTDTVRSLFSQ 69
           R G    P Y IV  DS   RDGK+I  +G  NP L ++      A+ +    EWL KGA+PTD V    SQ
  S:     8 RGGAKKRPYYHIVIADSHSPRDGKFIEKVGSYNPMLPKDGATPRVALKVERIAEWLGKGAQPTDRVARFLSQ 79
>gi|152991246|ref|YP_001356968.1| 30S ribosomal protein S16 [Nitratiruptor sp. SB155-2] >gi|166201324|sp|A6Q552.1|RS16_NITSB 30S ribosomal protein S16 >gi|151423107|dbj|BAF70611.1| 30S ribosomal protein S16 [Nitratiruptor sp. SB155-2] (75 aa)
Score = 126, Expect = 5.8e-06, Identities = 29/65 (44%), Positives = 35/65 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSL 66
           R GR   P YRIV  DSR +RD  +I  IG+ NP       KIDE     WL  GAK ++ V+ L
  S:     8 RFGRKKRPFYRIVVTDSRKRRDSGWIESIGYYNPLTDPVTVKIDEERLNYWLGVGAKMSERVKKL 72
>gi|169794055|ref|YP_001718419.1| ribosomal protein S16 [Manihot esculenta] >gi|157695867|gb|ABV66136.1| ribosomal protein S16 [Manihot esculenta] (88 aa)
Score = 126, Expect = 5.9e-06, Identities = 26/72 (36%), Positives = 43/72 (59%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLW 73
           R GR     YRIVA+D R +R+G+ +  +G  +P   +N+  ++    L +L KGA+PT TVR +  + G++
  S:     8 RCGRKQRTVYRIVAIDVRSRREGRDLRKVGFYDPI--KNQTYLNVPAILYFLEKGAQPTGTVRDILRKAGVF 77
>gi|89280617|ref|YP_514834.1| ribosomal protein S16 [Solanum lycopersicum] >gi|91208970|ref|YP_538830.1| ribosomal protein S16 [Solanum bulbocastanum] >gi|108773112|ref|YP_635621.1| ribosomal protein S16 [Solanum tuberosum] >gi|93141307|sp|P32087|RR16_SOLTU Chloroplast 30S ribosomal protein S16 >gi|122245045|sp|Q2MIK5|RR16_SOLBU Chloroplast 30S ribosomal protein S16 >gi|122248452|sp|Q2MIB8|RR16_SOLLC Chloroplast 30S ribosomal protein S16 >gi|516564|gb|AAA74421.1| ribosomal protein S16 >gi|84371877|gb|ABC56195.1| ribosomal protein S16 [Solanum bulbocastanum] >gi|84371965|gb|ABC56282.1| ribosomal protein S16 [Lycopersicon esculentum] >gi|88656786|gb|ABD47039.1| ribosomal protein S16 [Solanum tuberosum] >gi|89241653|emb|CAJ32375.1| ribosomal protein S16 [Solanum lycopersicum] (88 aa)
Score = 126, Expect = 6.2e-06, Identities = 26/75 (34%), Positives = 45/75 (60%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKF 76
           R GR     YRIVA+D R +R+GK +  +G  +P   +N+  ++    L +L KGA+PT+TV+ +  +  ++K+ 
  S:     8 RCGRKQRAVYRIVAIDVRSRREGKDLQKVGFYDPI--KNQTYLNVPAILYFLEKGAQPTETVQDILKKAEVFKEL 80
>gi|148261144|ref|YP_001235271.1| 30S ribosomal protein S16 [Acidiphilium cryptum JF-5] >gi|166234384|sp|A5G0H0.1|RS16_ACICJ 30S ribosomal protein S16 >gi|146402825|gb|ABQ31352.1| SSU ribosomal protein S16P [Acidiphilium cryptum JF-5] (114 aa)
Score = 126, Expect = 6.3e-06, Identities = 29/71 (40%), Positives = 38/71 (53%)
  Q:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPAL---KENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGL 72
           R G    P Y IV  DSR  RDGK+I  IG  NP L    E++ ++       WL++GA+ TD V     + GL
  S:     9 RAGAKKRPFYHIVVADSRSPRDGKFIERIGTYNPMLPADHEDRIRLVTDRVTHWLSQGAQATDRVARFIGKAGL 82