>gi|26553453|ref|NP_757387.1| chromosomal replication initiation protein [Mycoplasma penetrans HF-2] >gi|26453459|dbj|BAC43791.1| chromosomal replication initiator protein [Mycoplasma penetrans HF-2] (452 aa)
Score = 1831, Expect = 0.0e+00, Identities = 452/452 (100%), Positives = 452/452 (100%)
  Q:     1 MFTLAQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           MFTLAQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF
  S:     1 MFTLAQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
>gi|461941|sp|P34028|DNAA_SPICI Chromosomal replication initiator protein dnaA >gi|49346|emb|CAA79521.1| DnaA protein [Spiroplasma citri] >gi|745456|prf||2016285A DnaA protein (450 aa)
Score = 542, Expect = 2.8e-53, Identities = 150/424 (35%), Positives = 234/424 (55%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLD--SRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKN-LMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           YN Y+ D++++ + D N  I  K++    VF     E  +           N+ F  + EK+INK+   I  K  TL  N  L     +TFEN+  G  N  A +AA ++ L+    W  L IYG +GLGKTHLLHA+ NK  +++   N + Y++ ++F +     +++G   +E FK S+D  D LLIDDIQ L  + K NE+FF+IFN    KNK IV+TSDK P  L   + R+ISRF+ GLSI ++ PD E+  KI+ + +K       FS  ++EFIAL FNSD+R LEG + ++ F  + N  PNEII    +    ++      + N  +I P  I + +   Y +  K+++SK R       R++ MY  R  ++  +  IG+ F  ++H TV+ ++K VE  + ++++ K  ++ I  K
  S:    25 YNYYISDTNLYTVSDNNCLITTKSEIAIGVFEAGLNEKIKNILKKLTGIQYNISF--ELEKNINKQASVIS-KIDTLTENNNLAYYENYTFENFVRGDSNHEAMQAALAVALDLGKKWNPLFIYGDSGLGKTHLLHAIENKVNEIYKTNNRVKYLKADEFGKIAMDILNQGHEIIEAFKTSYDIYDCLLIDDIQLLAKRNKTNELFFHIFNSYIEKNKQIVITSDKYPDDLGGFEARIISRFSYGLSIGLDSPDFETALKILEQKLKHQNNLGLFSEESLEFIALNFNSDVRKLEGAIKRLLFLAVMNKKPNEIITLADVEKAFKNAP----LQNNEKITPKKIKQIVADSYNITIKAMMSKSRVSNVMQARQLAMYFCRTLLDEPFTRIGTEFGGKDHTTVMNSVKKVEAHISTNKEFKHLVNAIRRK 446
>gi|110003908|emb|CAK98248.1| putative chromosomal replication initiator protein dnaa [Spiroplasma citri] (450 aa)
Score = 541, Expect = 3.8e-53, Identities = 150/424 (35%), Positives = 234/424 (55%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLD--SRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKN-LMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           YN Y+ D++++ + D N  I  K++    VF     E  +           N+ F  + EK+INK+   I  K  TL  N  L     +TFEN+  G  N  A +AA ++ L+    W  L IYG +GLGKTHLLHA+ NK  +++   N + Y++ ++F +     +++G   +E FK S+D  D LLIDDIQ L  + K NE+FF+IFN    KNK IV+TSDK P  L   + R+ISRF+ GLSI ++ PD E+  KI+ + +K       FS  ++EFIAL FNSD+R LEG + ++ F  + N  PNEII    +    ++      + N  +I P  I + +   Y +  K+++SK R       R++ MY  R  ++  +  IG+ F  ++H TV+ ++K VE  + ++++ K  ++ I  K
  S:    25 YNYYISDTNLYTVSDNNCLITTKSEIAIGVFEAGLNEKIKNILKKLTGIQYNISF--ELEKNINKQASVIS-KIDTLTENNNLAYYENYTFENFVRGDSNHEAMQAALAVALDLGKKWNPLFIYGDSGLGKTHLLHAIENKVNEIYKTNNRVKYLKADEFGKIAMDILNQGHEIIEAFKTSYDIYDCLLIDDIQLLAKRNKTNELFFHIFNSYIEKNKQIVITSDKYPDDLGGFEARIISRFSYGLSIGLDSPDFETALKILEQKLKHQNNLGLFSEESLEFIALNFNSDVRKLEGAIKRLLFLAVMNKKPNEIITLADVEKAFKNAP----LQNNEKITPKKIKQIVADNYNITIKAMMSKSRVSNVMQARQLAMYFCRTLLDEPFTRIGTEFGGKDHTTVMNSVKKVEAHISTNKEFKHLVNAIRRK 446
>gi|167755165|ref|ZP_02427292.1| hypothetical protein CLORAM_00670 [Clostridium ramosum DSM 1402] >gi|167705215|gb|EDS19794.1| hypothetical protein CLORAM_00670 [Clostridium ramosum DSM 1402] (448 aa)
Score = 529, Expect = 8.4e-52, Identities = 159/449 (35%), Positives = 262/449 (58%)
  Q:     4 LAQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLF-LEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP---FSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSN-LVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L  ++K+ L  +++I+K      F +     + I  I +  V I     F  E   N  K+I E+  S  + S++N+  + +E  D  K +   +E P    +N TL    TF+N+ +G  N+ A  AA L      +N+  L IY + GLGKTHLL+A+GN   ++ P   + YI ++DF++++  A+   G   +E  + + N+D+LLIDDIQFL NKEK +EIFF+IFN L + NK IV+TSDK+P  L+ I+ R+ISRFNSGLS  I+ P+ E+ + I+ + I+   + NP     +  ++F+A  +  DIR+LEG L +++F  + N       N   +   +ES  D +IV N    +  + I+++    Y +    +ISK + ++ +  R++CMY++RE +++++ EIG+ FSNR+H+TV++A   VETK+K D D K  ++ +  K 
  S:    12 LDTLEKQNLPEERKIDKVIMESVFRS-----AKIASINNNKVIITTPFSFNVETIKNNQKDI-EDILSGMLASSINLEIVGEE--DFKKSVAVKQETPFRDNLNRTL----TFDNFVVGSSNRMAQNAALLVSTNPGSNFNPLFIYSNPGLGKTHLLNAIGNYAKEVNPALRIRYITSKDFVDEVIGAMK--GRDGDEIYDKYKNLDILLIDDIQFLFNKEKSSEIFFHIFNELINNNKQIVITSDKMPEELQGIESRLISRFNSGLSFGIDPPEFETARAILEKKIEN--LDNPSLIIQDDVVDFMANHYCKDIRSLEGALKRLFFCSIMNH-----TNNIDMAFALESFKDDKIVQNPKSSLTKESILKTTAEFYYLTISQLISKNKTRKLTTPREMCMYLMRELLDITFAEIGATFSNRDHSTVMKACARVETKIKKDPDYKLAINKLKDKL 445
>gi|169351632|ref|ZP_02868570.1| hypothetical protein CLOSPI_02413 [Clostridium spiroforme DSM 1552] >gi|169291854|gb|EDS73987.1| hypothetical protein CLOSPI_02413 [Clostridium spiroforme DSM 1552] (448 aa)
Score = 512, Expect = 8.2e-50, Identities = 156/449 (34%), Positives = 257/449 (57%)
  Q:     4 LAQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLF-LEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP---FSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIES-DSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L  ++K+ L  +++I+K      F N     + I  I +  V I     F  E   N   +I E+  S  + S + V  + ++E   NK +  I+ K +  + N  L+   TFEN+ +G  N+ A  AA L      +N+  L IY + GLGKTHLL+A+GN   ++ P  N+ YI ++DF++++  A+   G   +E    +  +D+LLIDDIQFL NKEK +EIFF+IFN L + NK IV+TSDK+P  L+ I+ R+ISRFNSGLS  I+ P+ E+ + I+ + I+   + NP        I+F+A  +  DIR+LEG L +++F  + N       N   +   +ES   D ++ +    +  +II+++    Y +    +ISK + ++ +  R++CMY++RE ++++++EIG  FSNR+H+TV++A   VE K+  D D K  ++ +  K 
  S:    12 LDTLEKQTLPEERKIDKVIMESVFRN-----AQIASINNNKVTITTPFSFNVETIKNNLSDI-EDILSGMLASQVTVEILGEDE--FNKSI--IQAKKEVFKDN--LNKSLTFENFVVGGSNRMAQNAALLVSTNPGSNFNPLFIYSNPGLGKTHLLNAIGNYAKEINPNLNIRYITSKDFVDEVIGAMK--GKDGDEIYEKYKQLDILLIDDIQFLFNKEKSSEIFFHIFNELINNNKQIVITSDKMPEDLQGIESRLISRFNSGLSFGIDPPEFETARAILEKKIEN--LDNPSLIIQEDVIDFMASHYCRDIRSLEGALKRLFFCSIMNC-----TNNIDMAFALESFKDDKKVTTPKTALTKEIILKTTAEFYYLTIDQLISKNKTRKLTTPREMCMYLMRELLDITFSEIGMTFSNRDHSTVMKACARVEAKIAKDSDYKLAINKLKEKL 445
>gi|148654189|ref|YP_001274394.1| chromosomal replication initiator protein DnaA [Roseiflexus sp. RS-1] >gi|166215156|sp|A5UP91|DNAA_ROSS1 Chromosomal replication initiator protein dnaA >gi|148566299|gb|ABQ88444.1| chromosomal replication initiator protein DnaA [Roseiflexus sp. RS-1] (481 aa)
Score = 503, Expect = 8.9e-49, Identities = 118/348 (33%), Positives = 196/348 (56%)
  Q:    95 PTIEEKPKTLEI-----NPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           P     P+ LE+     +  L+ R+TF+ + IG  N+ A  AA + + E+    +  L +YG  GLGKTHLLHA+GN  +   P+ N++Y+ +E F   +  +I    T  EEF+  + N+D+LLIDDIQF+  KE+  E FF+ FN L+S  K IV++SD+ P + L +++R+ SRF  GL + +  PD E+   I+    ++S +  P     I+F+A R  S IR LEG LN++  F  + NV     +    +  +++++          ++ PD I+  +   Y VD +++  + R++     R+V MY+LRE+ + S  EIG     R+H TV+   + +  ++ SD  L+
  S:   122 PLERTPPQQLELHRAVRSSMLNPRYTFDRFIIGPSNRLA-NAACMAVAEHPAQAYNPLFLYGGVGLGKTHLLHAIGNFVLDRDPEVNVLYVSSETFTNDLINSIRRQQT--EEFRIRYRNIDILLIDDIQFIAGKEQTQEEFFHTFNTLHSAGKQIVISSDRSPKAILTLEERLRSRFEWGLIVDVQMPDLETRTAILRAKAEQSPV--PVPQPVIDFLAQRIQSHIRELEGCLNRVTAFAQMYNVPVTIEVATAALSELLDTNRRK-------RVTPDAILREVAAFYSVDLRALQGRSRSRNIVIPRQVAMYLLREETDSSLMEIGQLLGGRDHTTVMYGCEKITEELNSDARLR 466
>gi|46199910|ref|YP_005577.1| chromosomal replication initiator protein dnaA [Thermus thermophilus HB27] >gi|46197537|gb|AAS81950.1| chromosomal replication initiator protein dnaA [Thermus thermophilus HB27] (446 aa)
Score = 494, Expect = 9.7e-48, Identities = 122/359 (33%), Positives = 193/359 (53%)
  Q:    87 EKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           ++DI +  P   E P+     P L+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP   + Y+ TE F  ++  AI E   ++ EF+  + +VDLLL+DD+QF+  KE+  E FF+ FN L   +K I+++SD+ P   L ++ R+ SRF  GL   I  PD E+   I+  N ++  ++ P    A+E+IA +  S+IR LEG L + I F  L+ V+    +  + +  I             ++ +P  II  +   +G+  + +    R K+    R++ MY++RE    S  EIG  F  R+H TVL AI+ V+   +SD +++  L
  S:    96 QEDIFQAAPA--EAPR-----PKLNPKYTFENFVVGPNNSMAHAAAVAVAESPGRAYNPLFIYGGVGLGKTHLMHAVGHSVAKRFPHLKIEYVSTETFTNELINAIRE--DRMTEFRERYRSVDLLLVDDVQFIAGKERTQEEFFHTFNALYEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQRGLRIPED--ALEYIARQVTSNIRELEGALMRAIAFASLNGVELTRAVAAKALSDIFAPRE--------LEADPLEIIRKVADHFGLKPEELTGSGRKKEVVLPRQLAMYLVRELTRASLPEIGQLFGGRDHTTVLYAIQKVQELAESDREVQGLL 438
>gi|55981942|ref|YP_145239.1| chromosomal replication initiator protein DnaA [Thermus thermophilus HB8] >gi|14194700|sp|Q9X9D5|DNAA_THET8 Chromosomal replication initiator protein dnaA >gi|4572641|emb|CAB40110.1| initiator protein DnaA [Thermus thermophilus] >gi|55773355|dbj|BAD71796.1| chromosomal replication initiator protein DnaA [Thermus thermophilus HB8] (436 aa)
Score = 494, Expect = 1.0e-47, Identities = 122/359 (33%), Positives = 193/359 (53%)
  Q:    87 EKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           ++DI +  P   E P+     P L+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP   + Y+ TE F  ++  AI E   ++ EF+  + +VDLLL+DD+QF+  KE+  E FF+ FN L   +K I+++SD+ P   L ++ R+ SRF  GL   I  PD E+   I+  N ++  ++ P    A+E+IA +  S+IR LEG L + I F  L+ V+    +  + +  I             ++ +P  II  +   +G+  + +    R K+    R++ MY++RE    S  EIG  F  R+H TVL AI+ V+   +SD +++  L
  S:    86 QEDIFQAAPA--EAPR-----PKLNPKYTFENFVVGPNNSMAHAAAVAVAESPGRAYNPLFIYGGVGLGKTHLMHAVGHSVAKRFPHLRIEYVSTETFTNELINAIRE--DRMTEFRERYRSVDLLLVDDVQFIAGKERTQEEFFHTFNALYEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQRGLRIPED--ALEYIARQVTSNIRELEGALMRAIAFASLNGVELTRAVAAKALSDIFAPRE--------LEADPLEIIRKVADHFGLKPEELTGSGRKKEVVLPRQLAMYLVRELTRASLPEIGQLFGGRDHTTVLYAIQKVQELAESDREVQGLL 428
>gi|61212638|sp|Q72H87|DNAA_THET2 Chromosomal replication initiator protein dnaA (436 aa)
Score = 493, Expect = 1.3e-47, Identities = 122/359 (33%), Positives = 193/359 (53%)
  Q:    87 EKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           ++DI +  P   E P+     P L+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP   + Y+ TE F  ++  AI E   ++ EF+  + +VDLLL+DD+QF+  KE+  E FF+ FN L   +K I+++SD+ P   L ++ R+ SRF  GL   I  PD E+   I+  N ++  ++ P    A+E+IA +  S+IR LEG L + I F  L+ V+    +  + +  I             ++ +P  II  +   +G+  + +    R K+    R++ MY++RE    S  EIG  F  R+H TVL AI+ V+   +SD +++  L
  S:    86 QEDIFQAAPA--EAPR-----PKLNPKYTFENFVVGPNNSMAHAAAVAVAESPGRAYNPLFIYGGVGLGKTHLMHAVGHSVAKRFPHLKIEYVSTETFTNELINAIRE--DRMTEFRERYRSVDLLLVDDVQFIAGKERTQEEFFHTFNALYEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQRGLRIPED--ALEYIARQVTSNIRELEGALMRAIAFASLNGVELTRAVAAKALSDIFAPRE--------LEADPLEIIRKVADHFGLKPEELTGSGRKKEVVLPRQLAMYLVRELTRASLPEIGQLFGGRDHTTVLYAIQKVQELAESDREVQGLL 428
>gi|167461551|ref|ZP_02326640.1| chromosomal replication initiation protein [Paenibacillus larvae subsp. larvae BRL-230010] (452 aa)
Score = 491, Expect = 2.0e-47, Identities = 132/410 (32%), Positives = 224/410 (54%)
  Q:    42 DENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD----INKELPTIEEKP---KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           D  V I   N+F KE   + Y ++        +   + + FI + E+D    + + +P I + P   +    +  ++SR+TF+ + IG  N+ A  AASL + E     +  L +YG  GLGKTHL+HA+G+  ++  P+  ++YI +E F  +   A+ +   + E+F+N +  +D+LLIDDIQF++ KE   E FF+ FN L+ + K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   ++ P  N A+ +IA + +++IR LEG L ++  +  L N D    +  E ++ II S     I    +Q       + +   YG+  +   ++KR K  +F R+V MY+ RE  + S  +IG  F  R+H TV+ A + +   VK D++L   + +I  K
  S:    39 DTYVVICAPNNFAKEWLESRYAKMISSTIYEFLGKQVEIKFIVESEEDQVNPVPEAVPDIPKGPALGQEENYSNMMNSRYTFDTFVIGQGNRFA-HAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMHAIGHYVLEHNPEARVLYISSEKFTNEFINAVRD--NRGEDFRNKYRTIDVLLIDDIQFISGKEGTQEEFFHTFNALHEEGKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRIAILRKKAKAENLEIP--NEAMLYIANQIDTNIRELEGALIRVVAYSSLINQDITTHLAAEALKDIIPSSRPRVITIQDIQ-------QKVGEFYGLKLEDFKARKRTKAVAFPRQVAMYLSRELTDFSLPKIGDAFGGRDHTTVIHAHEKISEAVKKDQELYKIIQSITEK 447
>gi|13508425|ref|NP_110375.1| chromosomal replication initiation protein [Mycoplasma pneumoniae M129] >gi|2494136|sp|Q59549|DNAA_MYCPN Chromosomal replication initiator protein dnaA >gi|1209520|gb|AAC43648.1| DnaA protein >gi|1673817|gb|AAB95804.1| chromosomal replication initiator protein DnaA [Mycoplasma pneumoniae M129] (439 aa)
Score = 490, Expect = 2.6e-47, Identities = 141/446 (31%), Positives = 245/446 (54%)
  Q:     4 LAQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNE------YKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAI--SEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           + Q     L++KK+ E       FY+ Y+ +   F +K+  ++++V N+F +E   +         +++++  +++  +  + F    + ++ N+E         TL  +  L   FTF+N+ +G  N+  ++A     E ++ ++  L IYG TGLGKTHLL A+GN     FP   + Y+ + DF +++  A    E    +E+ K +++++DLLLIDD Q    KEK  EI F+IFN L SK K IV  SDK P  L  ID RM+SRF SGL +KI K +  S+ +I+   +K+       +N A E  A    +D+R+L G+  K+ F++        +IN + ++ I+  + +     +    +P ++IE++C  + V   SV+S+ R  +   VR VC Y+LREK  + + +IG  F  RNH+TV+ A+K V   ++ D+ L+  + +++
  S:     1 MEQFSAFKLLLKKQYETTL---GFYDKYIKNLKRFALKNNVLFVIVDNEFARETLNSNPDIVGLASKLYDDIRAVRFVNEQDFFINLAKLEEDNRE---------TLYQSSGLSKNFTFKNFVVGDGNRRVYEAGVRISETQDADFSPLFIYGETGLGKTHLLQAIGNDKFFHFPNAKVKYVVSSDFAQEVVNAFYQKEKDQGIEKLKAAYESLDLLLIDDTQIFGKKEKTLEILFSIFNNLVSKGKQIVFVSDKTPDELANIDPRMVSRFKSGLLLKIEKHNLSSLCEILAVKLKEKDPNIQITNEAREKAAQISGNDVRSLNGIATKLLFYV--KTTKQNLINNDNLKEILFEEFEK---FHKKSFDPYLLIENVCRRFNVPVDSVLSENRKAELVRVRDVCNYILREKYKMQFQQIGKIF-KRNHSTVVAAVKRVAKMIEKDDSLQDIITSLV 438
>gi|12045329|ref|NP_073140.1| chromosomal replication initiation protein [Mycoplasma genitalium G37] >gi|1352276|sp|P35888|DNAA_MYCGE Chromosomal replication initiator protein dnaA >gi|3845066|gb|AAC72490.1| chromosomal replication initiator protein DnaA [Mycoplasma genitalium G37] >gi|166079050|gb|ABY79668.1| chromosomal replication initiator protein DnaA [synthetic Mycoplasma genitalium JCVI-1.0] (437 aa)
Score = 489, Expect = 3.6e-47, Identities = 149/437 (34%), Positives = 239/437 (54%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPK-TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++KK  EK      F++ Y+ D + F  K+  + IL++N+F +    N+  EI     S+      +V F+   E+D    L  +EE  + TL  N  L   +TF+N+ I   NK A++A     E ++N +  L IYG TGLGKTHLL A+GN+  + FP   + Y+ + DF +++  A  +    +E+ K +++N+DL+LIDD Q    KEK  EI FNIFN L    K IV+ SDK P  L  ID RMISRF SGL +KI K +  S+ +I+   +K+       +N A    A    +D+R L G+  K+ F          +IN E ++ I+  + +     +    +P ++IE++C  + V   SV+S+ R  +   VR VC Y+LR+K N+ + +IG  F  R+H++VL A+K V   +++D  L+  + +++
  S:    10 LLKKHYEKTI---GFHDKYIKDINRFVFKNNVLLILLENEFARNSL-NDNSEIIHLAESLYEGIK-SVNFVN--EQDFFFNLAKLEENSRDTLYQNSGLSKNYTFQNFVISEGNKRAYEAGVRLAETQDNEFSPLFIYGETGLGKTHLLQAIGNEKFRNFPNARVKYVVSSDFAQEVVDAFYQRDKGIEKLKKNYENLDLVLIDDTQIFGRKEKTLEILFNIFNNLVLNKKQIVLVSDKAPDELIDIDARMISRFKSGLLLKIEKHNLSSLCEILTVKLKEKDPNIQITNEARHDAAQISGNDVRALNGIATKLLF--FAKTSKQNLINTENLKEILFEEFEK---FHKKSFDPYLLIENVCRRFNVPMDSVLSENRKAELVRVRDVCNYLLRQKYNMQFQQIGKIF-KRSHSSVLMAVKRVAKMIENDSSLRDVITSLV 436
>gi|159896534|ref|YP_001542781.1| chromosomal replication initiator protein DnaA [Herpetosiphon aurantiacus ATCC 23779] >gi|159889573|gb|ABX02653.1| chromosomal replication initiator protein DnaA [Herpetosiphon aurantiacus ATCC 23779] (472 aa)
Score = 486, Expect = 8.0e-47, Identities = 111/333 (33%), Positives = 182/333 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           L+ R+TF ++ +G  N+ A  A     E     +  L +YG  GLGKTHLL A+GN  +   P+ N++Y+ +E F   +  AI    T  EEF+  + N+D+LLIDDIQF+  KE   E FF+ FN L+   K IV++SD+ P + L +++R+ SRF  GL + +  PD E+  +  I   K   ++ P S+  I+F+A R  S+IR LEG LN++  +   N  P  + +    +  ++++       S   ++  D I   +   YG+D++++  + R++     R+V MY+LRE+ + S  EIG     R+H TV+     +   + SD  L+
  S:   132 LNPRYTFSSFIVGTSNRLAHAACMAVAEHPAQAYNPLFLYGGVGLGKTHLLQAIGNYALDRNPEVNVLYVSSEKFTNDLINAIRRQQT--EEFRIRYRNIDILLIDDIQFIAGKEGTQEEFFHTFNTLHGAGKQIVLSSDRPPKAILTLEERLRSRFEWGLIVDVQNPDLET--RTAILRAKGETLQVPVSSEVIDFLAQRIQSNIRELEGCLNRVIAYANLNRTPVTVEVASAALADLLDT-------SRRKRVTADDIFREVSQHYGIDQRAIRGRGRSRNVVLPRQVVMYLLREETDASLVEIGELLGGRDHTTVMHGYNKITDDLTSDARLR 456
>gi|156740029|ref|YP_001430158.1| chromosomal replication initiator protein DnaA [Roseiflexus castenholzii DSM 13941] >gi|189044602|sp|A7NFB8|DNAA_ROSCS Chromosomal replication initiator protein dnaA >gi|156231357|gb|ABU56140.1| chromosomal replication initiator protein DnaA [Roseiflexus castenholzii DSM 13941] (480 aa)
Score = 484, Expect = 1.4e-46, Identities = 110/333 (33%), Positives = 187/333 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           L+ R+TF+ + IG  N+ A  AA + + E+    +  L +YG  GLGKTHLLHA+GN  +   P+ N++Y+ +E F   +  +I    T  EEF+  + N+D+LLIDDIQF+  KE+  E FF+ FN L+S  K I+++SD+ P + L +++R+ SRF  GL + +  PD E+   I+    ++S +  P     I+F+A R  S IR LEG LN++  +  + N+     +    +  +++++          ++ P+ I+  +   Y VD +S+  + R++     R V MY+LRE+ + S  EIG     R+H TV+     +  ++ +D  L+
  S:   141 LNPRYTFDRFIIGPSNRLA-NAACMAVAEHPAQAYNPLFLYGGVGLGKTHLLHAIGNFVLDRDPEVNVLYVSSETFTNDLINSIRRQQT--EEFRIRYRNIDILLIDDIQFIAGKEQTQEEFFHTFNTLHSAGKQIIISSDRSPKAILTLEERLRSRFEWGLIVDVQMPDLETRTAILRAKAEQSPV--PVPQPVIDFLAQRIQSHIRELEGCLNRVTAYAQMYNIPVTIEVATAALSELLDTNRRK-------RVTPEAILREVAAFYSVDLRSLQGRGRSRNIVTPRHVAMYLLREETDSSLMEIGQLLGGRDHTTVMYGCDKIAEEINTDARLR 465
>gi|163938014|ref|YP_001642898.1| chromosomal replication initiation protein [Bacillus weihenstephanensis KBAB4] >gi|23193191|gb|AAN14420.1|AF319579_1 DnaA [Bacillus weihenstephanensis] >gi|163860211|gb|ABY41270.1| chromosomal replication initiator protein DnaA [Bacillus weihenstephanensis KBAB4] (446 aa)
Score = 483, Expect = 1.9e-46, Identities = 140/433 (32%), Positives = 243/433 (56%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI---TKEEKDINKELPTIEEKPKTLEIN----PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI   ++ E+DI  +LP++++K    E N      L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E +++II +      +  ++ I+   I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ +
  S:    13 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEDI--DLPSVKQKHAHDESNHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDMNADLAAEALKNIIPNS-----IPRIISISD--IQKAVGGVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKHVEEV 441
>gi|163845604|ref|YP_001633648.1| chromosomal replication initiator protein DnaA [Chloroflexus aurantiacus J-10-fl] >gi|187600353|ref|ZP_02986585.1| chromosomal replication initiator protein DnaA [Chloroflexus sp. Y-400-fl] >gi|189044632|sp|A9WAN1|DNAA_CHLAA Chromosomal replication initiator protein dnaA >gi|163666893|gb|ABY33259.1| chromosomal replication initiator protein DnaA [Chloroflexus aurantiacus J-10-fl] >gi|187487636|gb|EDU25605.1| chromosomal replication initiator protein DnaA [Chloroflexus sp. Y-400-fl] (479 aa)
Score = 482, Expect = 2.2e-46, Identities = 110/334 (32%), Positives = 191/334 (57%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           L+ R+TF ++ +G  N+ A  AA L + +N    +  L +YG  GLGKTHLLHA+GN+ +   P+ N++Y+ +E F   +  AI    T  EEF+  + N+D+LLIDDIQF+  K+   E FF+ FN L+S  K+IV++SD+ P + L +++R+ SRF  GL + +  PD E+   I+    ++  +  P  +  I+F+A +  S+IR LEG LN++  +   N  P        I +   + +D        +I+ + I++ +   YG++ + + ++ R++     R+V MY+LRE+   S  +IG+    R+H TV+   + +  ++ SD  L++
  S:   140 LNPRYTFSSFIVGSSNRLA-HAACLAVADNPGQAYNPLFLYGGVGLGKTHLLHAIGNRVLDRDPEINVLYVSSEKFTNDLINAIRRQQT--EEFRMRYRNIDVLLIDDIQFIAGKDATQEEFFHTFNTLHSAAKHIVISSDRPPKAILTLEERLRSRFEWGLIVDVQPPDLETRTAILRAKAEQMSVHVP--DEVIDFLAHKIQSNIRELEGSLNRVAAYAELNRAP------ITIETATAALADLLGNQRRRRISAEAILQIVSEHYGIEVEQLRARNRSRHVVVPRQVAMYLLREETESSLVDIGNLLGGRDHTTVMYGCEKIAEEINSDSRLRS 465
>gi|167041954|gb|ABZ06692.1| putative bacterial DnaA protein [uncultured marine microorganism HF4000_137B17] (461 aa)
Score = 482, Expect = 2.5e-46, Identities = 117/348 (33%), Positives = 197/348 (56%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPD-IIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           PT   K +      TL++++TF  + +G  N+ A  AA          +  L++YG+ GLGKTHL+HA+G++ V      +L+Y  TE+F  +  KAI EG T  EEF++ + + D+LL+DDIQFL  KE+  E FF+ FN L+  N+ IV+TSD+  ++L  ++DR+ SR   GL + I  PD E+  ++ I   K   I    S   ++F+A R + +IR LEG LN++  Y  L  ++   E++ +  I  + + D    I        PD ++++++   YGVD++ +  +KR+K+ +  R++ MY++RE  N+    IG     ++H TV      ++T++  D  L+
  S:   115 PTFSPKARL----TTLNTKYTFGRFVVGKSNELAHAAAEAVSNRPGEVYSPLVLYGAVGLGKTHLMHAIGHRAVA--NGLSLIYATTEEFTNEYIKAIGEGRT--EEFRDRYRSTDVLLLDDIQFLIGKEQTQEGFFHTFNALHMTNRQIVITSDRPVSALTLLEDRIQSRLAGGLVVDIQAPDIET--RLAILRAKAETINQDVSQTVLDFLAERIHKNIRELEGSLNRVVAYADLTGSLLDVELV-KRAIDGLADPDEHRAI--------PDYVVVDAVATHYGVDQQVLKGRKRDKKTAQARQMAMYLMREDGNMGLTAIGRVLGGKDHTTVAHGCDRIKTQLPVDAQLR 448
>gi|118046024|ref|ZP_01514678.1| chromosomal replication initiator protein DnaA [Chloroflexus aggregans DSM 9485] >gi|117997380|gb|EAV11567.1| chromosomal replication initiator protein DnaA [Chloroflexus aggregans DSM 9485] (478 aa)
Score = 479, Expect = 5.5e-46, Identities = 110/334 (32%), Positives = 194/334 (58%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV------QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           L+ R+TF ++ +G  N+ A  AA L + +N    +  L +YG  GLGKTHLLHA+GN+ +   P+ N++Y+ +E F   +  AI    T  EEF+  + N+D+LLIDDIQF+  K+   E FF+ FN L+S  K+IV++SD+ P + L +++R+ SRF  GL + +  PD E+   I+    ++  +  P  +  I+F+A +  S+IR LEG LN++  +   N  P            I  D+    +++L+      +I+ + I++ +   YG++ + + ++ R++     R+V MY+LRE+   S  +IG+    R+H TV+   + +  ++ +D  L++
  S:   138 LNPRYTFASFIVGSSNRLA-HAACLAVADNPGQAYNPLFLYGGVGLGKTHLLHAIGNRVLDRDPEINVLYVSSEKFTNDLINAIRRQQT--EEFRMRYRNIDVLLIDDIQFIAGKDATQEEFFHTFNTLHSAAKHIVISSDRPPKAILTLEERLRSRFEWGLIVDVQPPDLETRTAILRAKAEQMSVHVP--DEVIDFLAHKIQSNIRELEGSLNRVAAYAELNRLP------------ITIDTATAALADLLGNQRRRRISAEAILQIVSEHYGIEVEQLRARNRSRHVVVPRQVAMYLLREETESSLVDIGNLLGGRDHTTVMYGCEKIAEEINTDSHLRS 463
>gi|167629172|ref|YP_001679671.1| chromosomal replication initiator protein dnaa [Heliobacterium modesticaldum Ice1] >gi|167591912|gb|ABZ83660.1| chromosomal replication initiator protein dnaa [Heliobacterium modesticaldum Ice1] (443 aa)
Score = 479, Expect = 5.8e-46, Identities = 135/426 (31%), Positives = 225/426 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKT---LLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTES-----IKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           EI K+      ++ ++ ++ +  I++   +I V ND  ++   N Y  + +   S+ +  ++ V F T    D  +  P+           P L+ ++TF+ + +G  N N F  A+         K    L +YG  GLGKTHL+ A+G+  ++  PQ  ++Y+ +E F  ++  AI +   K  EF+N + N+D+LLIDDIQFL  KE+  E FF+ FN L+  +K I+++SD+ P  +  ++DR+ SRF  GL   IN PD E+      KK I+EN+          N  + FIA    S+IR LEG LN+ I +  L        + EE +++II S     I   L+Q   +I+ E     Y +  +   +KKR +  +F R++ MY+ RE +++S  +IG  F  R+H TV+ A + +   ++ D  L+
  S:    14 EILKQELKPASFDTWLKNTQLVTIQNGEAHIGVPNDLARDWLENRYATLVKNALSVVLGESVEVRFFTPS-ADSRRSEPSRRPVATEESSPPLLNPKYTFDTFVVG--NSNRFAHAAALAVAEAPAKAYNPLFVYGGVGLGKTHLMQAIGHFVIEQHPQSRVVYVSSEKFTNELINAIRD--DKTVEFRNRYRNIDVLLIDDIQFLAGKERTQEEFFHTFNALHESSKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDINPPDLETRIAILRKKAILENLD-------VPNEVMVFIANIIQSNIRELEGALNRVIAYANLSGKSLTSEVAEEALKNIIPSHRAKVITIALIQ---EIVAEH----YNMRVEDFKAKKRTRDVAFPRQIAMYLSREMLDVSLPKIGEEFGGRDHTTVIHAHEKITKDIEKDPQLE 430
>gi|89210814|ref|ZP_01189198.1| chromosomal replication initiator protein, DnaA [Halothermothrix orenii H 168] >gi|89159555|gb|EAR79219.1| chromosomal replication initiator protein, DnaA [Halothermothrix orenii H 168] (463 aa)
Score = 478, Expect = 6.1e-46, Identities = 143/435 (32%), Positives = 240/435 (55%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD--INKELPTIEEKPKT----------LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +I+++  N +F   +  D+    + +  + + V NDF+K+   + Y E+ EE      NSN  +  ++ EE D   NK+   +E + K           +EI   L+ ++TF+ + +G  N+ A  AASL + E     +  L IYG  GLGKTHL+ A+ +  +   P K ++Y+ +E F  ++  AI +  T   EF+N + N+D+LL+DDIQFL  KE+  E FF+ FN L+  NK ++++SD+ P  +  +++R+ SRF  GL   I KPD E+   I+ +      ++ P  N  I +IA +  S+IR LEG L K I +  L N + +  + +E ++ ++  D++        QI  D I + +   Y +  + + SKKR +  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A   V  K + D D K  +D ++ K
  S:    18 KIKEKLSNPSF-RTWFSDTEAHSLVNNQLIVKVPNDFIKDWLESRYLELIEEVIKNLTNSNWKIVLMSPEELDELDNKDRARVETRDKVKSKNNKKNSNIEIPNGLNPKYTFDTFVVGNSNRFA-HAASLAVAEAPARAYNPLFIYGDVGLGKTHLMQAIAHFILDHNPDKKVVYVSSETFTNELINAIKDDRTV--EFRNKYRNIDILLVDDIQFLAGKERTQEEFFHTFNSLHEANKQLIISSDRPPKEIPTLEERLRSRFEWGLITDIQKPDLETRIAILRKKADLEDLEVP--NEVIIYIANKIQSNIRELEGALIKVIAYSSLVNREIDIDLAQEALKDLVAKDNNAP-----KQITIDHIKKVVADYYNLTIEDMDSKKRTQNIAFPRQIAMYLSRELTSSSLPQIGENFGGRDHTTVIHAHNKVTKKYEDDLDFKKMIDKLVEK 457
>gi|94984110|ref|YP_603474.1| chromosomal replication initiator protein DnaA [Deinococcus geothermalis DSM 11300] >gi|94554391|gb|ABF44305.1| chromosomal replication initiator protein DnaA [Deinococcus geothermalis DSM 11300] (470 aa)
Score = 478, Expect = 7.8e-46, Identities = 130/407 (31%), Positives = 216/407 (53%)
  Q:    40 IKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFF-ITKEEKD----------------INKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           ++D  + I V+N F +E F   Y E+ E+        N  + F +    +D                  + LP         E    L+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+  ++ FP K + Y+ TE F  ++  AI +   K  +F+N + +VDLLL+DDIQFL  KE+  E FF+ FN L   +K I+++SD+ P  ++ ++ R+ SRF  GL   I  P+ E+   I+  N + +RI  P     +E IA +  S+IR LEG L ++  F  L+NV  +  +  + + ++            +V++    ++ ++   +G+  + +    R ++    R+V MY++RE  + S  EIG FF  R+H+TV+ A+  V  ++  D +L A ++
  S:    41 VQDGALVIGVRNSFAQEWFRKHYLELLEDALRALGAQNPQISFQVLPASQDALLLPSDPPPAPANSSPGRSLPGQPPSQVPSESRQVLNPKYTFENFVVGPNNNLAHAAALAVAESPGKAYNPLFIYGDVGLGKTHLMHAVGHYIMERFPDKRIEYVSTESFTNELINAIRD--DKTTQFRNRYRSVDLLLVDDIQFLAGKERTQEEFFHTFNALYENHKQIILSSDRPPKDIQTLEGRLRSRFEWGLITDIQTPEFETRVAILKMNAEHNRIDIP--QEVLELIARQVTSNIRELEGALMRVVAFASLNNVPFSRAVAAKALSNV--------FAPQVVKVEMGEVLRAVATHFGLAPEVIRGSGRAREVVVPRQVAMYLIRELTDHSLPEIGQFFG-RDHSTVMHAVSKVSEQMSKDPELAATVE 454
>gi|169187372|ref|ZP_02847531.1| chromosomal replication initiator protein DnaA [Paenibacillus sp. JDR-2] >gi|169005381|gb|EDS52233.1| chromosomal replication initiator protein DnaA [Paenibacillus sp. JDR-2] (450 aa)
Score = 475, Expect = 1.5e-45, Identities = 133/412 (32%), Positives = 214/412 (51%)
  Q:    40 IKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKE---LPTIEEKPKTLE--INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           + D  + +     F  E     Y ++        +   ++V F  +E K        LP   E P   E   N  L+ ++TF+ + IG  N+ A  AASL + E     +  L +YG  GLGKTHL+HA+G+  +   P   +MYI +E F  +   AI +   + E F+N + N+D+LLIDDIQFL  K+   E FF+ FN L+ + K IV++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ +  K   +  P  N A+ +IA + +++IR LEG L ++  +  L N D    +  E ++ II S     I  N +Q       + +   YG+  +   ++KR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +  ++K D+DL   L N+  K
  S:    37 VNDSLLEVTAPTTFAAEWLEGRYTKLIRNTLFEFLGRQVDVRFSIEEAKPAEPAPPILPKAAEAPIIQEETFNHMLNPKYTFDTFVIGANNRFA-HAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMHAIGHYIMDHNPSTKIMYISSEKFTNEFINAIRD--NRGESFRNKYRNIDVLLIDDIQFLAGKDGTQEEFFHTFNALHEERKQIVISSDRTPKEIPTLEERLRSRFEWGLITDIQAPDLETRIAILRKKAKAENLDIP--NEAMVYIANQIDTNIRELEGALIRVVAYSSLINQDITSHLAAEALKDIIPSSRPKMITINDIQ-------QKVGEFYGLRLEEFKARKRTKAVAYPRQIAMYLSRELTDYSLPKIGEAFGGRDHTTVIHAHEKISQQLKQDQDLYKILQNLTEK 445
>gi|159903109|ref|YP_001550453.1| chromosomal replication initiation protein [Prochlorococcus marinus str. MIT 9211] >gi|159888285|gb|ABX08499.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus str. MIT 9211] (454 aa)
Score = 475, Expect = 1.6e-45, Identities = 123/416 (29%), Positives = 211/416 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEK-----------PKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           Y  ++  ++    +   + +L  NDF     TN Y    EE     +  ++ V  I K + DI K   ++  +            K  +  P L+ R+ F  + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI + G  ++ F++ +   DL+L+DDIQFL  KE   E FF+ FN L+     IV+ SD+ P  + ++ +R+ISRF+ GL   +  PD E+   I+ +  ++ R++ P     I+FIA RF  +IR LEG L + + F  +  +     +  E I  +++ +         V++ P  ++E +   + V    + S  R +  S  R+V MY++R   +LS   IG  F  ++H TV+ AI+ +E K+ +D  L +
  S:    24 YETWISPTTFCNFERGELTLLAANDFSSAWLTNNYSRAIEEAAEAVIGESVKV--IVKVKDDIQKSEASLPPRISIPAFHPPGDSKKTDSKPALNLRYVFNRFVVGPNSRIAHAAAMSVAEAPAKEFNPLFICGGVGLGKTHLMQAIGHYRLEIDPGAKVSYVSTETFTNDLIVAIRQDG--MQSFRDKYRAADLILVDDIQFLEGKEYTQEEFFHTFNALHESGTQIVLASDRPPNQIPRLQERLISRFSMGLIADVQAPDLETRMAILQKKAEQDRVRLPRD--LIQFIAGRFTLNIRELEGALTRAVAFASITGLP----MTVESIAPMLDPNGQG------VEVTPKQVMEKVSEVFAVTSDEMCSSSRRRPVSQARQVGMYLMRHGTDLSLPRIGEVFGGKDHTTVMYAIEQIEKKLSTDPQLAS 437
>gi|18308983|ref|NP_560917.1| chromosomal replication initiation protein [Clostridium perfringens str. 13] >gi|110799791|ref|YP_694476.1| chromosomal replication initiation protein [Clostridium perfringens ATCC 13124] >gi|168218306|ref|ZP_02643931.1| chromosomal replication initiator protein DnaA [Clostridium perfringens NCTC 8239] >gi|169343457|ref|ZP_02864457.1| chromosomal replication initiator protein DnaA [Clostridium perfringens C str. JGS1495] >gi|182627054|ref|ZP_02954779.1| chromosomal replication initiator protein DnaA [Clostridium perfringens D str. JGS1721] >gi|123149082|sp|Q0TV64|DNAA_CLOP1 Chromosomal replication initiator protein dnaA >gi|38257694|sp|Q8XPG2|DNAA_CLOPE Chromosomal replication initiator protein dnaA >gi|18143658|dbj|BAB79707.1| chromosomal replication initiator protein [Clostridium perfringens str. 13] >gi|110674438|gb|ABG83425.1| chromosomal replication initiator protein DnaA [Clostridium perfringens ATCC 13124] >gi|169298409|gb|EDS80498.1| chromosomal replication initiator protein DnaA [Clostridium perfringens C str. JGS1495] >gi|177907580|gb|EDT70219.1| chromosomal replication initiator protein DnaA [Clostridium perfringens D str. JGS1721] >gi|182379693|gb|EDT77172.1| chromosomal replication initiator protein DnaA [Clostridium perfringens NCTC 8239] (457 aa)
Score = 474, Expect = 2.1e-45, Identities = 139/440 (31%), Positives = 243/440 (55%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL-------------EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           IIK EI     +E  +N ++   +   I D  + + V N+F K +    YK++  +   I  +    + F  + + +  KE    +++ K               E++ TL+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +Q  P+  ++Y+ +E F  ++  AI +   K EEF+N +  VD+LLIDDIQF+  KE+  E FF+ FN L+ +NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  +  L N D +  +  E ++ II +     +    +Q       ES+   Y +  + + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K+DE L++ +++I  K 
  S:    15 IIKGEI-----SEISFNTWIKSCTPISISDNILKLSVPNEFTKGILDTRYKDLLIQALKIVTSRKFKIEFYLESDLEEEKENEEKQKEEKKENTNDVDGSIVVSDEMSATLNPKYTFQSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKD--DKNEEFRNKYRKVDVLLIDDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDFETRMAILKKKADVEGLNVP--NEVMVYIATKIKSNIRELEGALIRIIAYSSLTNRDVSVDLASEALKDIISNKESAPVTVKTIQ-------ESVANYYNLRIEDLKSQRRTRNIAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDITKKL 454
>gi|73661310|ref|YP_300091.1| chromosomal replication initiation protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123747926|sp|Q4A180|DNAA_STAS1 Chromosomal replication initiator protein dnaA >gi|72493825|dbj|BAE17146.1| chromosomal replication initiator protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (455 aa)
Score = 473, Expect = 2.3e-45, Identities = 136/421 (32%), Positives = 223/421 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT----------------LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           Y  ++ D+ +FK+++E   ++  +DFV       Y EI +      +   +   F T+EE    K L T E+K +     P                  ++  TFE + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +   K E F+  + N+D+LLIDDIQF+ NKE+  E FF+ FN L+  NK IV++SD+ P  + K++DR+ SRF  GL + I  PD E+   I+ + I +  +  P    A+ +IA +  S+IR LEG L ++  F  L        +  E ++ II++    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D   K  ++N+
  S:    23 YQTFLKDTKLFKLQNEQAIVVTDDDFVANWLKMNYAEIIKAALYEAIGHEIAPVFYTEEEL---KSLHTSEQKEENQPEQPAKKYTPGVDEAVIGGEQFNTHNTFETFVIGPGNRFP-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVLDNNPDAKVIYTSSEKFTNEFIKSIRD--NKTERFREKYRNIDVLLIDDIQFIQNKEQTQEEFFHTFNELHQANKQIVISSDRPPKEIAKLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIGEENLNIPTE--ALTYIANQIQSNIRELEGALTRVLAFSKLQGQPITTELTAEALKDIIQAPKSKKITIQDIQ-------KIVGQYYSVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKIVKDIQNDPTFKQEVENL 448
>gi|118444635|ref|YP_879298.1| chromosomal replication initiation protein [Clostridium novyi NT] >gi|166201879|sp|A0Q3U6|DNAA_CLONN Chromosomal replication initiator protein dnaA >gi|118135091|gb|ABK62135.1| chromosomal replication initiator protein DnaA [Clostridium novyi NT] (448 aa)
Score = 473, Expect = 2.5e-45, Identities = 142/447 (31%), Positives = 247/447 (55%)
  Q:     5 AQIKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTL---EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           AQ+K+ +      I+ E    +F N ++   S   + +  + + V NDF + +  + YK++      +  +   N+ F IT EE   N++L         +   E+   L+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +Q  P   ++Y+ +E F  ++  +I +   K EEF+N + NVD+LLIDDIQF+  KE+  E FF+ FN L   +K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK+ ++N    N  + +IA +  S+IR LEG L +I  +  L N + +  +  E ++ II S+ + +I   L+Q       + +C  + +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+  +D++  K
  S:     3 AQLKQLWTKTLNIIKGELTEVSF-NTWIKSISPISMNENTIKLEVPNDFTRGILESRYKDLIINAIKLITSKKYNIEFSITSEEIFNNQQLKPKSSNDNIVVNDEMTSILNPKYTFDSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQNTPNAKVVYVSSEKFTNELINSIKD--DKNEEFRNKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNALYEADKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRIAIL---KKKADVENLDIPNEVMVYIATKIKSNIRELEGALIRIVAYSSLTNREISVDLAAEALKDIISSEQNKQITIELIQ-------DIVCNYFNLKIQELKSSRRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNILKKDESLRNVIDDLNKK 444
>gi|110803386|ref|YP_697352.1| chromosomal replication initiation protein [Clostridium perfringens SM101] >gi|123047633|sp|Q0SWX6|DNAA_CLOPS Chromosomal replication initiator protein dnaA >gi|110683887|gb|ABG87257.1| chromosomal replication initiator protein DnaA [Clostridium perfringens SM101] (457 aa)
Score = 473, Expect = 2.5e-45, Identities = 139/440 (31%), Positives = 244/440 (55%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPK-------------TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           IIK EI     +E  +N ++   +   I D  + + V N+F K +    YK++  +   I  +    + F  + + +  KE    +++ K             + E++ TL+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +Q  P+  ++Y+ +E F  ++  AI +   K EEF+N +  VD+LLIDDIQF+  KE+  E FF+ FN L+ +NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  +  L N D +  +  E ++ II +     +    +Q       ES+   Y +  + + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K+DE L++ +++I  K 
  S:    15 IIKGEI-----SEISFNTWIKSCTPISISDNILKLSVPNEFTKGILDTRYKDLLIQALKIVTSRKFKIEFYLESDLEEEKENEEKQKEEKKDNTNDVDGSIVVSDEMSATLNPKYTFQSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKD--DKNEEFRNKYRKVDVLLIDDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDFETRMAILKKKADVEGLSVP--NEVMVYIATKIKSNIRELEGALIRIIAYSSLTNRDVSVDLASEALKDIISNKESAPVTVKTIQ-------ESVANYYNLRIEDLKSQRRTRNIAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDITKKL 454
>gi|116617175|ref|YP_817546.1| chromosomal replication initiator protein DnaA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096022|gb|ABJ61173.1| DNA replication ATPase initiation [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (448 aa)
Score = 473, Expect = 3.0e-45, Identities = 140/434 (32%), Positives = 220/434 (50%)
  Q:    13 IIKKEIEKEFQNENF-------YNNYVLDSSIFKIKDENVYILVKNDFVKEV---FTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEI---------NPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEI-VSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           I K+E+  + Q E F       ++ Y+       + D ++ + V +D  +++   + +EY   F +            F ++  +  I  +L   E KP T+              L+  FTFE + IG  N+NA+  A    +E    +   LIYG  GLGKTHL+ A+GN +    P  ++ Y   EDFL    +++  G      FK  + +VDLLL+DDIQF + KEK+ E FFN FN L    K IVMTSDKLPT +  +  R+ SRF +G+ + I KPD  + +  I++N+ +S   +   N  +E IA + +S++R+LEG  +K    L     P      ++I   +  +  ++I V  + Q+  D  +++I          + S  R K     R V MY+ R   N S  +IG  F  R+H++VL A   +  K +SD   K  LD
  S:     5 ITKEELWSKVQAEFFTKLGRVTFSTYIEPLKPLTLGDTSLTLAVPSDMAQDIIDQWDSEYSMDFVQ------------FAMSIADGFIKPDLQVAEAKPTTIPTFSDNLSFTRESDLNPDFTFEKFVIGSGNENAYAVARAVADEPGQVYNPYLIYGGVGLGKTHLMQAIGNAYAVSTPSAHIKYATAEDFLNDFTESLRAGDGATAAFKQEYRSVDLLLVDDIQFWSGKEKVQEEFFNTFNVLTKNGKQIVMTSDKLPTEIVDLQTRLTSRFEAGIMMDIQKPDLPT-RVAILQNLSESDGLD-IPNDVLELIAEKIDSNVRSLEGAFHKFEASLRYMNKPATKETAQQILGDLNINQGFKITVERIQQVVADYYMQTI--------DDLKSSSRKKDLVTARHVAMYLTRTLTNESLPDIGRSFGGRDHSSVLHATTKITEKSESDSRTKEMLD 438
>gi|28376975|ref|NP_783867.1| chromosomal replication initiation protein DnaA [Lactobacillus plantarum WCFS1] >gi|38257539|sp|Q890K8|DNAA_LACPL Chromosomal replication initiator protein dnaA >gi|28269806|emb|CAD62703.1| chromosomal replication initiation protein DnaA [Lactobacillus plantarum WCFS1] (455 aa)
Score = 472, Expect = 3.1e-45, Identities = 118/343 (34%), Positives = 190/343 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L+ ++TF+ + IG  N+ A  AA +  EE    +  L  YG  GLGKTHL+HA+GNK ++  P  N+ Y+ +E F  ++  AI     K E F+  + NVDLLL+DDIQF  NKE   E FF+ FN L   +K IV+TSD+LP  + ++ DR++SRF  GLS+ I  PD E+   I+        I+ P   L+  +IA + +S++R LEG L ++  +  L+N      +  + ++S+        + S L +++  +I E +   + V    +  KKRNKQ    R++ MY+ RE    S   IG+ F  ++H TV+ A   +   +K+D +L+  + ++  + 
  S:   119 LNPKYTFDTFVIGKGNQMAHAAALVVSEEPGTMYNPLFFYGGVGLGKTHLMHAIGNKLLETDPTSNIKYVTSESFTNELINAIQT--KKQEAFREEYRNVDLLLVDDIQFFANKEATQEEFFHTFNALYEDDKQIVLTSDRLPNEIPQLQDRLVSRFKWGLSVDITPPDLETRIAILRNKADLEGIEIPDDTLS--YIAGQIDSNVRELEGALARVQAYSRLNNSPITTSLVADALKSL-------HLSSKLSEVSIPVIQEKVAKYFHVTMADLKGKKRNKQIVIPRQIAMYLSRELTESSLPRIGNEFGGKDHTTVIHAHDKITKALKTDAELQKAVGDLTGQL 453
>gi|196235396|ref|ZP_03134199.1| chromosomal replication initiator protein DnaA [Thermus aquaticus Y51MC23] >gi|196220658|gb|EDY15274.1| chromosomal replication initiator protein DnaA [Thermus aquaticus Y51MC23] (441 aa)
Score = 472, Expect = 3.2e-45, Identities = 115/351 (32%), Positives = 189/351 (53%)
  Q:   101 PKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           P+  +    L+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP   + Y+ TE F  ++  AI E   ++ EF+  + +VDLLL+DDIQF+  KE+  E FF+ FN L   +K I+++SD+ P   L ++ R+ SRF  GL   I  PD E+   I+  N ++  ++       +E+IA +  S+IR LEG L ++  +  L+ V+    +  + +  I             V+++P  I+  +   +G+  + ++   R K+    R++ M+++RE    S  EIG  F  R+H TVL AI+ V+   +SD +++A L  +  K
  S:    98 PQADQGKSKLNPKYTFENFVVGPNNNLAHAAAVAVAESPGKAYNPLFIYGGVGLGKTHLMHAVGHSVAKRFPSLKIEYVSTETFTNELINAIRE--DRMAEFRERYRSVDLLLVDDIQFIAGKERTQEEFFHTFNALFEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQRGLR--IGEDVLEYIARQVTSNIRELEGALMRVVAYASLNGVELTRQVAAKALSDIFAPRE--------VEVDPQEIVRVVAEHFGLRPEDLVGGGRRKEVVLPRQMAMFLVRELTRASLPEIGQLFGGRDHTTVLYAIQKVQELSESDREVQAILRTLKEK 439
>gi|168207736|ref|ZP_02633741.1| chromosomal replication initiator protein DnaA [Clostridium perfringens E str. JGS1987] >gi|170660929|gb|EDT13612.1| chromosomal replication initiator protein DnaA [Clostridium perfringens E str. JGS1987] (457 aa)
Score = 472, Expect = 3.9e-45, Identities = 139/440 (31%), Positives = 244/440 (55%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPK-------------TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           IIK EI     +E  +N ++   +   I D  + + V N+F K +    YK++  +   I  +    + F  + + +  KE    +++ K             + E++ TL+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +Q  P+  ++Y+ +E F  ++  AI +   K EEF+N +  VD+LLIDDIQF+  KE+  E FF+ FN L+ +NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  +  L N D +  +  E ++ II +     +    +Q       ES+   Y +  + + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K+DE L++ +++I  K 
  S:    15 IIKGEI-----SEISFNTWIKSCTPISISDNILKLSVPNEFTKGILDTRYKDLLIQALKIVTSRKFKIEFYLESDLEEEKENEEKQKEQKKDNTNDVDGSIVVSDEMSATLNPKYTFQSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKD--DKNEEFRNKYRKVDVLLIDDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDFETRMAILKKKADVEGLNVP--NEVMVYIATKIKSNIRELEGALIRIIAYSSLTNRDVSVDLASEALKDIISNKESAPVTVKTIQ-------ESVANYYNLRIEDLKSQRRTRNIAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDITKKL 454
>gi|172039681|ref|YP_001799395.1| chromosomal replication initiator protein [Corynebacterium urealyticum DSM 7109] >gi|171850985|emb|CAQ03961.1| chromosomal replication initiator protein [Corynebacterium urealyticum DSM 7109] (586 aa)
Score = 471, Expect = 4.3e-45, Identities = 110/344 (31%), Positives = 183/344 (53%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDP-NEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSD 438
           PT +      + +  L+ ++TFE++ IG  N+ A  A     E     +  L I+G +GLGKTHLLHA+G+   +L P   + Y+ +E+       +I+    + EEFK  + N+D+L++DDIQFL  KE   E FF+ FN L+  NK IV++SD+ P  L  ++DR+ +RF  GL   +  PD E+  ++ I + K +          +E IA R+ + IR LEG L ++  +     +P  +   E  +R I+  D         VQ+ P +II+ +   + +    ++ K R K+F   R++ MY+ RE  +LS  ++G  F  R+H TV+ A + +  ++  D
  S:   232 PTADTDEGDRDSDTLLNKKYTFESFVIGGSNQFAHAACRAVAEAPARAYNPLFIWGESGLGKTHLLHAIGHYAKELQPDMRVRYVSSEELTNDFINSIAN--DRREEFKREYRNLDMLIVDDIQFLQGKESTQEEFFHTFNALHQANKQIVLSSDRPPRQLTTLEDRLRTRFEGGLITDVQTPDLET--RMAILSRKAAAEGTTLPEDVLELIASRYETSIRELEGALIRVTAYCSLGKEPITKQAAEIALRDIMPVDD--------VQMTPQVIIDVVSSYFDLTVDELVGKGRTKRFVQARQIAMYLCRELTDLSLPKLGQAFGGRDHTTVMHAERRIREQLTED 566
>gi|30018279|ref|NP_829910.1| chromosomal replication initiation protein [Bacillus cereus ATCC 14579] >gi|167937957|ref|ZP_02525032.1| chromosomal replication initiation protein [Bacillus cereus AH1134] >gi|168137564|ref|ZP_02580793.1| chromosomal replication initiation protein [Bacillus cereus B4264] >gi|38257412|sp|Q81JD5|DNAA_BACCR Chromosomal replication initiator protein dnaA >gi|29893819|gb|AAP07111.1| Chromosomal replication initiator protein dnaA [Bacillus cereus ATCC 14579] (446 aa)
Score = 471, Expect = 4.7e-45, Identities = 141/433 (32%), Positives = 239/433 (55%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI---TKEEKDINKELPTIEEKPKTLEI----NPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI   ++ E+DI  +LP ++  P   +        L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S         I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ I
  S:    13 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEDI--DLPPVKPNPAQDDSAHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIY------DIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEI 441
>gi|168143808|ref|ZP_02587037.1| chromosomal replication initiation protein [Bacillus cereus G9842] (446 aa)
Score = 471, Expect = 4.7e-45, Identities = 141/433 (32%), Positives = 239/433 (55%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI---TKEEKDINKELPTIEEKPKTLEI----NPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI   ++ E+DI  +LP ++  P   +        L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S         I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ I
  S:    13 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEDI--DLPPVKRNPAQDDSAHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIY------DIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEI 441
>gi|118475779|ref|YP_892930.1| chromosomal replication initiation protein [Bacillus thuringiensis str. Al Hakam] >gi|118415004|gb|ABK83423.1| chromosomal replication initiator protein [Bacillus thuringiensis str. Al Hakam] (465 aa)
Score = 471, Expect = 5.1e-45, Identities = 139/433 (32%), Positives = 233/433 (53%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI-----TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI      +EE D+    P   +          L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S         I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ I
  S:    32 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPAKPNAAQDDSNHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIY------DIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEI 460
>gi|83814277|ref|YP_445493.1| chromosomal replication initiator protein DnaA [Salinibacter ruber DSM 13855] >gi|83755671|gb|ABC43784.1| chromosomal replication initiator protein DnaA [Salinibacter ruber DSM 13855] (564 aa)
Score = 470, Expect = 5.9e-45, Identities = 109/343 (31%), Positives = 190/343 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L   +TF+ +  G  N+ A  AA    +E  + N+  LL+YG  GLGKTHL  AV N  ++    + ++Y+ ++ F  +  +++ E   ++  F + +   DLL++DD+QF   KEK  E FF+IFN L+   K I + +D+ P  +  I++R++SRF  GLS  I +PD E+  +I I   K +R     S   +E IA R +S++R LEG L ++    L  +D +  ++ +  R  +   +D         +N D IIE +   + ++K  ++S+ R +  +  R++ MY+ RE  + SY+ IGS F  R+H+TV+ A + +E  ++SD +L+  + ++ S  
  S:   221 LRPEYTFDEFVEGDGNRLARSAAFAVAQEPGSTNYNPLLVYGGVGLGKTHLAQAVANYALEHNTAERVLYVSSDRFTSQFVQSVRE--NRIAAFSSYYRQADLLIVDDVQFFGEKEKTQEEFFHIFNDLHQNGKQIFLCADRPPAEIPGIEERLLSRFQWGLSADIQRPDLET--RIAILQRKAARQDIAVSPDVLELIAQRIDSNVRQLEGALTRLT--ALVQLD-DRTLDLDTARRFLREHTD----EGADALNADDIIEQVAEYFRLEKGDLLSRSRKQTVAQARQIAMYLCRELTDESYDHIGSRFGGRDHSTVIHAYRKIEEDLESDTELQDDISSLQSNL 555
>gi|192814041|ref|ZP_03042691.1| chromosomal replication initiator protein DnaA [Geobacillus sp. Y412MC10] >gi|192797163|gb|EDV73693.1| chromosomal replication initiator protein DnaA [Geobacillus sp. Y412MC10] (396 aa)
Score = 469, Expect = 7.3e-45, Identities = 115/359 (32%), Positives = 192/359 (53%)
  Q:    93 ELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ++   +  P+  +    L+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP   + Y+ TE F  ++  AI E   ++ EF+  + +VDLLL+DDIQF+  KE+  E FF+ FN L   +K I+++SD+ P   L ++ R+ SRF  GL   I  PD E+   I+  N ++  ++       +E+IA +  S+IR LEG L ++  +  L+ V+    +  + +  I             V+++P  I+  +   +G+  + ++   R K+    R++ M+++RE    S  EIG  F  R+H TVL AI+ V+   +SD +++A L  +  K
  S:    45 QVDIFQAAPQADQGKSKLNPKYTFENFVVGPNNNLAHAAAVAVAESPGKAYNPLFIYGGVGLGKTHLMHAVGHSVAKRFPSLKIEYVSTETFTNELINAIRE--DRMAEFRERYRSVDLLLVDDIQFIAGKERTQEEFFHTFNALFEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQRGLR--IGEDVLEYIARQVTSNIRELEGALMRVVAYASLNGVELTRQVAAKALSDIFAPRE--------VEVDPQEIVRVVAEHFGLRPEDLVGGGRRKEVVLPRQMAMFLVRELTRASLPEIGQLFGGRDHTTVLYAIQKVQELSESDREVQAILRTLKEK 394
>gi|166032891|ref|ZP_02235720.1| hypothetical protein DORFOR_02612 [Dorea formicigenerans ATCC 27755] >gi|166027248|gb|EDR46005.1| hypothetical protein DORFOR_02612 [Dorea formicigenerans ATCC 27755] (462 aa)
Score = 469, Expect = 8.2e-45, Identities = 137/448 (30%), Positives = 257/448 (57%)
  Q:     4 LAQIKKKY--LIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINK-ELPTIE----EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEE-----FKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTES-----IKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           + ++K+K+  +I    +E E  N +F N ++    ++ + D+  YILV  D   E    +Y+       +        + F+++++  +N+    +I+    +K K+L     L+ ++TF+ + +G  N N   AASL + E+    +  L +YG  GLGKTHL+H++ +  +   P+K ++Y+ +E F  ++  A+  G T   E     F++ + N+D+LLIDDIQF+  KE   E FF+ FN L++  K I+++SDK P  ++ ++ R+ +RF  GL   I+ PD E+      KKI +++++K  IKN      +++IA    S+IR LEG LNK+   + L +N +P +I +  E ++ II SD       N  ++ P++I++ +   +G+    + SKKR+ + +  R++CMY++R   + +   IG+    ++H+TV   ++ +   ++SDE +   ++ I  K
  S:     1 MNEVKEKWPEIIEHLRVEHELLNVSF-NTWIKPLKVYDVIDDTAYILVNKDSSVEYIDKKYRLPLMVCIAEITGKEYEIQFVSEDDDKLNEIHNASIDNGQKKKTKSLAEKAGLNPKYTFDTFVVGG-NNNFAHAASLAVAESPGEVYNPLFLYGGVGLGKTHLMHSIAHFILDKNPKKKVLYVTSETFTNELIDALRNGKTAGNESAMLNFRDKYRNIDVLLIDDIQFIIGKESTQEEFFHTFNHLHTLGKQIIISSDKPPKDIETLESRLRTRFEWGLIADISSPDYETRMAILQKKIELDHLEKYNIKND----VLDYIAANVKSNIRELEGSLNKLIALYKLNNNNNPIDIALAAEALKDIISSD-------NRREVTPELILDIVADHFGITVADLKSKKRDSEIAVPRQICMYLMRTMTDTALKGIGAVLGGKDHSTVKYGVEKIAKDIESDEMMANTINIIKKK 458
>gi|126697567|ref|YP_001086464.1| chromosomal replication initiator protein [Clostridium difficile 630] >gi|145952517|ref|ZP_01801527.1| hypothetical protein CdifQ_04004269 [Clostridium difficile QCD-32g58] >gi|168695998|ref|ZP_02728275.1| chromosomal replication initiator protein [Clostridium difficile QCD-37x79] >gi|168714854|ref|ZP_02747131.1| chromosomal replication initiator protein [Clostridium difficile QCD-63q42] >gi|168724975|ref|ZP_02757252.1| chromosomal replication initiator protein [Clostridium difficile QCD-76w55] >gi|168732212|ref|ZP_02764489.1| chromosomal replication initiator protein [Clostridium difficile QCD-97b34] >gi|196124306|ref|ZP_03116055.1| chromosomal replication initiator protein [Clostridium difficile ATCC 43255] >gi|196160221|ref|ZP_03120782.1| chromosomal replication initiator protein [Clostridium difficile CIP 107932] >gi|196163220|ref|ZP_03123751.1| chromosomal replication initiator protein [Clostridium difficile QCD-23m63] >gi|115249004|emb|CAJ66815.1| chromosomal replication initiator protein [Clostridium difficile 630] (439 aa)
Score = 469, Expect = 8.5e-45, Identities = 135/423 (31%), Positives = 226/423 (53%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI--TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMS 450
           +N +  +    KI   ++ +L  +DF K++  N Y  + E+  S       N+ F+   KE  D+N +   +  +     + P L+ ++TF+ + IG  N+ A  A     E     +  L +YG  GLGKTHL+HA+G+  V       ++Y+ +E F  ++  +I +   K EEF+N + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  +  RI  P  N  + +IA    S+IR LEG L ++  +  L N   +  +  E ++ II +  + EI  N+++I      E +   + +  +   SKKR +  ++ R++ MY+ RE  +LS  +IG  F  R+H TV+ A   V   ++  E++K  +D I+S
  S:    23 FNTFFKNIVPLKIHLNDLILLAPSDFNKDILENRYLHLIEDAISQLSLKKYNIKFVLSEKEVADLNSDSTDLNYRV----LYPNLNPKYTFDTFVIGNSNRFAHAACVAVAESPAKAYNPLFLYGGVGLGKTHLMHAIGHHIVSQKKDSKVVYVSSEKFTNELINSIKD--DKNEEFRNKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNTLHEANKQIIISSDRPPKDIPTLEDRLRSRFEMGLITDIQAPDFETRIAILRKKAQLERIDVP--NEVMSYIAKNIKSNIRELEGALTRVVAYSSLSNRVISFDLATEALKDIITTSKNEEI--NVLRIK-----EKVSSVFNLKMEDFNSKKRTRSIAYPRQIAMYLTRELTDLSLPKIGEEFGGRDHTTVIHAHDKVSKDIEESEEIKTKIDKIIS 435
>gi|168187277|ref|ZP_02621912.1| chromosomal replication initiator protein DnaA [Clostridium botulinum C str. Eklund] >gi|169294801|gb|EDS76934.1| chromosomal replication initiator protein DnaA [Clostridium botulinum C str. Eklund] (449 aa)
Score = 467, Expect = 1.2e-44, Identities = 146/448 (32%), Positives = 249/448 (55%)
  Q:     4 LAQIKKKYL-IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEK-DINKELPTIEEKPKTL---EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L Q+  K L IIK E+      E  +N ++   S   I +  + + V NDF + +  + YK++      +  +   N+ F IT EE  + N+   T    P  +   E+   L+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +Q  P   ++Y+ +E F  ++  +I +   K EEF+N + NVD+LLIDDIQF+  KE+  E FF+ FN L   +K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK+ ++N    N  + +IA +  S+IR LEG L +I  +  L N + +  +  E ++ II S+ + ++   L+Q       + +C  + +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+  +D++  K
  S:     5 LEQLWSKTLNIIKGEL-----TEVSFNTWIKSISPISITENTIKLEVPNDFTRGILESRYKDLIINAIKLITSKKYNIEFSITSEEIFNNNQTNRTKSNNPNIVVNDEMTSILNPKYTFDSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQNTPNAKVVYVSSEKFTNELINSIKD--DKNEEFRNKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNALYEADKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRIAIL---KKKADVENLDIPNEVMVYIATKIKSNIRELEGALIRIVAYSSLTNREISVDLAAEALKDIISSEQNKQVTIELIQ-------DIVCNYFNLKIQELKSSRRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNILKKDESLRNVIDDLNKK 445
>gi|30260196|ref|NP_842573.1| chromosomal replication initiation protein [Bacillus anthracis str. Ames] >gi|47525255|ref|YP_016604.1| chromosomal replication initiation protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183040|ref|YP_026292.1| chromosomal replication initiation protein [Bacillus anthracis str. Sterne] >gi|49479264|ref|YP_034361.1| chromosomal replication initiation protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145208|ref|YP_081620.1| chromosomal replication initiation protein [Bacillus cereus E33L] >gi|65317469|ref|ZP_00390428.1| COG0593: ATPase involved in DNA replication initiation [Bacillus anthracis str. A2012] >gi|165873037|ref|ZP_02217658.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0488] >gi|166997070|ref|ZP_02263529.1| chromosomal replication initiation protein [Bacillus cereus AH820] >gi|167635044|ref|ZP_02393361.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0442] >gi|167641739|ref|ZP_02399982.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0193] >gi|170689462|ref|ZP_02880652.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0465] >gi|170707519|ref|ZP_02897972.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0389] >gi|177655268|ref|ZP_02936822.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0174] >gi|190569280|ref|ZP_03022174.1| chromosomal replication initiator protein DnaA [Bacillus anthracis Tsiankovskii-I] >gi|196036095|ref|ZP_03103495.1| chromosomal replication initiator protein DnaA [Bacillus cereus W] >gi|196041966|ref|ZP_03109253.1| chromosomal replication initiator protein DnaA [Bacillus cereus NVH0597-99] >gi|196045507|ref|ZP_03112738.1| chromosomal replication initiator protein DnaA [Bacillus cereus 03BB108] >gi|38257418|sp|Q81W35|DNAA_BACAN Chromosomal replication initiator protein dnaA >gi|61212525|sp|Q63HG7|DNAA_BACCZ Chromosomal replication initiator protein dnaA >gi|61212595|sp|Q6HQ03|DNAA_BACHK Chromosomal replication initiator protein dnaA >gi|30253517|gb|AAP24059.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. Ames] >gi|47500403|gb|AAT29079.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. 'Ames Ancestor'] >gi|49176967|gb|AAT52343.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. Sterne] >gi|49330820|gb|AAT61466.1| chromosomal replication initiator protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978677|gb|AAU20227.1| chromosomal replication initiator protein [Bacillus cereus E33L] >gi|164711249|gb|EDR16805.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0488] >gi|167510293|gb|EDR85696.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0193] >gi|167529518|gb|EDR92268.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0442] >gi|170127515|gb|EDS96389.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0389] >gi|170666564|gb|EDT17337.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0465] >gi|172080195|gb|EDT65287.1| chromosomal replication initiator protein DnaA [Bacillus anthracis str. A0174] >gi|190559587|gb|EDV13578.1| chromosomal replication initiator protein DnaA [Bacillus anthracis Tsiankovskii-I] >gi|195991262|gb|EDX55230.1| chromosomal replication initiator protein DnaA [Bacillus cereus W] >gi|196023714|gb|EDX62390.1| chromosomal replication initiator protein DnaA [Bacillus cereus 03BB108] >gi|196027221|gb|EDX65841.1| chromosomal replication initiator protein DnaA [Bacillus cereus NVH0597-99] (446 aa)
Score = 466, Expect = 1.6e-44, Identities = 139/433 (32%), Positives = 233/433 (53%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI-----TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI      +EE D+    P   +          L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S         I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ I
  S:    13 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPAKPNAAQDDSNHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIY------DIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEI 441
>gi|134297882|ref|YP_001111378.1| chromosomal replication initiation protein [Desulfotomaculum reducens MI-1] >gi|172044200|sp|A4J0F0|DNAA_DESRM Chromosomal replication initiator protein dnaA >gi|134050582|gb|ABO48553.1| chromosomal replication initiator protein DnaA [Desulfotomaculum reducens MI-1] (441 aa)
Score = 466, Expect = 1.8e-44, Identities = 134/425 (31%), Positives = 228/425 (53%)
  Q:    18 IEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +EK+  N++ +  ++         D  + I V + F K    + Y  I ++ +   M+  +++ FI   + ++++  P  E   +   IN  L+ R+TF+ + +G  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  ++      + Y+ +E F  ++  +I +  T   EF+N + ++D+LLIDDIQFL  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   +  PD E+   I+ +  +   IKN   +  I +IA +  S+IR LEG L ++  F  L+  D    +  E ++ +I       I + L       I++++   YG+  + + +KKR +  +F R+V MY+ RE  +LS  +IG  F  R+H TVL A   + T + SD  L+
  S:    16 LEKQV-NKHSFETWLTKCKPVAFYDNTIIIEVPDHFSKSWLADRYAPIIKQAYESIMHQEISLQFILAGQ-EVDQPKPK-ERSSEETYIN-ILNPRYTFDTFVVGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILENNQNLKVAYVTSEKFTNELINSIRDDQTV--EFRNKYRSMDILLIDDIQFLEKKERTQEEFFHTFNTLYEANKQIIISSDRPPKEIATLEDRLRSRFEWGLITDMQSPDYETRVAILRKKAQLEAIKN-IPDETIAYIADKIQSNIRELEGALIRVSAFSSLEQRDATPQLAAEVLKDVIAPSKPKIITTPL-------IMQTVADFYGLRIEDLKAKKRTRSVAFPRQVAMYLARELTDLSLPKIGDEFGGRDHTTVLHACDKITTDLSSDPVLQ 429
>gi|42779082|ref|NP_976329.1| chromosomal replication initiation protein [Bacillus cereus ATCC 10987] >gi|166982557|ref|ZP_02253989.1| chromosomal replication initiation protein [Bacillus cereus AH187] >gi|168160934|ref|ZP_02596167.1| chromosomal replication initiation protein [Bacillus cereus H3081.97] >gi|61212644|sp|Q73FK5|DNAA_BACC1 Chromosomal replication initiator protein dnaA >gi|42734997|gb|AAS38937.1| chromosomal replication initiator protein DnaA [Bacillus cereus ATCC 10987] (446 aa)
Score = 465, Expect = 2.0e-44, Identities = 139/433 (32%), Positives = 233/433 (53%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI-----TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI      +EE D+    P   +          L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S         I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ I
  S:    13 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPSKPNSAQDDSNHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIY------DIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEI 441
>gi|192809501|ref|ZP_03038176.1| chromosomal replication initiator protein DnaA [Geobacillus sp. Y412MC10] >gi|192802172|gb|EDV78677.1| chromosomal replication initiator protein DnaA [Geobacillus sp. Y412MC10] (448 aa)
Score = 465, Expect = 2.1e-44, Identities = 131/424 (30%), Positives = 222/424 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINP------TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ++ +   +    I D +V I     F  E   + Y ++        +   ++V F+ +E K      P  ++    LEI+        L+ ++TF+ + IG  N+ A  AASL + E     +  L +YG  GLGKTHL+HA+G+  ++  P   ++YI +E F  +   +I +   + E F+N + NVD+LLIDDIQFL  KE   E FF+ FN L+ + K I+++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ +  K   +  P  N A+ +IA + +++IR LEG L ++  +  L N D    +  E ++ II S     I    +Q       + +   Y +  +   ++KR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D++L   ++NI  K
  S:    25 FDTWFKATKALTINDHSVVISAPTTFAVEWLESRYTKLVSATVLEVVGKQVDVRFVIEETK---AHEPAPQQPSPPLEISGEEIQSHMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMHAIGHYILEHNPSSKVVYISSEKFTNEFINSIRD--NRAESFRNKYRNVDILLIDDIQFLAGKESTQEEFFHTFNALHEERKQIIISSDRPPKEIPTLEERLRSRFEWGLITDIQPPDLETRIAILRKKAKAENLDIP--NEAMMYIANQIDTNIRELEGALIRVVAYSSLTNQDVTTHLAAEALKDIIPSSRPRMITIQDIQ-------QKVGEYYNLRLEDFKARKRTKAVAFPRQIAMYLSRELTDYSLPKIGEAFGGRDHTTVIHAHEKITQSLKTDQELFKVVNNITEK 443
>gi|77358983|ref|YP_338558.1| DNA replication initiator [Pseudoalteromonas haloplanktis TAC125] >gi|76873894|emb|CAI85115.1| DNA replication initiator protein, transcriptional regulator of replication and other genes; binds DNA at DnaA boxes, binds cardiolipin and other acidic phospholipids, binds ATP [Pseudoalteromonas haloplanktis TAC125] (474 aa)
Score = 465, Expect = 2.4e-44, Identities = 123/366 (33%), Positives = 204/366 (55%)
  Q:    84 TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           T+ ++   +  P +E  PK+ E    +   +TF+++  G  N+ A KAA+  + +N    +  + IYG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD L+IDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  ++ ++DR+ SRF  GL+I I  P+ E+   I+++  ++S+I  P       FIA +  S++R LEG LN++  +      P  I   +E +R ++       +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + V++      ++K    N++
  S:   114 TQAKQQSRQPKPVVEPAPKS-EYKSNIKENYTFDSFVEGKSNQLA-KAAATQVADNPGAAFNPVFIYGGTGLGKTHLLHAVGNGILANKPDAKIVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALMIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIEGVEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSKINLPHE--VAFFIAKKLRSNVRELEGALNRVIANANFTGRPISIDFVKEALRDLL------ALQDKLVTI--DNIQRTVAEYYRIRISDLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKSLRDESHEIKEDYQNLI 469
>gi|170764020|ref|ZP_02637629.2| chromosomal replication initiator protein DnaA [Clostridium perfringens B str. ATCC 3626] >gi|170710061|gb|EDT22243.1| chromosomal replication initiator protein DnaA [Clostridium perfringens B str. ATCC 3626] (342 aa)
Score = 464, Expect = 3.1e-44, Identities = 118/347 (34%), Positives = 202/347 (58%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           ++ TL+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +Q  P+  ++Y+ +E F  ++  AI +   K EEF+N +  VD+LLIDDIQF+  KE+  E FF+ FN L+ +NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  +  L N D +  +  E ++ II +     +    +Q       ES+   Y +  + + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K+DE L++ +++I  K 
  S:     1 MSATLNPKYTFQSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKD--DKNEEFRNKYRKVDVLLIDDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFECGLIADIQPPDFETRMAILKKKADVEGLNVP--NEVMVYIATKIKSNIRELEGALIRIIAYSSLTNRDVSVDLASEALKDIISNKESAPVTVKTIQ-------ESVANYYNLRIEDLKSQRRTRNIAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDITKKL 339
>gi|75761786|ref|ZP_00741721.1| Chromosomal replication initiator protein dnaA [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490719|gb|EAO54000.1| Chromosomal replication initiator protein dnaA [Bacillus thuringiensis serovar israelensis ATCC 35646] (447 aa)
Score = 464, Expect = 3.3e-44, Identities = 137/412 (33%), Positives = 228/412 (55%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI---TKEEKDINKELPTIEEKPKTLEI----NPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVS--NLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEA 427
           KE+EK+    + Y  ++  ++   +K + + I   N+F ++   + Y E+  E       + L + FI   ++ E+DI  +LP ++  P   +        L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S  ++ +   D+        Y V  +   +KKR K  +F R++ MY+ RE  + S   IG  F  R+H TV+ A
  S:    32 KELEKKVSKPS-YETWLKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEDI--DLPPVKRNPAQDDSAHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIYDIQKAVGDV--------YQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPNIGEEFGGRDHTTVIHA 439
>gi|148927276|ref|ZP_01810846.1| chromosomal replication initiator protein DnaA [candidate division TM7 genomosp. GTL1] >gi|147887335|gb|EDK72789.1| chromosomal replication initiator protein DnaA [candidate division TM7 genomosp. GTL1] (486 aa)
Score = 463, Expect = 3.4e-44, Identities = 132/426 (30%), Positives = 226/426 (53%)
  Q:    27 FYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKE---------EKDINKELPTIEEKPKT-LEINP---TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           F N  +L+ S     D  + I V N F K  F  ++ ++  E  +    +N+ V  IT E            + ++LPT+   P     ++P   +L+ R+TFE Y +G  N  A+ A     +     +  + IYG  GLGKTHL+ AVGN+         ++Y+ TE F+ +  + I     K + F + + NVD+L+IDDIQF+  KEK  E FF+ FN L+  NK I+++SDK P S+  + +R+ SRF  G++I I  PD E+   II     ++ I+ P     +E++A    ++IR LEG LN++  F  +  V P+           I++ +   ++ ++ Q  P       II+     + ++ K ++S KR+K     R++ MY+LR +++LS+ +I      ++H T + +I  +E  +K D  ++  + +I  K 
  S:    63 FKNTELLEQS----SDGGIIIGVPNIFAKRQFEVKFDKMINETLA---KNNIEVASITYEVSTQKKKAVRDRVTEKLPTVNATPTGGHSLSPPGNSLNPRYTFETYIVGSNNDLAYAACQAVAKSPGRKYNPIFIYGGVGLGKTHLIQAVGNEIAHTDRAARILYVNTETFVNEFLEYIR---FKKKGFSDRYRNVDVLIIDDIQFIAGKEKTQEEFFHTFNVLHQANKQIIISSDKPPRSIPTLTERLRSRFEWGMAIDIQIPDFETRSAIIETKASQAGIELPRE--TVEYMASNIKTNIRELEGALNQLLAFCEMRGVTPD-----------IQTATG--LIGDVRQARPHHLTAKQIIDRTAKHFQIEPKDILSPKRDKHIVVPRQIAMYLLRSELHLSFPKIAIELGRKDHTTAIHSIDKIEKAIKLDYLIREQVADIREKL 484
>gi|30065010|ref|NP_839181.1| chromosomal replication initiation protein [Shigella flexneri 2a str. 2457T] >gi|30043271|gb|AAP18992.1| replication initiation protein DnaA [Shigella flexneri 2a str. 2457T] (467 aa)
Score = 463, Expect = 3.7e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAACQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|158319060|ref|YP_001511567.1| chromosomal replication initiation protein [Alkaliphilus oremlandii OhILAs] >gi|167016896|sp|A8MEA0|DNAA_ALKOO Chromosomal replication initiator protein dnaA >gi|158139259|gb|ABW17571.1| chromosomal replication initiator protein DnaA [Alkaliphilus oremlandii OhILAs] (451 aa)
Score = 463, Expect = 3.9e-44, Identities = 141/445 (31%), Positives = 237/445 (53%)
  Q:     4 LAQIKKKYL-IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLE------------INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           L QI +K L +IK E+      E  +  ++    +  ++   + + V N F K++ T  Y  +         + N  + FI   E+ I+K     EE  K LE            ++  L+ ++TF+ + IG  N+ A  AASL + E+    +  L +YG  GLGKTHL+HA+G+  +Q  P+  ++Y+ +E F  ++  +I     +  EF+N F  +D+LL+DDIQF+  KE   E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  +   I  P  N  +  IA +  S+IR LEG L +I  +  L N +    +  E ++ +  S +         Q+N D+I E +   Y +  +   SKKR +  S+ R++ MY+ RE  +LS  +IG  F  R+H TV+ A + +   + +D+++K  ++ I
  S:     5 LPQIWEKTLNLIKPEL-----TEVSFTTWIKSIEVISLEGNTMILGVPNVFTKDILTARYATLISNALKQTTSKNFEIRFIVPSEEKISK----TEESQKKLEGSVNISVASDQFVSNNLNPKYTFDTFVIGNSNRFA-HAASLAVAESPAKAYNPLFLYGGVGLGKTHLMHAIGHFILQNNPKAKVVYVSSETFTNELINSIRH--DRNVEFRNRFRTIDVLLVDDIQFIAGKESTQEEFFHTFNALHESNKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRIAILYKKAQMENIDVP--NEVLTHIAKKIQSNIRELEGALIRIVAYSSLTNSEITVELASEALKELFSSKAR--------QLNIDLIKEVVANKYNMKIEDFNSKKRTRSISYPRQIAMYLSRELTDLSLPKIGEEFGGRDHTTVMHAHEKISKDILADDNIKEKIERI 444
>gi|152973855|ref|YP_001373372.1| chromosomal replication initiation protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189044630|sp|A7GJR9|DNAA_BACCN Chromosomal replication initiator protein dnaA >gi|152022607|gb|ABS20377.1| chromosomal replication initiator protein DnaA [Bacillus cereus subsp. cytotoxis NVH 391-98] (446 aa)
Score = 463, Expect = 4.0e-44, Identities = 139/432 (32%), Positives = 235/432 (54%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTLEIN----PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           E+EK+    + Y  ++  +    +K + + I+  N+F ++   + Y E+  E       + LN+ F I + + +   + P  + K    E N      L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II  +S  +I+S         I +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D  L+  ++ I
  S:    14 ELEKKVSKPS-YETWLKSTKAHALKKDTLTIIAPNEFARDWLESHYSELISETIYDITGAKLNIRFIIPQSQTEEEVDYPPAKAKKMNDESNHLPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPNAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMIYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDII-PNSKPKIISIY------DIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDSSLPKIGEEFGGRDHTTVIHAHEKISRLLKTDTQLQKQIEEI 441
>gi|138893680|ref|YP_001124133.1| chromosomal replication initiation protein [Geobacillus thermodenitrificans NG80-2] >gi|166201885|sp|A4IJ84|DNAA_GEOTN Chromosomal replication initiator protein dnaA >gi|134265193|gb|ABO65388.1| DnaA [Geobacillus thermodenitrificans NG80-2] (450 aa)
Score = 463, Expect = 4.2e-44, Identities = 136/436 (31%), Positives = 228/436 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTL--EIN----PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           EIE++    +F   ++  +    ++ + + I+  N+F ++   + Y  +  E         L V F I   + D   ELP+  +K +    E N      L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   AI +   + ++F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K      P  N  + +IA + +S+IR LEG L ++  +  L N +    +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D  L+  L  I  K 
  S:    14 EIERKISKPSF-ETWLKSTKAHSLRGDTLVIVAPNEFARDWLDSRYSHLIAETIYAITGEELAVKFIIPPNQADEKLELPSSAKKQRKPYEEANDFPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRD--NRPDDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGFDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLAAEALKDIIPSAKPKVITIQDIQ-------RVVGQHFNIKLEDFKAKKRTKSVAFPRQIAMYLSRELTDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDTQLQKHLKEIQEKL 447
>gi|23097456|ref|NP_690922.1| chromosomal replication initiation protein [Oceanobacillus iheyensis HTE831] >gi|38257607|sp|Q8EU88|DNAA_OCEIH Chromosomal replication initiator protein dnaA >gi|22775679|dbj|BAC11957.1| chromosomal replication initiation protein [Oceanobacillus iheyensis HTE831] (447 aa)
Score = 462, Expect = 4.4e-44, Identities = 136/437 (31%), Positives = 235/437 (53%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI---TKEEKDINKELPTIEEKPKTLEINPT-LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K+IE++    +F + ++ ++    ++ + + I   N+F ++   N+Y  +  +       S LN  FI   + EE +  K +P  ++   T +   + L+S++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+      P   ++Y+ +E F  +   AI +   K   F+N + N+D+LLIDDIQF+  KE   E FF+ FN L+ ++K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + N++IR LEG L ++  +  L N D +  +  + ++ II S    EI    +Q   +I+ E     Y +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   ++ D +L   ++ +  K 
  S:    13 KKIEEKLSKPSF-DTWLKNTKAEALEKDTLIISAPNEFARDWLENQYTNLISQMLLEVTGSELNTKFIIPDSLEEIEEQKPMPKPKQSTDTGDSPKSMLNSKYTFDTFVIGAGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVRDHNPNAKVVYLTSEKFTNEFINAIMD--NKSNHFRNKYRNIDVLLIDDIQFIAGKESTQEEFFHTFNALHGESKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILNKKAKAEGLDIP--NEVMLYIANQINTNIRELEGALIRVVAYSSLVNQDIDASLAADALKDIIPSSKPKEITIPAIQ---EIVAER----YHIRLEDFAAKKRTKSIAFPRQIAMYLSRELTDASLPKIGEEFGGRDHTTVIHAHEKISKMLEQDTELDRDIEELKEKL 444
>gi|170760502|ref|YP_001785336.1| chromosomal replication initiator protein DnaA [Clostridium botulinum A3 str. Loch Maree] >gi|169407491|gb|ACA55902.1| chromosomal replication initiator protein DnaA [Clostridium botulinum A3 str. Loch Maree] (445 aa)
Score = 462, Expect = 4.5e-44, Identities = 132/421 (31%), Positives = 232/421 (55%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL---EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +N ++   +   +++ ++ + V NDF K +  + YK++      +  +   N+ FI   E+ I K      EK   +   E++  L+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +   P+  ++Y+ +E F  ++  +I +   K  EF+N + N+D+LL+DDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +     ++  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S           Q+  DII E +   Y +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+  ++++
  S:    25 FNTWIKSINPISLENNSLKLAVPNDFTKGILESRYKDLIVNALKLLTSKKYNIDFIVTTEEKIEKNHNN--EKSNIVVNDEMSTMLNPKYTFDSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILHNNPKSQVVYVSSEKFTNELINSIKD--DKNVEFRNKYRNIDILLVDDIQFIAGKERTQEEFFHTFNALYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVEKLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKQTR-------QVTIDIIQEVVANYYNLKIEDLKSARRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLQNAINDL 438
>gi|167729008|emb|CAO79919.1| chromosomal replication initiation protein [Candidatus Cloacamonas acidaminovorans] (443 aa)
Score = 462, Expect = 4.6e-44, Identities = 136/429 (31%), Positives = 215/429 (50%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKI-NLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           N   +  +  D+ +  + D  + I V   F        YKE+  E          +V FIT+  ++ NKE    +   K +  N  L+ R+TF+ + +G  N  A+ AA    E     +  L IYG +G+GKTHL+ A+GN  ++     ++ YI +E F  ++   I     K+ EF+  F  VDLLL+DDI FL+ KE   E FF+ FN L    K IV+TSD+ P  +  ++ R+++RF SGL   +  PD E+   I+ +  +   +    S+    FIA    S +R LEG L +I  F   + ++P +I  +  + + I SD   E V +   I  D I E +C  YG+    ++ K R  Q +F R+V MY+    I  LS  +I  +++ ++H TVL A K VE + +  ED +  L+ I+   
  S:    18 NPQSFKTWFSDTRLVDMNDRELMIRVATQFSANYLNQNYKEVLGEISYGLYGRKYDVQFITQPHRNHNKEKDVQDYSIKRVSANVRLNERYTFDEFVVGKNNNFAYSAAKAVAESPGYTYNPLFIYGESGMGKTHLMQAIGNYILKEGRNCSIYYITSEAFTNEMIDGIRS--NKMPEFRAKFRKVDLLLMDDIHFLSRKEGTQEEFFHTFNALFENKKQIVLTSDRPPKDIPDLEKRLVTRFESGLLCDLKSPDFETRVAILRKKAEPENVV--LSDAIFNFIADNITSSVRALEGSLIRILAFSSYNKLNPEDI--DINLAAEILSDMISEKVHS---ITLDAITEKVCECYGITPAQLLEKTRKPQVAFPRQVAMYLANYLIPQLSLKDIAEYYNRKDHTTVLHAKKMVENQFREKEDFRIQLEEIIKNL 441
>gi|161486853|ref|NP_780810.2| chromosomal replication initiation protein [Clostridium tetani E88] (454 aa)
Score = 462, Expect = 4.7e-44, Identities = 146/439 (33%), Positives = 239/439 (54%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPK----TLEIN---------PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           IIK E+      E  +N ++      KI+ + V++ V NDF + +  + YK++      +  +   N+ FFIT EE        TI+E P       EIN           L+ ++TF+++ IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +Q      ++Y+ +E F  ++  +I +   K EEF+N + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S    ++   L+Q   DI+       + +  +   S +R +  +F R++ MY+ R+  + S  +IG  F  R+H TV+   + + T +K D+ L+  ++ + SK
  S:    15 IIKGEL-----TEVSFNTWIKSIEPIKIEHDTVFLSVPNDFTRGILDSRYKDLIINALKLITSKKYNIEFFITSEES----AFTTIKENPNLKIHNNEINNIVTSDGMSAMLNPKYTFDSFVIGNSNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQNNSNVKVVYVSSEKFTNELINSIKD--DKNEEFRNKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNALHEANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVEHLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKESNQVTIELIQ---DIVSSY----FNLRVEDFKSSRRTRNVAFPRQIAMYLCRKLTDNSLPKIGEEFGGRDHTTVIHGYEKISTALKKDDSLQKTVNELTSK 450
>gi|15893299|ref|NP_346648.1| chromosomal replication initiation protein [Clostridium acetobutylicum ATCC 824] >gi|38257741|sp|Q97N35|DNAA_CLOAB Chromosomal replication initiator protein dnaA >gi|15022818|gb|AAK77988.1|AE007513_1 DNA replication initiator protein, ATPase [Clostridium acetobutylicum ATCC 824] (446 aa)
Score = 462, Expect = 5.5e-44, Identities = 133/445 (29%), Positives = 234/445 (52%)
  Q:     8 KKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEK--DINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +K   IIK E+      E  +N ++   +   I  +++ + V N F KE+  N YK++      I      ++ F+   E+  + +++  T      T   +  L+ ++ F+++ IG  N+ A  A     E     +  L IYG  GLGKTHL+ A+G+  +   P+  ++Y+ +E F  ++  +I +   K  EF+N + NVD+LLIDD+QF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S  + +I  +L+Q       + +   + +  +   S +R K  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + + + +K D+DLK  ++ I  +F
  S:    10 QKTINIIKGEL-----TEVSFNTWIKSITPISIDKDSIRLSVPNQFTKEILENRYKDLIINSMKIITTKKYDIAFLISSEEALETDEDQETDTNNVNTDTSSSMLNPKYKFDSFVIGNSNRFAHAACLAVAEAPAKAYNPLFIYGGVGLGKTHLMQAIGHYILDNNPKAKVVYVSSEKFTNELINSIKD--DKNVEFRNKYRNVDVLLIDDVQFIAGKERTQEEFFHTFNALHENNKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRIAILKKKADVEHLNIP--NDVMVYIATQIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKQNKQITIDLIQ-------DVVSSYFNLRIEDFKSARRTKNIAFPRQIAMYLSRKLTDMSLPKIGEAFGGRDHTTVIHAYEKISSALKEDDDLKYTINEITKRF 443
>gi|170766828|ref|ZP_02901281.1| chromosomal replication initiator protein DnaA [Escherichia albertii TW07627] >gi|170124266|gb|EDS93197.1| chromosomal replication initiator protein DnaA [Escherichia albertii TW07627] (467 aa)
Score = 461, Expect = 5.7e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|15804296|ref|NP_290335.1| chromosomal replication initiation protein [Escherichia coli O157:H7 EDL933] >gi|15833891|ref|NP_312664.1| chromosomal replication initiation protein [Escherichia coli O157:H7 str. Sakai] >gi|168709443|ref|ZP_02741720.1| chromosomal replication initiation protein [Escherichia coli O157:H7 str. EC4045] >gi|168716634|ref|ZP_02748911.1| chromosomal replication initiation protein [Escherichia coli O157:H7 str. EC4206] >gi|168735275|ref|ZP_02767552.1| chromosomal replication initiation protein [Escherichia coli O157:H7 str. EC4115] >gi|168748582|ref|ZP_02773604.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4113] >gi|168753591|ref|ZP_02778598.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4401] >gi|168759888|ref|ZP_02784895.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4501] >gi|168772263|ref|ZP_02797270.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4196] >gi|168779924|ref|ZP_02804931.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4076] >gi|168786532|ref|ZP_02811539.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC869] >gi|168791010|ref|ZP_02816017.1| chromosomal replication initiation protein [Escherichia coli O157:H7 str. EC4042] >gi|168798737|ref|ZP_02823744.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC508] >gi|195936323|ref|ZP_03081705.1| chromosomal replication initiation protein [Escherichia coli O157:H7 str. EC4024] >gi|21362461|sp|Q8XBZ3|DNAA_ECO57 Chromosomal replication initiator protein dnaA >gi|12518541|gb|AAG58899.1|AE005601_5 DNA biosynthesis; initiation of chromosome replication; can be transcription regulator [Escherichia coli O157:H7 EDL933] >gi|13364112|dbj|BAB38060.1| replication initiation protein DnaA [Escherichia coli O157:H7 str. Sakai] >gi|187771794|gb|EDU35638.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4196] >gi|188016856|gb|EDU54978.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4113] >gi|189002469|gb|EDU71455.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4076] >gi|189358966|gb|EDU77385.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4401] >gi|189369914|gb|EDU88330.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC4501] >gi|189373439|gb|EDU91855.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC869] >gi|189378776|gb|EDU97192.1| chromosomal replication initiator protein DnaA [Escherichia coli O157:H7 str. EC508] (467 aa)
Score = 461, Expect = 6.4e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|121596425|ref|YP_988321.1| chromosomal replication initiator protein DnaA [Acidovorax sp. JS42] >gi|120608505|gb|ABM44245.1| chromosomal replication initiator protein DnaA [Acidovorax sp. JS42] (473 aa)
Score = 461, Expect = 6.6e-44, Identities = 121/337 (35%), Positives = 178/337 (52%)
  Q:    95 PTIEEKPK---TLEINPTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           PT +E P       +NP L    TFE    G  N+ A  AA  +     + +  L IYG  GLGKTHL+HAVGNK +Q  P   ++YI  E F+  + K+        ++FK  + ++DLLLIDD+QF  NK++  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +    + P   +A  F+A    S++R LEG L KI  +   N        E  I+   E+  D   + N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   124 PTADEAPAGAFRTRLNPAL----TFETLVEGTANRMARSAAMHVAGSPGHLYNPLFIYGGVGLGKTHLVHAVGNKLLQDRPDAKVLYIHAEQFVSDVVKSYQR--RTFDDFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLANIHERLVSRFDSGLTVAIEPPELEMRVAILINKARAEGSEMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFNQ------KEVSIQLAREALRDLLSIQNR-QISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 450
>gi|170018062|ref|YP_001723016.1| chromosomal replication initiator protein DnaA [Escherichia coli ATCC 8739] >gi|189044638|sp|B1IYP2|DNAA_ECOLC Chromosomal replication initiator protein dnaA >gi|169752990|gb|ACA75689.1| chromosomal replication initiator protein DnaA [Escherichia coli ATCC 8739] (467 aa)
Score = 461, Expect = 6.9e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|117625978|ref|YP_859301.1| chromosomal replication initiation protein [Escherichia coli APEC O1] >gi|115515102|gb|ABJ03177.1| chromosomal replication initiation protein [Escherichia coli APEC O1] (471 aa)
Score = 461, Expect = 6.9e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   136 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 466
>gi|82779231|ref|YP_405580.1| chromosomal replication initiation protein [Shigella dysenteriae Sd197] >gi|123769515|sp|Q329B6|DNAA_SHIDS Chromosomal replication initiator protein dnaA >gi|81243379|gb|ABB64089.1| DnaA [Shigella dysenteriae Sd197] (467 aa)
Score = 461, Expect = 6.9e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|16131570|ref|NP_418157.1| chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator [Escherichia coli str. K-12 substr. MG1655] >gi|74314016|ref|YP_312435.1| chromosomal replication initiation protein [Shigella sonnei Ss046] >gi|89110311|ref|AP_004091.1| chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator [Escherichia coli W3110] >gi|91213224|ref|YP_543210.1| chromosomal replication initiation protein [Escherichia coli UTI89] >gi|157155055|ref|YP_001465187.1| chromosomal replication initiation protein [Escherichia coli E24377A] >gi|157163182|ref|YP_001460500.1| chromosomal replication initiation protein [Escherichia coli HS] >gi|170679718|ref|YP_001746030.1| chromosomal replication initiator protein DnaA [Escherichia coli SMS-3-5] >gi|188495189|ref|ZP_03002459.1| chromosomal replication initiator protein DnaA [Escherichia coli 53638] >gi|191165774|ref|ZP_03027612.1| chromosomal replication initiator protein DnaA [Escherichia coli B7A] >gi|191170447|ref|ZP_03032000.1| chromosomal replication initiator protein DnaA [Escherichia coli F11] >gi|193063799|ref|ZP_03044886.1| chromosomal replication initiator protein DnaA [Escherichia coli E22] >gi|193069150|ref|ZP_03050107.1| chromosomal replication initiator protein DnaA [Escherichia coli E110019] >gi|194428054|ref|ZP_03060598.1| chromosomal replication initiator protein DnaA [Escherichia coli B171] >gi|194431303|ref|ZP_03063596.1| chromosomal replication initiator protein DnaA [Shigella dysenteriae 1012] >gi|194435690|ref|ZP_03067793.1| chromosomal replication initiator protein DnaA [Escherichia coli 101-1] >gi|399394|sp|P03004|DNAA_ECOLI Chromosomal replication initiator protein dnaA >gi|123387748|sp|Q1R4N5|DNAA_ECOUT Chromosomal replication initiator protein dnaA >gi|123745913|sp|Q3YWB2|DNAA_SHISS Chromosomal replication initiator protein dnaA >gi|167016899|sp|A7ZTQ8|DNAA_ECO24 Chromosomal replication initiator protein dnaA >gi|167016900|sp|A8A6G3|DNAA_ECOHS Chromosomal replication initiator protein dnaA >gi|145760|gb|AAB59149.1| DnaA protein (gtg start codon) >gi|2367267|gb|AAC76725.1| chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator [Escherichia coli str. K-12 substr. MG1655] >gi|73857493|gb|AAZ90200.1| DnaA [Shigella sonnei Ss046] >gi|85676342|dbj|BAE77592.1| chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator [Escherichia coli W3110] >gi|91074798|gb|ABE09679.1| chromosomal replication initiator protein DnaA [Escherichia coli UTI89] >gi|157068862|gb|ABV08117.1| chromosomal replication initiator protein DnaA [Escherichia coli HS] >gi|157077085|gb|ABV16793.1| chromosomal replication initiator protein DnaA [Escherichia coli E24377A] >gi|170517436|gb|ACB15614.1| chromosomal replication initiator protein DnaA [Escherichia coli SMS-3-5] >gi|188490388|gb|EDU65491.1| chromosomal replication initiator protein DnaA [Escherichia coli 53638] >gi|190904098|gb|EDV63809.1| chromosomal replication initiator protein DnaA [Escherichia coli B7A] >gi|190909255|gb|EDV68841.1| chromosomal replication initiator protein DnaA [Escherichia coli F11] >gi|192930514|gb|EDV83121.1| chromosomal replication initiator protein DnaA [Escherichia coli E22] >gi|192957474|gb|EDV87920.1| chromosomal replication initiator protein DnaA [Escherichia coli E110019] >gi|194413812|gb|EDX30090.1| chromosomal replication initiator protein DnaA [Escherichia coli B171] >gi|194420758|gb|EDX36834.1| chromosomal replication initiator protein DnaA [Shigella dysenteriae 1012] >gi|194425233|gb|EDX41217.1| chromosomal replication initiator protein DnaA [Escherichia coli 101-1] (467 aa)
Score = 461, Expect = 6.9e-44, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|153940298|ref|YP_001389370.1| chromosomal replication initiation protein [Clostridium botulinum F str. Langeland] >gi|168181116|ref|ZP_02615780.1| chromosomal replication initiator protein DnaA [Clostridium botulinum NCTC 2916] >gi|170756151|ref|YP_001779627.1| chromosomal replication initiator protein DnaA [Clostridium botulinum B1 str. Okra] >gi|166201878|sp|A7G9B0|DNAA_CLOBL Chromosomal replication initiator protein dnaA >gi|152936194|gb|ABS41692.1| chromosomal replication initiator protein DnaA [Clostridium botulinum F str. Langeland] >gi|169121363|gb|ACA45199.1| chromosomal replication initiator protein DnaA [Clostridium botulinum B1 str. Okra] >gi|182668171|gb|EDT80150.1| chromosomal replication initiator protein DnaA [Clostridium botulinum NCTC 2916] (445 aa)
Score = 461, Expect = 7.2e-44, Identities = 132/415 (31%), Positives = 228/415 (54%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL---EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +N ++   +   +++ ++ + V NDF K +  + YK++      +  +   N+ FI   E+ I K      EK   +   E++  L+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +   P+  ++Y+ +E F  ++  +I +   K  EF+N + N+D+LL+DDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +     ++  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S           Q+  DII E +   Y +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+
  S:    25 FNTWIKSINPISLENNSLKLAVPNDFTKGILESRYKDLIVNALKLLTSKKYNIDFIVTTEEKIEKNHNN--EKSNIVVNDEMSTMLNPKYTFDSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILHNNPKSQVVYVSSEKFTNELINSIKD--DKNVEFRNKYRNIDILLVDDIQFIAGKERTQEEFFHTFNALYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVEKLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKQTR-------QVTIDIIQEVVANYYNLKIEDLKSARRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLQ 432
>gi|146309668|ref|YP_001174742.1| chromosomal replication initiator protein DnaA [Enterobacter sp. 638] >gi|145316544|gb|ABP58691.1| chromosomal replication initiator protein DnaA [Enterobacter sp. 638] (483 aa)
Score = 460, Expect = 8.2e-44, Identities = 118/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   148 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIVARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 478
>gi|145592567|ref|YP_001156864.1| chromosomal replication initiator protein DnaA [Salinispora tropica CNB-440] >gi|145301904|gb|ABP52486.1| chromosomal replication initiator protein DnaA [Salinispora tropica CNB-440] (587 aa)
Score = 459, Expect = 1.0e-43, Identities = 116/332 (34%), Positives = 180/332 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           L+ ++ FE + IG  N+ A  AAS+ + E+    +  L IYGS+GLGKTHLLHA+G+    L    ++ Y+ TE+F      ++ +   K   F+  + +VD+LLIDDIQFL N+E+  E FF+ FN L++ NK IV+TSD+ P  L  ++DR+ +RF  GL   I  PD E+   I+ +   + R+  P     +EFIA R ++ IR LEG L ++  F  L        + EE +R  I   +  EI +       D I+ +    +GV  + +    R++     R+V MY+ RE  +LS   IG  F  R+H TV+ A + +  ++     L
  S:   249 LNPKYMFETFVIGSSNRFA-HAASVAVAESPAKAYNPLFIYGSSGLGKTHLLHAIGHYATTLGNANSVRYVSTEEFTNDFINSLRD--DKTSAFQRRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANKQIVITSDRSPKQLATLEDRLRTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPD--VLEFIASRVSNSIRELEGALIRVTAFASLTRSSVELSLAEEVLRDFIPDGTGPEITA-------DQIMVATADYFGVSLEDLRGHSRSRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVMHADRKIRQQMAERRSL 572
>gi|189423083|ref|YP_001950260.1| Chromosomal replication initiator DnaA [Geobacter lovleyi SZ] >gi|189419342|gb|ACD93740.1| Chromosomal replication initiator DnaA [Geobacter lovleyi SZ] (459 aa)
Score = 459, Expect = 1.1e-43, Identities = 133/431 (30%), Positives = 231/431 (53%)
  Q:    18 IEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEE-KPK-------------TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +EK    +N Y N++         + ++Y++V N F KE   + Y ++     S+  + N+ V F+ +E++  N  L  +E  +PK             T  +NP L+ R+TF+ +  G  N+ A  AA++ +  N    +  L IYG  GLGK+HLL+AVG+K +       + Y   E F+ ++   I     K++EF+  F ++D+LLIDDIQF+  KE+    FF+ FN L   +K IV+TSDK P  +  ++DR+ SRF  GL   I  PD E+   I+ +    +RI  P  +    F+A     +IR LEG+L ++  +  L ++     + +  ++ I        +V+   +I  ++I +++   +G+    + S+KR K F   R+V +++ R+    SY +IG+ F  ++H+TV+ A K +E  +  D  L   +D +
  S:    20 LEKVISPQN-YTNWIQPIQFSHADNHSLYLIVPNQFFKEWLEDNYVDLINSALSVTADKNMLVTFLIREKEADNAPLEIMEAPQPKESSTLKDLDQAKETTPLNP-LNPRYTFDQFVSGAGNQFA-HAAAMAVSHNPAITYNPLFIYGGVGLGKSHLLNAVGHKIISDNSSTKICYCSAEKFMHEMVNCIKL--NKMDEFRERFRSIDVLLIDDIQFITGKERTQVEFFHTFNALYESHKQIVITSDKFPREMPNLEDRLRSRFEWGLIADIQPPDLETKIAILKKKADTNRILLP--DDVAYFLASSDTRNIRELEGMLIRLGAYSSLQHIPITLTMAQNNLKDI--------LVNKRKEITVELIQKTVADHFGLKVADLKSEKRLKAFVLARQVAIWLCRDMTTASYPDIGARFGGKDHSTVIHATKKIEKLLAEDHKLSKIIDEL 453
>gi|62182326|ref|YP_218743.1| chromosomal replication initiation protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|71151802|sp|Q57I00|DNAA_SALCH Chromosomal replication initiator protein dnaA >gi|62129959|gb|AAX67662.1| DNA replication initiator protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (466 aa)
Score = 459, Expect = 1.2e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   131 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNYSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|50364816|ref|YP_053241.1| chromosomal replication initiator protein [Mesoplasma florum L1] >gi|61212578|sp|Q6F2A9|DNAA_MESFL Chromosomal replication initiator protein dnaA >gi|50363372|gb|AAT75357.1| chromosomal replication initiator protein [Mesoplasma florum L1] (443 aa)
Score = 459, Expect = 1.2e-43, Identities = 139/439 (31%), Positives = 241/439 (54%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNA-FKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGG-TKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +I K  +++  +++    Y++ S + KI +    ILV+++    +  NE+KE+F   F   +NS ++V F+TKE  + N +    +E   T+      ++  TFEN+ +G  NK A   A ++      ++  L IYG +GLGKTHLL A+ N+       K ++Y+ +E+F ++I  A+++G  +++EE K   ++ +  ++DD+QFL+ K+K NE FFNI N      K +V +SDK P  L   D RMI+RFNSGLS  IN  D  + K II   IKK  +K      A+ ++A  F+ D+R ++G++N++ F  + N D   II+ E +  + +        +NL  +N   I E +   Y V  K++  K R       R + MY  +  +N +  +IG+ F  R+H+TVL AI  +E  +  +++ K  ++++ ++
  S:    10 LINKLKKEKLIDQDIIEEYIVTSELIKISNTEFVILVRSNLGVTIL-NEFKEVFVYEFKSVLNSYVSVDFLTKEIFEKNTKKENKKEPINTV----LSENALTFENFIVGSSNKQANLAAKNVVANPGMSFNPLFIYGDSGLGKTHLLQAIKNQ--AELNGKKVLYLTSEEFTKRIVNALNKGDLSEIEELKTEINSNEFFILDDVQFLSKKDKTNEFFFNIINNFTENGKQLVFSSDKTPELLNGFDKRMITRFNSGLSTPINALDIPTAKLIIEAEIKKQGLKQKIKEDAVVYLAQNFSDDVRKIKGLVNRLLFFGIQN-DLGHIIDLEDVIDLFKDTPS----ANLGLLNVKKIKEVVAKKYDVTIKAIDGKARTTAIKNARHLSMYFAKIILNHTSTQIGAEFGGRDHSTVLSAISRIEKLIYKEKEFKKIVESLKNE 439
>gi|159035675|ref|YP_001534928.1| chromosomal replication initiator protein DnaA [Salinispora arenicola CNS-205] >gi|157914510|gb|ABV95937.1| chromosomal replication initiator protein DnaA [Salinispora arenicola CNS-205] (591 aa)
Score = 459, Expect = 1.3e-43, Identities = 116/332 (34%), Positives = 180/332 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           L+ ++ FE + IG  N+ A  AAS+ + E+    +  L IYGS+GLGKTHLLHA+G+    L    ++ Y+ TE+F      ++ +   K   F+  + +VD+LLIDDIQFL N+E+  E FF+ FN L++ NK IV+TSD+ P  L  ++DR+ +RF  GL   I  PD E+   I+ +   + R+  P     +EFIA R ++ IR LEG L ++  F  L        + EE +R  I   +  EI +       D I+ +    +GV  + +    R++     R+V MY+ RE  +LS   IG  F  R+H TV+ A + +  ++     L
  S:   253 LNPKYMFETFVIGSSNRFA-HAASVAVAESPAKAYNPLFIYGSSGLGKTHLLHAIGHYATTLGNAHSVRYVSTEEFTNDFINSLRD--DKTSAFQRRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANKQIVITSDRSPKQLATLEDRLRTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPD--VLEFIASRVSNSIRELEGALIRVTAFASLTRSSVELSLAEEVLRDFIPDGAGPEITA-------DQIMVATADYFGVSLEDLRGHSRSRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVMHADRKIRQQMAERRSL 576
>gi|160878163|ref|YP_001557131.1| chromosomal replication initiator protein DnaA [Clostridium phytofermentans ISDg] >gi|160426829|gb|ABX40392.1| chromosomal replication initiator protein DnaA [Clostridium phytofermentans ISDg] (453 aa)
Score = 459, Expect = 1.3e-43, Identities = 130/424 (30%), Positives = 227/424 (53%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKN--------DFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI----TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           Y  ++L   ++ +KD  + + V +        DF+K    N+Y +  +   +  +N +  + F+    TK E+ +  + P   +      +NP    R+TF+ + +G  N N   AASL + E+    +  L IYG  GLGKTHL+H++ +  ++  P   ++Y+ +E F  ++ ++I    T   EF+  + N+D+LLIDDIQF+  KE+  E FF+ FN L+   K I+++SDK P   L +++R+ SRF  GL++ I  PD E+  ++ I   K+        +  +++IA    S+IR LEG L KI     L   + + I+ EE ++ +I  D       N   +  D+IIE +   +      + S  R++  ++ R++ MY+ R+  +LS  +IG    NR+H+TVL     VE  +K D   +  +D ++ K
  S:    27 YKTWLLPLKVYDVKDNVIKLSVDDTKIGANSLDFIK----NKYSQFLKTAIAEVINQDFEIEFVLLSQTKAEEKVQTQAPNKIKNESLSYLNP----RYTFDTFVVGA-NNNLAHAASLAVAESPAEIYNPLFIYGGVGLGKTHLMHSIAHYILEQNPNSKVLYVTSEKFTNELIESIRNADTTPTEFREKYRNIDVLLIDDIQFIIGKERTQEEFFHTFNTLHESKKQIIISSDKPPKDILTLEERLRSRFEWGLTVDIQSPDYET--RMAILKKKEELDCLTIDDEVMKYIASNIKSNIRELEGALTKIVALSRLKKKEVDVILAEEALKDLISPD-------NKKTVTLDLIIEVVSEHFTTSTSEIYSDNRSRNIAYPRQIAMYLCRKLTSLSLTDIGKMMGNRDHSTVLHGCNKVEKDIKKDPSFQNTIDVLIKK 448
>gi|157144344|ref|YP_001451663.1| hypothetical protein CKO_00048 [Citrobacter koseri ATCC BAA-895] >gi|157081549|gb|ABV11227.1| hypothetical protein CKO_00048 [Citrobacter koseri ATCC BAA-895] (444 aa)
Score = 458, Expect = 1.3e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   109 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 439
>gi|89892747|ref|YP_516234.1| ATPase involved in DNA replication initiation [Desulfitobacterium hafniense Y51] >gi|109647880|ref|ZP_01371783.1| chromosomal replication initiator protein DnaA [Desulfitobacterium hafniense DCB-2] >gi|89332195|dbj|BAE81790.1| ATPase involved in DNA replication initiation [Desulfitobacterium hafniense Y51] >gi|109640970|gb|EAT50525.1| chromosomal replication initiator protein DnaA [Desulfitobacterium hafniense DCB-2] (449 aa)
Score = 458, Expect = 1.3e-43, Identities = 135/433 (31%), Positives = 231/433 (53%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFI-------TKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN---NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++E E    +F   ++  + +  I+ + + + V N+F K+   + Y  I        +  ++N+ F+       T+   + NK     + +P     N TL+S++TF+ + IG  N N F  A+      +    +  L IYG  GLGKTHL+HA+GN  +Q  P   ++Y+ +E F  ++ ++I +      EF+N + NVD+LLIDDIQFL  KE   E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK++++N   +N  + +IA + +S+IR LEG L ++    + ++  N I  E   E ++ II   +  EI   ++Q       +++   Y +      +KKR +  +F R++ MY+ RE  + S   IG  F  R+H TVL A   +    ++D  L   ++ I+
  S:    16 KLENELSKPSF-ETWLSSTYLLDIEGDTLIVSVPNEFAKDWLESRYAPIIRSTVQSILGQSMNLRFLVTSIHETTQPGDNQNKASSNSKAEPAD---NKTLNSKYTFDTFVIG--NSNRFAHAAALAVAESPALAYNPLFIYGGVGLGKTHLMHAIGNAVIQRSPSTRVLYVSSEKFTNELIESIRDQNPI--EFRNHYRNVDILLIDDIQFLAGKEGTQEEFFHTFNALHDANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRIAIL---RKKAKLENLQVANEVMVYIADKIHSNIRELEGALIRVM--AVGSLTSNPITVETAAEALKDIIPVSTPKEITIEMIQ-------QAVADFYHLSLGEFKAKKRTRAVAFPRQIAMYLSRELTDNSLPRIGDEFGGRDHTTVLHAYDKISESRQNDPLLDRKINEII 443
>gi|87302489|ref|ZP_01085306.1| chromosomal replication initiation protein [Synechococcus sp. WH 5701] >gi|87282833|gb|EAQ74790.1| chromosomal replication initiation protein [Synechococcus sp. WH 5701] (484 aa)
Score = 458, Expect = 1.3e-43, Identities = 105/341 (30%), Positives = 188/341 (55%)
  Q:   108 PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           P L+ R+ F  + +G  ++     A ++       +  L + G  GLGKTHL+ A+G+  +++ P+  + Y+ TE F   + +AI + G  +++F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I+++A RF S+IR LEG L + + F  +  +     +  E +  +++       V N VQ+ P  ++E +   +GV  + + S  R +  S  R+V MY+LR+  +LS   IG  F  ++H+TV+ A++ +E K+  D  L   L  +
  S:   143 PGLNPRYVFNRFVVGPNSRMAHAAALAVAEAPGREFNPLFLCGGVGLGKTHLMQAIGHYRLEIDPEARVFYVSTETFTNDLIQAIRKDG--MQKFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILHKKAEQERMALPRD--LIQYLAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDP------VGNEVQVTPQQVVEKVAEVFGVSGEEMRSSSRKRAVSQARQVGMYLLRQSTDLSLPRIGDVFGGKDHSTVMYAVEQIEKKLAIDPSLARQLQQV 472
>gi|196154827|ref|YP_002124316.1| Chromosomal replication initiator protein dnaA [Alteromonas macleodii 'Deep ecotype'] >gi|196110606|gb|ACG64322.1| Chromosomal replication initiator protein dnaA [Alteromonas macleodii 'Deep ecotype'] (533 aa)
Score = 458, Expect = 1.4e-43, Identities = 123/358 (34%), Positives = 189/358 (52%)
  Q:    92 KELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           K +P  E       INPT    + F+N+  G  N+ A  AA+        ++  L IYG TGLGKTHLLHAVGN  V       ++Y+ +E F++ + KA+      +E+FK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL+I I  P+ E+   I++    ++RI  P  N    FIA R  S++R LEG LN++  +      P  I    E +R ++        V N+ +   D         Y +    ++SK+R++  +  R+V M + +E  N S  E+G+ F  R+H TVL A + +E   +   D+K    N++
  S:   184 KVIPIPEAMKHKSNINPT----YQFDNFVEGKSNQLARAAATQVANNPGGSYNPLFIYGGTGLGKTHLLHAVGNGIVANNGDAKIVYMHSERFVQDMVKALQNNA--IEDFKRFYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIDGVEDRLKSRFGWGLTIAIEPPELETRVAILMRKAAENRIHLP--NEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLALQEKLVTVDNIQKTVADY--------YKIKVADILSKRRSRSVARPRQVAMALAKELTNHSLPELGNAFGGRDHTTVLHACRKIEQLREESHDIKEDYKNLI 528
>gi|182416749|ref|ZP_02948146.1| chromosomal replication initiator protein DnaA [Clostridium butyricum 5521] >gi|182379406|gb|EDT76901.1| chromosomal replication initiator protein DnaA [Clostridium butyricum 5521] (450 aa)
Score = 458, Expect = 1.5e-43, Identities = 130/429 (30%), Positives = 231/429 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL------EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +E  +N ++       I  + + I V N F +++    YK++      +  +    + F+   E    ++L        +       E++ TL+ ++TF ++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  ++  AI +   K E+F+N + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK+ ++N   +N  + +IA +  S+IR LEG L +I  +  L N D    +  E ++ II       I  +L+Q       + +   + +  + + S++R +  +  R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K+D+ L+  +++I  K 
  S:    21 SEVSFNTWIKSCEPISISSDTITISVPNSFTQDILDKRYKDLVANSIEVVCSKLYKIEFVIASEASEKEDLKETSSNSASKSIVVNDEMSSTLNPKYTFNSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILDNNPSAKVVYVSSEKFTNELINAIKD--DKNEDFRNKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNALHDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQVPDFETRMAIL---KKKADVENLNVANEVMGYIATKIKSNIRELEGALIRIIAYSSLTNRDVTVDLATEALKDIISKKQGKHITIDLIQ-------DVVSSYFNLRIEDLKSQRRTRNVAHPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDDSLQHTVNDITKKL 447
>gi|110644045|ref|YP_671775.1| chromosomal replication initiator protein DnaA [Escherichia coli 536] >gi|110345637|gb|ABG71874.1| chromosomal replication initiator protein DnaA [Escherichia coli 536] (444 aa)
Score = 458, Expect = 1.5e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   109 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 439
>gi|170016359|ref|YP_001727278.1| chromosomal replication initiator protein DnaA [Leuconostoc citreum KM20] >gi|169803216|gb|ACA81834.1| Chromosomal replication initiator protein DnaA [Leuconostoc citreum KM20] (448 aa)
Score = 458, Expect = 1.5e-43, Identities = 125/357 (35%), Positives = 183/357 (51%)
  Q:    90 INKELPTIEEKPKTLEINPT---------LDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEI-VSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           I  EL   +  PKT+ +            L+  FTF+ + +G  N+NA+  A    E+    +   LIYG  GLGKTHL+ A+GN + +  P   + Y   EDFL    +++  G      FK  +  VDLLLIDDIQF + KEK+ E FFN FN L    K I+MTSDKLPT +  +  R+ SRF +G+S+ I KPD  +   I+    +   +  P  N  +E IA + +S+IRTLEG  ++    L     P      ++I   +  +  ++I V  + Q+  D  +++I          + S  R K     R V MY+ R   N S  +IG  F  R+H++VL A   +  K +SD   K  LD
  S:    80 IKPELRVADILPKTMPLTSENLTFTRESDLNENFTFDKFVVGTGNENAYAIARAVAEDPGRVYNPYLIYGGVGLGKTHLMQAIGNAYSKTTPSARIKYATAEDFLNDFTESLRAGEGATAAFKKEYRTVDLLLIDDIQFWSGKEKVQEEFFNTFNVLTKTGKQIIMTSDKLPTEIVDLQSRLTSRFEAGISMDIQKPDLPTRVAILKNLAETDGLTIP--NDVLELIADKIDSNIRTLEGTFHRFEAMLRFRNKPATKETAQQILGDLNINQGFKITVERIQQVVADYYMQTI--------DDLKSTSRKKDLVTARHVAMYLTRTLTNESLPDIGRSFGGRDHSSVLHATNKITEKAESDARTKEMLD 438
>gi|15612564|ref|NP_240867.1| chromosomal replication initiation protein [Bacillus halodurans C-125] >gi|14194694|sp|Q9RCA2|DNAA_BACHD Chromosomal replication initiator protein dnaA >gi|5672647|dbj|BAA82685.1| 78%-identity [Bacillus halodurans] >gi|10172613|dbj|BAB03720.1| initiation of chromosome replication [Bacillus halodurans C-125] (449 aa)
Score = 458, Expect = 1.6e-43, Identities = 140/437 (32%), Positives = 230/437 (52%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFS-----------IKMNSNLNVFFITKEEKDINKELPTIE-EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K +EK+    +F   ++  +    I+D  + I   N+F ++     Y E+  E              +   S L+  F+ +E K   K+ P    E P     N  L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  +   AI +   K   F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+  NK IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +++IR LEG L ++  +  L N D N  +  E ++ II +     +    +Q       +++   + V  +   +KKR K  +F R++ MY+ RE  + S  +IGS F  R+H TV+ A + +   + +D++L+  + +I  K 
  S:    13 KSMEKKVSKPSF-ETWLKQTKANSIEDSTIIITAPNEFARDWLEKHYDELISETIDDLTGVRLYPKFVIPTSQLDEPFVEQELKKPMKQPPAQNGEMP-----NNMLNDKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVMDHNPNAKVVYLSSEKFTNEFINAIRD--NKAVNFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNALHEDNKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAENLDIP--NEVMLYIANQIDTNIRELEGALIRVVAYSSLINQDMNADLAAEALKDIIPNAKPRVLTITDIQ-------KTVGEYFHVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDASLPKIGSEFGGRDHTTVIHAHEKISKLLSTDQELQDKIQDISDKL 447
>gi|161505631|ref|YP_001572743.1| chromosomal replication initiation protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866978|gb|ABX23601.1| hypothetical protein SARI_03807 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (469 aa)
Score = 458, Expect = 1.6e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   134 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 464
>gi|153948|gb|AAA02815.1| dnaA protein (466 aa)
Score = 458, Expect = 1.6e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   131 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|16762487|ref|NP_458104.1| chromosomal replication initiation protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143975|ref|NP_807317.1| chromosomal replication initiation protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|167545660|ref|ZP_02341229.1| chromosomal replication initiation protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|21362471|sp|Q8Z2N6|DNAA_SALTI Chromosomal replication initiator protein dnaA >gi|25299855|pir||AI0957 chromosomal replication initiator protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504792|emb|CAD03157.1| chromosomal replication initiator protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139611|gb|AAO71177.1| chromosomal replication initiator protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (466 aa)
Score = 458, Expect = 1.6e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   131 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|167555698|ref|ZP_02348716.1| hypothetical protein Sententeri_02350 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (466 aa)
Score = 457, Expect = 1.7e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   131 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|16767123|ref|NP_462738.1| chromosomal replication initiation protein [Salmonella typhimurium LT2] >gi|56415711|ref|YP_152786.1| chromosomal replication initiation protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161616956|ref|YP_001590921.1| chromosomal replication initiation protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167548872|ref|ZP_02342631.1| hypothetical protein Sentente_00085 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167992432|ref|ZP_02573530.1| hypothetical protein Sententer_01000013_0100013340 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168219978|ref|ZP_02645210.1| hypothetical protein Senterenterica_06296 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168225004|ref|ZP_02650235.1| hypothetical protein Sententeric_04478 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168233393|ref|ZP_02658451.1| hypothetical protein Sententerica_20575 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168235478|ref|ZP_02660536.1| hypothetical protein Senteenterica_04774 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168242058|ref|ZP_02666990.1| hypothetical protein Senterienterica_10512 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168260377|ref|ZP_02682350.1| hypothetical protein Salmentericaenterica_04785 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464831|ref|ZP_02698723.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168473086|ref|ZP_02702109.1| hypothetical protein Salmoentericaenterica_00405 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818302|ref|ZP_02830302.1| hypothetical protein Salentericaenterica_02866 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442253|ref|YP_002043088.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448643|ref|YP_002047871.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194470761|ref|ZP_03076745.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736495|ref|YP_002116782.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189044603|sp|A9MX77|DNAA_SALPB Chromosomal replication initiator protein dnaA >gi|20141364|sp|P35891|DNAA_SALTY Chromosomal replication initiator protein dnaA >gi|71151803|sp|Q5PKU6|DNAA_SALPA Chromosomal replication initiator protein dnaA >gi|16422412|gb|AAL22697.1| DNA replication initiator protein [Salmonella typhimurium LT2] >gi|56129968|gb|AAV79474.1| chromosomal replication initiator protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161366320|gb|ABX70088.1| hypothetical protein SPAB_04777 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194400916|gb|ACF61138.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194406947|gb|ACF67166.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194457125|gb|EDX45964.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711997|gb|ACF91218.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632396|gb|EDX50880.1| chromosomal replication initiator protein DnaA [Salmonella enterica subsp. enterica serovar Newport str. SL317] (466 aa)
Score = 457, Expect = 1.7e-43, Identities = 117/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   131 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|152972609|ref|YP_001337755.1| chromosomal replication initiation protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957458|gb|ABR79488.1| chromosomal replication initiation protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (444 aa)
Score = 457, Expect = 1.7e-43, Identities = 118/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   109 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIVARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 439
>gi|120608715|ref|YP_968393.1| chromosomal replication initiator protein DnaA [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120587179|gb|ABM30619.1| chromosomal replication initiator protein DnaA [Acidovorax avenae subsp. citrulli AAC00-1] (475 aa)
Score = 457, Expect = 1.9e-43, Identities = 117/333 (35%), Positives = 174/333 (52%)
  Q:    99 EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           ++P        L+   TFE    G  N+ A  AA  +     + +  L IYG  GLGKTHL+HAVGN+ +Q  P   ++YI  E F+  + KA        +EFK  + ++DLLLIDD+QF  NK++  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +    + P   +A  F+A    S++R LEG L KI  +   N        E  I+   E+  D   + N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   129 DEPAAAPFRSRLNPALTFETLVEGTANRMARSAAMHVAGSPGHLYNPLFIYGGVGLGKTHLVHAVGNRLLQDKPDAKVLYIHAEQFVSDVVKAYQR--RTFDEFKAHYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLANIHERLVSRFDSGLTVTIEPPELEMRVAILINKARAESAEMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFNQ------KEVSIQLAREALRDLLSIQNR-QISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 452
>gi|150014893|ref|YP_001307147.1| chromosomal replication initiation protein [Clostridium beijerinckii NCIMB 8052] >gi|189044634|sp|A6LPB1|DNAA_CLOB8 Chromosomal replication initiator protein dnaA >gi|149901358|gb|ABR32191.1| chromosomal replication initiator protein DnaA [Clostridium beijerinckii NCIMB 8052] (449 aa)
Score = 457, Expect = 1.9e-43, Identities = 136/440 (30%), Positives = 240/440 (54%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKEL-PTIEEKPKTL----EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           IIK E+     +E  +N ++       I    + I V N F +++    YK++         +    + FI   E    +E+  +  +K K +    E++ TL+ ++TF ++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  ++  AI +   K EEF+N + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK+ ++N   +N  + +IA +  S+IR LEG L +I  +  L N +    +  E ++ II       +  +L+Q       + +   + +  + + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K+D+ L++ +++I  K 
  S:    15 IIKSEL-----SEVSFNTWIKSCEPLSISSNTLKISVPNSFTQDILDKRYKDLVANSIKAVCSKLYTIEFIIMSEIYEKEEIKSSSNQKSKAIVVNDEMSSTLNPKYTFNSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILDGNPNAKVVYVSSEKFTNELINAIKD--DKNEEFRNKYRNVDILLIDDIQFIAGKERTQEEFFHTFNALHDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQVPDFETRMAIL---KKKADVENLNVANEVMGYIATKIKSNIRELEGALIRIIAYSSLTNREVTVDLATEALKDIISKKQGKHVTIDLIQ-------DVVSSYFNLRVEDLKSQRRTRNVAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDDSLQSTVNDITKKL 446
>gi|148543244|ref|YP_001270614.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri F275] >gi|184152656|ref|YP_001840997.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri F275] >gi|167016901|sp|A5VHF3|DNAA_LACRF Chromosomal replication initiator protein dnaA >gi|148530278|gb|ABQ82277.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri F275] >gi|183224000|dbj|BAG24517.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri F275] (440 aa)
Score = 457, Expect = 2.0e-43, Identities = 127/404 (31%), Positives = 213/404 (52%)
  Q:    49 VKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           V  DF ++    + KE  +     ++  N+   ++ + E     +  T ++   + E++  L+  + F  + +G  NK A  AA    E   + +  L IYG  GLGKTHL+ A+GN  +Q+ P   + Y+ +EDF      AI    T  E+ +  + N+DLLLIDDIQFL NKE     FFN FN L+ + K IVMTSD++P  + ++ DR++SRF  GL+++I  PD E+   I+   +++  I     N  + +IA + +++IR LEG L K+  F  L        +  + ++ +      + +  N + I    I + +   Y + +  ++ KKR KQ    R++ MY+ RE  + S  +IG+ F  ++H TVL AI  +ET++K D DL+  +  + +K 
  S:    49 VHRDFWRKNLNTQLKEFAQR----ELGRNIEPHYVLEGEFTYTNK-KTEDDPTPSFEMDTPLNPHYNFGTFVVGEGNKMAHAAAFAVAESPGSLYNPLFIYGGVGLGKTHLMEAIGNHMLQVNPNSRVKYVTSEDFTNDYINAIRNNTT--EQLREEYRNLDLLLIDDIQFLANKEGTQLEFFNTFNALHDRKKQIVMTSDRIPNEIPELQDRLVSRFRWGLTVEITPPDLETRIAILRSKVEEDHID--IGNDTLNYIAGQIDTNIRELEGALTKVQAFANLSGERITPSLASQALKGL------HRVAKNEISIA--TIQKQVADFYNITQGDILGKKRVKQIVMPRQIAMYLSRELTDSSLPKIGNEFGGKDHTTVLHAIDKIETELKKDTDLQNDITKLKAKL 438
>gi|146295086|ref|YP_001178857.1| chromosomal replication initiator protein DnaA [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408662|gb|ABP65666.1| chromosomal replication initiator protein DnaA [Caldicellulosiruptor saccharolyticus DSM 8903] (454 aa)
Score = 457, Expect = 2.1e-43, Identities = 141/446 (31%), Positives = 243/446 (54%)
  Q:     7 IKKKYLIIKKEIEKEFQ---NENFYNNYVLDSSIFKIKDENVYILVKN--DFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKT---LLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI---INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           + K +  IK+ I+KE      +  YN +V ++ +    DEN   ++K   DF +++  N Y  +         + +L++  I   E +  K+    +++ K +E+  TL+ ++TFE + +G  N+ A  AA    E     KT   L IYG  GLGKTHL+HA+G+  ++L+P   +MY+ +E F  ++  AI +   K +EF+  + NVD+LLIDDIQFL  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+  +I I + K      P     +EFIA +  ++IR LEG LNKI  +        EI   + E+ ++  I++++  E+    +Q         +   + +  +   S +R++  +F R++ MY+ RE  N+S  +IG  F  ++H TVL A + ++  +  D +++  ++N+  + 
  S:     6 VNKVWEDIKEVIKKELNPSPTDISYNTWV-ETLVPICFDENDTFILKAFADFHRDIVINRYSLLILNALRQLYSPHLSLKVILPNEVEKYKKYIKQKQEEK-VEVTTTLNPKYTFETFVVGNNNRLAHAAALAVAETPPGEKTYNPLFIYGGVGLGKTHLMHAIGHHVLKLYPDTKVMYVTSEIFTNELIAAIRD--EKTDEFRMKYRNVDVLLIDDIQFLGGKERTQEEFFHTFNTLYEANKKIILSSDRPPKEINTLEDRLRSRFEWGLITDIQPPDFET--RIAILSKKCQLEGTPVPQHILEFIASKIETNIRELEGALNKILAYSKLMAPDKEITLELAEKALKEFIDTNTKKELTIEDIQ-------AEVAGYFNIKLEDFKSSRRSRNVAFPRQIAMYLARELTNVSLPKIGEAFGGKDHTTVLHACEKIKELINKDTNIRNTVENLKKRL 450
>gi|152989598|ref|YP_001345397.1| chromosomal replication initiation protein [Pseudomonas aeruginosa PA7] >gi|150964756|gb|ABR86781.1| chromosomal replication initiator protein DnaA [Pseudomonas aeruginosa PA7] (512 aa)
Score = 457, Expect = 2.1e-43, Identities = 118/340 (34%), Positives = 192/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSD-YEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++  ++++I+ P    A  FIA R  S++R LEG L ++  H      P   I  E IR   ES  D   +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   177 LNRTFTFENFVEGKSNQLA-RAAAWQVADNLKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQAKIELPHD--AAFFIAQRIRSNVRELEGALKRVIAHSHFMGRP---ITIELIR---ESLKDLLALQDKLVSI--DNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLL 507
>gi|118587493|ref|ZP_01544918.1| initiation of chromosome replication [Oenococcus oeni ATCC BAA-1163] >gi|118432143|gb|EAV38884.1| initiation of chromosome replication [Oenococcus oeni ATCC BAA-1163] (466 aa)
Score = 457, Expect = 2.1e-43, Identities = 120/342 (35%), Positives = 187/342 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L+  FTF+ + IG  N+ A  AA    E+    +  LLIYGS+GLGKTHL+ A+GN+  +L P   + YI T+DF+     AIS+  T   +F ++++NVDLLL+DDIQ L  K++  E FFNIFN++    K IVMTSD LP  +  ++ R++SRF  G++  I KPD  +  ++ I   K   +     N  +  IA + ++++R LEG  N +   +     P  + N +KI   +       I    V   PD I +++   Y V    +I KKRN      R+V MY++R   + S  +IG  F  R+H TV+   + +   +++D  LK  ++N+ +K
  S:   130 LNQNFTFDTWVIGDANELATSAAMAVSEQPGRQYNPLLIYGSSGLGKTHLMEAIGNRLKELQPDAIVRYITTDDFMNDWVNAISKKTTT--DFTSTYENVDLLLVDDIQMLQGKDRFQEEFFNIFNKITKSQKQIVMTSDVLPKDIPGLNARLVSRFMQGVAYDIQKPDFPT--RLAILKNKSEEVGISIDNQTLTLIAEQIDTNVRELEGAFNTLTL-MARAGRPINVSNAQKILEHL------NITRQKVITLPD-IQKTVADDYNVSINDLIGKKRNSDIVLPRQVAMYLIRTLTDTSLPKIGQAFGGRDHTTVMHGTEKIADLIETDYALKQRIENLSTK 461
>gi|50123359|ref|YP_052526.1| chromosomal replication initiation protein [Pectobacterium atrosepticum SCRI1043] >gi|61212568|sp|Q6CYR4|DNAA_ERWCT Chromosomal replication initiator protein dnaA >gi|49613885|emb|CAG77337.1| chromosomal replication initiator protein [Erwinia carotovora subsp. atroseptica SCRI1043] (465 aa)
Score = 457, Expect = 2.1e-43, Identities = 121/355 (34%), Positives = 194/355 (54%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P   E      +NP    + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   119 PVQAEHTYRSNVNP----KHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRSITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 460
>gi|187777367|ref|ZP_02993840.1| hypothetical protein CLOSPO_00923 [Clostridium sporogenes ATCC 15579] >gi|187774295|gb|EDU38097.1| hypothetical protein CLOSPO_00923 [Clostridium sporogenes ATCC 15579] (448 aa)
Score = 456, Expect = 2.4e-43, Identities = 132/415 (31%), Positives = 229/415 (55%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTL---EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +N ++   +   +++ ++ + V NDF K +  + YK++      +  +   N+ F +T EEK    +     EK   +   E++  L+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +   P+  ++Y+ +E F  ++  +I +   K  EF+N + N+D+LL+DDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +     ++  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S           Q+  DII E +   Y +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+
  S:    25 FNTWIKSINPISLENNSLKLAVPNDFTKGILESRYKDLIVNALKLLTSKKYNIDFIVTTEEKIEENQKNHNNEKSNIVVNDEMSTMLNPKYTFDSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILNNNPKSQVVYVSSEKFTNELINSIKD--DKNVEFRNKYRNIDILLVDDIQFIAGKERTQEEFFHTFNALYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVEKLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKQTR-------QVTIDIIQEVVANYYNLKIEDLKSARRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLQ 435
>gi|188535562|ref|YP_001909359.1| Chromosomal replication initiator protein [Erwinia tasmaniensis] >gi|188030604|emb|CAO98499.1| Chromosomal replication initiator protein [Erwinia tasmaniensis] (463 aa)
Score = 456, Expect = 2.4e-43, Identities = 119/355 (33%), Positives = 198/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++++  F+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   111 PSWDNVPALAELSYRSNVNTKHNFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMAMAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 458
>gi|187731749|ref|YP_001882464.1| chromosomal replication initiator protein DnaA [Shigella boydii CDC 3083-94] >gi|187428741|gb|ACD08015.1| chromosomal replication initiator protein DnaA [Shigella boydii CDC 3083-94] (467 aa)
Score = 456, Expect = 2.5e-43, Identities = 117/340 (34%), Positives = 190/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I  P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDILLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|67153555|ref|ZP_00415300.1| chromosomal replication initiator protein, DnaA [Azotobacter vinelandii AvOP] >gi|67087688|gb|EAM07154.1| chromosomal replication initiator protein, DnaA [Azotobacter vinelandii AvOP] (478 aa)
Score = 456, Expect = 2.7e-43, Identities = 116/340 (34%), Positives = 193/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSD-YEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++  ++++++ P    A  FIA R  S++R LEG L ++  H   +   N  I  E IR   ES  D   +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    ++D D++    N++
  S:   143 LNRAFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFAKKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQTKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH---SHFTNHPITIELIR---ESLKDLLALQDKLVSI--DNIQRTVAEYYKIKIADLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDSFGGRDHTTVLHACRKIAELRETDADIREDYKNLL 473
>gi|16077069|ref|NP_387882.1| chromosomal replication initiation protein [Bacillus subtilis subsp. subtilis str. 168] >gi|118704|sp|P05648|DNAA_BACSU Chromosomal replication initiator protein dnaA >gi|40014|emb|CAA26217.1| unnamed protein product [Bacillus subtilis] >gi|467391|dbj|BAA05237.1| initiation protein of replicaton [Bacillus subtilis] >gi|2632268|emb|CAB11777.1| dnaA [Bacillus subtilis subsp. subtilis str. 168] (446 aa)
Score = 456, Expect = 2.7e-43, Identities = 131/436 (30%), Positives = 225/436 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINP-----TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +IEK+    +F   ++  +    ++ + + I   N+F ++   + Y  +  +         L++ F+  + +D+   +P  + K    E         L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +  DE L+  +  I  + 
  S:    14 QIEKKLSKPSF-ETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRD--NKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQ-------RVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQL 445
>gi|89101119|ref|ZP_01173955.1| chromosomal replication initiation protein [Bacillus sp. NRRL B-14911] >gi|89084174|gb|EAR63339.1| chromosomal replication initiation protein [Bacillus sp. NRRL B-14911] (425 aa)
Score = 456, Expect = 2.7e-43, Identities = 132/421 (31%), Positives = 222/421 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTLEINP-----TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           ++ ++  +    ++ + + I   N+F ++     Y ++            L V F I + + +   +LP   +K K  +  P      L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+      P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E +R II S     I  + +Q       +++   Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D  L+  L  +
  S:     1 FDTWLKSTKAHSLQGDLLIITAPNEFARDWLEERYSQLISGILYDITGEELGVKFIIPQNQGEEEVDLPVPPKKGKKDDDQPELPLNMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVQDHNPAAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALRDIIPSSKPKVITIHEIQ-------KTVGEHYSVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKLLQTDPQLQKQLKEL 419
>gi|119471658|ref|ZP_01614043.1| DNA replication initiator protein, transcriptional regulator of replication and other genes; binds DNA at DnaA boxes [Alteromonadales bacterium TW-7] >gi|119445437|gb|EAW26724.1| DNA replication initiator protein, transcriptional regulator of replication and other genes; binds DNA at DnaA boxes [Alteromonadales bacterium TW-7] (462 aa)
Score = 456, Expect = 2.7e-43, Identities = 120/358 (33%), Positives = 201/358 (56%)
  Q:    92 KELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ P +E  PK+      +   +TF+++  G  N+ A KAA+  + +N  + +  + IYG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD L+IDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  ++ ++DR+ SRF  GL+I I  P+ E+   I+++  ++S+I  P       FIA +  S++R LEG LN++  +      P  I   +E +R ++       +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +++      ++K    N++
  S:   110 EQKPVVEPAPKS-GYKSNIKENYTFDSFVEGKSNQLA-KAAATQVADNPGSAFNPVFIYGGTGLGKTHLLHAVGNGIMANKPDAKIVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALMIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIEGVEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSKINLPHE--VAFFIAKKLRSNVRELEGALNRVIANANFTGRPISIDFVKEALRDLL------ALQDKLVTI--DNIQRTVAEYYRIRVSDLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIKSLRDESHEIKEDYQNLI 457
>gi|148378012|ref|YP_001252553.1| chromosomal replication initiator protein DnaA [Clostridium botulinum A str. ATCC 3502] >gi|153930843|ref|YP_001382411.1| chromosomal replication initiation protein [Clostridium botulinum A str. ATCC 19397] >gi|153935412|ref|YP_001385963.1| chromosomal replication initiation protein [Clostridium botulinum A str. Hall] >gi|166201876|sp|A7FPR6|DNAA_CLOB1 Chromosomal replication initiator protein dnaA >gi|166201877|sp|A5HXP7|DNAA_CLOBH Chromosomal replication initiator protein dnaA >gi|148287496|emb|CAL81555.1| chromosomal replication initiator protein [Clostridium botulinum A str. ATCC 3502] >gi|152926887|gb|ABS32387.1| chromosomal replication initiator protein DnaA [Clostridium botulinum A str. ATCC 19397] >gi|152931326|gb|ABS36825.1| chromosomal replication initiator protein DnaA [Clostridium botulinum A str. Hall] (448 aa)
Score = 455, Expect = 3.0e-43, Identities = 132/415 (31%), Positives = 228/415 (54%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTL---EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +N ++   +   +++ ++ + V NDF K +  + YK++      +  +   N+ F +T EEK    +     EK   +   E++  L+ ++TF+++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +   P+  ++Y+ +E F  ++  +I +   K  EF+N + N+D+LL+DDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S           Q+  DII E +   Y +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+
  S:    25 FNTWIKSINPISLENNSLKLAVPNDFTKGILESRYKDLIVNALKLLTSKKYNIDFIVTTEEKIEENQKNHNNEKSNIVVNDEMSTMLNPKYTFDSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYILHNNPKSQVVYVSSEKFTNELINSIKD--DKNVEFRNKYRNIDILLVDDIQFIAGKERTQEEFFHTFNALYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVENLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISIDLASEALKDIISSKQTR-------QVTIDIIQEVVANYYNLKIEDLKSARRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLQ 435
>gi|27466919|ref|NP_763556.1| chromosomal replication initiation protein [Staphylococcus epidermidis ATCC 12228] >gi|38257580|sp|Q8CQK7|DNAA_STAES Chromosomal replication initiator protein dnaA >gi|27314461|gb|AAO03598.1|AE016744_1 chromosomal replication initiator protein [Staphylococcus epidermidis ATCC 12228] (451 aa)
Score = 455, Expect = 3.0e-43, Identities = 134/432 (31%), Positives = 225/432 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRF---------TFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           EI +E  +   Y  ++ D+ ++ +K++   ILV   F        Y EI +      +   +   FI+++E      + T E +   ++ +   D  +         TF+ + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +  T  E F+  +  +D+LLIDDIQF+ NKE+  E FF+ FN L+  NK IV++SD+ P  + K++DR+ SRF  GL + I  PD E+   I+ + I++  +  P    A+ +IA +  S+IR LEG L ++  +  L        +  E ++ II+S    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +KSD   K  ++N+
  S:    12 EIAQERISNTSYQTFIKDTQLYSLKNDEAIILVSLPFNASWLNQRYSEIMQAIIYDVIGYEVKPHFISEDELASYNNVNTQEVQEPQVQHSSIDDKTWGKEQFNMHNTFDTFVIGPGNRFP-HAASLAVAEAPAEAYNPLFIYGGVGLGKTHLMHAIGHHVLSNKPNAKVIYTSSEKFTNEFIKSIRDNET--EAFREKYRKIDVLLIDDIQFIQNKEQTQEEFFHTFNELHQNNKQIVISSDRPPKEIAKLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEENLDIPPE--ALNYIANQIQSNIRELEGALTRLLAYSKLQGKPITTELTAEALKDIIQSPKSKKITIQDIQ-------KVVGQYYSVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKIANDIKSDPTFKQEVENL 444
>gi|57865939|ref|YP_190094.1| chromosomal replication initiation protein [Staphylococcus epidermidis RP62A] >gi|71151806|sp|Q5HJZ9|DNAA_STAEQ Chromosomal replication initiator protein dnaA >gi|57636597|gb|AAW53385.1| chromosomal replication initiator protein DnaA [Staphylococcus epidermidis RP62A] (451 aa)
Score = 455, Expect = 3.3e-43, Identities = 134/432 (31%), Positives = 225/432 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRF---------TFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           EI +E  +   Y  ++ D+ ++ +K++   ILV   F        Y EI +      +   +   FI+++E      + T E +   ++ +   D  +         TF+ + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +  T  E F+  +  +D+LLIDDIQF+ NKE+  E FF+ FN L+  NK IV++SD+ P  + K++DR+ SRF  GL + I  PD E+   I+ + I++  +  P    A+ +IA +  S+IR LEG L ++  +  L        +  E ++ II+S    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +KSD   K  ++N+
  S:    12 EIAQERISNTSYQTFIKDTQLYSLKNDEAIILVSLPFNASWLNQRYSEIMQAIIYDVIGYEVKPHFISEDELASYNNVNTQEVQEPQVQHSSIDDKTWGKEQFNMHNTFDTFVIGPGNRFP-HAASLAVAEAPAEAYNPLFIYGGVGLGKTHLMHAIGHHVLSNKPNAKVIYTSSEKFTNEFIKSIRDNET--EAFREKYRKIDVLLIDDIQFIQNKEQTQEEFFHTFNELHQNNKQIVISSDRPPKEIAKLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEENLDIPPE--ALNYIANQIQSNIRELEGALTRLLAYSKLQGKPITTELTAEALKDIIQSPKSKKITIQDIQ-------KIVGQYYSVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKIANDIKSDPTFKQEVENL 444
>gi|116490127|ref|YP_809648.1| chromosomal replication initiator protein DnaA [Oenococcus oeni PSU-1] >gi|122277682|sp|Q04HR6|DNAA_OENOB Chromosomal replication initiator protein dnaA >gi|116090852|gb|ABJ56006.1| DNA replication ATPase initiation [Oenococcus oeni PSU-1] (450 aa)
Score = 455, Expect = 3.5e-43, Identities = 120/342 (35%), Positives = 187/342 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L+  FTF+ + IG  N+ A  AA    E+    +  LLIYGS+GLGKTHL+ A+GN+  +L P   + YI T+DF+     AIS+  T   +F ++++NVDLLL+DDIQ L  K++  E FFNIFN++    K IVMTSD LP  +  ++ R++SRF  G++  I KPD  +  ++ I   K   +     N  +  IA + ++++R LEG  N +   +     P  + N +KI   +       I    V   PD I +++   Y V    +I KKRN      R+V MY++R   + S  +IG  F  R+H TV+   + +   +++D  LK  ++N+ +K
  S:   114 LNQNFTFDTWVIGDANELATSAAMAVSEQPGRQYNPLLIYGSSGLGKTHLMEAIGNRLKELQPDAIVRYITTDDFMNDWVNAISKKTTA--DFTSTYENVDLLLVDDIQMLQGKDRFQEEFFNIFNKITKSQKQIVMTSDVLPKDIPGLNARLVSRFMQGVAYDIQKPDFPT--RLAILKNKSEEVGISIDNQTLTLIAEQIDTNVRELEGAFNTLTL-MARAGRPINVSNAQKILEHL------NITRQKVITLPD-IQKTVADDYNVSINDLIGKKRNSDIVLPRQVAMYLIRTLTDTSLPKIGQAFGGRDHTTVMHGTEKIADLIETDYALKQRIENLSTK 445
>gi|183597172|ref|ZP_02958665.1| hypothetical protein PROSTU_00415 [Providencia stuartii ATCC 25827] >gi|188023486|gb|EDU61526.1| hypothetical protein PROSTU_00415 [Providencia stuartii ATCC 25827] (463 aa)
Score = 455, Expect = 3.6e-43, Identities = 118/340 (34%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + EN    +  L +YG TGLGKTHLLHAVGN  +Q      ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   128 VNPKHTFDNFVEGKSNQLA-RAAARQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNSIMQHKANARVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENEIQLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 458
>gi|123444342|ref|YP_001008307.1| chromosomal replication initiation protein [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166215369|sp|A1JT80|DNAA_YERE8 Chromosomal replication initiator protein dnaA >gi|122091303|emb|CAL14189.1| chromosomal replication initiator protein [Yersinia enterocolitica subsp. enterocolitica 8081] (462 aa)
Score = 455, Expect = 3.7e-43, Identities = 119/355 (33%), Positives = 197/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   110 PSWDSSPAQPELSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 457
>gi|160932427|ref|ZP_02079817.1| hypothetical protein CLOLEP_01262 [Clostridium leptum DSM 753] >gi|156868386|gb|EDO61758.1| hypothetical protein CLOLEP_01262 [Clostridium leptum DSM 753] (438 aa)
Score = 454, Expect = 3.8e-43, Identities = 130/403 (32%), Positives = 201/403 (49%)
  Q:    47 ILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSR--FTFENYTIGMFNKNAFKAASLFLEENN---NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEK-IRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++V N+F ++     Y  +          S +N+ F    E    K  P           N  +DS   FTF+ Y +G  NK  F  A+      N    +  L IYG++GLGKTHLL+A+ N   +  P+   +YI+ +DF  ++  AI  G T    F   +   D+LL+DDIQF+  K+   E FF+ FN L    K IV+TSD+ P  ++ ++DR+ +RF  GL   I  PD E+  +I I   K   +         E+IA R  ++IR LEG + K+  + L N D   + N +  I  I+ +D    +         + IIE +   +GV    + S KR+   S  R++ +YV+RE   LS   IG  F  R+H+TV+ A++ VE  +K D   KA +++I+
  S:    45 LMVPNEFHRQTLNRCYMPLLNSAVHEIFGSGINIIFTIPNEAGEKKAAPND---------NLAIDSEYEFTFDTYIVGSSNK--FAHAASLAVAANPAGAYNPLFIYGNSGLGKTHLLYAICNDLKRSHPEMTTLYIKGDDFTNELIDAIQHGTTST--FHQKYRKTDVLLVDDIQFIAGKDSTQEEFFHTFNSLYEAKKQIVLTSDRPPKEIQTLEDRLRTRFEWGLIADIQPPDFET--RIAIIKRKAEALDLELPGDVCEYIATRLKTNIRQLEGAVKKMKANWLLNGDAPTMANAQTAISDILNNDQPPPLTV-------EKIIEEVGRTFGVSPDDIRSSKRSANISNARQIAVYVVREITQLSMTTIGEEFGGRDHSTVVYAVQQVEKNMKKDSKTKAMVEDII 432
>gi|116491819|ref|YP_803554.1| chromosomal replication initiator protein DnaA [Pediococcus pentosaceus ATCC 25745] >gi|122266717|sp|Q03I60|DNAA_PEDPA Chromosomal replication initiator protein dnaA >gi|116101969|gb|ABJ67112.1| DNA replication ATPase initiation [Pediococcus pentosaceus ATCC 25745] (446 aa)
Score = 454, Expect = 3.8e-43, Identities = 132/420 (31%), Positives = 221/420 (52%)
  Q:    33 LDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINK--ELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L++ I KIK       V +   ++ +T    E F EY     + ++   F+T++E    +     T +++ K    +  L+SR+TF+ + IG  N+ A  AA    +E    +  L  YG  GLGKTHL+HA+G++ ++  P+  + Y+ +E F      +I +   K EEF   + NVDLLL+DD+QF  +KE   E FF+ F  L +  K IV+TSD+LP  + K+ +R++SRF  GLSI I  P+ E+   I+ E  +   ++ P   L  E+IA R +S+IR LEG + +I  +  L N      +  + +RS+          SNL  I   +I + +   + V    +  KKR K     R++ MY+ RE    S  +IG+ F  ++H TV+ +   ++ +++ DE+L   + ++ S+ 
  S:    38 LENHIMKIK-------VLSSLHRDYWTKHLIEKFVEYAYQFTDQDITPEFVTEDEFKTQQAERSATSKKETKASTEDTQLNSRYTFDTFVIGSGNQMAHAAAMAVSDEPGVLYNPLFFYGGVGLGKTHLMHAIGHQLLENDPKTRVKYVTSEAFTNDFINSIQK--NKTEEFHEKYRNVDLLLVDDVQFFADKEATQEEFFHTFEALYNAQKQIVLTSDRLPNEIPKLQERLVSRFKWGLSIDITPPNLETRIAILREKAQADNVEIPDETL--EYIANRIDSNIRELEGAMARIQAYAKLQNAAITTDLASDALRSL-------NFGSNLSHITIPMIQDKVAKYFHVTVADLKGKKRMKSIVIPRQIAMYLSRELTESSLPKIGTEFGGKDHTTVIHSFDKIKAELEKDEELARQVGDLKSEL 444
>gi|170719188|ref|YP_001746876.1| chromosomal replication initiator protein DnaA [Pseudomonas putida W619] >gi|169757191|gb|ACA70507.1| chromosomal replication initiator protein DnaA [Pseudomonas putida W619] (511 aa)
Score = 454, Expect = 4.1e-43, Identities = 110/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFE +  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   176 LNRTFTFETFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLL 506
>gi|91791370|ref|YP_561021.1| chromosomal replication initiation protein [Shewanella denitrificans OS217] >gi|122969114|sp|Q12TC8|DNAA_SHEDO Chromosomal replication initiator protein dnaA >gi|91713372|gb|ABE53298.1| chromosomal replication initiator protein DnaA [Shewanella denitrificans OS217] (462 aa)
Score = 454, Expect = 4.2e-43, Identities = 119/344 (34%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA++ + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    F+A R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   127 INPT----YQFDNFVEGKSNQLG-KAAAMQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFVAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 457
>gi|28867244|ref|NP_789863.1| chromosomal replication initiation protein [Pseudomonas syringae pv. tomato str. DC3000] >gi|38257476|sp|Q88BK3|DNAA_PSESM Chromosomal replication initiator protein dnaA >gi|28850478|gb|AAO53558.1| chromosomal replication initiator protein DnaA [Pseudomonas syringae pv. tomato str. DC3000] (511 aa)
Score = 454, Expect = 4.2e-43, Identities = 111/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   ++++  P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   176 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLL 506
>gi|194467403|ref|ZP_03073390.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri 100-23] >gi|194454439|gb|EDX43336.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri 100-23] (440 aa)
Score = 454, Expect = 4.6e-43, Identities = 127/404 (31%), Positives = 212/404 (52%)
  Q:    49 VKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           V  DF ++    + KE  +     ++  N+   +I + E     +  T ++   + E++  L+  + F  + +G  NK A  AA    E   + +  L IYG  GLGKTHL+ A+GN  +Q+ P   + Y+ +EDF      AI    T  E+ +  + N+DLLLIDDIQFL NKE     FFN FN L+ + K IVMTSD++P  + ++ DR++SRF  GL+++I  PD E+   I+   +++  I     N  + +IA + +++IR LEG L K+  F  L        +  + ++ +      + +  N + I    I + +   Y + +  ++ KKR KQ    R++ MY+ RE  + S  +IG+ F  ++H TVL AI  +E ++K D DL+  +  + +K 
  S:    49 VHRDFWRKNLNTQLKEFAQR----ELGRNIEPHYILEGEFTYTNK-KTEDDPTPSFEMDTPLNPHYNFGTFVVGEGNKMAHAAAFAVAESPGSLYNPLFIYGGVGLGKTHLMEAIGNHMLQVNPNSRVKYVTSEDFTNDYINAIRNNTT--EQLREEYRNLDLLLIDDIQFLANKEGTQLEFFNTFNALHDRKKQIVMTSDRIPNEIPELQDRLVSRFRWGLTVEITPPDLETRIAILRSKVEEDHID--IGNDTLNYIAGQIDTNIRELEGALTKVQAFANLSGERITPSLASQALKGL------HRVAKNEISIA--TIQKQVADFYNITQGDILGKKRVKQIVMPRQIAMYLSRELTDSSLPKIGNEFGGKDHTTVLHAIDKIEAELKKDTDLQNDITKLKAKL 438
>gi|24371608|ref|NP_715650.1| chromosomal replication initiation protein [Shewanella oneidensis MR-1] >gi|38257603|sp|Q8EKT2|DNAA_SHEON Chromosomal replication initiator protein dnaA >gi|24345358|gb|AAN53095.1|AE015452_8 chromosomal replication initiator protein DnaA [Shewanella oneidensis MR-1] (460 aa)
Score = 454, Expect = 4.7e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   125 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 455
>gi|170724371|ref|YP_001758397.1| chromosomal replication initiator protein DnaA [Shewanella woodyi ATCC 51908] >gi|169809718|gb|ACA84302.1| chromosomal replication initiator protein DnaA [Shewanella woodyi ATCC 51908] (462 aa)
Score = 454, Expect = 4.7e-43, Identities = 122/344 (35%), Positives = 189/344 (54%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + FEN+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D K    N++
  S:   127 INPT----YQFENFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLI 457
>gi|119714273|ref|YP_921238.1| chromosomal replication initiator protein DnaA [Nocardioides sp. JS614] >gi|119534934|gb|ABL79551.1| chromosomal replication initiator protein DnaA [Nocardioides sp. JS614] (528 aa)
Score = 454, Expect = 4.7e-43, Identities = 112/332 (33%), Positives = 181/332 (54%)
  Q:   100 KPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           +P +LE    L+ ++TFE + IG  N+    AA    E     +  LL+YG +GLGKTHLLHA+G+    L+    + Y+ +E+F  +   AI +   + + FK  + +VD+LLIDDIQFL  K +  E FF+ FN L++ NK IV+TSD+ P  L+ ++DR+ +RF  GL   +  PD E+   I+ +     R+  P     +EFIA +  ++IR LEG L ++  F  L+  + +  + E  ++ +I    + EI + L       II      +G+    +    R +     R++ MY+ RE  +LS  +IG+ F NR+H TV+ A + +
  S:   179 RPSSLETR--LNPKYTFETFVIGSSNRFPHAAAVAVAEAPGKAYNPLLVYGDSGLGKTHLLHAIGHYVRSLYTGAKVRYVSSEEFTNEFINAIRD--DRQDRFKRRYRDVDVLLIDDIQFLEGKTQTQEEFFHTFNTLHNANKQIVLTSDRAPKRLEALEDRLRNRFEWGLITDVQPPDLETRIAILRKKAAMDRLTAPPD--VLEFIASKIQTNIRELEGALIRVTAFANLNRQEVDMTLAEIVLKDLIPEGGEPEITAAL-------IIAQTAAYFGLSIDELTGPSRGRHLVMARQIAMYLCRELTDLSLPKIGAQFGNRDHTTVMYADRKI 500
>gi|77958161|ref|ZP_00822199.1| COG0593: ATPase involved in DNA replication initiation [Yersinia bercovieri ATCC 43970] (467 aa)
Score = 453, Expect = 4.9e-43, Identities = 120/355 (33%), Positives = 193/355 (54%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P   E      +NP    + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   121 PAQPEHSYRSNVNP----KHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|167621942|ref|YP_001672236.1| chromosomal replication initiation protein [Shewanella halifaxensis HAW-EB4] >gi|189083278|sp|B0TLA4|DNAA_SHEHH Chromosomal replication initiator protein dnaA >gi|167351964|gb|ABZ74577.1| chromosomal replication initiator protein DnaA [Shewanella halifaxensis HAW-EB4] (461 aa)
Score = 453, Expect = 4.9e-43, Identities = 138/411 (33%), Positives = 222/411 (54%)
  Q:    39 KIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNL-NVFF----------ITKEEKDINKELPTIEE--KPK--------------TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +++ + + I   N FV +   ++Y  I  ++F+ +M S+  N+ F          I +    I    P   E  KP                  INPT    + F+N+  G  N+   KAA++ + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSDK P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:    32 EMEGDTLVIYAPNRFVLDWVRDKYLNIINQFFTEQMGSDAPNLRFDIGSRPSARPIVQATAAIRTSRPVSREVVKPSFNTPHADPIANANHRSNINPT----YQFDNFVEGKSNQLG-KAAAMQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 456
>gi|154705516|gb|ABS84184.1| chromosomal replication initiator protein DnaA [Lactobacillus reuteri] (440 aa)
Score = 453, Expect = 5.3e-43, Identities = 127/404 (31%), Positives = 212/404 (52%)
  Q:    49 VKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           V  DF ++    + KE  +     ++  N+   +I + E     +  T ++   + E++  L+  + F  + +G  NK A  AA    E   + +  L IYG  GLGKTHL+ A+GN  +Q+ P   + Y+ +EDF      AI    T  E+ +  + N+DLLLIDDIQFL NKE     FFN FN L+ + K IVMTSD++P  + ++ DR++SRF  GL+++I  PD E+   I+   +++  I     N  + +IA + +++IR LEG L K+  F  L        +  + ++ +      + +  N + I    I + +   Y + +  ++ KKR KQ    R++ MY+ RE  + S  +IG+ F  ++H TVL AI  +E ++K D DL+  +  + +K 
  S:    49 VHRDFWRKNLNTQLKEFAQH----ELGRNIEPHYILEGEFTYTNK-KTEDDPTPSFEMDTPLNPHYNFGTFVVGEGNKMAHAAAFAVAESPGSLYNPLFIYGGVGLGKTHLMEAIGNHMLQVNPNSRVKYVTSEDFTNDYINAIRNNTT--EQLREEYRNLDLLLIDDIQFLANKEGTQLEFFNTFNALHDRKKQIVMTSDRIPNEIPELQDRLVSRFRWGLTVEITPPDLETRIAILRSKVEEDHID--IGNDTLNYIAGQIDTNIRELEGALTKVQAFANLSGERITPSLASQALKGL------HRVAKNEISIAK--IQKQVADFYNITQGDILGKKRVKQIVMPRQIAMYLSRELTDSSLPKIGNEFGGKDHTTVLHAIDKIEAELKKDTDLQNDITKLKAKL 438
>gi|77973772|ref|ZP_00829317.1| COG0593: ATPase involved in DNA replication initiation [Yersinia frederiksenii ATCC 33641] (466 aa)
Score = 453, Expect = 5.3e-43, Identities = 119/355 (33%), Positives = 197/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   114 PSWDSSPVQPELSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|157959831|ref|YP_001499865.1| chromosomal replication initiation protein [Shewanella pealeana ATCC 700345] >gi|189083279|sp|A8GYE3|DNAA_SHEPA Chromosomal replication initiator protein dnaA >gi|157844831|gb|ABV85330.1| chromosomal replication initiator protein DnaA [Shewanella pealeana ATCC 700345] (461 aa)
Score = 453, Expect = 5.5e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSDK P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   126 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 456
>gi|83588876|ref|YP_428885.1| chromosomal replication initiation protein [Moorella thermoacetica ATCC 39073] >gi|83571790|gb|ABC18342.1| chromosomal replication initiator protein DnaA [Moorella thermoacetica ATCC 39073] (442 aa)
Score = 453, Expect = 5.9e-43, Identities = 116/345 (33%), Positives = 188/345 (54%)
  Q:   108 PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI---INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           P L+ ++TFE + +G  N+ A  AA L + E+  +++  L IYG  GLGKTHL+ A+G++  Q  P+  +MYI +E F   +  AI +  T  E+F+  + N+D+LLIDDIQFL  KE   E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      I  P  +  + FIA + +S+IR LEG L ++  +   N    EI   + EE ++ +++      I   L+Q       E++   + +  + + +KKR +  ++ R++ MY+ RE    S  +IG  F  R+H TVL A   +   + +D  L   +  I  + 
  S:   103 PPLNPKYTFETFVVGNSNRFA-HAACLAVAESPASSYNPLFIYGGVGLGKTHLMQAIGHRVRQHLPELRVMYISSEKFTNDLINAIKDKAT--EQFRTKYRNIDVLLIDDIQFLAKKESTQEEFFHTFNHLYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRMAILRKKAVAEGINLP--DEVMFFIAQKIDSNIRELEGALIRVAAYA--NFTKKEITPGLAEEILKDVLDLARPKPITIRLIQ-------ETVANYFNLKVEDLKAKKRTRSVAYPRQIAMYLCRELTESSLPDIGKEFGGRDHTTVLHAYDKIRDDLNTDPSLPQVIAQIRQQL 439
>gi|82546034|ref|YP_409981.1| chromosomal replication initiation protein [Shigella boydii Sb227] >gi|123769372|sp|Q31UV5|DNAA_SHIBS Chromosomal replication initiator protein dnaA >gi|81247445|gb|ABB68153.1| DnaA [Shigella boydii Sb227] (467 aa)
Score = 453, Expect = 6.2e-43, Identities = 116/340 (34%), Positives = 190/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E    S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTIHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 462
>gi|16124206|ref|NP_407519.1| chromosomal replication initiation protein [Yersinia pestis CO92] >gi|45443728|ref|NP_995267.1| chromosomal replication initiation protein [Yersinia pestis biovar Microtus str. 91001] >gi|51598227|ref|YP_072418.1| chromosomal replication initiation protein [Yersinia pseudotuberculosis IP 32953] >gi|108810133|ref|YP_654049.1| chromosomal replication initiation protein [Yersinia pestis Antiqua] >gi|108814115|ref|YP_649882.1| chromosomal replication initiation protein [Yersinia pestis Nepal516] >gi|145597325|ref|YP_001161400.1| chromosomal replication initiation protein [Yersinia pestis Pestoides F] >gi|150260968|ref|ZP_01917696.1| chromosomal replication initiator protein [Yersinia pestis CA88-4125] >gi|153950668|ref|YP_001403095.1| chromosomal replication initiation protein [Yersinia pseudotuberculosis IP 31758] >gi|162419763|ref|YP_001608448.1| chromosomal replication initiation protein [Yersinia pestis Angola] >gi|165926099|ref|ZP_02221931.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Orientalis str. F1991016] >gi|166009506|ref|ZP_02230404.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213287|ref|ZP_02239322.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401560|ref|ZP_02307054.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422851|ref|ZP_02314604.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425478|ref|ZP_02317231.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|123073045|sp|Q1CCJ8|DNAA_YERPN Chromosomal replication initiator protein dnaA >gi|123371953|sp|Q1C0B8|DNAA_YERPA Chromosomal replication initiator protein dnaA >gi|166215370|sp|A4TGL5|DNAA_YERPP Chromosomal replication initiator protein dnaA >gi|167016907|sp|A7FPB7|DNAA_YERP3 Chromosomal replication initiator protein dnaA >gi|21362472|sp|Q8Z9U7|DNAA_YERPE Chromosomal replication initiator protein dnaA >gi|61212542|sp|Q663T2|DNAA_YERPS Chromosomal replication initiator protein dnaA >gi|45438598|gb|AAS64144.1| chromosomal replication initiator protein [Yersinia pestis biovar Microtus str. 91001] >gi|51591509|emb|CAH23181.1| chromosomal replication initiator protein [Yersinia pseudotuberculosis IP 32953] >gi|108777763|gb|ABG20282.1| chromosomal replication initiator protein DnaA [Yersinia pestis Nepal516] >gi|108782046|gb|ABG16104.1| chromosomal replication initiator protein DnaA [Yersinia pestis Antiqua] >gi|115349685|emb|CAL22666.1| chromosomal replication initiator protein [Yersinia pestis CO92] >gi|145209021|gb|ABP38428.1| chromosomal replication initiator protein [Yersinia pestis Pestoides F] >gi|149290376|gb|EDM40453.1| chromosomal replication initiator protein [Yersinia pestis CA88-4125] >gi|152962163|gb|ABS49624.1| chromosomal replication initiator protein DnaA [Yersinia pseudotuberculosis IP 31758] >gi|162352578|gb|ABX86526.1| chromosomal replication initiator protein DnaA [Yersinia pestis Angola] >gi|165921959|gb|EDR39136.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991428|gb|EDR43729.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205585|gb|EDR50065.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958243|gb|EDR55264.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048942|gb|EDR60350.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055492|gb|EDR65285.1| chromosomal replication initiator protein DnaA [Yersinia pestis biovar Mediaevalis str. K1973002] (462 aa)
Score = 453, Expect = 6.3e-43, Identities = 119/355 (33%), Positives = 197/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   110 PSWDNSPAQPELSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 457
>gi|22127981|ref|NP_671404.1| chromosomal replication initiation protein [Yersinia pestis KIM] >gi|21961126|gb|AAM87655.1|AE014012_12 DNA biosynthesis protein [Yersinia pestis KIM] (466 aa)
Score = 452, Expect = 6.4e-43, Identities = 119/355 (33%), Positives = 197/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   114 PSWDNSPAQPELSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|114561189|ref|YP_748702.1| chromosomal replication initiation protein [Shewanella frigidimarina NCIMB 400] >gi|122301225|sp|Q08A51|DNAA_SHEFN Chromosomal replication initiator protein dnaA >gi|114332482|gb|ABI69864.1| chromosomal replication initiator protein DnaA [Shewanella frigidimarina NCIMB 400] (461 aa)
Score = 452, Expect = 6.4e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   126 INPT----YQFDNFVEGKSNQLG-KAAALQVSENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 456
>gi|167770836|ref|ZP_02442889.1| hypothetical protein ANACOL_02189 [Anaerotruncus colihominis DSM 17241] >gi|167666876|gb|EDS11006.1| hypothetical protein ANACOL_02189 [Anaerotruncus colihominis DSM 17241] (439 aa)
Score = 452, Expect = 6.8e-43, Identities = 127/422 (30%), Positives = 219/422 (51%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKP------KTLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +N ++ D    +++    ++ V ++F   +   +Y  I +  F   +   ++V         I  E P   EKP          +N   D  +TF+ + +G  NK     + ++     N +  L IYG +GLGKTHLL+A+  +  +  P  N++Y++ ++F   I  AI +   +  EF+  +   D+LL+DDIQF+  KE   E FF+ FN L   NK IV+ SD+ P  +K ++DR+ +RF  GL   I  PD E+   II    +   I+ P  +   E+IA R  ++IR LEG + K+  + LL   +P+ +I +  IR I+  +         V +  + II  +   YG+  + + S KR+ Q S  R++ +Y++RE   +S + IG  F  R+H+T++ AI+ VE  + +D   K  +++I+
  S:    24 FNLWLKDIIPLRLEGSAAFLQVNSEFKMNIIREKYTSILKSAFETTLGFPVDVI--------ITCETPQPAEKPAGPPPSDAAAVNGEYD--YTFDTFIVGSSNKFAHAASLAVAANPANAYNPLFIYGGSGLGKTHLLYAICAEIRKNRPNYNIIYVKGDEFANDIITAIRD--QRTAEFRERYRKADVLLVDDIQFIGGKESTQEEFFHTFNTLYESNKQIVLASDRPPKEIKTLEDRLRTRFEWGLLADIQIPDFETRIAIIRRKAQLLDIQMP--DDVAEYIANRLKTNIRQLEGTVKKLKAYKLLQGTNPSIMIAQNAIRDILNDNQP-------VPVTVERIISEVGRTYGISPQDIRSNKRSAQISAARQISIYIVREITQMSMSTIGDEFGGRDHSTIVYAIQQVEKNMNNDLRYKETIEDII 433
>gi|15595199|ref|NP_064721.1| chromosomal replication initiation protein [Pseudomonas aeruginosa PAO1] >gi|116053721|ref|YP_788156.1| chromosomal replication initiation protein [Pseudomonas aeruginosa UCBPP-PA14] >gi|194554100|ref|YP_002089127.1| chromosomal replication initiator protein DnaA [Pseudomonas aeruginosa 2192] >gi|122262144|sp|Q02V80|DNAA_PSEAB Chromosomal replication initiator protein dnaA >gi|14194675|sp|Q9I7C5|DNAA_PSEAE Chromosomal replication initiator protein dnaA >gi|9945819|gb|AAG03391.1|AE004440_1 chromosomal replication initiator protein DnaA [Pseudomonas aeruginosa PAO1] >gi|11067000|gb|AAG28797.1|AF229442_1 DnaA [Pseudomonas aeruginosa] >gi|115588942|gb|ABJ14957.1| chromosomal replication initiator protein DnaA [Pseudomonas aeruginosa UCBPP-PA14] >gi|126196493|gb|EAZ60556.1| chromosomal replication initiator protein DnaA [Pseudomonas aeruginosa 2192] (514 aa)
Score = 452, Expect = 7.6e-43, Identities = 118/340 (34%), Positives = 192/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSD-YEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++  ++++I+ P    A  FIA R  S++R LEG L ++  H      P   I  E IR   ES  D   +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   179 LNRTFTFENFVEGKSNQLA-RAAAWQVADNLKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQAKIELPHD--AAFFIAQRIRSNVRELEGALKRVIAHSHFMGRP---ITIELIR---ESLKDLLALQDKLVSI--DNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLL 509
>gi|113968347|ref|YP_732140.1| chromosomal replication initiation protein [Shewanella sp. MR-4] >gi|123130898|sp|Q0HPD4|DNAA_SHESM Chromosomal replication initiator protein dnaA >gi|113883031|gb|ABI37083.1| chromosomal replication initiator protein DnaA [Shewanella sp. MR-4] (460 aa)
Score = 452, Expect = 7.9e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   125 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 455
>gi|114045514|ref|YP_736064.1| chromosomal replication initiation protein [Shewanella sp. MR-7] >gi|123131884|sp|Q0I0U8|DNAA_SHESR Chromosomal replication initiator protein dnaA >gi|113886956|gb|ABI41007.1| chromosomal replication initiator protein DnaA [Shewanella sp. MR-7] (460 aa)
Score = 452, Expect = 7.9e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   125 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 455
>gi|120596834|ref|YP_961408.1| chromosomal replication initiation protein [Shewanella sp. W3-18-1] >gi|146291112|ref|YP_001181536.1| chromosomal replication initiation protein [Shewanella putrefaciens CN-32] >gi|166215331|sp|A4Y1A4|DNAA_SHEPC Chromosomal replication initiator protein dnaA >gi|166215333|sp|A1RDX7|DNAA_SHESW Chromosomal replication initiator protein dnaA >gi|120556927|gb|ABM22854.1| chromosomal replication initiator protein DnaA [Shewanella sp. W3-18-1] >gi|145562802|gb|ABP73737.1| chromosomal replication initiator protein DnaA [Shewanella putrefaciens CN-32] (461 aa)
Score = 452, Expect = 8.0e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   126 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 456
>gi|117918468|ref|YP_867660.1| chromosomal replication initiation protein [Shewanella sp. ANA-3] >gi|166215332|sp|A0KR35|DNAA_SHESA Chromosomal replication initiator protein dnaA >gi|117610800|gb|ABK46254.1| chromosomal replication initiator protein DnaA [Shewanella sp. ANA-3] (460 aa)
Score = 451, Expect = 8.2e-43, Identities = 121/344 (35%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   125 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPDAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 455
>gi|153952671|ref|YP_001393436.1| chromosomal replication initiation protein [Clostridium kluyveri DSM 555] >gi|189044635|sp|A5N457|DNAA_CLOK5 Chromosomal replication initiator protein dnaA >gi|146345552|gb|EDK32088.1| DnaA [Clostridium kluyveri DSM 555] (451 aa)
Score = 451, Expect = 8.4e-43, Identities = 131/425 (30%), Positives = 230/425 (54%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKP------KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +N ++   +   I+++   + V ND  K + +N+Y ++      +  +   NV F I+ E  +    L TI E+        + E++  L+ ++TF ++ IG  N+ A  AASL + E+    +  L IYG  GLGKTHL+HA+G+  +       ++Y+ +E F  ++  +I +   K  EF++ + N+D+LLIDDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +     ++  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S    ++   L+Q   D++       Y +      S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE LK  ++++  + 
  S:    25 FNTWIKSITPISIENDTFMLTVPNDLTKGILSNKYTDLIIRSLQMVTSQKYNVKFLISSELPEEFLTLDTINEQNIKGSIIVSDEMSAMLNPKYTFTSFVIGNSNRFA-HAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHHILHNNTSCKVVYVSSEKFTNELINSIKD--DKNVEFRSKYRNIDVLLIDDIQFIAGKERTQEEFFHTFNALYEANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDFETRMAILKKKADVEKLNIP--NEVMAYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLAIEALKDIISSGQSKQVTIELIQ---DVVSNY----YNLKVSDFKSSRRTRNVAFPRQIAMYLCRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLKNAVNDLTKRL 448
>gi|78187975|ref|YP_376018.1| chromosomal replication initiator protein, DnaA [Pelodictyon luteolum DSM 273] >gi|78167877|gb|ABB24975.1| chromosomal replication initiator protein DnaA [Pelodictyon luteolum DSM 273] (489 aa)
Score = 451, Expect = 9.0e-43, Identities = 116/339 (34%), Positives = 186/339 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           L+S++TF+    G  N  AF AA    +    N +  L+IYG  GLGKTH++ A+GN   +      ++Y+ +E F      AI  G  K++EF + + N+D+L+IDDIQF + KEK  E  F+IFN L+  NK I++++D+    +K I+DR+ISRFN GLS  I  PD E+ K II+  + +S +   F    IEFIA     ++R LEG + K+     LD  + +    +  ++ II   +         Q+N D I +++C  + +    +  K + K+ S  R++ MY+ ++  + S   IG  F  R+H+TV+ AI  +  KV S  + +  +D I
  S:   150 LNSKYTFDTLIRGDCNSLAFAAAKSVAQNPGQNAFNPLVIYGGVGLGKTHIMQAIGNTVRESRDASKVLYVSSEKFAIDFVNAIQNG--KIQEFSSFYRNIDVLIIDDIQFFSGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLHQSGVN--FDENVIEFIANNVTDNVRELEGCIVKLLAAQSLDKREIDLQFTKSTLKDIIRHTTK--------QLNLDTIEKAVCEYFSITSNDLKGKSKKKEISVGRQIAMYLSKQMTDSSLKTIGLHFGGRDHSTVIHAINTIAKKVDSGGEDRGKIDEI 480
>gi|88860616|ref|ZP_01135253.1| DNA replication initiator protein [Pseudoalteromonas tunicata D2] >gi|88817211|gb|EAR27029.1| DNA replication initiator protein [Pseudoalteromonas tunicata D2] (460 aa)
Score = 451, Expect = 9.1e-43, Identities = 132/398 (33%), Positives = 216/398 (54%)
  Q:    52 DFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT---------------------LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           D+V+E + N   E+  E   I  N    + F    +  +NK  P +  + +    N T                     +   +TF+++  G  N+ A  AAS   +     +  + IYG TGLGKTHLLHAVGN  +   P   + Y+ +E F++ + +A+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  ++ ++DR+ SRF  GL+I I  P+ E+   I+++  ++S+IK P   +A  FIA R  S++R LEG LN++  +      P  I   +E +R ++       +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +++  +   ++K    N++
  S:    49 DWVREKYLNRINELLVE---ICGNETPTLRFDVGSKPVLNKPAPAVVSEAQNPPANKTRAEVSSPQQVEPALKNAHKSNIKETYTFDSFVEGKSNQLAKAAASQVADNPGTAFNPVFIYGGTGLGKTHLLHAVGNGILANKPNAKIAYMHSERFVQDMVRALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIEGVEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSKIKLP-EEVAF-FIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVKEALRDLL------ALQDKLVTI--DNIQRTVAEYYRIRVSDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIKSLREETHEIKEDYQNLI 455
>gi|118051710|ref|ZP_01520258.1| chromosomal replication initiator protein DnaA [Comamonas testosteroni KF-1] >gi|118001053|gb|EAV15209.1| chromosomal replication initiator protein DnaA [Comamonas testosteroni KF-1] (468 aa)
Score = 451, Expect = 9.6e-43, Identities = 120/354 (33%), Positives = 187/354 (52%)
  Q:    88 KDINKELPTIEEKPKTLEINPT-LDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           + +N  +PT+  +  +  +  T L+   TFE    G  N+ A  AA  +     + +  L IYG  GLGKTHL+HAVGN+ ++  P   ++YI  E F+  + KA        +EFK  + ++DLLLIDD+QF  NK++  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +      P   +A  F+A    S++R LEG L KI  +   N        E  I+   E+  D   + N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  + +++ +L
  S:   110 QTLNVAVPTVTSEEASAPVFRTRLNPALTFETLVEGTANRMARSAAMHVAGSPGHLYNPLFIYGGVGLGKTHLVHAVGNQLLKDKPDAKILYIHAEQFVSDVVKAYQR--RTFDEFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLANIHERLVSRFDSGLTVAIEPPELEMRVAILINKARAENADMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFNQ------KEVSIQLAREALRDLLSIQNR-QISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAGERQTNTEL 455
>gi|290550|gb|AAA62053.1| dnaA (CG Site No. 851) (471 aa)
Score = 450, Expect = 1.1e-42, Identities = 116/340 (34%), Positives = 189/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++      ++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   136 VNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNXLLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSGXGPGQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 466
>gi|126172258|ref|YP_001048407.1| chromosomal replication initiator protein DnaA [Shewanella baltica OS155] >gi|152998556|ref|YP_001364237.1| chromosomal replication initiation protein [Shewanella baltica OS185] >gi|160873127|ref|YP_001552443.1| chromosomal replication initiation protein [Shewanella baltica OS195] >gi|166215328|sp|A3CYH5|DNAA_SHEB5 Chromosomal replication initiator protein dnaA >gi|166215329|sp|A6WH85|DNAA_SHEB8 Chromosomal replication initiator protein dnaA >gi|189083277|sp|A9KU72|DNAA_SHEB9 Chromosomal replication initiator protein dnaA >gi|125995463|gb|ABN59538.1| chromosomal replication initiator protein DnaA [Shewanella baltica OS155] >gi|151363174|gb|ABS06174.1| chromosomal replication initiator protein DnaA [Shewanella baltica OS185] >gi|160858649|gb|ABX47183.1| chromosomal replication initiator protein DnaA [Shewanella baltica OS195] (462 aa)
Score = 450, Expect = 1.1e-42, Identities = 120/344 (34%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INP+    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   127 INPS----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 457
>gi|56418536|ref|YP_145854.1| chromosomal replication initiation protein [Geobacillus kaustophilus HTA426] >gi|61212478|sp|Q5L3Z2|DNAA_GEOKA Chromosomal replication initiator protein dnaA >gi|56378378|dbj|BAD74286.1| chromosome replication initiator protein [Geobacillus kaustophilus HTA426] (450 aa)
Score = 450, Expect = 1.1e-42, Identities = 135/436 (30%), Positives = 227/436 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL----EIN----PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           EIE++    +F   ++  +    ++ + + I+  N+F ++   + Y  +  E         L V FI    +D ++EL     K K      E N      L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   AI +   + ++F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K      P  N  + +IA + +S+IR LEG L ++  +  L N +    +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D  L+  +  I  K 
  S:    14 EIEQKISKPSF-ETWLKSTKAHSLRGDTLVIVAPNEFARDWLDSRYSHLIAETIYTITGEELAVKFIIPPNQD-DEELEFQSSKKKQRKPYEETNDFPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRD--NRPDDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGFDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLAAEALKDIIPSAKPKVITIQDIQ-------RVVGQHFNIKMEDFKAKKRTKSVAFPRQIAMYLSRELTDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDTQLQRHIQEIQEKL 447
>gi|78042923|ref|YP_361492.1| chromosomal replication initiation protein [Carboxydothermus hydrogenoformans Z-2901] >gi|77995038|gb|ABB13937.1| chromosomal replication initiator protein DnaA [Carboxydothermus hydrogenoformans Z-2901] (454 aa)
Score = 450, Expect = 1.2e-42, Identities = 136/435 (31%), Positives = 232/435 (53%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKE-------LPTIEEKPKTLE--INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAI-EFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           E+ K   N+  ++ ++         +  + + V N F K+     Y  + +   ++  N ++N   +   E  I            + ++  K LE  I  TL+ ++TFE + +G  N+ A  AA L + E+    +  L IYG  GLGKTHL+HA+G+  ++  P+  + Y+ TE F   +  +I +  T  EEF+N + ++D+LLIDDIQFL  KE+  E FF+ FN L   NK IV++SD+ P  L  ++DR+ SRF  GL   I  PD E+   I+    KK+++ N   + A+  FIA    S+IR LEG L ++  +   + +P  + +  + ++ ++ S+    I   L+Q       + +   YG+    + +KKR K  +F R+V MY+ RE  + S  +IG  F  R+H TV+ A + ++  ++SD +LK  +  +  +
  S:    15 EVLKNHVNKPSWDMWIKSIRPLGFLENTILVEVPNKFAKDWLEEHYASLIKHILNLITNEDINFKLVVPNESAIEDSEGKTKSKKNSPKKPSKFLEEGIFFTLNPKYTFETFVVGNSNRFA-HAACLAVAESPAEAYNPLFIYGGVGLGKTHLMHAIGHYILKNKPEMKVAYVTTEKFTNDLINSIKDDTT--EEFRNKYRSIDVLLIDDIQFLEKKERTQEEFFHTFNALYEANKQIVISSDRTPKELSTLEDRLRSRFEWGLITDIQPPDLETRIAIL---RKKAQLDNLHVDDAVLNFIANEIVSNIRELEGALIRVVAYAGLHGEPITVDLAAKALKDLLPSNHVKPITIPLIQ-------QVVANFYGLTVDDLKAKKRTKSVAFPRQVAMYLCRELTDASLPKIGEEFGGRDHTTVIHAHEKIQQDLQSDPNLKTVIRQLTEQ 450
>gi|16802049|ref|NP_463534.1| chromosomal replication initiation protein [Listeria monocytogenes EGD-e] >gi|46906225|ref|YP_012614.1| chromosomal replication initiation protein [Listeria monocytogenes str. 4b F2365] >gi|153176163|ref|ZP_01931422.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes FSL N3-165] >gi|153184353|ref|ZP_01935112.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes J0161] >gi|153192643|ref|ZP_01939603.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes J2818] >gi|153197967|ref|ZP_01942137.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes 10403S] >gi|21362468|sp|Q8YAW2|DNAA_LISMO Chromosomal replication initiator protein dnaA >gi|61212634|sp|Q725H0|DNAA_LISMF Chromosomal replication initiator protein dnaA >gi|16409360|emb|CAC98216.1| Chromosomal replication initiation protein DnaA [Listeria monocytogenes] >gi|46879489|gb|AAT02791.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes str. 4b F2365] >gi|126942856|gb|EBA20590.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes J0161] >gi|127632303|gb|EBA21985.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes 10403S] >gi|127763680|gb|EBA24514.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes J2818] >gi|133728876|gb|EBA30574.1| chromosomal replication initiator protein DnaA [Listeria monocytogenes FSL N3-165] (451 aa)
Score = 450, Expect = 1.2e-42, Identities = 140/432 (32%), Positives = 224/432 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKT----LEINP-TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +I K+  ++  Y+ ++  ++   ++     I   N+FV++     Y +              +V FI  E+++ N E   I+  P      +EI    L+ R+ F+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HAVG+   Q      +MY+ +E F  +   +I +   K EEF+  + NVD+LLIDDIQFL  KE   E FF+ FN L  + K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D    +  E ++ II S     I  + +Q       E++   + V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D+ LK  L  I
  S:    13 QIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISAPNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEE-NFEYTVIKPNPALDEDGIEIGKHMLNPRYVFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAVGHYVQQHKDNAKVMYLSSEKFTNEFISSIRD--NKTEEFRTKYRNVDVLLIDDIQFLAGKEGTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKADGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEALKDIIPSSKSQVITISGIQ-------EAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDASLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEI 440
>gi|77961789|ref|ZP_00825619.1| COG0593: ATPase involved in DNA replication initiation [Yersinia mollaretii ATCC 43969] (440 aa)
Score = 450, Expect = 1.2e-42, Identities = 120/355 (33%), Positives = 193/355 (54%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P   E      +NP    + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:    94 PAQPEHSYRSNVNP----KHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENNIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 435
>gi|16330393|ref|NP_441121.1| chromosomal replication initiation protein [Synechocystis sp. PCC 6803] >gi|2506358|sp|P49995|DNAA_SYNY3 Chromosomal replication initiator protein dnaA >gi|1652883|dbj|BAA17801.1| chromosomal replication initiator protein; DnaA [Synechocystis sp. PCC 6803] (447 aa)
Score = 450, Expect = 1.3e-42, Identities = 125/398 (31%), Positives = 205/398 (51%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFIT---KEEKDINKE--LPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVL 425
           ++ ++  S +  + D    I V+N FV       Y  +  E  +      + V  IT   +    I +E  LP +E  PK       L+ ++TF  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+ +  ++++P   + Y+ TE F   +  AI +    +E+F++ + + D LLIDDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  + DR+ISRF+ GL   I  PD E+   I+ +  +  RI+ P     IE+IA  + S+IR LEG L + I +  L NV     +  E I  ++    +       V   P+ II  +   Y +  + ++S  R ++ S  R+V MY++R+  +LS   IG  F  ++H TV+
  S:    24 FDTWIKASVLISLGDGVATIQVENGFVLNHLQKSYGPLLMEVLTDLTGQEITVKLITDGLEPHSLIGQESSLP-METTPKNAT---ALNGKYTFSRFVVGPTNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLEMYPNAKVYYVSTERFTNDLITAIRQ--DNMEDFRSYYRSADFLLIDDIQFIKGKEYTQEEFFHTFNSLHEAGKQVVVASDRAPQRIPGLQDRLISRFSMGLIADIQVPDLETRMAILQKKAEYDRIRLP--KEVIEYIASHYTSNIRELEGALIRAIAYTSLSNV----AMTVENIAPVLNPPVEK------VAAAPETIITIVAQHYQLKVEELLSNSRRREVSLARQVGMYLMRQHTDLSLPRIGEAFGGKDHTTVM 411
>gi|147676336|ref|YP_001210551.1| chromosomal replication initiation protein [Pelotomaculum thermopropionicum SI] >gi|146272433|dbj|BAF58182.1| ATPase [Pelotomaculum thermopropionicum SI] (447 aa)
Score = 450, Expect = 1.3e-42, Identities = 132/410 (32%), Positives = 221/410 (53%)
  Q:    42 DENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIE------EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPF-SNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +  V I V N F +E     Y  + +  F   +  ++ V F+   E  + +  P  +      E+  T+ +NP    ++TF+ + +G  N+ A  AA L + E+    +  L IYG  GLGKTHL+HA+G   ++   +  + Y+ +E F  ++  AI +   K  EF+N +  +D+LL+DDIQFL  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KKS+ +N F  +  I +IA R  S+IR LEG L + I +  L+  + +  +  E ++ I+  +   +I   L+Q       E +   Y +  +   SK R++  +F R+V MY+ RE  +LS  +IG +F  R+H TV+ A + +  ++  D  L+  +  ++SK
  S:    40 ENTVIIEVPNHFSREWLNERYAPLIKNIFRHILEQDIGVQFLLSGEVSVVESDPLKKAVKNNFEEASTIHLNP----KYTFDTFVVGNSNRFA-HAACLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGQHILEHSNKMKVSYVTSEKFTNELINAIKD--DKTVEFRNKYRGMDILLVDDIQFLAGKERTQEEFFHTFNTLYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRIAIL---RKKSQQENLFVPDDTIFYIANRIQSNIRELEGALIRVIAYASLNGKEISPELAAEVLKDILPPEKPRQITVELIQ-------EVVAGYYNIRVEDFKSKNRSRAVAFPRQVAMYLARELTDLSLPKIGEYFGGRDHTTVIHAYEKINNELNIDMSLQESIKQLISK 443
>gi|118727514|ref|ZP_01576112.1| chromosomal replication initiator protein DnaA [Clostridium cellulolyticum H10] >gi|118663091|gb|EAV69754.1| chromosomal replication initiator protein DnaA [Clostridium cellulolyticum H10] (440 aa)
Score = 450, Expect = 1.3e-42, Identities = 133/432 (30%), Positives = 222/432 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           E+ K    E  +N ++L      I    + + V  DF K +    Y  + +       + + N++F    +  +        E      +NP    ++TF+ + IG  N+ A  AASL + E     +  L +YG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  ++  AI +   K EEF+  + N+D+LLIDDIQF+  KE+  E FF+ FN L   NK I+++SDK P  +  ++DR+ SRF  GL   I  PD E+   I+ +  +   +  P  +  + FIA +  S+IR LEG LN++  Y  L +N     IIN   +   +E+  D    S  + IN   I E++   + +    + SK+R++  SF R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   + +  +LK  ++ I
  S:    14 ELLKGEMTEISFNTWILTIEPISIDSNTITLGVPADFNKGILEARYSYLIKNALRQISHRDYNIYFAIPSQTPVKPVAQEYTEDSNMSFLNP----KYTFDTFVIGNGNRFA-HAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMHAIGHFVLSQNPALKVLYVSSEKFTNELINAIRD--DKNEEFRYKYRNIDVLLIDDIQFIGGKERTEEEFFHTFNALYEANKQIIISSDKPPKEIPTLEDRLRSRFEWGLIADIAPPDLETRIAILRKKAQLENLDVP--DDVMVFIADKVASNIRELEGALNRVIAYSTLTEN-----IIN---VDMAVEALKDMLNNSKAIIINSKTIQEAVARYFHLKTDDLKSKRRSRDVSFPRQIAMYLCRDMTDMSLPKIGDEFGGRDHTTVIHACEKINNDLNNSTELKRTVEEI 433
>gi|77976616|ref|ZP_00832095.1| COG0593: ATPase involved in DNA replication initiation [Yersinia intermedia ATCC 29909] (439 aa)
Score = 449, Expect = 1.4e-42, Identities = 120/355 (33%), Positives = 193/355 (54%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P   E      +NP    + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:    93 PAQPEHSYRSNVNP----KHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 434
>gi|71737409|ref|YP_272316.1| chromosomal replication initiation protein [Pseudomonas syringae pv. phaseolicola 1448A] >gi|123734066|sp|Q48QK0|DNAA_PSE14 Chromosomal replication initiator protein dnaA >gi|71557962|gb|AAZ37173.1| chromosomal replication initiator protein DnaA [Pseudomonas syringae pv. phaseolicola 1448A] (511 aa)
Score = 449, Expect = 1.4e-42, Identities = 111/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   ++++  P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   176 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLL 506
>gi|156936082|ref|YP_001439998.1| hypothetical protein ESA_03976 [Enterobacter sakazakii ATCC BAA-894] >gi|156534336|gb|ABU79162.1| hypothetical protein ESA_03976 [Enterobacter sakazakii ATCC BAA-894] (438 aa)
Score = 449, Expect = 1.5e-42, Identities = 118/349 (33%), Positives = 192/349 (55%)
  Q:   101 PKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P        ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:    94 PAEPSYRSNVNVKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 433
>gi|16799080|ref|NP_469348.1| chromosomal replication initiation protein [Listeria innocua Clip11262] >gi|116871423|ref|YP_848204.1| chromosomal replication initiation protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123460548|sp|A0AEI7|DNAA_LISW6 Chromosomal replication initiator protein dnaA >gi|21362477|sp|Q92FV2|DNAA_LISIN Chromosomal replication initiator protein dnaA >gi|16412422|emb|CAC95234.1| Chromosomal replication initiation protein DnaA [Listeria innocua] >gi|116740301|emb|CAK19419.1| dnaA [Listeria welshimeri serovar 6b str. SLCC5334] (451 aa)
Score = 449, Expect = 1.5e-42, Identities = 140/432 (32%), Positives = 224/432 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKT----LEINP-TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +I K+  ++  Y+ ++  ++   ++     I   N+FV++     Y +              +V FI  E+++ N E   I+  P      +EI    L+ R+ F+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HAVG+   Q      +MY+ +E F  +   +I +   K EEF+  + NVD+LLIDDIQFL  KE   E FF+ FN L  + K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D    +  E ++ II S     I  + +Q       E++   + V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D+ LK  L  I
  S:    13 QIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISAPNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEE-NFEYTVIKPNPALDEDGIEIGKHMLNPRYVFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAVGHYVQQHKDNAKVMYLSSEKFTNEFISSIRD--NKTEEFRTKYRNVDVLLIDDIQFLAGKEGTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKADGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEALKDIIPSSKSQVITISGIQ-------ETVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDASLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEI 440
>gi|157368281|ref|YP_001476270.1| chromosomal replication initiation protein [Serratia proteamaculans 568] >gi|167016905|sp|A8G7Q2|DNAA_SERP5 Chromosomal replication initiator protein dnaA >gi|157320045|gb|ABV39142.1| chromosomal replication initiator protein DnaA [Serratia proteamaculans 568] (463 aa)
Score = 449, Expect = 1.6e-42, Identities = 117/346 (33%), Positives = 191/346 (55%)
  Q:   104 LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L     ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   122 LSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENNIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 458
>gi|170022263|ref|YP_001718768.1| chromosomal replication initiator protein DnaA [Yersinia pseudotuberculosis YPIII] >gi|186893345|ref|YP_001870457.1| chromosomal replication initiator protein DnaA [Yersinia pseudotuberculosis PB1/+] >gi|169748797|gb|ACA66315.1| chromosomal replication initiator protein DnaA [Yersinia pseudotuberculosis YPIII] >gi|186696371|gb|ACC87000.1| chromosomal replication initiator protein DnaA [Yersinia pseudotuberculosis PB1/+] (450 aa)
Score = 449, Expect = 1.7e-42, Identities = 119/355 (33%), Positives = 197/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:    98 PSWDNSPAQPELSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 445
>gi|89092264|ref|ZP_01165218.1| chromosomal replication initiator protein, DnaA [Oceanospirillum sp. MED92] >gi|89083352|gb|EAR62570.1| chromosomal replication initiator protein, DnaA [Oceanospirillum sp. MED92] (543 aa)
Score = 449, Expect = 1.7e-42, Identities = 110/340 (32%), Positives = 189/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV-----QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFE++  G  N+ A  AA    +    ++  L IYG  GLGKTHL+HAVGN+ ++  P   ++Y+ +E F+  + KA+      + +FK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  +  +++R+ SRF  GL++ I  P+ E+   I+++   ++R++ P  + A  F+A +  S++R LEG L ++            I N     S I +    E + +L+     Q++ D I   +   Y +    ++SK+R++  +  R+V M + +E  N S  EIG+ F  R+H TVL A + ++   +SD D++    N++
  S:   208 LNQSFTFESFVQGKSNQLALAAARQVGDNPGVSYNPLFIYGGVGLGKTHLMHAVGNEMLKRNPNAKIVYLHSERFVADMVKALQLNA--INDFKRYYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEGGQQMILTSDRYPKEINGVEERLKSRFGWGLTVAIEPPELETRVAILMKKADEARVRLP--DDAAFFLAQKIRSNVRELEGALKRV------------IANAHFTGSAITTPFIKESLKDLLALQDKQVSIDNIQRVVADYYKIKVSDLLSKRRSRSVARPRQVAMSLSKELTNHSLPEIGNAFGGRDHTTVLHACRKIKELRESDTDIREDYQNLL 538
>gi|124520295|ref|ZP_01695478.1| chromosomal replication initiator protein DnaA [Bacillus coagulans 36D1] >gi|124497785|gb|EAY45338.1| chromosomal replication initiator protein DnaA [Bacillus coagulans 36D1] (449 aa)
Score = 449, Expect = 1.7e-42, Identities = 133/433 (30%), Positives = 230/433 (53%)
  Q:    18 IEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPK--------TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMS 450
           IEK+    +F + ++  +  + +K++   I V N+F ++     Y  +            L + F+  +++D ++  P +   PK        T +    L  ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P+  ++Y+ +E F  +   +I +   K  EF+N + NVD+LLIDDIQFL  KE   E FF+ FN L+ ++K IV++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +++IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q    ++ E     Y V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D   +  ++ + +
  S:    15 IEKKISKPSF-DTWLKSTKAYSLKNDTFVISVPNEFARDWLEGHYIPLITTVLYDITGEELEIKFVIPQQQDSDE--PELFPSPKKSAEKLNDTRDYQSMLIPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVLEHNPKAKVVYLSSEKFTNEFINSIRD--NKGGEFRNKYRNVDILLIDDIQFLAGKESTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEERLRSRFEWGLITDITPPDLETRIAILRKKAKADGLDIP--NEVMLYIANQIDTNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSAKPKTITIEDIQ---KVVGEE----YHVKMEDFKAKKRTKSVAFPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKIANLIQTDAQFQKKIEELQN 444
>gi|104779317|ref|YP_605815.1| chromosomal replication initiation protein [Pseudomonas entomophila L48] >gi|123255134|sp|Q1I2G4|DNAA_PSEE4 Chromosomal replication initiator protein dnaA >gi|95108304|emb|CAK12998.1| Chromosomal replication initiator protein DnaA [Pseudomonas entomophila L48] (508 aa)
Score = 449, Expect = 1.7e-42, Identities = 110/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFE +  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   173 LNRTFTFETFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLL 503
>gi|146305043|ref|YP_001185508.1| chromosomal replication initiation protein [Pseudomonas mendocina ymp] >gi|145573244|gb|ABP82776.1| chromosomal replication initiator protein DnaA [Pseudomonas mendocina ymp] (494 aa)
Score = 449, Expect = 1.7e-42, Identities = 113/340 (33%), Positives = 189/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSD-YEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTF+N+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  +   P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   +   LV I  D I  +    Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   159 LNRTFTFDNFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLAKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFAKKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKLVSI--DNIQRTTAEYYKIKISDLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAELRESDADIREDYKNLL 489
>gi|154684519|ref|YP_001419680.1| chromosomal replication initiation protein [Bacillus amyloliquefaciens FZB42] >gi|166201860|sp|A7Z0C3|DNAA_BACA2 Chromosomal replication initiator protein dnaA >gi|154350370|gb|ABS72449.1| DnaA [Bacillus amyloliquefaciens FZB42] (446 aa)
Score = 449, Expect = 1.8e-42, Identities = 132/426 (30%), Positives = 221/426 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLE-----INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +IEK+    +F   ++  +    ++ + + I   N+F ++   + Y  +  +         L+V F+  + +D    LP  + K    E         L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +  DE L+
  S:    14 QIEKKLSKPSF-ETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSVKFVIPQNQDEENFLPKPQVKKAAKEEPSDFPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRD--NKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQ-------RIVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLIDDEQLQ 435
>gi|168183727|ref|ZP_02618391.1| chromosomal replication initiator protein DnaA [Clostridium botulinum Bf] >gi|182673252|gb|EDT85213.1| chromosomal replication initiator protein DnaA [Clostridium botulinum Bf] (448 aa)
Score = 448, Expect = 1.9e-42, Identities = 134/436 (30%), Positives = 234/436 (53%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL----EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           IIK E+      E  +N ++   +   +++ +  + V NDF K +  + YK++      +  +   N+ FI   E+ I +       +   +    E++  L+ ++TF+++ IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P+  ++Y+ +E F  ++  +I +   K  EF+N + N+D+LL+DDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +     ++  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S           Q+  DII E +   Y +  + + S +R +  +F R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +K DE L+  ++ +
  S:    15 IIKGEL-----TEVSFNTWIKSINPISLENNSFKLAVPNDFTKGILESRYKDLIVNALKLLTSKKYNIDFIVTTEEKIEENEKNHNNEKSNIVVNDEMSTMLNPKYTFDSFVIGNSNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYILHNNPKSQVVYVSSEKFTNELINSIKD--DKNVEFRNKYRNIDILLVDDIQFIAGKERTQEEFFHTFNALYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVEKLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKQTR-------QVTIDIIQEVVANYYNLKIEDLKSARRTRNIAFPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLQNAINEL 441
>gi|167031024|ref|YP_001666255.1| chromosomal replication initiation protein [Pseudomonas putida GB-1] >gi|189044600|sp|B0KEU9|DNAA_PSEPG Chromosomal replication initiator protein dnaA >gi|166857512|gb|ABY95919.1| chromosomal replication initiator protein DnaA [Pseudomonas putida GB-1] (510 aa)
Score = 448, Expect = 2.0e-42, Identities = 109/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTF+ +  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   175 LNRTFTFDTFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLL 505
>gi|66043272|ref|YP_233113.1| chromosomal replication initiation protein [Pseudomonas syringae pv. syringae B728a] >gi|81308685|sp|Q500U7|DNAA_PSEU2 Chromosomal replication initiator protein dnaA >gi|63253979|gb|AAY35075.1| chromosomal replication initiator protein, DnaA [Pseudomonas syringae pv. syringae B728a] (511 aa)
Score = 448, Expect = 2.2e-42, Identities = 111/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   ++++  P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   176 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLL 506
>gi|121998017|ref|YP_001002804.1| chromosomal replication initiator protein DnaA [Halorhodospira halophila SL1] >gi|166214674|sp|A1WWE0|DNAA_HALHL Chromosomal replication initiator protein dnaA >gi|121589422|gb|ABM62002.1| chromosomal replication initiator protein DnaA [Halorhodospira halophila SL1] (449 aa)
Score = 448, Expect = 2.2e-42, Identities = 109/350 (31%), Positives = 190/350 (54%)
  Q:   100 KPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +P+   ++  L+  FTF+++  G  N+ A +AAS+ + +N    +  L +YG  GLGKTHL+HAVGN      P+  ++Y+ +E F+ ++ KA+      + EFK  + N+D LLIDDIQF   KE+  E FF+ FN L    + ++MT D+ P  +  +++R+ SRF  GL++ I  P+ E+  ++ I   K  R      +    F+A R  S++R LEG L +I              N +     I+ D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R + M + +E  + S  EIG  F  R+H+TVL A +++++ ++ D  L    DN++
  S:   104 EPRQRPVDSNLNPGFTFDSFVEGKSNQLA-RAASMQVADNPGGAYNPLFLYGGVGLGKTHLMHAVGNAIRTARPEARVLYLHSERFVAEMVKALQHNA--INEFKRHYRNLDALLIDDIQFFAGKERSQEEFFHTFNALLESEQQVIMTCDRYPKEVNGLEERLKSRFGWGLTVAIEPPELET--RVAILKSKAIRDGVDLPDEVAFFVAKRLRSNVRELEGALRRI------------TANAQFTGRAIDVDFAKEALRDLLALQDKLVTIDNIQKTVAAYYKIRVGDLLSKRRSRSITRPRHMAMVLAKELTSHSLPEIGDAFGGRDHSTVLHACRNIKSLIEDDARLAEDYDNLL 444
>gi|94323531|gb|ABF17877.1| chromosomal replication initiator protein [Staphylococcus xylosus] (455 aa)
Score = 448, Expect = 2.2e-42, Identities = 132/421 (31%), Positives = 223/421 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD-----INKELPTIEEKPKTLEINPTLD----------SRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           Y  ++ D+ ++++++    +++ + FV     + Y EI +      +   +   F T++E +      NKE    E   K  E  P +D          +  TFE + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +   K E F+  + N+D+LLIDDIQF+ NKE+  E FF+ FN L+  NK IV++SD+ P  + K++DR+ SRF  GL + I  PD E+   I+ + I +  +  P    A+ +IA +  S+IR LEG L ++  F  L        +    ++ II++    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D   K  ++N+
  S:    23 YQTFLKDTKLYQLQNNEAIVVIDDPFVANWLKSNYVEIVQSALYEAIGHEIMPVFYTEDELENLKPSKNKETNEAERFKK--EYTPGVDEAVIGGEQFNTHNTFETFVIGPGNRFP-HAASLAVAEAPAQAYNPLFIYGGVGLGKTHLMHAIGHYVLANNPDAKVIYTSSEKFTNEFIKSIRD--NKTERFREKYRNIDVLLIDDIQFIQNKEQTQEEFFHTFNELHQANKQIVISSDRPPKEIAKLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIGEENLDIPTE--ALTYIANQIQSNIRELEGALTRVLAFSKLQGQPITTELTAAALKDIIQAPRSKKITIQDIQ-------KIVGQYYSVKIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKIVKDIQNDPTFKQEVENL 448
>gi|121607005|ref|YP_994812.1| chromosomal replication initiator protein DnaA [Verminephrobacter eiseniae EF01-2] >gi|121551645|gb|ABM55794.1| chromosomal replication initiator protein DnaA [Verminephrobacter eiseniae EF01-2] (483 aa)
Score = 447, Expect = 2.5e-42, Identities = 111/334 (33%), Positives = 179/334 (53%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLE--ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           +E P+ L     L++  TFE    G  N+ A ++A + +     + +  L +YG  GLGKTHL+HAVGN+ +   PQ  ++Y+  E F+  + ++        +EFK  + ++DLLLIDD+QF  NK++  E FFN F  L +K  ++VMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +    + P   +A  F+A    S++R LEG L KI  +   N     I +  E +R ++   +         QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   138 DEAPQALR--HRLNAALTFETLVEGSANRMA-RSAGMHVAGMPGHLYNPLFVYGGVGLGKTHLVHAVGNRLLASRPQAKVLYVHAEQFVSDVVRSYQR--RTFDEFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLTKKSHLVMTSDTYPKGLSNIHERLVSRFDSGLTVAIEPPELEMRVAILINKAQAESTEMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFNQKEISIQLAREALRDLLSIQNR--------QISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLTKELTQKSLPEIGESFGGRDHTTVLHAVRKI 460
>gi|37524033|ref|NP_927377.1| chromosomal replication initiation protein [Photorhabdus luminescens subsp. laumondii TTO1] >gi|61212694|sp|Q7NAD3|DNAA_PHOLL Chromosomal replication initiator protein dnaA >gi|36783456|emb|CAE12296.1| Chromosomal replication initiator protein DnaA [Photorhabdus luminescens subsp. laumondii TTO1] (462 aa)
Score = 447, Expect = 2.5e-42, Identities = 117/346 (33%), Positives = 191/346 (55%)
  Q:   104 LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L     ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   121 LSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNSIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENEIQLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 457
>gi|124025331|ref|YP_001014447.1| chromosomal replication initiation protein [Prochlorococcus marinus str. NATL1A] >gi|166214689|sp|A2C122|DNAA_PROM1 Chromosomal replication initiator protein dnaA >gi|123960399|gb|ABM75182.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus str. NATL1A] (464 aa)
Score = 447, Expect = 2.6e-42, Identities = 128/430 (29%), Positives = 220/430 (51%)
  Q:    14 IKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDIN-------------KELPTIEE---KPKTLEIN---PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           ++K ++K     + Y  ++  +  F  KD  + +L  N F  +     Y +  EE  S      + V    KEE   N               + T E    K K   I    P+L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ ++G+  +++ P   + Y+ TE F   +  AI + G  ++ F+N +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+TSD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  +  R++ P     I+FIA RF S+IR LEG   + + F  +  +     +  E +  +++           V++ P  ++E +   +GV ++ + S  R +  S  R+V MY++R   +LS   IG  F  ++H TV+ AI+ VE K+ S+  L +
  S:    11 VQKLLQKNLSKPS-YETWIRPAEFFDFKDGCLTLLAPNSFSSDWLRKNYSQTIEEIASETFGHEVKVHIKVKEEFSSNKSNKKKNFSNVEANSIATSENSDVKSKQTPIKKFLPSLNLRYVFNRFVVGPNSRMAHAAAMAVAEAPGREFNPLFICGGVGLGKTHLMQSIGHYRLEIDPGAKVAYVSTETFTNDLIVAIRKDG--MQAFRNRYREADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVLTSDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEHERMRLPRD--LIQFIAGRFTSNIRELEGAFTRAVAFASITGLP----MTVESVAPMLDP------TGQGVEVKPKQVLEKVAEVFGVTEEEMRSPSRRRPVSQARQVGMYLMRHGTDLSLPRIGESFGGKDHTTVMYAIEQVEKKLSSEPQLAS 447
>gi|49482254|ref|YP_039478.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|56748687|sp|Q6GKU4|DNAA_STAAR Chromosomal replication initiator protein dnaA >gi|49240383|emb|CAG39029.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus MRSA252] (453 aa)
Score = 447, Expect = 2.6e-42, Identities = 141/432 (32%), Positives = 228/432 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEE--KDINKELPTIEEKPK----TLEINPTL-----DSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           EI +E  +   Y+ ++ D+ ++ IKD    +L    F       +Y EI +      +   +   FIT EE     N E  T +E  K    T E N  L     ++  TF+ + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +   + E F+  + N+D+LLIDDIQF+ NK +  E FF  FN L+  NK IV++SD+ P  + +++DR+ SRF  GL + I  PD E+   I+ + I++ ++  P    A+ +IA +  S+IR LEG L ++  Y  LL      E +  E ++ II++    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K D   K  ++N+
  S:    12 EIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKEATKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFP-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRD--NEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPE--ALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTE-LTAEALKDIIQAPKSKKITIQDIQ-------KIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENL 446
>gi|38232643|ref|NP_938410.1| chromosomal replication initiation protein [Corynebacterium diphtheriae NCTC 13129] >gi|61212619|sp|Q6NKL7|DNAA_CORDI Chromosomal replication initiator protein dnaA >gi|38198901|emb|CAE48512.1| chromosomal replication initiator protein [Corynebacterium diphtheriae] (552 aa)
Score = 447, Expect = 2.6e-42, Identities = 105/334 (31%), Positives = 178/334 (53%)
  Q:   107 NPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDP-NEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDED 440
           N +L+ R+TF+ Y +   NK  + AA    E+    +  L I+G +GLGKTHL+HA+GN   +L P+  + Y+ +E+F      ++ +   + E FK  + ++D+L++DDIQFL  KE   E FF+ FN L   +K IV++SD+ P  L  ++DR+ +RF SGL   I  PD E+   I++       I        +E IA RFN+ IR LEG   ++  +   N  P N    +E +R ++   +D EI + +       I+      + +D  ++    +++  +  R++ MY+ RE  +LS  +IG  F  ++H TV+ A + +  ++    D
  S:   209 NGSLNPRYTFDTYVVSDSNKLPWSAAWAVAEKPARAYNPLFIWGDSGLGKTHLMHAIGNYAQELDPKLKVKYVSSEEFTNDYINSVRD--DRQEAFKRRYRDLDILMVDDIQFLQGKEGTQEEFFHTFNALQQADKQIVLSSDRPPKQLTTLEDRLRTRFQSGLIADIYPPDLETRIAILLNKASAEGITA--DRDVLELIASRFNASIRELEGAFIRVSAYASLNEAPINMATAQEALRDMMPEQADIEITAGM-------IMSVTAEYFHIDVDTLKGSGKSRSVAHPRQLAMYLCRELTDLSLPKIGEHFGGKDHTTVMYAYRKIGKEITEKRD 534
>gi|145588190|ref|YP_001154787.1| chromosomal replication initiator protein DnaA [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145046596|gb|ABP33223.1| chromosomal replication initiator protein DnaA [Polynucleobacter sp. QLW-P1DMWA-1] (475 aa)
Score = 447, Expect = 2.7e-42, Identities = 123/392 (31%), Positives = 204/392 (52%)
  Q:    50 KNDFVKEVFTNEYKEIFEEYFSIKMNSNL-----------------NVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           K D++K+ F + ++E+  EYFS  +N N                   +     + +D +  + ++EE+   +E +  L+   TFE +  G  N+ A +AAS+ +  N   ++  + +YG  GLGKTHL+HA+GN  ++  P   + YI  E ++  + +A  +     + FK  + ++DLLLIDDIQF + K +  E FF  F  L S    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++      I  P +     F+A    S++R LEG L KI     FH  +       I  + + SI              QI+ + I +++   Y +    + SKKR    +  R++ M++ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    63 KLDWIKKTFADRFQELASEYFSGPININFVLAVEGSAPTPSNVPAPEIDMSEPQSQDESSPIISVEEQSFEIEDHSKLNPNLTFETFVTGKANQLA-RAASIQVAHNPGTSYNPMFLYGGVGLGKTHLIHAIGNHLLKEKPNARIRYIHAEQYVSDVVRAYQQKA--FDRFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALLSNKSQVIITSDTYPKEMAGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAASEGI--PMTEDVAFFVAKHLRSNVRELEGALRKILAFVRFHGREVTIDVARIALKDLLSIQNR-----------QISVENIQKAVADFYSIKVADMYSKKRPANIARPRQIAMFMAKELTQKSLPEIGELFGGRDHTTVLHAVRKIGEERSHDSQL 462
>gi|126651995|ref|ZP_01724187.1| chromosomal replication initiation protein [Bacillus sp. B14905] >gi|126591264|gb|EAZ85373.1| chromosomal replication initiation protein [Bacillus sp. B14905] (449 aa)
Score = 447, Expect = 3.0e-42, Identities = 129/406 (31%), Positives = 219/406 (53%)
  Q:    45 VYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD---INKELPTIEEKPKTL-EINP-TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMS 450
           V I   N F ++   N Y  +     +     +L + F+ ++ +D    +   P I+ K     +I+P  L+ ++TF+ + IG  N+ A  AASL + E     +    IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE   E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   ++ P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II +     +    +Q        ++   + +  +  ++KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + + + +K+D  L+  +  I S
  S:    43 VTIAAPNSFARDWLENHYIHLITGILTELTGEDLLIKFVVQKNQDSDDFDLPAPIIQAKNNDHHDISPGMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPFFIYGGVGLGKTHLMHAIGHYVLEHNPNAKVVYLSSEKFTNEFINSIRD--NKALDFRNKYRNVDVLLIDDIQFLAGKESTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDIAPPDLETRIAILRKKAKADGLEVP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDINATLAAEALKDIIPNSKPRTVTILDIQ-------NAVGEHFSIRLEDFVAKKRTKLIAFPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISSLLKNDVQLQQDVKQIRS 445
>gi|85057979|ref|YP_453681.1| chromosomal replication initiation protein [Sodalis glossinidius str. 'morsitans'] >gi|123725464|sp|Q2NX49|DNAA_SODGM Chromosomal replication initiator protein dnaA >gi|84778499|dbj|BAE73276.1| chromosomal replication initiator protein DnaA [Sodalis glossinidius str. 'morsitans'] (464 aa)
Score = 447, Expect = 3.0e-42, Identities = 118/355 (33%), Positives = 196/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ +  F+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   112 PSWDNAPVQPELSYRSNVNPKHNFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENAIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 459
>gi|20806543|ref|NP_621714.1| chromosomal replication initiation protein [Thermoanaerobacter tengcongensis MB4] >gi|38257678|sp|Q8RDL6|DNAA_THETN Chromosomal replication initiator protein dnaA >gi|20514980|gb|AAM23318.1| ATPase involved in DNA replication initiation [Thermoanaerobacter tengcongensis MB4] (443 aa)
Score = 447, Expect = 3.0e-42, Identities = 130/414 (31%), Positives = 224/414 (54%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIE-EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           YN +++        ++ +++   N F K +    Y  I  +  S   N  + +  ++++E++  +   +IE E      +  TL+ ++TF+ + +G  NK A  AA L + ++    +  L IYG  GLGKTHL+HA+G+   +      +MY+ +E F  ++  +I +   K EEF+N + N+D+LLIDDIQF+ NKE+  E FF+ FN L   NK IV++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ +  +   +  P   LA  ++A +  S+IR LEG L +I  F  L   + +  + +  ++ I+ S+   EI   L+Q       E +C  Y +  +   S+KR K  ++ R++ MY+ RE  +LS  +IG  F  ++H TV+ A + +  ++K DE L
  S:    25 YNTWLVHIKPLAFAEDTLFLSTPNTFTKNIINGRYINIIYDAASKVTNRFIEIKILSEDEEEYREIKESIERENSSESTLLSTLNPKYTFDTFVVGNSNKLA-HAACLAVAQSPAKAYNPLFIYGGVGLGKTHLMHAIGHFINKNHAGYKIMYVTSETFTNELVNSIKD--DKNEEFRNKYRNIDVLLIDDIQFIANKERTQEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRVAILKKKAQSENLNIPDEVLA--YVAEKIQSNIRELEGALIRIVAFATLTKSNIDLELTKHALKDIV-SNKTREITVKLIQ-------EEVCKYYNIKLEDFRSRKRTKNIAYPRQIAMYLARELTDLSLPKIGEEFG-KDHTTVIHAYEKISNEIKQDESL 429
>gi|15922991|ref|NP_370525.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus Mu50] >gi|15925706|ref|NP_373239.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus N315] >gi|21281730|ref|NP_644816.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus MW2] >gi|49484913|ref|YP_042134.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651109|ref|YP_184912.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus COL] >gi|87161673|ref|YP_492723.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus USA300] >gi|88193824|ref|YP_498609.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266448|ref|YP_001245391.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus JH9] >gi|150392481|ref|YP_001315156.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus JH1] >gi|151220213|ref|YP_001331036.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978332|ref|YP_001440591.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus Mu3] >gi|161508267|ref|YP_001573926.1| chromosomal replication initiation protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727090|ref|ZP_02759367.1| replication initiation protein DnaA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123291872|sp|Q2G2H5|DNAA_STAA8 Chromosomal replication initiator protein dnaA >gi|123736033|sp|Q2FKQ5|DNAA_STAA3 Chromosomal replication initiator protein dnaA >gi|166215334|sp|A7WWM4|DNAA_STAA1 Chromosomal replication initiator protein dnaA >gi|172048750|sp|A6QD41|DNAA_STAAE Chromosomal replication initiator protein dnaA >gi|189083281|sp|A6TXF1|DNAA_STAA2 Chromosomal replication initiator protein dnaA >gi|189083282|sp|A5INP2|DNAA_STAA9 Chromosomal replication initiator protein dnaA >gi|189083283|sp|A8YYS4|DNAA_STAAT Chromosomal replication initiator protein dnaA >gi|56748673|sp|Q6GD89|DNAA_STAAS Chromosomal replication initiator protein dnaA >gi|56749818|sp|P68865|DNAA_STAAM Chromosomal replication initiator protein dnaA >gi|56749819|sp|P68866|DNAA_STAAN Chromosomal replication initiator protein dnaA >gi|56749820|sp|P68867|DNAA_STAAU Chromosomal replication initiator protein dnaA >gi|56749821|sp|P68868|DNAA_STAAW Chromosomal replication initiator protein dnaA >gi|71151805|sp|Q5HJZ5|DNAA_STAAC Chromosomal replication initiator protein dnaA >gi|1694677|dbj|BAA13755.1| DnaA [Staphylococcus aureus] >gi|13699918|dbj|BAB41217.1| chromosomal replication initiator protein [Staphylococcus aureus subsp. aureus N315] >gi|14245768|dbj|BAB56163.1| chromosomal replication initiator protein [Staphylococcus aureus subsp. aureus Mu50] >gi|21203165|dbj|BAB93866.1| chromosomal replication initiator protein [Staphylococcus aureus subsp. aureus MW2] >gi|49243356|emb|CAG41773.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285295|gb|AAW37389.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus COL] >gi|58578564|dbj|BAD89355.1| DnaA [Staphylococcus aureus] >gi|87127647|gb|ABD22161.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201382|gb|ABD29192.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147739517|gb|ABQ47815.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus JH9] >gi|149944933|gb|ABR50869.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus JH1] >gi|150373013|dbj|BAF66273.1| chromosomal replication initiator protein DnaA [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720467|dbj|BAF76884.1| chromosomal replication initiator protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160367076|gb|ABX28047.1| replication initiation protein DnaA [Staphylococcus aureus subsp. aureus USA300_TCH1516] (453 aa)
Score = 447, Expect = 3.0e-42, Identities = 141/432 (32%), Positives = 228/432 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEE--KDINKELPTIEEKPK----TLEINPTL-----DSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           EI +E  +   Y+ ++ D+ ++ IKD    +L    F       +Y EI +      +   +   FIT EE     N E  T +E  K    T E N  L     ++  TF+ + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +   + E F+  + N+D+LLIDDIQF+ NK +  E FF  FN L+  NK IV++SD+ P  + +++DR+ SRF  GL + I  PD E+   I+ + I++ ++  P    A+ +IA +  S+IR LEG L ++  Y  LL      E +  E ++ II++    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K D   K  ++N+
  S:    12 EIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFP-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRD--NEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPE--ALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTE-LTAEALKDIIQAPKSKKITIQDIQ-------KIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENL 446
>gi|117927212|ref|YP_871763.1| chromosomal replication initiator protein DnaA [Acidothermus cellulolyticus 11B] >gi|117647675|gb|ABK51777.1| chromosomal replication initiator protein DnaA [Acidothermus cellulolyticus 11B] (480 aa)
Score = 446, Expect = 3.1e-42, Identities = 112/322 (34%), Positives = 178/322 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L+ ++TFE + IG  N+ A  AA    E     +  L IYG +GLGKTHLLHA+G+  + LF    + Y+ +E+F      +I +G  K E F+  + +VD+LL+DDIQFL NKE+  E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +   +  +  P  N  +E+IA + +S+IR LEG L +I  F  L+    +  + E  ++ +I      EI + L       I+      +GV  + +    R++     R+V MY+ RE  +LS  +IG  F  R+H TV+ A + +
  S:   141 LNPKYTFETFVIGASNRFAHAAAFAAAESPAKAYNPLFIYGDSGLGKTHLLHAIGHYALSLFGNIRVRYVSSEEFTNDFINSIRDG--KAEGFRRRYRDVDVLLVDDIQFLENKEQTQEEFFHTFNTLHNANKQIVISSDRAPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAAQEGLDIP--NEVLEYIASKISSNIRELEGALIRISAFANLNRQRVDLALAEVVLKDLIPDSQTPEITAAL-------IMAETGAYFGVSIEDLCGSSRSRVLVTARQVAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKI 454
>gi|86604734|ref|YP_473497.1| chromosomal replication initiation protein [Synechococcus sp. JA-3-3Ab] >gi|123724517|sp|Q2JQW9|DNAA_SYNJA Chromosomal replication initiator protein dnaA >gi|86553276|gb|ABC98234.1| chromosomal replication initiator protein DnaA [Synechococcus sp. JA-3-3Ab] (467 aa)
Score = 446, Expect = 3.2e-42, Identities = 105/345 (30%), Positives = 188/345 (54%)
  Q:   108 PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           P L+ +++F  + +G  N+ A  AA    ++    +  L + G  GLGKTHL+ A+G+  ++  P+  + Y+ TE F   +  AI      ++ F+  + +VD+LL+DDIQF+  KE   E FF+ FN L+   K IV+ +D+ P  + ++ +R+ SRF+ GL  +I  PD E+   I+ +  +   +  P     IE+IA  + S+IR LEG L +   ++  +  P  +   E I+ I+   S+ +      +I PD+II+ +C  +GVD++S++   R +  S  R++ M+++R   NLS  +IG +F  ++H TVL + + V    + +   +  L N+  + 
  S:   125 PDLNPKYSFSRFVVGPNNRMAHAAALAVADKPGRAYNPLFLCGGVGLGKTHLMQAIGHYQLEANPRAKVFYVSTERFTNDLIDAIRR--DSMQSFREHYRDVDILLVDDIQFIEGKEYTQEEFFHTFNTLHESGKQIVLAADRSPHLIPRLQERLCSRFSMGLIAEIQPPDIETRMAILKKKAEYEGMILPPE--VIEYIATTYTSNIRELEGALIRAVAYVSISGLPMSV---ETIQPILNPPSEPK------EITPDMIIDVVCEEFGVDRESLLGSSRKRDISQARQIAMFLMRHHTNLSLPKIGDYFGGKDHTTVLYSCEKVSQLQRENLQFERQLQNLAQRL 458
>gi|70733514|ref|YP_257153.1| chromosomal replication initiation protein [Pseudomonas fluorescens Pf-5] >gi|123776101|sp|Q4KKT0|DNAA_PSEF5 Chromosomal replication initiator protein dnaA >gi|68347813|gb|AAY95419.1| chromosomal replication initiator protein DnaA [Pseudomonas fluorescens Pf-5] (513 aa)
Score = 446, Expect = 3.2e-42, Identities = 111/340 (32%), Positives = 192/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   178 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLL 508
>gi|123965864|ref|YP_001010945.1| chromosomal replication initiation protein [Prochlorococcus marinus str. MIT 9515] >gi|166214691|sp|A2BVM7|DNAA_PROM5 Chromosomal replication initiator protein dnaA >gi|123200230|gb|ABM71838.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus str. MIT 9515] (463 aa)
Score = 446, Expect = 3.4e-42, Identities = 128/402 (31%), Positives = 221/402 (54%)
  Q:    47 ILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELP------TIEEKPKTLEINP------------TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           ++  N+F  +     Y E  E+        N+ V F ++   + N  +P      +I+ + +++  +             +L+ R+ F+ + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  V++ P+  ++Y+ TE F   + ++I + G  V  FKN + +VDLLLIDDIQFL  KE   E FFN FN L    K IV+ SD+ P+ + K+ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     ++FIA RF+S+IR LEG   + + F  +  +     +  + I  +++ +S   +V+      P  +I+ +   + V  + ++S  R K  S  R++ MY++R+  NLS  +IG  F  ++H TV+ AI+ VE K+ SD ++ + +  I
  S:    43 LITPNNFTSDWLRKNYSETIEKAAEEICGHNVKVIFKSENNVNNNSNIPDTVSQQSIKSQTRSISTSQGNNTNNRTKKSHSLNIRYVFKRFVVGPNSRMAHAAALAVAESPGREFNPLFICGGVGLGKTHLMQAIGHYRVEIDPEAKVLYVSTETFSSDLIQSIRKDGMHV--FKNKYRSVDLLLIDDIQFLEGKEYTQEEFFNTFNALYEAGKQIVIASDRPPSQIPKLQERLISRFSMGLIADIQPPDIETRMAILQKKAEQERMNLPRD--LVQFIAGRFSSNIRELEGAFTRAVAFASITGLP----MTVQSIAPMLDPNSVGVVVT------PKQVIKKVSDFFSVTAEELVSSSRRKPVSQARQIGMYLMRQGTNLSLPKIGDEFGGKDHTTVMYAIEQVEKKLSSDPNVASQVQKI 451
>gi|157373147|ref|YP_001471747.1| chromosomal replication initiation protein [Shewanella sediminis HAW-EB3] >gi|189083280|sp|A8FP46|DNAA_SHESH Chromosomal replication initiator protein dnaA >gi|157315521|gb|ABV34619.1| chromosomal replication initiator protein DnaA [Shewanella sediminis HAW-EB3] (462 aa)
Score = 446, Expect = 3.8e-42, Identities = 118/340 (34%), Positives = 187/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++  + FEN+  G  N+   KAA++ + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSDK P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +   D K    N++
  S:   127 INRTYQFENFVEGKSNQLG-KAAAMQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLI 457
>gi|149912068|ref|ZP_01900659.1| chromosomal replication initiation protein [Moritella sp. PE36] >gi|149804864|gb|EDM64901.1| chromosomal replication initiation protein [Moritella sp. PE36] (460 aa)
Score = 446, Expect = 3.9e-42, Identities = 120/342 (35%), Positives = 184/342 (53%)
  Q:   108 PTLDSR------FTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           PT++ R      +TFEN+  G  N+ A  AA          +  L +YG TGLGKTHLLHAVGN      P   ++Y+ +E F++ + KA+      +E FKN + +VD LLIDDIQF   KE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL+I I  P+ E+   I++    +S I  P  +    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    + + D+K    N++
  S:   117 PTINHRSNVNLTYTFENFVEGKSNQLARAAAQQVASNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIKAQKPNAKVIYMHSERFVQDMVKALQNNA--IEAFKNYYRSVDALLIDDIQFFAKKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIDGVEDRLKSRFGWGLTIAIEPPELETRVAILMRKAVESNIHLP--DEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAINIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADLLSKRRSRSVARPRQVAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIVQLKEENHDIKEDYSNLI 455
>gi|160895451|ref|YP_001561033.1| chromosomal replication initiator protein DnaA [Delftia acidovorans SPH-1] >gi|160361035|gb|ABX32648.1| chromosomal replication initiator protein DnaA [Delftia acidovorans SPH-1] (468 aa)
Score = 446, Expect = 3.9e-42, Identities = 120/342 (35%), Positives = 179/342 (52%)
  Q:    90 INKELPTIEEKPKTLEINPT-LDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           I   +PT+  +     +  T L++  TFE    G  N+ A  AA  +     + +  L IYG  GLGKTHL+HAVGNK +   P   ++YI  E F+  + KA        +EFK  + ++DLLLIDD+QF  NK++  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +    + P   +A  F+A    S++R LEG L KI  +   N        E  I+   E+  D   + N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   112 IVTSVPTVTSEDAAAPVFRTRLNAALTFETLVEGTANRMARSAAMHVAGSPGHLYNPLFIYGGVGLGKTHLVHAVGNKLLADKPDAKVLYIHAEQFVSDVVKAYQR--RTFDEFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLANIHERLVSRFDSGLTVAIEPPELEMRVAILINKARAENAEMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFNQ------KEVSIQLAREALRDLLSIQNR-QISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 445
>gi|146280398|ref|YP_001170551.1| chromosomal replication initiation protein [Pseudomonas stutzeri A1501] >gi|145568603|gb|ABP77709.1| chromosomal replication initiator protein DnaA [Pseudomonas stutzeri A1501] (514 aa)
Score = 446, Expect = 4.0e-42, Identities = 110/340 (32%), Positives = 190/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  +  +++R+ SRF  GL++ +  P+ E+   I+++   ++++  P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    ++D D++    N++
  S:   179 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFAKKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIDGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHD--AAFFIAQRIRSNVRELEGALKRVIAH------AHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAELRETDADIREDYKNLL 509
>gi|71278268|ref|YP_266783.1| chromosomal replication initiator protein DnaA [Colwellia psychrerythraea 34H] >gi|123761122|sp|Q48AS7|DNAA_COLP3 Chromosomal replication initiator protein dnaA >gi|71144008|gb|AAZ24481.1| chromosomal replication initiator protein DnaA [Colwellia psychrerythraea 34H] (461 aa)
Score = 446, Expect = 4.0e-42, Identities = 122/355 (34%), Positives = 189/355 (53%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIE---FIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P + E    +     +   +TFEN+  G  N+ A  AAS   +     +  L IYG TGLGKTHLLHAVGN  +   P   + Y+ +E F++ + +A+      +E+FK  + +VD LLIDDIQF   KE+  E FF+ FN L   N+ +++TSD+ P  +  +DDR+ SRF  GL++ I  P+ E+   I+    ++S+I     NLA E   FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I  ++   Y +    ++SK+RN+  +  R++ M + +E  N S  EIG  F  R+H TVL A + V++  +   D+K    N++
  S:   111 PKVAEPESNIPKKTNVRLNYTFENFVEGKSNQLARAAASQVADNPGTAYNPLFIYGGTGLGKTHLLHAVGNGILLNKPNAKIAYMHSERFVQDMVRALQNNA--MEKFKQYYRSVDALLIDDIQFFAGKERTQEEFFHTFNALLEGNQQVILTSDRYPKEINGVDDRLKSRFGWGLTLAIEPPELETRVAILKRKAQESQI-----NLADEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQDKLVTIDNIQRTVAEYYKIKIADLLSKRRNRSVARPRQIAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKSLREETHDIKEDYSNLI 456
>gi|37678195|ref|NP_932804.1| chromosomal replication initiation protein [Vibrio vulnificus YJ016] >gi|61212682|sp|Q7MQJ7|DNAA_VIBVY Chromosomal replication initiator protein dnaA >gi|37196934|dbj|BAC92775.1| chromosomal DNA replication initiator DnaA [Vibrio vulnificus YJ016] (468 aa)
Score = 445, Expect = 4.1e-42, Identities = 116/344 (33%), Positives = 185/344 (53%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +NP    +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   133 VNP----KHKFNNFVEGKSNQLGLAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNAIVDNKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 463
>gi|31340045|sp|Q8DDI9|DNAA_VIBVU Chromosomal replication initiator protein dnaA (468 aa)
Score = 445, Expect = 4.1e-42, Identities = 116/344 (33%), Positives = 185/344 (53%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +NP    +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   133 VNP----KHKFNNFVEGKSNQLGLAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNAIVDNKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 463
>gi|119773155|ref|YP_925895.1| chromosomal replication initiation protein [Shewanella amazonensis SB2B] >gi|166215327|sp|A1S1G9|DNAA_SHEAM Chromosomal replication initiator protein dnaA >gi|119765655|gb|ABL98225.1| chromosomal replication initiator protein DnaA [Shewanella amazonensis SB2B] (457 aa)
Score = 445, Expect = 4.4e-42, Identities = 120/344 (34%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           INPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   122 INPT----YQFDNFVEGKSNQLG-KAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 452
>gi|164564809|emb|CAJ57270.1| chromosomal replication initiator protein DnaA [Pseudomonas fluorescens SBW25] (501 aa)
Score = 445, Expect = 4.8e-42, Identities = 111/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   ++++  P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   166 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLL 496
>gi|77456229|ref|YP_345734.1| chromosomal replication initiation protein [Pseudomonas fluorescens PfO-1] >gi|123772395|sp|Q3KKG1|DNAA_PSEPF Chromosomal replication initiator protein dnaA >gi|77380232|gb|ABA71745.1| chromosomal replication initiator protein, DnaA [Pseudomonas fluorescens PfO-1] (507 aa)
Score = 445, Expect = 4.8e-42, Identities = 111/340 (32%), Positives = 192/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   172 LNRTFTFENFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLL 502
>gi|149925376|ref|ZP_01913640.1| chromosomal replication initiation protein [Limnobacter sp. MED105] >gi|149825493|gb|EDM84701.1| chromosomal replication initiation protein [Limnobacter sp. MED105] (463 aa)
Score = 445, Expect = 5.0e-42, Identities = 114/330 (34%), Positives = 175/330 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV-ETKVKSDE 439
           L+    F N+  G  N+ A  AA         ++  L +YG  GLGKTHL+H++GN+ ++  P   + YI  E ++  + KA  +     EEFK S+ ++DLLLIDDIQF   K +  E FF  F +L +  K I++TSD  P  ++ +DDR+ISRFNSGL++ I  P+ E    I+++  ++ +I   FS     F+A    S+IR LEG L +I  F    N      +  E +R +I             Q++ + I +++   Y +    + SK+R  Q    R+V MY+ +E    SY EIG  F  R+H TVL A+  + E + +S E
  S:   128 LNRDLCFSNFVSGRANQLARAAAEQVASNPGVSYNPLFLYGGVGLGKTHLIHSIGNRLLEQNPNTQIRYIHAEQYVSDVVKAYQKKA--FEEFKRSYYSLDLLLIDDIQFFGGKSRTQEEFFYAFEQLIAAKKQIIITSDTYPKDIQGMDDRLISRFNSGLTVAIEPPELEMRVAILLKKAEQQKIM--FSEDVAFFVAKHMRSNIRELEGALRRIMAFASFHNKPVTMDLVREALRDMISVHHG--------QVSVESIQKTVADYYKIKVADMFSKRRQAQIVLPRQVAMYLAKELTEKSYVEIGELFGGRDHTTVLHAVNKISELRNQSSE 449
>gi|127510936|ref|YP_001092133.1| chromosomal replication initiation protein [Shewanella loihica PV-4] >gi|166215330|sp|A3Q8S6|DNAA_SHELP Chromosomal replication initiator protein dnaA >gi|126636231|gb|ABO21874.1| chromosomal replication initiator protein DnaA [Shewanella loihica PV-4] (459 aa)
Score = 445, Expect = 5.0e-42, Identities = 118/344 (34%), Positives = 190/344 (55%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +NPT    + F+N+  G  N+   KAA+L + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  +++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++   ++S I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   124 MNPT----YQFDNFVEGKSNQLG-KAAALQVSENPGGAYNPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQVILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLI 454
>gi|91228348|ref|ZP_01262276.1| chromosomal replication initiation protein [Vibrio alginolyticus 12G01] >gi|91188108|gb|EAS74412.1| chromosomal replication initiation protein [Vibrio alginolyticus 12G01] (468 aa)
Score = 445, Expect = 5.1e-42, Identities = 114/340 (33%), Positives = 185/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F+N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   133 MNPKHKFDNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 463
>gi|28896785|ref|NP_796390.1| chromosomal replication initiation protein [Vibrio parahaemolyticus RIMD 2210633] >gi|31340039|sp|Q87TQ7|DNAA_VIBPA Chromosomal replication initiator protein dnaA >gi|28804993|dbj|BAC58274.1| chromosomal DNA replication initiator DnaA [Vibrio parahaemolyticus RIMD 2210633] (468 aa)
Score = 445, Expect = 5.2e-42, Identities = 114/340 (33%), Positives = 185/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F+N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   133 MNPKHKFDNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 463
>gi|1352278|sp|P29440|DNAA_SERMA Chromosomal replication initiator protein dnaA >gi|407186|gb|AAA02924.1|AAA02924 DnaA [Serratia marcescens] (464 aa)
Score = 444, Expect = 5.8e-42, Identities = 117/346 (33%), Positives = 191/346 (55%)
  Q:   104 LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L     ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   123 LSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 459
>gi|171741734|ref|ZP_02917541.1| hypothetical protein BIFDEN_00825 [Bifidobacterium dentium ATCC 27678] >gi|171277348|gb|EDT45009.1| hypothetical protein BIFDEN_00825 [Bifidobacterium dentium ATCC 27678] (500 aa)
Score = 444, Expect = 6.6e-42, Identities = 113/336 (33%), Positives = 182/336 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAI---SEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKII--IENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           L+   TF+ +  G  N+ A   A    E   +++  L IYG +GLGKTHLL+A+GN  +   P   + Y+ +E+F  +  +A+   ++   +++EF   +  VD+LLIDDIQFL+ KE   E FF+ FN L+  NK IV+ SD  P  LK    R+ISRF SGL++ +  PD E+   I+  +  +  S I N   NL    IA RF  +IR LEG LN++     L N      + E  ++    SD         V+I P  II  +   + +    ++ + R K  +  R+V MY++RE  ++S N+IG  F  ++H TV+ A   +  +++  +++  ++
  S:   156 LNKNATFDTFVPGDSNRFARTVALAVAEGSGHDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPNLKVRYVTSEEFTNEFIEALGDTNQNSGQIKEFNRRYREVDVLLIDDIQFLSGKEATLEQFFHTFNTLHQANKRIVIASDVPPKDLKGFQARLISRFESGLTVDVKPPDLETRIAILRMMATMNGSNIPNDVLNL----IAERFTENIRELEGALNRVTAMASLSNQPVTRALAEHTLQDFFTSD---------VEIKPADIISQVAKYFHLTFDDIVGRSRTKNIALARQVAMYLVRELTSMSLNDIGLVFGGKDHTTVMHAYTRISDEMQEKQEIYNYV 486
>gi|94308946|ref|YP_582156.1| chromosomal replication initiation protein [Ralstonia metallidurans CH34] >gi|123384106|sp|Q1LSI9|DNAA_RALME Chromosomal replication initiator protein dnaA >gi|93352798|gb|ABF06887.1| chromosomal replication initiator protein DnaA [Ralstonia metallidurans CH34] (579 aa)
Score = 444, Expect = 6.6e-42, Identities = 112/346 (32%), Positives = 178/346 (51%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        +EFK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++      +  P   +A  F+A    S++R LEG L KI  F      D    +  E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   237 TVHERSR---LNPIL----TFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVSVP-EEVAF-FVAKHLRSNVRELEGALRKILAFSNFHGKDITIDVTREALKDLLTVQNRQISVENIQKTCADF--------YNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAEERSKDAQL 566
>gi|15671983|ref|NP_266157.1| chromosomal replication initiation protein [Lactococcus lactis subsp. lactis Il1403] >gi|14194668|sp|Q9CJJ2|DNAA_LACLA Chromosomal replication initiator protein dnaA >gi|12722836|gb|AAK04099.1|AE006239_1 replication initiation protein DnaA [Lactococcus lactis subsp. lactis Il1403] (455 aa)
Score = 444, Expect = 6.7e-42, Identities = 120/357 (33%), Positives = 209/357 (58%)
  Q:    96 TIEEKPKTLE-----INPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIES--DSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +IEE+P++       +   L+ ++ FEN+  G  N+    AA    ++  + +  L IYG  GLGKTHL+HA+GN+ +   P   + Y+ +E+F+     A  +   ++E F+N++ N+DLLL+DD+QF ++KE     FFN FN L  K   IV+TSD++P  L  ++DR++SRF+ GL+  I  PD E+   I++   + SR++ P   L+  +IA + +S++R LEG LN++ F  +   +   +++ E     + S  ++  + +SNL       I + +   Y +    ++  KR K+ +F R++ MY++RE +  S   IG+ F  R+H TV+ A K +  K+K+D D++  +D+I  KF
  S:    99 SIEEQPRSTAKPASPLVSGLNEKYNFENFVQGPGNRWTLAAAIAVADKPGDTYNPLFIYGGAGLGKTHLMHAIGNQILTDNPTARIKYVSSENFVNDYVNATRK--NQMENFENTYRNLDLLLLDDVQFFSDKEGTKNEFFNTFNALYDKGSQIVLTSDRIPQELNNLEDRLVSRFSWGLTTDITAPDYETRMAILLIKSESSRLEFPSETLS--YIAGQIDSNVRELEGALNRVEF--VARANGIAVVDIETASQALRSLKNATQQSLSNLTIKK---IQDEVANYYHISFSDLVGPKRPKEIAFPRQIAMYLVRELLGTSLPAIGTAFGGRDHTTVMYAYKQISDKMKNDMDVQKDIDSIKRKF 455
>gi|14194696|sp|Q9RYE7|DNAA_DEIRA Chromosomal replication initiator protein dnaA (466 aa)
Score = 443, Expect = 7.1e-42, Identities = 112/343 (32%), Positives = 183/343 (53%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           TL+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP+K + Y+ TE F  ++  AI +   K  +F+N + +VDLLL+DDIQFL  KE+  E FF+ FN L   NK I+++SD+ P  ++ ++ R+ SRF  GL   I  P+ E+   I+  N ++  I  P     +E IA +  S+IR LEG L ++  F  L+NV  +     + + ++              ++    ++  +   YG     +    R +     R+V  Y++R   + S  EIG FF  R+H+TV+ A+  +  ++  D +L A ++ + ++
  S:   122 TLNPKYTFENFVVGPNNNLAHAAALAVAESPGKAYNPLFIYGDVGLGKTHLMHAVGHYLAERFPEKRIEYVSTETFTNELINAIRD--DKTTQFRNRYRSVDLLLVDDIQFLAGKERTQEEFFHTFNALYESNKQIILSSDRPPKDIQTLEGRLRSRFEWGLITDIQSPEYETRVAILKMNAEQGHITIP--QEVLELIARQVTSNIRELEGALMRVVAFASLNNVPFSRAAAAKALSNVFAPQE--------AKVEMTDVLRQVAAHYGTTPDLIRGSGRARDIVVPRQVAQYLIRALTDHSLPEIGQFFG-RDHSTVMHAVSKITEQMGKDPELAATVNTLRNR 454
>gi|82749778|ref|YP_415519.1| chromosomal replication initiation protein [Staphylococcus aureus RF122] >gi|123727433|sp|Q2YUP1|DNAA_STAAB Chromosomal replication initiator protein dnaA >gi|82655309|emb|CAI79689.1| chromosomal replicator initiator protein [Staphylococcus aureus RF122] (453 aa)
Score = 443, Expect = 7.6e-42, Identities = 138/421 (32%), Positives = 223/421 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEE--KDINKELPTIEEKPK----TLEINPTL-----DSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           Y+ ++ D+ ++ IKD    +L    F       +Y EI +      +   +   FIT EE     N E  T +E  K    T E N  L     ++  TF+ + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F  +  K+I +   + E F+  + N+D+LLIDDIQF+ NK +  E FF  FN L+  NK IV++SD+ P  + +++DR+ SRF  GL + I  PD E+   I+ + I++ ++  P    A+ +IA +  S+IR LEG L ++  Y  LL      E +  E ++ II++    +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K D   K  ++N+
  S:    23 YSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFP-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRD--NEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPE--ALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTE-LTAEALKDIIQAPKSKKITIQDIQ-------KIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENL 446
>gi|21326649|gb|AAL30089.1| chromosomal replication initiator protein DnaA [Xanthomonas campestris pv. campestris] (442 aa)
Score = 443, Expect = 7.7e-42, Identities = 110/343 (32%), Positives = 183/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQANPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|21229479|ref|NP_635396.1| chromosomal replication initiation protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|188989397|ref|YP_001901407.1| chromosomal replication initiator protein [Xanthomonas campestris pv. campestris] >gi|38257667|sp|Q8PEH5|DNAA_XANCP Chromosomal replication initiator protein dnaA >gi|21110939|gb|AAM39320.1| chromosomal replication initiator [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|167731157|emb|CAP49329.1| chromosomal replication initiator protein [Xanthomonas campestris pv. campestris] (442 aa)
Score = 443, Expect = 7.7e-42, Identities = 110/343 (32%), Positives = 183/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQANPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|21240775|ref|NP_640357.1| chromosomal replication initiation protein [Xanthomonas axonopodis pv. citri str. 306] >gi|38257669|sp|Q8PRG2|DNAA_XANAC Chromosomal replication initiator protein dnaA >gi|21106039|gb|AAM34893.1| chromosomal replication initiator [Xanthomonas axonopodis pv. citri str. 306] (442 aa)
Score = 443, Expect = 7.7e-42, Identities = 110/343 (32%), Positives = 183/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQANPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|162446889|ref|YP_001620021.1| chromosomal replication initiator protein [Acholeplasma laidlawii PG-8A] >gi|189044629|sp|A9NE65|DNAA_ACHLI Chromosomal replication initiator protein dnaA >gi|161984996|gb|ABX80645.1| chromosomal replication initiator protein [Acholeplasma laidlawii PG-8A] (452 aa)
Score = 443, Expect = 7.7e-42, Identities = 129/438 (29%), Positives = 233/438 (53%)
  Q:    14 IKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKT-LLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           I +++EK +  E +   ++  +S FK ++  + ++V N+F+K      Y     E  +   ++ + + F+++EE     E P  + K         L+S +TF+++ +G  N  AF+ A    ++         I+G  GLGKTHL+ A+GN  +    +K ++Y++ ++F+E     +S    K EEF   + ++D++L+DDIQ + N  K    FF +F+ L   NK IV+TSDK  + L  I  R+ +RF +GLS+ I  P+ E    I+             S   + FIA +F ++IR +EG L + I +    N++    + EE + +++++       ++L + N D I   +   + V    +I KKR+ +F+  R + MY+++ K N+ Y  IGS F++R+H+TVL A + VE  ++ D +LK  +D+I+ K
  S:    11 ILQDLEKLYNEETYNELFLPVTSTFKDQNGLLTMVVANEFLKNRINKLYIAKINELATKYSSTPVRLKFVSQEEV---IEEPVADRKLTIDYRQGNLNSTYTFDSFVVGKSNMFAFRMAMKVADQPGAVANPFYIFGDVGLGKTHLMQAIGNYILDNDVEKRILYVKADNFIEDFVSLLSRNKNKTEEFNAKYKDIDVILVDDIQIMANASKTQMEFFKLFDYLYLNNKQIVITSDKPASQLTNIMPRLTTRFEAGLSVDIQIPELEHRISILKRKTATLDANLEVSEDILTFIASQFAANIREMEGALIRLISYAQTFNLEITMNVVEEALGAVLKTKKK---TNDLNENNYDKIQSIVADYFQVSLPDLIGKKRHAKFTLPRHIAMYLIKLKYNIPYKTIGSLFNDRDHSTVLSACEKVERDMRMDSNLKFAVDSIVKK 445
>gi|161611268|ref|YP_294227.2| chromosomal replication initiation protein [Ralstonia eutropha JMP134] (584 aa)
Score = 443, Expect = 7.7e-42, Identities = 112/346 (32%), Positives = 178/346 (51%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        +EFK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++      +  P   +A  F+A    S++R LEG L KI  F      D    +  E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   242 TVHERSR---LNPIL----TFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVSVP-EEVAF-FVAKHLRSNVRELEGALRKILAFSNFHGRDITIEVTREALKDLLTVQNRQISVENIQKTCADF--------YNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 571
>gi|27364433|ref|NP_759961.1| chromosomal replication initiation protein [Vibrio vulnificus CMCP6] >gi|27360552|gb|AAO09488.1|AE016800_93 DNA replication initiator DnaA [Vibrio vulnificus CMCP6] (459 aa)
Score = 443, Expect = 7.7e-42, Identities = 114/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   124 VNPKHKFNNFVEGKSNQLGLAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNAIVDNKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 454
>gi|72117120|gb|AAZ59383.1| chromosomal replication initiator protein, DnaA [Ralstonia eutropha JMP134] (611 aa)
Score = 443, Expect = 7.7e-42, Identities = 112/346 (32%), Positives = 178/346 (51%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        +EFK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++      +  P   +A  F+A    S++R LEG L KI  F      D    +  E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   269 TVHERSR---LNPIL----TFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVSVP-EEVAF-FVAKHLRSNVRELEGALRKILAFSNFHGRDITIEVTREALKDLLTVQNRQISVENIQKTCADF--------YNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 598
>gi|84621658|ref|YP_449030.1| chromosomal replication initiation protein [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188574271|ref|YP_001911200.1| chromosomal replication initiator protein DnaA [Xanthomonas oryzae pv. oryzae PXO99A] >gi|123725613|sp|Q2P9M1|DNAA_XANOM Chromosomal replication initiator protein dnaA >gi|84365598|dbj|BAE66756.1| chromosomal replication initiator [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188518723|gb|ACD56668.1| chromosomal replication initiator protein DnaA [Xanthomonas oryzae pv. oryzae PXO99A] (442 aa)
Score = 443, Expect = 7.8e-42, Identities = 110/343 (32%), Positives = 183/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQAKPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|58579624|ref|YP_198640.1| chromosomal replication initiation protein [Xanthomonas oryzae pv. oryzae KACC10331] >gi|71151811|sp|Q5H715|DNAA_XANOR Chromosomal replication initiator protein dnaA >gi|58424218|gb|AAW73255.1| chromosomal replication initiator [Xanthomonas oryzae pv. oryzae KACC10331] (443 aa)
Score = 443, Expect = 7.8e-42, Identities = 110/343 (32%), Positives = 183/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   107 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQAKPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 441
>gi|90019650|ref|YP_525477.1| chromosomal replication initiator protein DnaA [Saccharophagus degradans 2-40] >gi|122996680|sp|Q21PW4|DNAA_SACD2 Chromosomal replication initiator protein dnaA >gi|89949250|gb|ABD79265.1| chromosomal replication initiator protein DnaA [Saccharophagus degradans 2-40] (524 aa)
Score = 443, Expect = 7.9e-42, Identities = 111/344 (32%), Positives = 185/344 (53%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL-LDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +NPT    F F+N+ +G  N+    AA+   E    ++  L IYG  GLGKTHL+HAVGN      P   ++Y+ +E F+  + KA+      + +FK  + +VD LLIDDIQF   KE+  E FF+ FN L    + I++T D+ P  +  +++R+ SRF  GL++ I  P+ E+  ++ I   K  ++  P  N A  FIA R  S++R LEG L ++  +      D +  +  E ++ ++       +   LV I  D I   +   Y +    + SK+R++  +  R+V MY+ ++  + S  EIG  F  R+H TVL A + ++  ++SD D++  + N++
  S:   189 LNPT----FIFDNFVVGKSNQLGLAAATQVAENPGGSYNPLFIYGGVGLGKTHLMHAVGNALCVRKPGAKVVYLHSERFVADMVKALQLNA--INDFKRYYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEGGQQIILTCDRYPKEINGLEERLKSRFGWGLTVAIEPPELET--RVAILKRKAEQVGAPLPNDAAFFIAQRIRSNVRELEGALKRVIANAHFTGRDISVELVREALKDLL------ALQDRLVSI--DNIQRVVAEYYKIKVSDLHSKRRSRSVARPRQVAMYLAKDLTHHSLPEIGEAFGGRDHTTVLHACRKIKEMIESDADIREDVKNLL 519
>gi|188590796|ref|YP_001795396.1| chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator [Cupriavidus taiwanensis] >gi|170937690|emb|CAP62674.1| chromosomal replication initiator protein DnaA, DNA-binding transcriptional dual regulator [Cupriavidus taiwanensis] (589 aa)
Score = 443, Expect = 8.1e-42, Identities = 111/346 (32%), Positives = 178/346 (51%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+H++GN  +   P+  + YI  E ++  + KA        +EFK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++      +  P   +A  F+A    S++R LEG L KI  F      D    +  E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   247 TVHERSR---LNPIL----TFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHSIGNHMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVNVP-EEVAF-FVAKHLRSNVRELEGALRKILAFSNFHGKDITIEVTREALKDLLTVQNRQISVENIQKTCADF--------YNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 576
>gi|171325324|ref|ZP_02913830.1| chromosomal replication initiator protein DnaA [Geobacillus sp. WCH70] >gi|171088748|gb|EDT35093.1| chromosomal replication initiator protein DnaA [Geobacillus sp. WCH70] (450 aa)
Score = 443, Expect = 8.4e-42, Identities = 132/436 (30%), Positives = 226/436 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFIT---KEEKDINKELPTIEEKPKTLEI----NPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           EIEK+    +F   ++  +    ++ + + I+  N+F ++   + Y  +  E         L + FIT   + E D   +  + + +    E        L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   AI +   + ++F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K      P  N  + +IA + +S+IR LEG L ++  +  L N +    +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +++D  L+  +  I  K 
  S:    14 EIEKKISKPSF-ETWLKSTKAHSLRGDTLVIIAPNEFARDWLDSRYSRLIAETIYDITGEELLIKFITPPNQSEDDFEFQRSSKKHRKPYEESTDFPQSMLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRD--NRPDDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGFDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLAAEALKDIIPSTKPKVITIQDIQ-------RVVGQHFNIKLEDFKAKKRTKSVAFPRQIAMYLSRELTDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDAQLQKHIKEIEEKL 447
>gi|188589439|ref|YP_001919466.1| chromosomal replication initiator protein DnaA [Clostridium botulinum E3 str. Alaska E43] >gi|188499720|gb|ACD52856.1| chromosomal replication initiator protein DnaA [Clostridium botulinum E3 str. Alaska E43] (456 aa)
Score = 443, Expect = 8.6e-42, Identities = 137/434 (31%), Positives = 235/434 (54%)
  Q:    18 IEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKE----EKDINKELPTIEEKPKTL--------EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           I K   +E  +N ++       I D ++ I V N F K++    YK +         +   ++ FI +     E ++N    +I+ + K          E++ TL+ ++TF ++ IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +Q   +  ++Y+ +E F  ++  AI +   K EEF+  + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK+ ++N   +N  + +IA +  S+IR LEG L +I  +  L N +    +  E ++ II       +    +Q       E +   + +    + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +KSDE+L+  + +I  K
  S:    15 IVKSEMSEVSFNTWIKSCEPISISDTSIKISVPNSFTKDILDKRYKSLVANSIEAVCSKLYDIKFIIESDLNNEDELNSSDNSIKNRNKNSTKNIVVNDEMSSTLNPKYTFNSFVIGNSNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQNNTKAKVVYVSSEKFTNELINAIKD--DKNEEFRKKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNELHDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQVPDFETRMAIL---KKKADVENLKVANEVMGYIATKIKSNIRELEGALIRIIAYSSLTNREVTVDLASEALKDIISKKQGKHVTIPSIQ-------EIVANYFNLKIDDLKSQRRTRNVAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKSDENLQHTVSDITKK 452
>gi|52078492|ref|YP_077283.1| chromosomal replication initiation protein [Bacillus licheniformis ATCC 14580] >gi|52783856|ref|YP_089685.1| chromosomal replication initiation protein [Bacillus licheniformis ATCC 14580] >gi|71151793|sp|Q65PM2|DNAA_BACLD Chromosomal replication initiator protein dnaA >gi|52001703|gb|AAU21645.1| DnaA [Bacillus licheniformis ATCC 14580] >gi|52346358|gb|AAU38992.1| DnaA [Bacillus licheniformis DSM 13] (446 aa)
Score = 443, Expect = 8.9e-42, Identities = 131/436 (30%), Positives = 225/436 (51%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTI------EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +IEK+    +F   ++  +    ++ + + I   N+F ++   + Y  +  +         L++ F+  + ++    +P        +E+P     N  L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ + K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +  DE L+  +  I  + 
  S:    14 QIEKKLSKPSF-ETWMKSTKAHSLQGDTLIITAPNEFARDWLESRYLHLIADTIYDLTGEELSIKFVIPQNQNEEDFMPKSPIKKMSKEEPADFPQN-MLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRD--NKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEETKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKDIQ-------RIVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLSDDEQLQQQIKEIKEQL 445
>gi|86147175|ref|ZP_01065491.1| chromosomal replication initiation protein [Vibrio sp. MED222] >gi|85835059|gb|EAQ53201.1| chromosomal replication initiation protein [Vibrio sp. MED222] (473 aa)
Score = 443, Expect = 9.0e-42, Identities = 116/352 (32%), Positives = 191/352 (54%)
  Q:    98 EEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +E+P  +++N    ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   124 DEEPVAVDLNHRSNVNPKHKFNNFVEGKSNQLGLAAARQVSDNPGTAYNPLFLYGGTGLGKTHLLHAVGNAIVDNKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYSNLI 468
>gi|114319167|ref|YP_740850.1| chromosomal replication initiator protein DnaA [Alkalilimnicola ehrlichei MLHE-1] >gi|122312809|sp|Q0ACS7|DNAA_ALHEH Chromosomal replication initiator protein dnaA >gi|114225561|gb|ABI55360.1| chromosomal replication initiator protein DnaA [Alkalilimnicola ehrlichei MLHE-1] (451 aa)
Score = 442, Expect = 9.2e-42, Identities = 115/352 (32%), Positives = 188/352 (53%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ P T      L+S FTF+ +  G  N+ A +AAS+ + EN    +  L +YG  GLGKTHL+HAVGN  ++  P+  ++Y+ +E F+  + KA+      + EFK  +  VD LLIDDIQF   KE+  E FF+ FN L    + ++MT D+ P  +  +++R+ SRF  GL++ I  P+ E+   I++    +  +  P       FIA R  S+IR LEG L ++  +        EI  E   E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  + S  EIG  F  R+H TVL A + VE+    D  ++    N++
  S:   104 DQTPATRSAASNLNSNFTFDTFVEGKSNQLA-RAASMQVVENPGTAYNPLFLYGGVGLGKTHLMHAVGNAMLRRRPEARVLYLHSERFVADMVKALQHNA--INEFKRHYRMVDALLIDDIQFFARKERSQEEFFHTFNALLEGEQQVIMTCDRYPKEVNGLEERLKSRFGWGLTVAIEPPELETRVAILMSKALQEGVDLPHE--VAFFIAKRIRSNIRELEGALRRVVANA--QFTGQEITVEFTKEALRDLL------ALQDKLVTI--DNIQKTVAEYYKIRVADLLSKRRSRSITRPRQMAMALAKELTSHSLPEIGDAFGGRDHTTVLHACRKVESLCAEDSRIEEDYSNLL 446
>gi|163751709|ref|ZP_02158928.1| chromosomal replication initiation protein [Shewanella benthica KT99] >gi|161328448|gb|EDP99604.1| chromosomal replication initiation protein [Shewanella benthica KT99] (396 aa)
Score = 442, Expect = 9.4e-42, Identities = 121/361 (33%), Positives = 195/361 (54%)
  Q:    89 DINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++N   P I    ++  INP     + F+N+  G  N+   KAA+  + EN    +  L +YG TGLGKTHLLHAVGN  ++  P   ++Y+ +E F++ + KA+      +EEFK  + +VD L IDDIQF  NK++  E FF+ FN L   N  +++TSDK P  +  ++DR+ SRF  GL++ I  P+ E+   I++    +S +  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    + + D+K    N++
  S:    45 NVNMPEPAIMTNHRS-NINPA----YQFDNFVEGKSNQLG-KAAAQQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGNAIIKNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQVILTSDKYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKALESGVNLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRRIAQLREENHDIKEDYANLI 391
>gi|87123971|ref|ZP_01079821.1| chromosomal replication initiator protein DnaA [Synechococcus sp. RS9917] >gi|86168540|gb|EAQ69797.1| chromosomal replication initiator protein DnaA [Synechococcus sp. RS9917] (466 aa)
Score = 442, Expect = 9.4e-42, Identities = 106/336 (31%), Positives = 182/336 (54%)
  Q:   108 PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           P L+ R+ F  + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   + +AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I++I+ RF S+IR LEG L + + F  +  +     +  E +  +++           V++ P  +IE +   + V    ++S  R +  S  R+V M+++R+   LS   IG  F  ++H TV+ AI+ VE K+ SD  L +
  S:   125 PGLNMRYVFNRFVVGPNSRMAHAAALAVAESPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPDARVSYVSTETFTNDLIQAIRKDG--MQAFRDRYRATDLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEQERVTLPRD--LIQYISGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDPSGQG------VEVTPQQVIEKVSEVFDVSADDMLSSSRRRAVSQARQVGMFLMRQGTGLSLPRIGETFGGKDHTTVMYAIEQVEKKLASDPQLAS 449
>gi|145218823|ref|YP_001129532.1| chromosomal replication initiator protein DnaA [Prosthecochloris vibrioformis DSM 265] >gi|145204987|gb|ABP36030.1| chromosomal replication initiator protein DnaA [Prosthecochloris vibrioformis DSM 265] (487 aa)
Score = 442, Expect = 9.4e-42, Identities = 117/362 (32%), Positives = 195/362 (53%)
  Q:    87 EKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           E+ + K   + E   +  E    L+S++TF+    G  N  AF AA    +    N +  L+IYG  GLGKTH++ A+GN   Q      ++Y+ +E F      AI  G  K++EF + +  +D+L+IDDIQF + KEK  E  F+IFN L+  NK I++++D+   ++K I+DR+ISRFN GLS  I  PD E+ K II+  +++S +        IEFIA     ++R LEG + K+     LDN D +    +  ++ II   +         Q+N D I + IC  Y +    +  K + K+ +  R++ MY+ ++    S   IG  F  R+H+TV+ A+  +  +++++ + +  ++ I
  S:   127 EEAVKKSSDSFERDIERFETQ--LNSKYTFDTLIRGDCNSLAFAAAKSVAQNPGQNAFNPLVIYGGVGLGKTHMMQAIGNTVRQEREGAKVLYVSSEKFAIDFVNAIQNG--KIQEFSSFYRTIDVLIIDDIQFFSGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKNIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLQQSGVD--LDENVIEFIANNITDNVRELEGCIVKLLAARSLDNRDIDLSFTKLTLKDIIRHSAK--------QLNLDTIEKVICEFYAITSNDLKGKSKKKEIATGRQIAMYLAKQLTESSLKTIGLHFGGRDHSTVIHAVNTIARRIEAEGEDQGRINEI 478
>gi|78045557|ref|YP_361732.1| chromosomal replication initiation protein [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|123744129|sp|Q3BZT1|DNAA_XANC5 Chromosomal replication initiator protein dnaA >gi|78033987|emb|CAJ21632.1| chromosomal replication initiator protein DnaA [Xanthomonas campestris pv. vesicatoria str. 85-10] (442 aa)
Score = 442, Expect = 9.9e-42, Identities = 110/343 (32%), Positives = 182/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    +   +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQRPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQANPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|119475236|ref|ZP_01615589.1| chromosomal replication initiation protein [marine gamma proteobacterium HTCC2143] >gi|119451439|gb|EAW32672.1| chromosomal replication initiation protein [marine gamma proteobacterium HTCC2143] (479 aa)
Score = 442, Expect = 1.0e-41, Identities = 112/352 (31%), Positives = 194/352 (55%)
  Q:    98 EEKPKTLEINPTLDSR-FTFENYTIGMF----NKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +  P+ +E+   +  + F  ENYT   F    +    +AAS+ + EN    +  L +YG  GLGKTHL+HAVGN  +Q  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++T D+ P  +  +++R+ SRF  GL++ +  P+ E+   I+++  ++++I+ P    A  FIA R  S++R LEG L ++          + +  E  I  I ES  D   + +  Q++ + I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + ++   ++D D++    N++
  S:   126 QSSPRKVEVEGAIQHQSFLMENYTFDTFVEGKSNQLARAASIQVAENTGGAYNPLFLYGGVGLGKTHLMHAVGNAIIQRKPNAKVVYLHSERFVADMVKALQLNA--INEFKRYYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEGGQQMILTCDRYPKEINGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQAKIELPAD--AAFFIAQRIRSNVRELEGALKRVI------ASAHFMGREIDIELIRESLKDLLALQD-KQVSMENIQRTVAEYYKIKVSDMMSKRRSRSVARPRQVAMALAKELTNHSLPEIGDGFGGRDHTTVLHACRKIKELEETDADIREDCKNLL 474
>gi|177666436|ref|ZP_02942231.1| chromosomal replication initiator protein DnaA [Cyanothece sp. PCC 8801] >gi|172074613|gb|EDT60031.1| chromosomal replication initiator protein DnaA [Cyanothece sp. PCC 8801] (453 aa)
Score = 442, Expect = 1.0e-41, Identities = 121/424 (28%), Positives = 213/424 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKE--------------EKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +  ++ D+++ + KD  + I V N F+       Y+ I  +  +  +   +++   T E              EK + +  P   E PK  ++NP    R+TF  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+ +  ++L+P   + Y+ TE F   +  AI +    +E F+  +   D LLIDDIQF+  KE   E  F+ FN L+   K +V+ SD+ P  +  + DR+ISRF+ GL   I  PD E+   I+ +  +   ++ P     +E+IA  + S+IR LEG L + I +  +  +     +  + I  ++    +       V  +P++I+ ++     V  + +    R ++ SF R+V MY++R+   LS   IG  F  ++H TVL +   +    + D +L   L  +  +
  S:    25 FETWIQDATVQEWKDNCLVIQVANSFILNHLQKTYQPIIAQEVASVVGYPVDIQLTTAEGETMAMTGEAQSYQEKSLTQIAP---ESPKLNQLNP----RYTFSRFVVGPTNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLELYPNAKVFYVSTEQFTNDLIAAIRQ--DSMERFREHYRRADFLLIDDIQFIEGKEYTQEELFHTFNTLHEAGKQVVLASDRAPKRIPTLQDRLISRFSMGLIADIQVPDLETRMAILQKKAQYENMRLPRD--VVEYIATNYTSNIRELEGALIRAIAYTSISGLS----MTVQNIAPVLNPPVEQ------VPASPEVILRTVAESLKVSIEDLKGSSRRREISFARQVGMYLMRQHTELSLPRIGEEFGGKDHTTVLYSCDKISKLQQKDWELSQMLSELSDR 444
>gi|113866032|ref|YP_724521.1| chromosomal replication initiation protein [Ralstonia eutropha H16] >gi|123033387|sp|Q0KFR8|DNAA_RALEH Chromosomal replication initiator protein dnaA >gi|113524808|emb|CAJ91153.1| chromosomal replication initiator protein DnaA [Ralstonia eutropha H16] (588 aa)
Score = 442, Expect = 1.0e-41, Identities = 112/346 (32%), Positives = 178/346 (51%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        +EFK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++      +  P   +A  F+A    S++R LEG L KI  F      D    +  E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   246 TVHERSR---LNPIL----TFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLLENPRARIRYIHAEQYVSDVVKAYQRKA--FDEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVNVP-EEVAF-FVAKHLRSNVRELEGALRKILAFSNFHGKDITIEVTREALKDLLTVQNRQISVENIQKTCADF--------YNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 575
>gi|21672843|ref|NP_660908.1| chromosomal replication initiator protein DnaA [Chlorobium tepidum TLS] >gi|38257655|sp|Q8KGG6|DNAA_CHLTE Chromosomal replication initiator protein dnaA >gi|21645891|gb|AAM71250.1| chromosomal replication initiator protein DnaA [Chlorobium tepidum TLS] (493 aa)
Score = 442, Expect = 1.1e-41, Identities = 113/342 (33%), Positives = 189/342 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L+ ++TF     G  N  AF AAS  + +N   N +  L+IYG  GLGKTH++ A+GN  ++      ++Y+ +E F      AI  G   ++EF   + N+D+L+IDDIQF   KEK  E  F+IFN L+  NK I++++D+    +K I+DR+ISRFN GLS  I  PD E+ K II   +K+S +      + IEFIA    S++R LEG + K+   H LDN + +    +  ++ II          N  Q+  + I +++C  + +    +  K + K+ +  R++ MY+ ++  + S   IG  F  R+H+TV+ A+  +E K+ +  + +  ++ +  +
  S:   154 LNPKYTFSTLVRGDCNSLAF-AASKSIAQNPGQNAFNPLVIYGGVGLGKTHMMQAIGNSVLENRITDAVLYVSSEKFAIDFVNAIQNG--NIQEFSAFYRNIDVLIIDDIQFFAGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKEIKGIEDRLISRFNWGLSTDIQAPDYETRKAIIQSKLKQSGVS--LDPVVIEFIATNVTSNVRELEGCIVKLLAAHSLDNQEIDLQFAKSTLKDIIR--------YNTKQLTLETIEKAVCSYFSITSNDLKGKSKKKEIAVGRQIAMYLSKDMTDSSLKTIGLHFGGRDHSTVIHALNTIEKKIAASNEERKKIEELRKR 487
>gi|153854255|ref|ZP_01995554.1| hypothetical protein DORLON_01548 [Dorea longicatena DSM 13814] >gi|149753030|gb|EDM62961.1| hypothetical protein DORLON_01548 [Dorea longicatena DSM 13814] (462 aa)
Score = 442, Expect = 1.1e-41, Identities = 133/445 (29%), Positives = 243/445 (54%)
  Q:     7 IKKKY--LIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT-----LDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEE-----FKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRI-KNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +K+K+  +I    +E E  N +F N ++    ++ + D  V+ILV  +   E    +Y+   +   +    +   V FI++++  +N+      E  +  +         L+ ++TF+ + +G  N N   AASL + E+    +  L +YG  GLGKTHL+H++ +  +   P+K ++Y+ +E F  ++ +A+  G T   E     F++ + N D+LLIDDIQF+  KE   E FF+ FN L++  K I+++SDK P  ++ ++ R+ +RF  GL   I+ P+ E+   I+ + I+   + K    N  +E+IA    ++IR LEG LNK I  + L+N    +I +  E ++ II SD       N  ++ P++I++ +   +GV    +   KRN +  F R++ MY++R     S   +G     ++H+T+   I+ +E ++K+DE L   ++ I  K
  S:     5 VKEKWPEIIEHLRVEHELSNVSF-NTWIQPLKVYDVVDNTVFILVNMNASVEYIEKKYQLPLKVCIAEITGTEYEVVFISEDDDRLNEIQNMAIEANQKKKSKSAAEKAGLNPKYTFDTFVVGG-NNNFAHAASLAVAESPGEVYNPLFLYGGVGLGKTHLMHSIAHFILDKNPKKKVLYVTSETFTNELIEALKNGKTAGNESAMSKFRDKYRNNDVLLIDDIQFIIGKESTQEEFFHTFNHLHTSGKQIIISSDKPPKDIETLEARLRTRFEWGLIADISSPNYETRMAILQKKIELDHLEKYNIPNDVLEYIATNVKTNIRELEGSLNKLIALYKLNNTGSIDIALAAEALKDIISSD-------NRREVTPELILDIVSEHFGVSIPDLKGNKRNAEIVFPRQIAMYLIRNMTETSLKAVGVILGGKDHSTIKHGIEKIENELKADETLSNTINIIKKK 458
>gi|26986755|ref|NP_742180.1| chromosomal replication initiation protein [Pseudomonas putida KT2440] >gi|60392185|sp|P0A116|DNAA_PSEPK Chromosomal replication initiator protein dnaA >gi|60392186|sp|P0A117|DNAA_PSEPU Chromosomal replication initiator protein dnaA >gi|24981346|gb|AAN65644.1|AE016191_1 chromosomal replication initiator protein DnaA [Pseudomonas putida KT2440] >gi|581460|emb|CAA32893.1| unnamed protein product [Pseudomonas putida] (506 aa)
Score = 442, Expect = 1.1e-41, Identities = 109/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTF+ +  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   171 LNRTFTFDTFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLL 501
>gi|117617947|ref|YP_854527.1| chromosomal replication initiator protein DnaA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166201857|sp|A0KEC3|DNAA_AERHH Chromosomal replication initiator protein dnaA >gi|117559354|gb|ABK36302.1| chromosomal replication initiator protein DnaA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (456 aa)
Score = 442, Expect = 1.1e-41, Identities = 120/352 (34%), Positives = 193/352 (54%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           E KP+    + T +  +TFEN+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN   +      ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++    +++I  P  +    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   110 EAKPEPNHKSNT-NVNYTFENFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNAIKERKQDAKVIYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKADENQIHLP--DEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAINIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKLADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLKEESHDIKEDYSNLI 451
>gi|15805044|ref|NP_293728.1| chromosomal replication initiator protein [Deinococcus radiodurans R1] >gi|6457661|gb|AAF09596.1|AE001864_2 chromosomal replication initiator protein [Deinococcus radiodurans R1] (454 aa)
Score = 442, Expect = 1.1e-41, Identities = 112/343 (32%), Positives = 183/343 (53%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           TL+ ++TFEN+ +G  N  A  AA    E     +  L IYG  GLGKTHL+HAVG+   + FP+K + Y+ TE F  ++  AI +   K  +F+N + +VDLLL+DDIQFL  KE+  E FF+ FN L   NK I+++SD+ P  ++ ++ R+ SRF  GL   I  P+ E+   I+  N ++  I  P     +E IA +  S+IR LEG L ++  F  L+NV  +     + + ++              ++    ++  +   YG     +    R +     R+V  Y++R   + S  EIG FF  R+H+TV+ A+  +  ++  D +L A ++ + ++
  S:   110 TLNPKYTFENFVVGPNNNLAHAAALAVAESPGKAYNPLFIYGDVGLGKTHLMHAVGHYLAERFPEKRIEYVSTETFTNELINAIRD--DKTTQFRNRYRSVDLLLVDDIQFLAGKERTQEEFFHTFNALYESNKQIILSSDRPPKDIQTLEGRLRSRFEWGLITDIQSPEYETRVAILKMNAEQGHITIP--QEVLELIARQVTSNIRELEGALMRVVAFASLNNVPFSRAAAAKALSNVFAPQE--------AKVEMTDVLRQVAAHYGTTPDLIRGSGRARDIVVPRQVAQYLIRALTDHSLPEIGQFFG-RDHSTVMHAVSKITEQMGKDPELAATVNTLRNR 442
>gi|150387854|ref|YP_001317903.1| chromosomal replication initiation protein [Alkaliphilus metalliredigens QYMF] >gi|167016895|sp|A6TJ76|DNAA_ALKMQ Chromosomal replication initiator protein dnaA >gi|149947716|gb|ABR46244.1| chromosomal replication initiator protein DnaA [Alkaliphilus metalliredigens QYMF] (448 aa)
Score = 442, Expect = 1.2e-41, Identities = 140/449 (31%), Positives = 233/449 (51%)
  Q:     4 LAQIKKKYL-IIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDI-----------NKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L QI +K + +IK E+      E  +N +V       + +E + + V NDF + +    Y  +         + N  V  +   E+ +           N + P +   P  L +NP    ++TF+ + IG  N+ A  AAS+ + E+    +  L IYG  GLGKTHL++A+G+  +   P+  ++Y+ +E F  ++  +I +   +  EF+N + NVD+LL+DDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ +  +   I  P  +     IA +  S+IR LEG L +I  +  L N +    +  E ++ I  S            +N  +I E +   + +  +   SKKR +  S+ R+V MY+ RE  +LS  +IG  F  R+H TV+ A   +  ++ SD DLK  LD I+ + 
  S:     5 LPQIWEKAINLIKTEL-----TEVSFNTWVKPIQAISLDNETLVLGVPNDFTQGILNARYNTLISNAVKQVTSKNYEVHIVVPSEERVGDTQNINARRSNAQSPIMGNSP--LILNP----KYTFDTFVIGNSNRFA-HAASVAVAESPAKAYNPLFIYGGVGLGKTHLMNAIGHYILANNPKAKVVYVSSETFTNELINSIRD--DRNVEFRNRYRNVDVLLVDDIQFIAGKERTQEEFFHTFNALHESNKQIIISSDRPPKEIPTLEERLRSRFEWGLITDIQPPDLETRIAILRKKAQMENIYVP--DEVTAHIAKKIQSNIRELEGALIRIVAYSSLTNSEVTVELASEALKEIFTSKPRL--------LNVPLIKEVVSNHFSIKLEDFDSKKRTRSISYPRQVAMYLTRELTDLSLPKIGDEFGGRDHTTVMHAHSKIVNEINSDSDLKNKLDAIIKEL 445
>gi|14194681|sp|Q9KHU8|DNAA_ACHLA Chromosomal replication initiator protein dnaA >gi|8515411|gb|AAF75986.1|AF248639_2 DNA replication initiator protein [Acholeplasma laidlawii] (445 aa)
Score = 441, Expect = 1.2e-41, Identities = 129/438 (29%), Positives = 232/438 (52%)
  Q:    14 IKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKT-LLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           I +++EK +  E +   ++  +S FK ++  + ++V N+F+K      Y     E  +   ++ + + F+++EE     E P  + K         L+S +TF+++ +G  N  AF+ A    +          I+G  GLGKTHL+ A+GN  +    +K ++Y++ ++F+E     +S    K EEF   + ++D++L+DDIQ + N  K    FF +F+ L   NK IV+TSDK  + L  I  R+ +RF +GLS+ I  P+ E    I+             S   + FIA +F ++IR +EG L + I +    N++    + EE + +++++       ++L + N D I   +   + V    +I KKR+ +F+  R + MY+++ K N+ Y  IGS F++R+H+TVL A + VE  ++ D +LK  +D+I+ K
  S:    11 ILQDLEKLYNEETYNELFLPVTSTFKDQNGLLTMVVANEFLKNRINKLYIAKINELATKYSSTPVRLKFVSQEEV---IEEPVADRKLTIDYRQGNLNSTYTFDSFVVGKSNMFAFRMAMKVADHPGAVANPFYIFGDVGLGKTHLMQAIGNYILDNDVEKRILYVKADNFIEDFVSLLSRNKNKTEEFNAKYKDIDVILVDDIQIMANASKTQMEFFKLFDYLYLNNKQIVITSDKPASQLTNIMPRLTTRFEAGLSVDIQIPELEHRISILKRKTATLDANLEVSEDILTFIASQFAANIREMEGALIRLISYAQTFNLEITMNVVEEALGAVLKTKKK---TNDLNENNYDKIQSIVADYFQVSLPDLIGKKRHAKFTLPRHIAMYLIKLKYNIPYKTIGSLFNDRDHSTVLSACEKVERDMRMDSNLKFAVDSIVKK 445
>gi|124007462|ref|ZP_01692168.1| chromosomal replication initiator protein DnaA [Microscilla marina ATCC 23134] >gi|123987118|gb|EAY26867.1| chromosomal replication initiator protein DnaA [Microscilla marina ATCC 23134] (493 aa)
Score = 441, Expect = 1.2e-41, Identities = 118/351 (33%), Positives = 199/351 (56%)
  Q:   102 KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +T +INP    R+TFE++  G  N+ A ++A L + +     ++  L++YG  GLGKTHL+ A+GN +VQ   QK ++Y+ ++ F  +  +A+      ++ F + +   D+L IDD+QFL+ KEK  EIFFNIFN L+   K I+MTSD  P  LK + +R++SRF  GL+  + +PD E+   II + ++    KN   S   +E++A   +S++R LEG +  I      N  P  + + ++ ++ I++     E       IN D + + +   +GV  + + SK R K+    R++ MY  +E    S   IG  F  R+H+TV+ AI+ V   +   ++LK ++D++  KF
  S:   150 QTFQINP----RYTFESFIEGDCNRLA-RSAGLAVAQKPGVTSFNPLMLYGGVGLGKTHLVQAIGN-YVQENGQKKILYVSSDRFTNQFIEALKN--NDLQSFTDYYMQADVLAIDDVQFLSGKEKTQEIFFNIFNHLHQSGKQIIMTSDCPPKELKGLQERLLSRFKWGLTADLKQPDLETRIAIIHKILQSEDNKNIEISGKVVEYLAHSIDSNVRELEGAIVSIIAKASLNQSPITMELAKQTVQQIVQPVDSSE-------INIDEVQKYVGDYFGVSVEMLKSKTRKKEIVIARQIAMYFAKEYTGFSLKSIGYHFGGRDHSTVIHAIQTVNDMMSEKKELKMYIDDLRKKF 491
>gi|196245035|ref|ZP_03143760.1| chromosomal replication initiator protein DnaA [Cyanothece sp. PCC 8802] >gi|196207153|gb|EDY01947.1| chromosomal replication initiator protein DnaA [Cyanothece sp. PCC 8802] (453 aa)
Score = 441, Expect = 1.3e-41, Identities = 121/424 (28%), Positives = 213/424 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKE--------------EKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +  ++ D+++ + KD  + I V N F+       Y+ I  +  +  +   +++   T E              EK + +  P   E PK  ++NP    R+TF  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+ +  ++L+P   + Y+ TE F   +  AI +    +E F+  +   D LLIDDIQF+  KE   E  F+ FN L+   K +V+ SD+ P  +  + DR+ISRF+ GL   I  PD E+   I+ +  +   ++ P     +E+IA  + S+IR LEG L + I +  +  +     +  + I  ++    +       V  +P++I+ ++     V  + +    R ++ SF R+V MY++R+   LS   IG  F  ++H TVL +   +    + D +L   L  +  +
  S:    25 FETWIQDATVQEWKDNCLVIQVANSFILNHLQKTYQPIIAQEVASVVGYPVDIQLTTAEGETMAMTGEAQSYQEKSLTQIAP---ESPKLNQLNP----RYTFSRFVVGPTNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLELYPNAKVFYVSTEQFTNDLIAAIRQ--DSMERFREHYRRADFLLIDDIQFIEGKEYTQEELFHTFNTLHEAGKQVVLASDRAPKRIPTLQDRLISRFSMGLIADIQVPDLETRMAILQKKAQYENMRLPRD--VVEYIATNYTSNIRELEGALIRAIAYTSISGLS----MTVQNIAPVLNPPVEQ------VPASPEVILRTVADSLKVSIEDLKGSSRRREISFARQVGMYLMRQHTELSLPRIGEEFGGKDHTTVLYSCDKISKLQQKDWELSQMLSELSDR 444
>gi|116510844|ref|YP_808060.1| chromosomal replication initiation protein [Lactococcus lactis subsp. cremoris SK11] >gi|125622883|ref|YP_001031366.1| chromosomal replication initiation protein [Lactococcus lactis subsp. cremoris MG1363] >gi|123320723|sp|Q033I4|DNAA_LACLS Chromosomal replication initiator protein dnaA >gi|166214677|sp|A2RH74|DNAA_LACLM Chromosomal replication initiator protein dnaA >gi|116106498|gb|ABJ71638.1| ATPase for DNA replication initiation [Lactococcus lactis subsp. cremoris SK11] >gi|124491691|emb|CAL96609.1| replication initiation protein DnaA [Lactococcus lactis subsp. cremoris MG1363] (454 aa)
Score = 441, Expect = 1.3e-41, Identities = 133/436 (30%), Positives = 241/436 (55%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILV----KNDFVK---EVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT---LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIES--DSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           E+ ++   +  Y+ ++  + +  ++ +   IL+    K D+ K   ++ T    E+F      ++ +N  +  I  E + +N + P  E        +P    L+ ++ FEN+  G  N+    AA    ++  + +  L IYG  GLGKTHL+HA+GN+ +   P   + Y+ +E+F+     A  +   ++E F+N++ N+DLLL+DD+QF ++KE     FFN FN L  K   IV+TSD++P  L  ++DR++SRF+ GL+  I  PD E+   I++   + S ++ P   L+  +IA + +S++R LEG LN++ F  +   +   I++ E     + S  ++  + +SNL       I + +   Y +    ++  KR K+ +F R++ MY++RE +  S   IG+ F  R+H TV+ A K +  K+K+D D++  +D+I  KF
  S:    16 ELARQSIGKQAYDFFIEPAQLMSVEQDTANILLDSGMKKDYWKKQSDLITTAGFEVFGRMIDYELYANDELTDI--ELRRLNNQSPVDEPLSVAKPTSPLVSGLNEKYNFENFVQGPGNRWTLAAAIAVADKPGDTYNPLFIYGGAGLGKTHLMHAIGNQILTDNPTARIKYVSSENFVNDYVNATRK--NQMESFENTYRNLDLLLLDDVQFFSDKEGTKNEFFNTFNALYDKGSQIVLTSDRIPQELNNLEDRLVSRFSWGLTTDITAPDYETRMAILLIKSESSHLEFPSETLS--YIAGQIDSNVRELEGALNRVEF--VARANGISIVDIETASQALRSLKNATQQSLSNLTIKK---IQDEVANYYHISFSDLVGPKRPKEIAFPRQIAMYLVRELLGTSLPAIGTAFGGRDHTTVMYAYKQISDKMKNDMDVQKDIDSIKRKF 454
>gi|187935721|ref|YP_001884266.1| chromosomal replication initiator protein DnaA [Clostridium botulinum B str. Eklund 17B] >gi|187723874|gb|ACD25095.1| chromosomal replication initiator protein DnaA [Clostridium botulinum B str. Eklund 17B] (456 aa)
Score = 441, Expect = 1.3e-41, Identities = 136/434 (31%), Positives = 230/434 (52%)
  Q:    18 IEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL------------EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           I K   +E  +N ++       I D ++ I V N F K++    YK +         +    + FI + + +   EL   +   K              E++ TL+ ++TF ++ IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +Q   +  ++Y+ +E F  ++  AI +   K EEF+  + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    KK+ ++N   +N  + +IA +  S+IR LEG L +I  +  L N +    +  E ++ II       +    +Q       E +   + +    + S++R +  ++ R++ MY+ R+  ++S  +IG  F  R+H TV+ A + +   +KSDE L+  + +I  K
  S:    15 IVKSEMSEVSFNTWIKSCEPISISDTSIKISVPNSFTKDILDKRYKSLVANSIEAVCSKLYEIKFIIESDLNNEDELNNSDNSDKNRDKNSRRNIVVNDEMSSTLNPKYTFNSFVIGNSNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQNNTKAKVVYVSSEKFTNELINAIKD--DKNEEFRKKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNELHDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQVPDFETRMAIL---KKKADVENLKVANEVMGYIATKIKSNIRELEGALIRIIAYSSLTNREVTVDLASEALKDIISKKQGKHVTIPSIQ-------EIVANYFNLKIDDLKSQRRTRNVAYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKSDESLQHTVSDITKK 452
>gi|15640044|ref|NP_062596.1| chromosomal replication initiation protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|147674057|ref|YP_001218400.1| chromosomal replication initiation protein [Vibrio cholerae O395] >gi|153212955|ref|ZP_01948549.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae 1587] >gi|153802489|ref|ZP_01957075.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae MZO-3] >gi|153819845|ref|ZP_01972512.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae NCTC 8457] >gi|153830821|ref|ZP_01983488.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae 623-39] >gi|194532271|ref|YP_002067701.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae MO10] >gi|194534898|ref|YP_002070093.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae RC385] >gi|194537251|ref|YP_002072395.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae V51] >gi|9654403|gb|AAF93190.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|124116181|gb|EAY35001.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae 1587] >gi|124121959|gb|EAY40702.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae MZO-3] >gi|125618272|gb|EAZ46814.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae MO10] >gi|125621864|gb|EAZ50189.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae V51] >gi|126509606|gb|EAZ72200.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae NCTC 8457] >gi|146315940|gb|ABQ20479.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae O395] >gi|148873705|gb|EDL71840.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae 623-39] >gi|150419692|gb|EDN12011.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae RC385] >gi|150422972|gb|EDN14922.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae AM-19226] (472 aa)
Score = 441, Expect = 1.3e-41, Identities = 115/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   137 VNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIHLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 467
>gi|194016318|ref|ZP_03054932.1| chromosomal replication initiator protein DnaA [Bacillus pumilus ATCC 7061] >gi|194011791|gb|EDW21359.1| chromosomal replication initiator protein DnaA [Bacillus pumilus ATCC 7061] (446 aa)
Score = 441, Expect = 1.3e-41, Identities = 131/437 (29%), Positives = 227/437 (51%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTI------EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           ++IE +    +F   ++  +    ++ + + I   N+F ++   + Y  +  +         L++ FI  + +D  + +P        +E P  +  N  L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q         +   + +  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +  DE L+  +  I  + 
  S:    13 QKIETKLSKPSF-ETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFIIPQNQDEVEAMPKSPIKKMSKEDPVDIPQN-MLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRD--NKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPRIITIKDIQ-------RIVGQQFNIRLEDFKAKKRTKSVAYPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLIVEDEQLQQHVKEIKEQL 445
>gi|167470924|ref|ZP_02335628.1| chromosomal replication initiator protein DnaA [Yersinia pestis FV-1] (355 aa)
Score = 441, Expect = 1.3e-41, Identities = 119/355 (33%), Positives = 197/355 (55%)
  Q:    95 PTIEEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ +  P   E++    ++ + TF+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   ++ I+ P   +A  FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:     3 PSWDNSPAQPELSYRSNVNPKHTFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLP-GEVAF-FIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 350
>gi|167748043|ref|ZP_02420170.1| hypothetical protein ANACAC_02781 [Anaerostipes caccae DSM 14662] >gi|167652523|gb|EDR96652.1| hypothetical protein ANACAC_02781 [Anaerostipes caccae DSM 14662] (447 aa)
Score = 441, Expect = 1.4e-41, Identities = 119/423 (28%), Positives = 235/423 (55%)
  Q:    29 NNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMN----SNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAI-EFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           N ++   +I ++KD+ + + + ++F          ++++ Y S+ +         + F+ +E K   K+ P      +  + N  L+ R+TF+++ +G  N+ A  A     E     +  L +YG  GLGKTHL+H++ +  ++   +  ++Y+ +EDF  ++  AI     K EE +N +  +D+LLIDDIQF+  K+   + FF+ FN L +    I+++SDK P  ++ +++R+ +RF  GL+  I  PD E+   I+    K++ + + + + AI ++IA    S+IR LEG LNKI  +      P ++ + +  ++ ++++D+       +V+I PD+II ++   + +    +ISKKR+   ++ R++CMY+ ++  + S+ +IG +   R+H+TV+   + +E  ++ D  L   LD I+ K
  S:    28 NAWIKPLNIKEVKDDQIVLSLNSNFDARGIHFIESKMYDFYISLAIQDITGKKYEISFVLEEAK--KKKAPASRTDTQLQDSN-NLNPRYTFDSFVVGTNNQMAHAACIAVAEAPAEAYNPLFLYGGAGLGKTHLMHSIAHYIMENNSKLKVLYVTSEDFTNEVINAIHH--NKQEELRNKYRTIDVLLIDDIQFIIGKDSTQQEFFHTFNALYNSKSQIIISSDKPPKEIETLEERLRTRFGCGLTADIQPPDYETRIAILR---KRAELDHIYIDDAIFDYIASNIKSNIRELEGALNKIRVYSKLEKRPIDLDLAKIALKDLVDNDT-------VVKITPDLIITTVAEHFNIQPADIISKKRSHDIAYPRQICMYLCKKLTDTSFVKIGEYLGKRDHSTVIHGSEKIEKDLQKDSSLSTTLDVIIKK 443
>gi|118708|sp|P22837|DNAA_PROMI Chromosomal replication initiator protein dnaA >gi|150878|gb|AAA83958.1| dnaA gene product >gi|194684437|emb|CAR46152.1| chromosomal replication initiator protein [Proteus mirabilis HI4320] (466 aa)
Score = 441, Expect = 1.4e-41, Identities = 116/355 (32%), Positives = 198/355 (55%)
  Q:    95 PTIEEKPKT----LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P+ + +P++    L     ++ +  F+N+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN  ++      ++Y+ +E F++ + KA+      +E+FK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++   +++I+ P  +    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   112 PSWDNQPQSQLPELNYRSNVNPKHKFDNFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNSIMERKANAKVVYMHSERFVQDMVKALQNNA--IEDFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENQIQLP--DEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI 461
>gi|156972777|ref|YP_001443684.1| chromosomal replication initiation protein [Vibrio harveyi ATCC BAA-1116] >gi|166215368|sp|A7N1E9|DNAA_VIBHB Chromosomal replication initiator protein dnaA >gi|156524371|gb|ABU69457.1| hypothetical protein VIBHAR_00442 [Vibrio harveyi ATCC BAA-1116] (468 aa)
Score = 441, Expect = 1.4e-41, Identities = 114/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   133 VNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 463
>gi|148982286|ref|ZP_01816693.1| chromosomal replication initiation protein [Vibrionales bacterium SWAT-3] >gi|145960551|gb|EDK25908.1| chromosomal replication initiation protein [Vibrionales bacterium SWAT-3] (465 aa)
Score = 441, Expect = 1.4e-41, Identities = 116/345 (33%), Positives = 188/345 (54%)
  Q:    98 EEKPKTLEIN--PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +E+P  ++IN    ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K
  S:   126 DEEPVDVDINHRSNVNPKHKFNNFVEGKSNQLGLAAARQVADNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDGKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIK 463
>gi|31340536|sp|Q9KVX6|DNAA_VIBCH Chromosomal replication initiator protein dnaA (467 aa)
Score = 441, Expect = 1.4e-41, Identities = 115/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   132 VNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIHLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 462
>gi|166709896|ref|ZP_02241103.1| chromosomal replication initiation protein [Xanthomonas oryzae pv. oryzicola BLS256] (442 aa)
Score = 441, Expect = 1.4e-41, Identities = 109/343 (31%), Positives = 185/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-----YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +     +   L  V+      +E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQAKPAAKVMYLRSEQFFSAMIRALQDKA--MDQFKRQFQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARANFTGRLITVE----FAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|69246706|ref|ZP_00604074.1| chromosomal replication initiator protein, DnaA [Enterococcus faecium DO] >gi|68195120|gb|EAN09579.1| chromosomal replication initiator protein, DnaA [Enterococcus faecium DO] (444 aa)
Score = 441, Expect = 1.5e-41, Identities = 129/403 (32%), Positives = 222/403 (55%)
  Q:    40 IKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKM--------NSNLNVFFITKEEKDINKELPTIEEKPKTLEINP----TLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           I+  N   L +N  V EV +  +KE +E+  + K+         + +   FIT EE +  +     E+ PK +  +P     L+ ++TF+ + IG  N+ A  AA +  E+  + +  L  YG  GLGKTHL+HA+G++ +Q  P   + Y+ +E F      +I       EEF+  + NVDLLL+DDIQF   KE   E FF+ FN L ++ K IV+TSD+LP  + K+ +R++SRF  GLS+ I  PD E+   I+ +     R++ P   L+  +IA + +S+IR LEG L ++  F  +++ D +  +  + ++++       ++  +++QI      E +   Y +  K +  KKR K     R++ MY+ RE  + S  +IG+ F  ++H TV+ A + ++  + S   ++
  S:    28 IETANPRTLDQNQLVVEVPSKIHKEYWEKNLATKIVEVGYMLSGNEIIPRFITGEEAEQEEV--IEEKNPKVVAPSPLKKAMLNPKYTFDTFVIGKGNQMAHAAALVVAEDPGSIYNPLFFYGGVGLGKTHLMHAIGHQMLQSQPNAKVKYVSSETFANDFINSIQN--KTAEEFRQEYRNVDLLLVDDIQFFAEKEATQEEFFHTFNALYNEGKQIVLTSDRLPNEIPKLQERLVSRFAWGLSVDITPPDLETRTAILRKKAAAERLEIPDDTLS--YIAGQIDSNIRELEGALVRVQAFAAMNSEDISTSLAADALKTLKSGKGHPQL--SILQIQ-----EEVAKYYHIQLKDLKGKKRVKSIVVPRQIAMYLARELTDNSLPKIGAEFGGKDHTTVIHAHEKIQQLMDSSVSMQ 432
>gi|72381841|ref|YP_291196.1| chromosomal replication initiation protein [Prochlorococcus marinus str. NATL2A] >gi|72001691|gb|AAZ57493.1| bacterial chromosomal replication initiator protein, DnaA [Prochlorococcus marinus str. NATL2A] (466 aa)
Score = 440, Expect = 1.6e-41, Identities = 125/416 (30%), Positives = 214/416 (51%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDIN-------------KELPTIEE---KPKTLEIN---PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           Y  ++  +  F  KD  + ++  N F  +     Y +  EE  S      + V    KEE   N               + T E    K K  +I    P+L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ ++G+  +++ P   + Y+ TE F   +  AI + G  ++ F+N +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+TSD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  +  R++ P     I+FIA RF S+IR LEG   + + F  +  +     +  E +  +++           V++ P  ++E +   +GV ++ + S  R +  S  R+V MY++R   +LS   IG  F  ++H TV+ AI+ VE K+ S+  L +
  S:    26 YETWIRPAEFFDFKDGCLTLIAPNSFSSDWLRKNYSQTIEEIASEIFGHEVKVCIKVKEEFSSNKSNKKKNYSNVEANSIATSENYDVKSKQTQIKKFLPSLNLRYVFNRFVVGPNSRMAHAAAMAVAEAPGREFNPLFICGGVGLGKTHLMQSIGHYRLEIDPGAKVAYVSTETFTNDLIVAIRKDG--MQAFRNRYREADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVLTSDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEHERMRLPRD--LIQFIAGRFTSNIRELEGAFTRAVAFASITGLP----MTVESVAPMLDP------TGQGVEVKPKQVLEKVAEVFGVTEEEMRSPSRRRPVSQARQVGMYLMRHGTDLSLPRIGESFGGKDHTTVMYAIEQVEKKLSSEPQLAS 449
>gi|91785914|ref|YP_546866.1| chromosomal replication initiator protein DnaA [Polaromonas sp. JS666] >gi|91695139|gb|ABE41968.1| chromosomal replication initiator protein DnaA [Polaromonas sp. JS666] (464 aa)
Score = 440, Expect = 1.6e-41, Identities = 116/332 (34%), Positives = 177/332 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           L+S  TF+    G  N+   +AA+L +  +    +  L IYG  GLGKTHL+HA+GNK +   P   ++YI  E F+  + KA        +EFK  + ++DLLLIDD+QF  NK++  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +      P   +A  F+A    S++R LEG L KI  +   N      + E  I+   E+  D   + N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  + +   +L
  S:   129 LNSALTFDTLIEGTANRMG-RAAALHVSSSLGQLYNPLFIYGGVGLGKTHLMHAIGNKLLADNPAAKVLYIHAEQFVSDVVKAYQR--KTFDEFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLTKKSHIVMTSDTYPKGLTDIHERLVSRFDSGLTVAIEPPELEMRVAILIRKAEAEGTVMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFN------LKEISIQLAREALRDLLSIQNR-QISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKMSAERQQMTEL 451
>gi|1706462|sp|P49996|DNAA_VIBHA Chromosomal replication initiator protein dnaA >gi|1006569|gb|AAA78257.1| DnaA [Vibrio harveyi] (468 aa)
Score = 440, Expect = 1.7e-41, Identities = 114/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   133 VNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 463
>gi|167766864|ref|ZP_02438917.1| hypothetical protein CLOSS21_01381 [Clostridium sp. SS2/1] >gi|167711412|gb|EDS21991.1| hypothetical protein CLOSS21_01381 [Clostridium sp. SS2/1] (444 aa)
Score = 440, Expect = 1.7e-41, Identities = 121/389 (31%), Positives = 223/389 (57%)
  Q:    63 KEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEI------NPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLKI-DDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAI-EFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           K++++ Y S+ ++       +T ++ DI  EL    EKP+          N  L+ R+TF+ + IG  N+ A  AAS+ + E     +  L +YG  GLGKTHL+H++ +  ++     N++Y+ +EDF  ++  +I     K EE ++ + N+D+LL+DDIQF+  KE   + FF+ FN L +  K I+++SDK P  L + ++R+ SRF+ GL + I  P+ E+   I+    K++ + N + +  I ++IA    S+IR LEG LNKI  +   N  P ++ +++  ++ +I++ +          I P++I++++   + +    +ISKKR+   ++ R++CMY+ ++  + S  +IG     R+H+TV+  I+ +E  +  D +L   +D I  K
  S:    62 KKMYDFYISLAISD------LTGKKYDIEFELEKEGEKPQETPAAAPEHDNNNLNPRYTFDTFVIGDNNRMA-HAASIAVAEAPAEAYNPLFLYGGAGLGKTHLMHSIAHYIIEHNSSLNVLYVTSEDFTNEVINSIQH--KKQEELRSKYRNIDVLLVDDIQFVIGKESTQQEFFHTFNALYNSKKQIILSSDKPPKELDVLEERLRSRFSWGLPVDIQPPNYETKVAILR---KRAELDNIYIDDEIFDYIATHIKSNIRDLEGALNKIKVYSKLNKKPIDLELSKIALQDLIDNKTKQ-------AITPELIMQTVAEHFNIQTSDIISKKRSHDIAYPRQICMYLCKKMTDQSLVKIGEIIGKRDHSTVIHGIEKIEKDLDKDPELSKVIDVITKK 442
>gi|110639382|ref|YP_679591.1| chromosomal replication initiator protein DnaA [Cytophaga hutchinsonii ATCC 33406] >gi|110282063|gb|ABG60249.1| chromosomal replication initiator protein DnaA [Cytophaga hutchinsonii ATCC 33406] (471 aa)
Score = 440, Expect = 1.7e-41, Identities = 114/364 (31%), Positives = 209/364 (57%)
  Q:    88 KDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNL-VQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           K+  +E+P + +      I+  L++ ++F+ +  G  NK A ++A L +       ++  LL+YG+ GLGKTHL+ A+GN+  +    K ++Y+ +E FL +  +A+     + +EF N F  +D+L++DD+QFL+ KEK  EIFF+IFN L+   K I++TSD  P  +K + +R++SRF  GLS  +  PD E+   II + ++   I+   +   I+++A   ++++R LEGV+N +   +  +      I+ E  + II++     IV N+  ++N D I + +   + V  + +  K R ++    R+V MY  +E  N+S   IG+ F  R+H+TV+ A+  V   + +D+  +A + +++ K
  S:   115 KETKQEVPAVSQP-----IDSQLNASYSFDTFIEGDCNKLA-RSAGLAVANKPGVTSFNPLLVYGNVGLGKTHLVQAIGNQIKKNHADKKVLYMPSERFLSQFIEAMKN--NQSQEFTNQFLGLDVLILDDVQFLSGKEKTQEIFFHIFNHLHQSGKQIIITSDCAPKDIKGLQERLLSRFKWGLSADLQVPDYETRNAIICKKMQFEGIE--IAADVIDYLAYSVDTNMRDLEGVVNSL---IAQHTLSGRQIDLELAKQIIQN-----IVQNVETEVNIDYIQKFVSEYFAVTIEQMKDKTRKREIVIARQVAMYFTKEYTNMSLKSIGNHFGGRDHSTVIHALTSVSDLMDTDKKFRATMQDLIKK 465
>gi|148241930|ref|YP_001227087.1| chromosomal replication initiation protein [Synechococcus sp. RCC307] >gi|147850240|emb|CAK27734.1| Chromosomal replication initiator protein dnaA [Synechococcus sp. RCC307] (461 aa)
Score = 440, Expect = 1.7e-41, Identities = 107/343 (31%), Positives = 189/343 (55%)
  Q:   101 PKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           PKT +    L+ R+TF+ + +G  ++ A  AA    E     +  L + G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI + G  ++ F++ +   DL+++DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ +++ P     I++IA RF S+IR LEG L + + F  +  + P  +     +      + D         INP +++E +   +GV  + + S  R +  S  R+V M+++R+  +LS  +IG  F  ++H TV+ A++ VE K+ S+  L +
  S:   115 PKTRQ-KSNLNPRYTFQRFVVGPNSRMAHAAALAVAESPGREFNPLFLCGGVGLGKTHLMQAIGHYRLEIDPDSRVFYVSTETFTNDLILAIRKDG--MQAFRDRYRAADLIMVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIQRLQERLISRFSMGLIADIQAPDLETRMAILHKKAEQEQMRLPRD--LIQYIAGRFTSNIRELEGALTRAVAFASITGL-PMTVDAVAPLLGTGMPEGD---------INPKVVLEKVAEVFGVSTEDMCSSSRKRAVSQARQVGMHLMRQCTDLSLPKIGDHFGGKDHTTVMYAVQQVEKKLASNPALAS 445
>gi|157690799|ref|YP_001485261.1| chromosomal replication initiation protein [Bacillus pumilus SAFR-032] >gi|167016898|sp|A8F8Y4|DNAA_BACP2 Chromosomal replication initiator protein dnaA >gi|157679557|gb|ABV60701.1| DNA-directed DNA replication initiator protein [Bacillus pumilus SAFR-032] (446 aa)
Score = 440, Expect = 1.9e-41, Identities = 131/437 (29%), Positives = 227/437 (51%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTI------EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           ++IE +    +F   ++  +    ++ + + I   N+F ++   + Y  +  +         L++ FI  + +D  + +P        +E P  +  N  L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q         +   + +  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +  DE L+  +  I  + 
  S:    13 QKIETKLSKPSF-ETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFIIPQNQDEVEAMPKSPIKKMSKEDPVDIPQN-MLNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRD--NKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPRVITIKDIQ-------RIVGQQFNIRLEDFKAKKRTKSVAYPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLMVEDEQLQQHVKEIKEQL 445
>gi|163765000|ref|ZP_02172049.1| ATPase involved in DNA replication initiation-like protein [Bacillus selenitireducens MLS10] >gi|160354538|gb|EDP81202.1| ATPase involved in DNA replication initiation-like protein [Bacillus selenitireducens MLS10] (451 aa)
Score = 440, Expect = 1.9e-41, Identities = 126/408 (30%), Positives = 216/408 (52%)
  Q:    45 VYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKEL------PTIEEKPKTLEINP-TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           + ++  N+F ++   N Y  I  E       + L   FI  +++  + +       P ++E     E     L++++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  V   P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ + K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P     + +IA + +++IR LEG L ++  +  L N D N  +    ++ II +    ++    VQ       E++   + +  + + +KKR K  ++ R++ MY+ RE  + S  +IG+ F  R+H TV+ A + +      DE+L+  +  I  K 
  S:    43 ITVIAPNEFARDWLENRYFSILTETLYELTGAELEARFILPKDEGSDLDFVEKNNPPVLQEDLDNGETTKHMLNTKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVVDHNPDAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDILLIDDIQFLAGKEQTQEEFFHTFNALHEERKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAENLDIP--KEVMNYIANQIDTNIRELEGALIRVVAYSSLINQDMNADLAAVALKDIIPNSKPKKVTIESVQ-------EAVAAHFQIRVEEMKAKKRTKTVAYPRQIAMYMAREMTDSSLPKIGNEFGKRDHTTVIHAHEKISRLFADDEELQQHIREITEKL 449
>gi|107098995|ref|ZP_01362913.1| hypothetical protein PaerPA_01000001 [Pseudomonas aeruginosa PACS2] (381 aa)
Score = 440, Expect = 2.0e-41, Identities = 118/340 (34%), Positives = 192/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSD-YEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTFEN+  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++  ++++I+ P    A  FIA R  S++R LEG L ++  H      P   I  E IR   ES  D   +   LV I  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:    46 LNRTFTFENFVEGKSNQLA-RAAAWQVADNLKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQAKIELPHD--AAFFIAQRIRSNVRELEGALKRVIAHSHFMGRP---ITIELIR---ESLKDLLALQDKLVSI--DNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLL 376
>gi|148545260|ref|YP_001265362.1| chromosomal replication initiation protein [Pseudomonas putida F1] >gi|166214693|sp|A5VWB8|DNAA_PSEP1 Chromosomal replication initiator protein dnaA >gi|148509318|gb|ABQ76178.1| chromosomal replication initiator protein DnaA [Pseudomonas putida F1] (505 aa)
Score = 440, Expect = 2.0e-41, Identities = 109/340 (32%), Positives = 191/340 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTF+ +  G  N+ A +AA+  + +N  + +  L +YG  GLGKTHL+HAVGN  ++  P   ++Y+ +E F+  + KA+      + EFK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+++   +++++ P    A  FIA R  S++R LEG L ++  H       + +  +  I  I ES  D   + + + ++ D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + +    +SD D++    N++
  S:   170 LNRTFTFDTFVEGKSNQLA-RAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNA--INEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHD--AAFFIAQRIRSNVRELEGALKRVIAH------SHFMGRDITIELIRESLKDLLALQDKL-VSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLL 500
>gi|163802133|ref|ZP_02196028.1| chromosomal replication initiation protein [Vibrio campbellii AND4] >gi|159173938|gb|EDP58748.1| chromosomal replication initiation protein [Vibrio campbellii AND4] (468 aa)
Score = 439, Expect = 2.0e-41, Identities = 113/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + ++   +   D+K    N++
  S:   133 VNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEAHQIH--LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIQQLREESHDIKEDYSNLI 463
>gi|81097167|ref|ZP_00875474.1| chromosomal replication initiator protein, DnaA [Streptococcus suis 89/1591] >gi|80976790|gb|EAP40366.1| chromosomal replication initiator protein, DnaA [Streptococcus suis 89/1591] (457 aa)
Score = 439, Expect = 2.2e-41, Identities = 145/436 (33%), Positives = 236/436 (54%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIF-EEYFSIKMNSNLNVFFITKEEKDINKELPT---IEEKPKTLE----------INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPD---IIIESICLG----YGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           E+ K     + Y+ YV D+ +  I  +   I +   F K+ +   ++E+     F I        +  T++E++I     T   I  + +TLE          ++  + S++TF N+  G  N  A KAA+L + +N    +  L I+G  GLGKTH+L+A+GNK +   PQ  + Y+ +E F+ +  + +      +E FK ++ N+DLLLIDDIQ L NK    E FF+ FN L+ KNK IV+TSD+ P  L  +++R+++RF  GL+ +I  PD E+  +I I   K   +   F+N  + ++A +F+S++R LEG L  I+           +I   +  S I  +   E + +  Q NP    I IE I       YGV  K +   KR +     R+V M++ RE  + S  +IG  F NR+H TV+ A   ++T +  DE+L+  + +I +K 
  S:    13 ELAKVNFKPSIYDFYVADAKLLGINQQVANIFLNRPFKKDFWEKNFEELMIAASFEIYGEPLAIQYQFTEDEQEIRNTTNTRSSIVHQVQTLEPATPQETFKPVHSGIKSQYTFANFVQGDNNHWA-KAAALAVSDNLGELYNPLFIFGGPGLGKTHILNAIGNKVLADNPQARIKYVSSETFINEFLEHLRL--NDMESFKKTYRNLDLLLIDDIQSLRNKATTQEEFFHTFNALHEKNKQIVLTSDRNPDHLDNLEERLVTRFKWGLTSEITPPDFET--RIAILRNKCENLPYNFTNETLSYLAGQFDSNVRDLEGALKDIH-----------LIATMRQLSEISVEVAAEAIRSRKQTNPQNMVIPIEKIQTEVGNFYGVSLKELKGSKRVQHIVHARQVAMFLAREMTDNSLPKIGKEFGNRDHTTVMHAYNKIKTLLLDDENLEIEITSIKNKL 456
>gi|183602668|ref|ZP_02964032.1| chromosomal replication initiator protein DnaA [Bifidobacterium animalis subsp. lactis HN019] >gi|183218086|gb|EDT88733.1| chromosomal replication initiator protein DnaA [Bifidobacterium animalis subsp. lactis HN019] (583 aa)
Score = 439, Expect = 2.2e-41, Identities = 107/339 (31%), Positives = 182/339 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQ-LFPQKNLMYIQTEDFLEKIYKAISEGGTK-----VEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDP-NEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           L+S  TF+ +  G  N+ A   A    E    ++  L IYG +GLGKTHLLHA+GN  VQ   P+  ++Y+ +E+F     ++I   G       +E+F   +  VD+LLIDDIQFL  K  + E FF+ FN L   NK IV+ SD  P +L+  +DR+ISRF  G+++ +  P+ E+   I+    +++ I+ P  N  +  IA RF +++R LEG L ++      N  P    + E  ++    +D         V++ P  II  +   + +    ++   R +  +  R++ MY+ R+  ++S   IG  F  R+H TV+ A K +  K++  +++  +++ +
  S:   237 LNSNDTFDTFIQGDSNRFARTVALAVAEGSGRDYNPLCIYGGSGLGKTHLLHAIGNYAVQNQKPRPRVLYVTSEEFTNDFIESIRTSGQDNEDPAMEKFYRKYREVDVLLIDDIQFLGGKRGILEQFFHTFNSLYQANKRIVIASDVPPHNLEDFEDRLISRFEQGITVDVKPPNLETRIAILRMLAEQNHIRVP--NDVLNLIAERFANNVRELEGALKRVIAMASLNHQPVTRALTERTLQDFFTTD---------VEVKPTDIIARVAKYFHLTFDDIVGPGRPRSVTLARQIAMYLTRDMTSMSLMNIGQIFGGRDHTTVMHACKHIADKMQEKQEIYNYVNEL 573
>gi|116332682|ref|YP_794209.1| DNA replication ATPase initiation [Lactobacillus brevis ATCC 367] >gi|122270622|sp|Q03UE4|DNAA_LACBA Chromosomal replication initiator protein dnaA >gi|116098029|gb|ABJ63178.1| DNA replication ATPase initiation [Lactobacillus brevis ATCC 367] (452 aa)
Score = 439, Expect = 2.3e-41, Identities = 122/350 (34%), Positives = 188/350 (53%)
  Q:    99 EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           E   T      L+SR+TF+ + IG  N+ A  AA +  EE    +  L  YG  GLGKTHL+HA+GNK ++  P   + Y+ +E F      AI       E+F+  + NVDLLL+DDIQF  NKE   E FF+ FN L    K IV+TSD+LP  + K+ DR++SRF  GLS+ I  PD E+   I+       +I  P   L+  +IA + +S++R LEG L ++  Y  L+      ++   E ++S+  +++     S+ V I   +I + +   + V  K +  KKR K     R++ MY+ RE    S   IG+ F  ++H TV+ A   +   +K+D  L+  +D++
  S:   105 EPTPTFMKETALNSRYTFDTFVIGKGNQMAHAAALVVSEEPGVMYNPLFFYGGVGLGKTHLMHAIGNKMLEDRPDTKVKYVTSEAFTNDFINAIQT--RTQEQFRQEYRNVDLLLVDDIQFFANKEGTQEEFFHTFNALYDDGKQIVLTSDRLPNEIPKLQDRLVSRFAWGLSVDITPPDLETRIAILRNKADADQIDIPDDTLS--YIAGQIDSNVRELEGALARVQAYSQLMHQPIATDLA-AEALKSLNLANA-----SDAVTI--PVIQDRVAKYFDVSLKDLKGKKRKKAIVMPRQIAMYLSRELTEASLPRIGNEFGGKDHTTVIHAYDKITESLKTDPQLQKDIDSL 446
>gi|92112137|ref|YP_572065.1| chromosomal replication initiation protein [Chromohalobacter salexigens DSM 3043] >gi|123084264|sp|Q1R1P2|DNAA_CHRSD Chromosomal replication initiator protein dnaA >gi|91795227|gb|ABE57366.1| chromosomal replication initiator protein DnaA [Chromohalobacter salexigens DSM 3043] (495 aa)
Score = 439, Expect = 2.3e-41, Identities = 120/364 (32%), Positives = 202/364 (55%)
  Q:    86 EEKDINKELPTIEEKPK------------TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +E++I++ L   EE P+            +L+    L+  FTFE +  G  N+ A +AAS  + EN    +  L +YG  GLGKTHL+HAVGN          ++Y+ +E F+  + KA+      + +FK  + +VD LLIDDIQF   KE+  E FF+ FN L    + +++TSD+ P  +  +++R+ SRF  GL++ I  P+ E+   I+++   ++++  P    A  FIA +  S++R LEG L K+   + D+    + I ++ IR   ES  D   + +  Q+  D I  ++   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + V+T  +   D++    N++
  S:   125 DEQEIDR-LREREETPRRGGGERQVQVEGSLKHQSGLNPNFTFETFVEGKSNQLA-RAASRQVAENPGGAYNPLFLYGGVGLGKTHLMHAVGNHLAGQRENAKVVYLHSERFVADMVKALQLNA--INDFKRFYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEGGQQMILTSDRYPKEISGVEERLKSRFGWGLTVAIEPPELETRVAILMKKADQAKVDLPHD--AAFFIAQKIRSNVRELEGALKKV---IADSHFMGKPITQDFIR---ESLKDLLALQD-KQVGVDNIQRTVAEYYKIKLADLLSKRRSRSVARPRQVAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKVQTLKEESADIREDYKNLL 490
>gi|153885242|ref|ZP_02006399.1| chromosomal replication initiator protein DnaA [Ralstonia pickettii 12D] >gi|151578142|gb|EDN42541.1| chromosomal replication initiator protein DnaA [Ralstonia pickettii 12D] (733 aa)
Score = 439, Expect = 2.4e-41, Identities = 112/332 (33%), Positives = 175/332 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           L+   TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++  +   +  P   +A  F+A    S++R LEG L KI  +   N    EI     I    E+  D   V N  QI+ + I ++    Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   398 LNQILTFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVP-EEVAF-FVAKHLRSNVRELEGALRKILAY--SNFHGKEI----TIEVTREALKDLLTVQNR-QISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERTKDAQL 720
>gi|160944267|ref|ZP_02091496.1| hypothetical protein FAEPRAM212_01776 [Faecalibacterium prausnitzii M21/2] >gi|158444449|gb|EDP21453.1| hypothetical protein FAEPRAM212_01776 [Faecalibacterium prausnitzii M21/2] (440 aa)
Score = 439, Expect = 2.5e-41, Identities = 127/425 (29%), Positives = 219/425 (51%)
  Q:    25 ENFYNNYVLDSSIFKIKDEN-VYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPT-IEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           E  YN Y+        +D + + + V+NDF+ ++ T+ Y  + +E F   +  ++++  +          L    E  P +    P  +  FTFEN+  G  N+ AF AA       +  +  L IYG +GLGKTHLL A+  +  +  P   +MY+  E F  ++  AI  G T  E+F+  +   DLLL+DDIQF+  KE   E FF+ FN L+  +K IV+ SD+    +K +++R+ +RF  GL+  +  PD E+  ++ I   K   +         EFIA    ++IR LEG + K+  +++L+ + P   + +  I+ I+         +  V +  + II  +   + V    +   KRN   +  R+V +Y+LRE   +S  EIG  FS R+H+T++ ++K +E  +K+D+ L+  + +I+
  S:    21 EPTYNLYIDGLEPISFEDSSHITLSVRNDFICKIVTDRYLGLLKEAFKSVLGFDVDITLVVPSTPPHEVVLAQQYEANPAS----PQGNYEFTFENFIKGPSNQFAFAAAQAVAANPSGAYNPLFIYGGSGLGKTHLLTAIQTEIKRTHPDFVIMYVTCEQFTNELIAAIRAGST--EDFRMKYRVADLLLVDDIQFIAGKESTQEEFFHTFNSLHDAHKQIVIASDRPAKEIKSLEERLRTRFEWGLTADVQPPDFET--RVAIVKRKAELLHLDLPEDVAEFIANHLKNNIRQLEGAVKKLNAYYMLEGIQPVISVAQNAIKDILNE-------TQPVPVTIEKIIGEVSRTFNVSPADIRGTKRNANVASARRVAIYILREVTGMSMEEIGREFSGRDHSTIVYSLKTMERDMKNDQHLRETVSDII 435
>gi|66766353|ref|YP_241115.1| chromosomal replication initiation protein [Xanthomonas campestris pv. campestris str. 8004] >gi|81307653|sp|Q4V0S8|DNAA_XANC8 Chromosomal replication initiator protein dnaA >gi|66571685|gb|AAY47095.1| chromosomal replication initiator [Xanthomonas campestris pv. campestris str. 8004] (442 aa)
Score = 438, Expect = 2.7e-41, Identities = 109/343 (31%), Positives = 183/343 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           LDS +TF N+  G  N+    AA    ++  +     LL+YGSTGLGKTHL+ A GN   Q  P   +MY+++E F   + +A+ +    +++FK  F  +D LLIDDIQF    ++  E FF+ FN L    ++I++T D+ P  ++ ++ R+ SR   GLS+ I+ PD E+   I++   ++   + P  ++A   IA +  S++R LEG LN +      N     I  E   E +R ++ +      + N+ +   D         YG+  K ++SK+R +  +  R+V M + +E    S  EIG  F+ R+H TVL A + + T +++D  L+   + ++ K 
  S:   106 LDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNALRQANPAAKVMYLRSEQFFSAMIRALHDKA--MDQFKRQFHQIDALLIDDIQFFAGMDRTQEEFFHTFNALFDGRQHIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIP-DDVAF-LIAKKMRSNVRDLEGALNTLVARA--NFTGRSITVEFAQETLRDLLRAQQQAIGIPNIQKTVADY--------YGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKL 440
>gi|149182290|ref|ZP_01860769.1| chromosomal replication initiation protein [Bacillus sp. SG-1] >gi|148849982|gb|EDL64153.1| chromosomal replication initiation protein [Bacillus sp. SG-1] (448 aa)
Score = 438, Expect = 2.8e-41, Identities = 136/431 (31%), Positives = 223/431 (51%)
  Q:    18 IEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINP--------TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           IEK+    +F + ++  +    I+ + + I   N+F ++     Y ++  +         L V FI  + ++   E   I   PK +  N          L+ ++ F+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   +I +   K  +F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N A+ +IA + +S+IR LEG L ++  +  L N D N  +  E ++ II S     I    +Q         +   + V  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   + SD   +  L  I
  S:    15 IEKKISKPSF-DTWLKSTKAHSIQGDTLVITAPNEFARDWLEGRYSQLISDVLLEITGEELIVKFIIPQNQE--PEEFDIPVPPKKVVDNDDGQEFQQNMLNPKYMFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVLEHNPAAKVVYLSSEKFTNEFINSIRD--NKAVDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIP--NEAMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIADIQ-------RVVGEQFNVRMEDFKAKKRTKSIAFPRQIAMYLSREMTDFSLPKIGEEFGGRDHTTVIHAHEKISKMLGSDSTFQHQLKEI 442
>gi|171462833|ref|YP_001796946.1| chromosomal replication initiator protein DnaA [Polynucleobacter necessarius STIR1] >gi|171192371|gb|ACB43332.1| chromosomal replication initiator protein DnaA [Polynucleobacter necessarius STIR1] (474 aa)
Score = 438, Expect = 2.9e-41, Identities = 130/392 (33%), Positives = 207/392 (52%)
  Q:    50 KNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELP--TIEEKPKT------------------LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTES-----IKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           K D++K+ F + ++E+  +YF       +NV F    E + N   P  TI+E P++                  +E +  L+   TFE +  G  N+ A +AAS+ +  N   ++  + +YG  GLGKTHL+HA+GN  ++  P   + YI  E ++  + +A  +     + FK  + ++DLLLIDDIQF + K +  E FF  F  L S    +++T D  P  +  IDDR+ISRF+SGL++ I  P+ E      +KK I E I       P S     F+A    S++R LEG L KI     FH          +  E  R+ ++   D   + N  QI+ + I +++   Y +    + SKKR    +  R++ M++ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    63 KLDWIKKTFADRFQELATQYFG----RPINVGFTLALEANPNNLAPNTTIQEPPQSVVIEALEPVISVEDSSFEIEDHSKLNPNLTFETFVTGKANQLA-RAASIQVAHNPGTSYNPMFLYGGVGLGKTHLIHAIGNHLLKEKPNARIRYIHAEQYVSDVVRAYQQ--KAFDRFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALLSNKSQVIITGDTYPKEMAGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAIGEGI-------PMSEDVAFFVAKHLRSNVRELEGALRKILAFVRFH-------GREVTIEVARTALK---DLLSIQNR-QISVENIQKAVADFYSIKVADMYSKKRPANIARPRQIAMFMAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSHDSQL 461
>gi|53802863|ref|YP_115420.1| chromosomal replication initiator protein DnaA [Methylococcus capsulatus str. Bath] >gi|61212517|sp|Q602N0|DNAA_METCA Chromosomal replication initiator protein dnaA >gi|53756624|gb|AAU90915.1| chromosomal replication initiator protein DnaA [Methylococcus capsulatus str. Bath] (442 aa)
Score = 438, Expect = 2.9e-41, Identities = 128/418 (30%), Positives = 209/418 (50%)
  Q:    32 VLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIF-EEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           V D    ++   N ++L   D+VK+ F  + +E+  E+      N  L +     E   +    P  +  P   ++   L+S F F N+  G  N+ A KAASL + +N    +  L IYG  GLGKTHL+HA+GN+ ++  P  N++Y+ +E F+  + KA+      +  FK  +  VD LLIDDIQF   KE+  E FF+ FN L      +V+T D+ P  +K +++R+ SRF  GL + I  PD E+   I++   ++S I    S     FI  R  S+IR LEG L ++  +      P  +   +E +R +I              IN + I +++   + + +  ++S KR +  +  R++ M + +E  + S  EIG  F  R+H TVL A + V+   +SD        N++
  S:    31 VEDGGELRLLAPNRFVL---DWVKQHFIGKIEEVVSEQNRDSAPNVVLEIGSRAAEAAQMRSANPPRKTAPARKQVPNNLNSAFIFGNFVEGKSNQLA-KAASLQVAQNVGRAYNPLFIYGGVGLGKTHLMHAIGNEILRGNPAANIVYLHSERFVSDMVKALQHNA--INAFKEFYRTVDALLIDDIQFFAGKERSQEEFFHTFNTLLENKHQVVLTCDRYPKEIKGLEERLKSRFGWGLPVAIEPPDLETRVAILMSKAQQSGID--LSPEVAFFIGKRIRSNIRELEGALRRVIANAQFTGRPITLEFAKEALRDLIALQDR--------MINVENIQKTVSEYFKIRQADLLSNKRTRSLTRPRQIAMALSKELTSHSLPEIGQMFGGRDHTTVLHACRKVQELKESDARFMEDFSNLL 437
>gi|17548159|ref|NP_521561.1| chromosomal replication initiation protein [Ralstonia solanacearum GMI1000] >gi|38257696|sp|Q8XTV4|DNAA_RALSO Chromosomal replication initiator protein dnaA >gi|17430466|emb|CAD16939.1| probable chromosomal replication initiator protein dnaa. [Ralstonia solanacearum] (522 aa)
Score = 437, Expect = 3.5e-41, Identities = 116/346 (33%), Positives = 181/346 (52%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N   G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++  +   +  P   +A  F+A    S++R LEG L KI  +   N    EI     I    E+  D   V N  QI+ + I ++    Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   180 TVHERSR---LNPIL----TFDNLVTGKANQLA-RAAAVQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVP-EEVAF-FVAKHLRSNVRELEGALRKILAY--SNFHGKEI----TIEVTREALKDLLTVQNR-QISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 509
>gi|84497194|ref|ZP_00996016.1| chromosomal replication initiator protein [Janibacter sp. HTCC2649] >gi|84382082|gb|EAP97964.1| chromosomal replication initiator protein [Janibacter sp. HTCC2649] (516 aa)
Score = 437, Expect = 3.5e-41, Identities = 115/336 (34%), Positives = 181/336 (53%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           T+ E+ +   +NP    ++TF+ + IG  N+ A  AA    E     +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F      +I +   K   F+  + +VD+LLIDDIQFL  K +  E FF+ FN L++ NK +V+TSD  P  L   ++RM SRF  GL   +  PD E+  +I I   K ++ K    +  +EFIA R +++IR LEG L ++      N  P +I + E  ++ +I  DS  +I S         I+      +G+  + +  + R++     R++ MY+ RE  +LS  +IG  F  R+H TV+ A K +
  S:   167 TVPEQVELTRLNP----KYTFDTFVIGASNRFANAAALAVAETPAKAYNPLFIYGESGLGKTHLLHAIGHYARNLYPHVKVRYVNSEEFTNDFINSIRD--DKAANFQRRYRDVDVLLIDDIQFLQGKVQTQEEFFHTFNTLHNANKQVVITSDLPPKLLSGFEERMRSRFEWGLMTDVQPPDLET--RIAILRKKAAQEKLSVPDDVLEFIASRISTNIRELEGALIRVTAFASLNRQPVDISLAEIVLKDLIPHDSANQITSA-------TIMAQTAAYFGLTLEDLQGQSRSRVLVTARQIAMYLCRELTDLSLPKIGQQFGGRDHTTVMHADKKI 490
>gi|153821932|ref|ZP_01974599.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae B33] >gi|126520552|gb|EAZ77775.1| chromosomal DNA replication initiator DnaA [Vibrio cholerae B33] (370 aa)
Score = 437, Expect = 3.7e-41, Identities = 115/340 (33%), Positives = 184/340 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:    35 VNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIHLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 365
>gi|111219506|ref|YP_710300.1| chromosomal replication initiator protein [Frankia alni ACN14a] >gi|111147038|emb|CAJ58685.1| Chromosomal replication initiator protein [Frankia alni ACN14a] (534 aa)
Score = 437, Expect = 3.8e-41, Identities = 111/342 (32%), Positives = 181/342 (52%)
  Q:    90 INKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAF---KAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLG----YGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           + ++   +E +P    +NP    R+ FE + IG  + N F    A ++       +  L IYG +GLGKTHLLHA+G+  ++L+P   + Y+ +E+F      +I +   + + F+  + ++D+LL+DDIQFL NKE+  E FF+ FN L+   K IV++SD+ P  L  ++DR+ SRF  GL   I  PD E+  +I I + K +  + P     +E+IA     +IR LEG L ++  F  L+    +  + E  +R +I               NPDI   +I       +GV    +    R++     R++ MY+ RE  +LS  +IG  F  R+H TV+ A + +
  S:   177 LGRDAAPLETEPAQARLNP----RYVFETFVIG--DSNRFPHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIGHYALKLYPNTRVKYVSSEEFTNDFINSIRD--DRQQAFQRRYRDIDVLLVDDIQFLENKERTQEEFFHTFNVLHDGEKQIVISSDRSPKQLSALEDRLRSRFEWGLMTDITPPDLET--RIAILSKKAATERLPVPPDVLEYIATHIERNIRELEGALIRVAAFASLNKSHVDRTLAEIVLRDLIPDAG-----------NPDITAAAIMNATAAYFGVSMDDLCGTSRSRVLVTARQIAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKI 506
>gi|88798539|ref|ZP_01114123.1| chromosomal replication initiation protein [Reinekea sp. MED297] >gi|88778639|gb|EAR09830.1| chromosomal replication initiation protein [Reinekea sp. MED297] (495 aa)
Score = 437, Expect = 3.9e-41, Identities = 109/345 (31%), Positives = 193/345 (55%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV-----QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++   L+  FTF+++  G  N+ A  AAS  + EN    +  L IYG  GLGKTHL+ A+GN+ +   P   ++Y+ +E F+  + KA+      + EFK  + ++D LLIDDIQF   K++  E FF+ FN L   N+ +++T D+ P  +  ++DR+ SRF  GL++ +  PD E+   I+++  +++++K P  +    FIA R  S++R LEG L ++            I N + I + I++    E + +L+     Q++ D I  ++   Y +    + SK+R++  +  R+V M + +E    S  EIG  F  R+H TVL A + V+   ++++D++    N++
  S:   155 KVQSYLNKAFTFQSFVEGKSNQLAL-AASQQVAENAGGAYNPLFIYGGVGLGKTHLMQAIGNEIIANNPTAKVVYLHSERFVADMVKALQLNA--MAEFKRFYRSLDALLIDDIQFFAKKDRSQEEFFHTFNALLEGNQQVILTCDRFPKEIDGLEDRLKSRFGWGLTVAVEPPDLETRVAILMKKAEQAKVKLPAESAF--FIAQRIRSNVRELEGALKRV------------IANAQFIGAPIDTALVKEALKDLLALQDKQVSIDNIQRTVAEYYKIKISDLHSKRRSRSIARPRQVAMALSKELTQHSLPEIGDAFGGRDHTTVLHACRKVKELRETNQDIREDYSNLL 490
>gi|189462574|ref|ZP_03011359.1| hypothetical protein BACCOP_03264 [Bacteroides coprocola DSM 17136] >gi|189430735|gb|EDU99719.1| hypothetical protein BACCOP_03264 [Bacteroides coprocola DSM 17136] (469 aa)
Score = 437, Expect = 4.1e-41, Identities = 107/354 (30%), Positives = 195/354 (55%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLD-----NVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           P++ + P   +++P L+  + FEN+  G  N+ +   A    +     +  L +YG +G+GKTHL++A+G +  +L+P+K ++Y+    F  +   ++        +F + +  +D+L+IDDIQ      K    FF+IFN L+   K +++TSD+ P  L+ ++DR+++RF  GL  ++ KPD E  K I+   I++  +  P S   I +IA   N  +R LEG++N +  + +      N+D  + I  + +R            + +  +  D IIE +C  Y VD  ++ +K R ++   VR+V MY+ ++  + S ++IG    N++HATVL A K V+ +V+ D+  KA ++ I
  S:   117 PSLLQAPAVQDLDPHLNPNYNFENFIKGTSNEFSRTVAETVAQNPARTFNPLFLYGPSGVGKTHLINAIGTRIKELYPEKRVLYVSAHLFQVQYTDSVRT--NHFNDFISFYQTIDVLIIDDIQEFAGVTKTQNTFFHIFNHLHQNGKQLILTSDRAPVMLQGMEDRLLTRFKWGLVAELEKPDIELRKNILRNKIRRDGLVIPES--VICYIAENVNESVRELEGIVNSLLVYSIQLKREINLDLAQRIVRKAVR-----------CAEVKPLTVDNIIEKVCSHYKVDASTIHTKTRKREVVQVRQVAMYLAKKHTDTSSSKIGQLIGNKDHATVLHACKIVKDQVEVDKAFKAEIEEI 462
>gi|187927113|ref|YP_001897600.1| chromosomal replication initiator protein DnaA [Ralstonia pickettii 12J] >gi|187724003|gb|ACD25168.1| chromosomal replication initiator protein DnaA [Ralstonia pickettii 12J] (529 aa)
Score = 437, Expect = 4.2e-41, Identities = 112/332 (33%), Positives = 175/332 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           L+   TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++  +   +  P   +A  F+A    S++R LEG L KI  +   N    EI     I    E+  D   V N  QI+ + I ++    Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   194 LNQILTFDNFVTGKANQLA-RAAAIQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVP-EEVAF-FVAKHLRSNVRELEGALRKILAY--SNFHGKEI----TIEVTREALKDLLTVQNR-QISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERTKDAQL 516
>gi|56750458|ref|YP_171159.1| chromosomal replication initiation protein [Synechococcus elongatus PCC 6301] >gi|56685417|dbj|BAD78639.1| chromosomal replication initiator protein DnaA [Synechococcus elongatus PCC 6301] (482 aa)
Score = 437, Expect = 4.2e-41, Identities = 117/416 (28%), Positives = 209/416 (50%)
  Q:    33 LDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKEL-PTIEEKPKTLEINP-------------TLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIYFH--------LLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
            D  + ++   N +     +++++ +     ++  E     +   + V   T  E +   EL P I   P    + P              L+ ++ F  + +G +N+ A  AASL + E     +  L + G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI      ++ F+  +   D++++DDIQF+  KE   E FF  FN L+   K IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+    KKS  +N P     IE+IA R+ S+IR LEG L +   +         L N+ P      EK+                 +++P++I++++   + V  + +    R ++ S  R+V MY++R+  +LS  +IG  F  ++H TV+ + + +    +SD  +   L  I
  S:    57 FDGKVLRLSTPNPF---ARNWLQKYYLRTIADVAAEILGHGIELQIGVLSDTSAEPESGAELWPAISPPPAVEVVKPPTTTAGRPPLRSSDLNPKYVFSRFVVGAYNRMA-HAASLAIAEYPGREYNPLFLCGGVGLGKTHLMQAIGHYRLEIDPDAKIFYVSTEQFTNDLIAAIRR--DSMQSFREHYRAADVIMVDDIQFIEGKEYTQEEFFYTFNSLHEAGKQIVLASDRPPSQIPRLQERLISRFSMGLIADIQPPDFETRVAIL---QKKSEFENMPLPRDVIEYIAARYTSNIRELEGALTRAVAYASISGLALTLANIAPVLTPPTEKM-----------------ELSPEMILQTVAETFDVSIEDLRGNSRRREVSLARQVGMYLMRQHTDLSLPKIGEQFGGKDHTTVMYSCEKIGQLRQSDPQMGKQLQEI 472
>gi|167036432|ref|YP_001664010.1| chromosomal replication initiation protein [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038676|ref|YP_001661661.1| chromosomal replication initiation protein [Thermoanaerobacter sp. X514] >gi|166852916|gb|ABY91325.1| chromosomal replication initiator protein DnaA [Thermoanaerobacter sp. X514] >gi|166855266|gb|ABY93674.1| chromosomal replication initiator protein DnaA [Thermoanaerobacter pseudethanolicus ATCC 33223] (443 aa)
Score = 437, Expect = 4.5e-41, Identities = 129/424 (30%), Positives = 225/424 (53%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEIN-PTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           YN +++      I D+ +++   N F K +    Y  I  +  S   N    +  ++++E++  +   +IE++  T      TL+ ++TF+ + +G  NK A  A  ++       +  L IYG  GLGKTHL+HA+G+   +      +MY+ +E F  ++  +I +   K EEF+N + N+D+LLIDDIQF+  KE+  E FF+ FN L   NK IV++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ +  +   +  P   LA  ++A +  S+IR LEG L +I  F  L   + +  + +  ++ I+ S+   EI   L+Q       E +C  Y +  +   S+KR K  ++ R++ MY+ RE  +LS  +IG  F  ++H TV+ A + +  ++K DE L   ++ +  +
  S:    25 YNTWLVHIKPLAIIDDVLFLSTPNTFTKNIINGRYINIIYDAASKATNKLYEIKILSEDEEEYREIKESIEKENLTESTTLSTLNPKYTFDTFVVGNSNKLAHAACLAVAQAPAKAYNPLFIYGGVGLGKTHLMHAIGHFINKHQSGYKIMYVTSETFTNELVNSIKD--DKNEEFRNKYRNIDVLLIDDIQFIAKKERTQEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRIAILKKKAQTENLNIPDEVLA--YVAEKIQSNIRELEGALIRIVAFSNLTKANIDLELAKHALKEIV-SNKTREITVKLIQ-------EEVCKYYNIKLEDFRSRKRTKNIAYPRQIAMYLARELTDLSLPKIGEEFG-KDHTTVIHAYEKISNEIKQDELLSRQIEELKKR 439
>gi|23465223|ref|NP_695826.1| chromosomal replication initiator protein DnaA [Bifidobacterium longum NCC2705] >gi|189440298|ref|YP_001955379.1| ATPase for DNA replication initiation [Bifidobacterium longum DJO10A] >gi|38257643|sp|Q8G6K0|DNAA_BIFLO Chromosomal replication initiator protein dnaA >gi|23325851|gb|AAN24462.1| chromosomal replication initiator protein DnaA [Bifidobacterium longum NCC2705] >gi|189428733|gb|ACD98881.1| ATPase for DNA replication initiation [Bifidobacterium longum DJO10A] (500 aa)
Score = 436, Expect = 4.6e-41, Identities = 108/336 (32%), Positives = 181/336 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAI---SEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           L+  FTF+++  G  N+ A   A    E    ++  L IYG +GLGKTHLL+A+GN  +   P   + Y+ +E+F  +   A+   ++   ++ EF   +  VD+LLIDDIQFL  KE   + FF+ FN L+  NK IV+ SD  P +LK  + R+ISRF SGL++ +  PD E+  +I I  +  S   +   +  ++ IA RF  +IR LEG L ++     L N      + E+ ++    +D         V+I P  II  +   + +  + ++ K R K  +  R++ MY+ RE  ++S  +IG  F  R+H TV+ A   +  +++  +++  ++
  S:   157 LNKNFTFDSFVPGDSNRFARTVALAVAEGSGQDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPGLKVRYVTSEEFTNEFIDALQNPNQSQGQIAEFNRRYRQVDVLLIDDIQFLGGKEATLDQFFHTFNALHQANKRIVIASDVAPKNLKGFEARLISRFESGLTVDVKPPDLET--RIAILRMIASMNGSKIPSDVLDLIAERFTENIRELEGALTRVTAVASLSNQPVTRALAEQTLQDFFTTD---------VEIKPTDIISQVAKYFHLTFEDLVGKSRTKNVAVPRQIAMYLAREMTSMSLMDIGQVFGGRDHTTVMHACTRISDRMQQKQEIYNYV 487
>gi|124022539|ref|YP_001016846.1| chromosomal replication initiation protein [Prochlorococcus marinus str. MIT 9303] >gi|166214690|sp|A2C7X1|DNAA_PROM3 Chromosomal replication initiator protein dnaA >gi|123962825|gb|ABM77581.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus str. MIT 9303] (463 aa)
Score = 436, Expect = 4.7e-41, Identities = 117/403 (29%), Positives = 206/403 (51%)
  Q:    41 KDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL-----------------EINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           +D  + ++  N F        Y +  E   +      + V    +EE    + LP +   P  L                  I P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P+  + Y+ TE F   + +AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + K+ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I++IA RF S+IR LEG L + + F  +  +     +  E +  +++ +         V + P  +I+ +   + V  + + S  R +  S  R+V MY++R+  +LS   IG  F  ++H TV+ AI+ VE ++ SD  L +
  S:    38 RDGELTLIAPNSFASNWLRKNYVQTIEAAAAKIYGQPVRVSVQAQEEDSAERVLPPMASAPVPLPAAEATTASAAPSSGPRRILPGLNLRYVFNRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEINPEAKVAYVSTETFTNDLIQAIRKDG--MQAFRDRYRATDLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPKLQERLISRFSMGLIADIQSPDLETRMAILQKKAEQERMMLPRD--LIQYIAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDPNGQG------VDVTPQQVIDKVSEVFDVTPQDMRSSSRRRAVSHARQVGMYLMRQGTDLSLPRIGETFGGKDHTTVMYAIEQVEKRLSSDPQLAS 446
>gi|196230261|ref|ZP_03129124.1| chromosomal replication initiator protein DnaA [Chthoniobacter flavus Ellin428] >gi|196225858|gb|EDY20365.1| chromosomal replication initiator protein DnaA [Chthoniobacter flavus Ellin428] (464 aa)
Score = 436, Expect = 4.7e-41, Identities = 123/438 (28%), Positives = 228/438 (52%)
  Q:    14 IKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINK--ELPTIEEKPKTLEINPTL--------DSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK---AFLDNIMSK 451
           I  +I+ E   ++ Y+ +  D    ++ ++ + + V N   +    N Y+        + + S  N+ ++ ++E  I    ++ T  +KPK     P +        + R  F+++ +G  N+ A  A     +     +  L IYG  GLGKTHL+HA+G+  +       ++YI +E F  +   AI      + +F+  +   D+LLIDDIQFL +K +  E FF+ FN L   +K IV++SD+ P+ +  ++ R++SRF  GL+ ++  PD E+  ++ I   K   ++    +  I+F+A R  +++R LEG L ++  ++  ++    +   EKI  +++ D  +E     + I  D I + +   + V    + SK+R    +F R++ M++ RE    S NEIG  F  R+H TVL A + V  K+  DE  +   +FL++ +++
  S:    22 ITAQIKTEVSADS-YDRWFRDIEPVELDEKTLTLRVPNSIFQLWIENNYQAHLRSVVMLVLGSPRNIHYVYQDETKIAPPPKVLTPAQKPKAEPAEPRMPAGGTSGFNPRNNFDSFVVGTNNQFAHAACKAVSDAPARTYNPLFIYGGVGLGKTHLMHAIGHAILSKRKPGKVVYITSEAFTNEFIDAIQN--NTLIKFRKRYRQADVLLIDDIQFLADKGRTQEEFFHTFNTLFDGHKQIVLSSDRPPSEIANLETRLVSRFEWGLTAELQAPDIET--RVAILRKKAQSVEIQLDDEIIQFLAARIRTNVRRLEGALMRVASYV--SLSHGRLPGMEKIEHLLK-DILHEEARRAITI--DQIQKRVAEHFDVRLADMTSKRRPANIAFPRQIAMFLARELTKTSLNEIGEAFGGRDHGTVLHAHRLVREKMTKDERTRQIVSFLESQLTR 464
>gi|146328959|ref|YP_001208941.1| chromosomal replication initiator protein [Dichelobacter nodosus VCS1703A] >gi|146232429|gb|ABQ13407.1| chromosomal replication initiator protein [Dichelobacter nodosus VCS1703A] (442 aa)
Score = 436, Expect = 4.9e-41, Identities = 120/343 (34%), Positives = 192/343 (55%)
  Q:    99 EKPKTLEINPTLDSR----FTFENYTIGMFNKNAFKA----ASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQI-NPDIIIESI----CLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++ ++ +  PT +SR    + FEN+ +G  N NA+ A    +   L E+ N   LLIYG TGLGK+HL+HA GN   Q   +K +MY+  E+F      AI     ++ +F N + N D LLIDD+QFL+ K +  E FF+ FN L  K + I++T D+ P  ++ + DR+ SRF SGL++ +  PD E+  +I I   K  R+         E+IA +  S+IR LEG L K+Y +   N   +EII  +  R+ +         ++L+Q  N DI I+ I       + +  + + SKKR    +  R++ M++ +     SY EIG  F  R+H+TV+ A + ++  ++ +E  
  S:    89 QRKQSNDFAPTFNSRLNPHYQFENFIVGKSNDNAYAAVHRVSKGLLSEDFN--PLLIYGGTGLGKSHLMHAAGNALCQ-NGKKRVMYLTAEEFTNDYINAIKNPKREMSDFINFYRNADALLIDDVQFLSGKNRSQEEFFHTFNSLFDKKRQIILTCDRFPKEIEGLADRLKSRFGSGLTVSVAPPDYET--RIAILQSKAERLHFSLPKEVEEYIAEKVTSNIRDLEGALRKVYAYCEFN---HEIITLDIARNAL---------NDLIQAQNCDITIDHIRTITATHFNISVEDMDSKKRMAAITLPRQIAMHLAKSLTQHSYPEIGKIFGKRDHSTVIHACRKIDELLQENESF 428
>gi|177672627|ref|ZP_02945312.1| chromosomal replication initiator protein DnaA [Micrococcus luteus NCTC 2665] >gi|118706|sp|P21173|DNAA_MICLU Chromosomal replication initiator protein dnaA >gi|149848|gb|AAA25315.1| DNA biosynthesis initiation protein (dnaA) >gi|172070746|gb|EDT56797.1| chromosomal replication initiator protein DnaA [Micrococcus luteus NCTC 2665] (515 aa)
Score = 436, Expect = 4.9e-41, Identities = 112/331 (33%), Positives = 178/331 (53%)
  Q:   101 PKTLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAI--SEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           P T      L+ R+ FE + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+   +L+P   + Y+ +E+F      +I   EG +    FK  + NVD+LLIDDIQFL +KE   E FF+ FN L + NK +V+TSD  P  L   +DR+ SRF  GL   I  PD E+   I+ +  +   +  P    A+E+IA R +++IR LEG L ++  F  L+    +  + E  ++ +I  ++ +E       I P++I+ +    + +  + + SK R +     R++ MY+LRE   +S  +IG     R+H TV+ A + +
  S:   165 PSTSAETSRLNDRYHFETFVIGSSNRFAHAAANAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYARRLYPGLRVRYVNSEEFTNDFINSIRHDEGAS----FKQVYRNVDILLIDDIQFLADKEATVEEFFHTFNTLYNNNKQVVITSDLPPKQLSGFEDRLRSRFEWGLITDIQPPDLETRIAILRKKAEAEGLVAPPE--ALEYIASRISTNIRELEGALIRVTAFASLNRQTVDIELAEHVLKDLITDETAHE-------ITPELILHATGEYFNLTLEELTSKSRTRTLVTARQIAMYLLRELTEMSLPKIGQVLGGRDHTTVIHADRKI 487
>gi|196251645|ref|ZP_03150313.1| chromosomal replication initiator protein DnaA [Clostridium thermocellum DSM 4150] >gi|196199022|gb|EDX93851.1| chromosomal replication initiator protein DnaA [Clostridium thermocellum DSM 4150] (443 aa)
Score = 436, Expect = 5.0e-41, Identities = 122/421 (28%), Positives = 219/421 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE---NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +N ++       +    + + V  +F K +  + Y+ + +            + FI   ++++NK     E           L+ ++TF+ + IG  N N F  A+           +  L IYG  GLGKTHL+HA+G+  ++    + ++Y+ +E F  ++  AI +   + EEF++ + N+D+LLIDDIQF+  KE+  E FF+ FN L   NK I+++SDK P  + ++DR+ SRF  GL   +  PD E+   I+    KK++++N    N  I FIA +  S+IR LEG LN++  +   ++  NEI  E   E ++ I+ ++    +    +Q       E++   + +  +   SKKR +  +F R++ MY+ RE   +S  +IG  F  R+H TV+ A + +  +++S+ + +  +  I
  S:    25 FNTWIKTIDPLSLTGNTINLAVPAEFNKGILESRYQTLIKNAIKQVTFKEYEIAFIVPSQENLNKLTKQTESAGNEDSPLSVLNPKYTFDTFVIG--NSNRFAHAAALAVAEAPGKAYNPLFIYGGVGLGKTHLMHAIGHYILEQNSSQRVLYVSSEKFTNELINAIKD--NRNEEFRSKYRNIDVLLIDDIQFIAGKERTEEEFFHTFNALYEANKQIILSSDKPPKEISLEDRLRSRFEWGLIADMQAPDLETRIAIL---RKKAQLENLTVPNEVIVFIADKIASNIRELEGALNRVIAY--SSLTENEITVELASEALKDILSANKAKVLNCTTIQ-------EAVARYFDIRPEEFKSKKRTRDIAFPRQIAMYLCRELTEMSLPKIGEEFGGRDHTTVIHACEKISKEIESNSETRRAVSEI 436
>gi|33861122|ref|NP_892683.1| chromosomal replication initiation protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|61222626|sp|P0A3A2|DNAA_PROMP Chromosomal replication initiator protein dnaA >gi|61222628|sp|P0A3A3|DNAA_PROS9 Chromosomal replication initiator protein dnaA >gi|5616249|gb|AAD45692.1|AF158628_2 DnaA [Prochlorococcus marinus subsp. pastoris str. PCC 9511] >gi|33639854|emb|CAE19024.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (463 aa)
Score = 436, Expect = 5.0e-41, Identities = 130/402 (32%), Positives = 217/402 (53%)
  Q:    47 ILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKEL------PTIEEKPKTLEINPT------------LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           ++  N+F  +     Y E  E+        N+ V F ++   + N           I  + K+  IN +            L++R+ F+ + +G  ++ A  AA    E     +  L I G  GLGKTHL+ AVG+  V++ P   ++Y+ TE F   + ++I + G  +  FKN + +VDLLLIDDIQFL  KE   E FFN FN L    K IV+ SD+ P+ + K+ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I+FIA RF+S+IR LEG   + + F  +  +     +  + I  +++ +S   +V+      P  +I+ +   + V  + ++S  R K  S  R++ MY++R+  +LS  +IG  F  ++H TV+ AI+ VE K+ SD ++ + +  I
  S:    43 LITPNNFTSDWLRKNYSETIEKAAEEICGHNVKVVFKSETNINNNSNSSDSVSQQNINSQSKSFSINQSNNLINRSKKSHSLNTRYVFKRFVVGPNSRMAHAAALAVAESPGREFNPLFICGGVGLGKTHLMQAVGHYRVEIDPDAKVLYVSTETFSSDLIQSIRKDG--MHAFKNKYRSVDLLLIDDIQFLEGKEYTQEEFFNTFNALYEAGKQIVIASDRPPSQIPKLQERLISRFSMGLIADIQPPDIETRMAILQKKAEQERMNLPRD--LIQFIAGRFSSNIRELEGAFTRAVAFASITGLP----MTVQSIAPMLDPNSVGVVVT------PKQVIKKVSDFFEVSAEELVSSSRRKPVSQARQIGMYLMRQGTDLSLPKIGDEFGGKDHTTVMYAIEQVEKKLSSDPNVASQVQKI 451
>gi|90581124|ref|ZP_01236923.1| chromosomal replication initiation protein [Vibrio angustum S14] >gi|90437645|gb|EAS62837.1| chromosomal replication initiation protein [Vibrio angustum S14] (466 aa)
Score = 436, Expect = 5.1e-41, Identities = 117/355 (32%), Positives = 187/355 (52%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P   E P     N  ++ +  F N+  G  N+    AA   + +N    +  L +YG TGLGKTHLLHAVGN      P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +   I+   ++    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   118 PVQNESPGGYRSN--VNPKHNFNNFVEGKSNQLGL-AACRQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIANRKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPREINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHNIR--LADEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 461
>gi|86607504|ref|YP_476266.1| chromosomal replication initiation protein [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123765419|sp|Q2JHS1|DNAA_SYNJB Chromosomal replication initiator protein dnaA >gi|86556046|gb|ABD01003.1| chromosomal replication initiator protein DnaA [Synechococcus sp. JA-2-3B'a(2-13)] (467 aa)
Score = 436, Expect = 5.3e-41, Identities = 100/324 (30%), Positives = 178/324 (54%)
  Q:   108 PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           P L+ +++F  + +G  N+ A  AA    ++    +  L + G  GLGKTHL+ A+G+  ++  PQ  + Y+ TE F   +  AI      ++ F+  + +VD+LL+DD+QF+  KE   E FF+ FN L+   K IV+ +D+ P  + ++ +R+ SRF+ GL  +I  PD E+   I+ +  +   +  P     IE+IA  + S+IR LEG L +   ++  +  P  +   E I+ I+   S+ +      +I  D+I + +C  +G+D+ S++   R +  S  R++ M+++R   NLS  +IG +F  ++H TVL + + V
  S:   125 PDLNPKYSFSRFVVGPNNRMAHAAALAVADKPGRAYNPLFLCGGVGLGKTHLMQAIGHYQLEANPQAKVFYVSTERFTNDLIDAIRR--DSMQSFREHYRDVDILLVDDVQFIEGKEYTQEEFFHTFNTLHESGKQIVLAADRSPHLIPRLQERLCSRFSMGLIAEIQSPDIETRMAILKKKAEYEGMNLPAD--VIEYIATTYTSNIRELEGALIRAVAYVSISGLPMSV---ETIQPILNPPSEPK------EITADMITDVVCEEFGIDRDSLLGSSRKRDISQARQIAMFLMRHYTNLSLPKIGDYFGGKDHTTVLYSCEKV 437
>gi|59710616|ref|YP_203392.1| chromosomal replication initiation protein [Vibrio fischeri ES114] >gi|163730206|ref|ZP_02137682.1| chromosomal replication initiation protein [Vibrio fischeri MJ11] >gi|71151809|sp|Q5E8Z2|DNAA_VIBF1 Chromosomal replication initiator protein dnaA >gi|59478717|gb|AAW84504.1| chromosomal replication initiator protein DnaA [Vibrio fischeri ES114] >gi|161396660|gb|EDQ20953.1| chromosomal replication initiation protein [Vibrio fischeri MJ11] (469 aa)
Score = 436, Expect = 5.3e-41, Identities = 112/340 (32%), Positives = 181/340 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA    +     +  L +YG TGLGKTHLLHAVGN  V   P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +  +I    ++    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   134 VNPKHKFTNFVEGKSNQLGLAAARQVSDNPGTAYNPLFLYGGTGLGKTHLLHAVGNAIVDSKPDARVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIH--LADEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADLLSKRRSRSVARPRQLAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYSNLI 464
>gi|146319849|ref|YP_001197375.1| chromosomal replication initiation protein [Streptococcus suis 05ZYH33] >gi|146322039|ref|YP_001199561.1| chromosomal replication initiation protein [Streptococcus suis 98HAH33] >gi|145690655|gb|ABP91161.1| ATPase involved in DNA replication initiation [Streptococcus suis 05ZYH33] >gi|145692845|gb|ABP93350.1| ATPase involved in DNA replication initiation [Streptococcus suis 98HAH33] (457 aa)
Score = 436, Expect = 5.3e-41, Identities = 144/436 (33%), Positives = 236/436 (54%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFF-ITKEEKDINKELPT---IEEKPKTLE----------INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPD---IIIESICLG----YGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           E+ K     + Y+ YV D+ +  I  +   I +   F K+ +   ++E+            L + +  T++E++I     T   I  + +TLE          ++  + S++TF N+  G  N  A KAA+L + +N    +  L I+G  GLGKTH+L+A+GNK +   PQ  + Y+ +E F+ +  + +      +E FK ++ N+DLLLIDDIQ L NK    E FF+ FN L+ KNK IV+TSD+ P  L  +++R+++RF  GL+ +I  PD E+  +I I   K   +   F+N  + ++A +F+S++R LEG L  I+           +I   +  S I  +   E + +  Q NP    I IE I       YGV  K +   KR +     R+V M++ RE  + S  +IG  F NR+H TV+ A   ++T +  DE+L+  + +I +K 
  S:    13 ELAKVNFKPSIYDFYVADAKLLGINQQVANIFLNRPFKKDFWEKNFEELMIAASFESYGEPLTIQYQFTEDEQEIRNTTNTRSSIVHQVQTLEPATPQETFKPVHSDIKSQYTFANFVQGDNNHWA-KAAALAVSDNLGELYNPLFIFGGPGLGKTHILNAIGNKVLADNPQARIKYVSSETFINEFLEHLRL--NDMESFKKTYRNLDLLLIDDIQSLRNKATTQEEFFHTFNALHEKNKQIVLTSDRNPDHLDNLEERLVTRFKWGLTSEITPPDFET--RIAILRNKCENLPYNFTNETLSYLAGQFDSNVRDLEGALKDIH-----------LIATMRQLSEISVEVAAEAIRSRKQTNPQNMVIPIEKIQTEVGNFYGVSLKELKGSKRVQHIVHARQVAMFLAREMTDNSLPKIGKEFGNRDHTTVMHAYNKIKTLLLDDENLEIEITSIKNKL 456
>gi|89074702|ref|ZP_01161160.1| chromosomal replication initiation protein [Photobacterium sp. SKA34] >gi|89049466|gb|EAR55027.1| chromosomal replication initiation protein [Photobacterium sp. SKA34] (466 aa)
Score = 436, Expect = 5.3e-41, Identities = 117/355 (32%), Positives = 187/355 (52%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           P   E P     N  ++ +  F N+  G  N+    AA   + +N    +  L +YG TGLGKTHLLHAVGN      P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +   I+   ++    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +E   +   D+K    N++
  S:   118 PVQNESPGGYRSN--VNPKHNFNNFVEGKSNQLGL-AACRQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIANRKPNAKVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPREINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHNIR--LADEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLI 461
>gi|153815423|ref|ZP_01968091.1| hypothetical protein RUMTOR_01658 [Ruminococcus torques ATCC 27756] >gi|145847282|gb|EDK24200.1| hypothetical protein RUMTOR_01658 [Ruminococcus torques ATCC 27756] (456 aa)
Score = 436, Expect = 5.4e-41, Identities = 134/445 (30%), Positives = 240/445 (53%)
  Q:     7 IKKKYLIIKKEIEKEFQNENF-YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEI--NPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVE----EFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKII-----IENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +++ + +I  +++ E+ + N  Y  ++   +++++KD  VYILV+     E    +Y   F+   +        V F+T  E  I ++   I +K +   I     L+ ++TF+ + +G  N N   AASL + E+    +  L IYG  GLGKTHL+H+V +  +   P K ++Y+ +E F  ++  A+  G T  E    +F+  + N D+LLIDDIQF+  KE   E FF+ FN L+   K I+++SDK P  ++ ++ R+ +RF  GL   I+ PD E+   I+     ++ ++K  I +      +++IA    S+IR LEG LNK I    L+N   +  +  E ++ +I  D++ E       + P++II+ +   + +    +  KKRN +    R++ MY+ R   +     IG+    ++HA+V   +K +E ++K+DE L   ++ I  K
  S:     4 VEQNWDLILNKMKLEYCSSNISYTTWIAPLTVYEVKDNTVYILVQLRASLEHIEEKYLLPFKVCIAEVTGIEFEVAFVTDNEAVIQEKKENIIKKNRVNAIYEKANLNPKYTFDTFVVGS-NNNFAHAASLAVAESPGEIYNPLFIYGGVGLGKTHLMHSVAHFILANDPSKKVLYVTSETFTNELIDALKAGKTGSELAMTKFREKYRNNDVLLIDDIQFIIGKESTQEEFFHTFNHLHVSGKQIIISSDKPPKDIETLEARLRTRFEWGLIADISSPDYETRMAILRKKEELDGLEKYHIPDD----VMQYIANNIKSNIRELEGSLNKLIALSNLENKKIDIPLAAEALKDMISPDNNRE-------VTPELIIDIVSEHFNIPISELKGKKRNAEIVLPRQIIMYLCRTLTDTPLKAIGAILGGKDHASVNHGVKKIENELKTDEALNNTVNIIKKK 452
>gi|194512763|ref|YP_002025287.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei Pasteur 52237] >gi|157934304|gb|EDO89974.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei Pasteur 52237] (533 aa)
Score = 436, Expect = 5.4e-41, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   197 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 520
>gi|124384274|ref|YP_001028201.1| chromosomal replication initiation protein [Burkholderia mallei NCTC 10229] >gi|126449063|ref|YP_001079584.1| chromosomal replication initiation protein [Burkholderia mallei NCTC 10247] >gi|194573662|ref|YP_002108548.1| chromosomal replication initiator protein DnaA [Burkholderia mallei 2002721280] >gi|166201864|sp|A3MH48|DNAA_BURM7 Chromosomal replication initiator protein dnaA >gi|166201865|sp|A2S8D2|DNAA_BURM9 Chromosomal replication initiator protein dnaA >gi|124292294|gb|ABN01563.1| chromosomal replication initiator protein DnaA [Burkholderia mallei NCTC 10229] >gi|126241933|gb|ABO05026.1| chromosomal replication initiator protein DnaA [Burkholderia mallei NCTC 10247] >gi|148028822|gb|EDK86754.1| chromosomal replication initiator protein DnaA [Burkholderia mallei 2002721280] (533 aa)
Score = 436, Expect = 5.4e-41, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   197 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 520
>gi|121599001|ref|YP_994142.1| chromosomal replication initiation protein [Burkholderia mallei SAVP1] >gi|126451895|ref|YP_001064388.1| chromosomal replication initiation protein [Burkholderia pseudomallei 1106a] >gi|134281353|ref|ZP_01768061.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 305] >gi|161361183|ref|ZP_02107040.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 1106b] >gi|167001180|ref|ZP_02266979.1| chromosomal replication initiation protein [Burkholderia mallei PRL-20] >gi|194502268|ref|YP_002031846.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 1655] >gi|194517977|ref|YP_002053558.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei S13] >gi|194569695|ref|YP_002104697.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 406e] >gi|166201866|sp|A1V7D9|DNAA_BURMS Chromosomal replication initiator protein dnaA >gi|166201867|sp|A3NPW7|DNAA_BURP0 Chromosomal replication initiator protein dnaA >gi|121227811|gb|ABM50329.1| chromosomal replication initiator protein DnaA [Burkholderia mallei SAVP1] >gi|126225537|gb|ABN89077.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 1106a] >gi|134247020|gb|EBA47106.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 305] >gi|157808658|gb|EDO85828.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 406e] >gi|169651300|gb|EDS83993.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei S13] >gi|184214680|gb|EDU11723.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 1655] (533 aa)
Score = 436, Expect = 5.4e-41, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   197 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 520
>gi|53724901|ref|YP_101862.1| chromosomal replication initiation protein [Burkholderia mallei ATCC 23344] >gi|52428324|gb|AAU48917.1| chromosomal replication initiator protein DnaA [Burkholderia mallei ATCC 23344] (518 aa)
Score = 436, Expect = 5.4e-41, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   182 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 505
>gi|53717714|ref|YP_106700.1| chromosomal replication initiation protein [Burkholderia pseudomallei K96243] >gi|76810636|ref|YP_331717.1| chromosomal replication initiation protein [Burkholderia pseudomallei 1710b] >gi|126441420|ref|YP_001057144.1| chromosomal replication initiation protein [Burkholderia pseudomallei 668] >gi|161375424|ref|ZP_02114956.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 1710a] >gi|123771937|sp|Q3JXI6|DNAA_BURP1 Chromosomal replication initiator protein dnaA >gi|166201868|sp|A3N473|DNAA_BURP6 Chromosomal replication initiator protein dnaA >gi|61212530|sp|Q63YW5|DNAA_BURPS Chromosomal replication initiator protein dnaA >gi|52208128|emb|CAH34058.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei K96243] >gi|76580089|gb|ABA49564.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 1710b] >gi|126220913|gb|ABN84419.1| chromosomal replication initiator protein DnaA [Burkholderia pseudomallei 668] (533 aa)
Score = 436, Expect = 5.4e-41, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   197 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 520
>gi|125974856|ref|YP_001038766.1| chromosomal replication initiation protein [Clostridium thermocellum ATCC 27405] >gi|166201880|sp|A3DHZ4|DNAA_CLOTH Chromosomal replication initiator protein dnaA >gi|125715081|gb|ABN53573.1| chromosomal replication initiator protein DnaA [Clostridium thermocellum ATCC 27405] (443 aa)
Score = 436, Expect = 5.4e-41, Identities = 122/421 (28%), Positives = 219/421 (52%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE---NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINE---EKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +N ++       +    + + V  +F K +  + Y+ + +            + FI   ++++NK     E           L+ ++TF+ + IG  N N F  A+           +  L IYG  GLGKTHL+HA+G+  ++    + ++Y+ +E F  ++  AI +   + EEF++ + N+D+LLIDDIQF+  KE+  E FF+ FN L   NK I+++SDK P  + ++DR+ SRF  GL   +  PD E+   I+    KK++++N    N  I FIA +  S+IR LEG LN++  +   ++  NEI  E   E ++ I+ ++    +    +Q       E++   + +  +   SKKR +  +F R++ MY+ RE   +S  +IG  F  R+H TV+ A + +  +++S+ + +  +  I
  S:    25 FNTWIKTIDPLSLTGNTINLAVPAEFNKGILESRYQTLIKNAIKQVTFKEYEIAFIVPSQENLNKLTKQTESAGNEDSPLSVLNPKYTFDTFVIG--NSNRFAHAAALAVAEAPGKAYNPLFIYGGVGLGKTHLMHAIGHYILEQNSSQKVLYVSSEKFTNELINAIKD--NRNEEFRSKYRNIDVLLIDDIQFIAGKERTEEEFFHTFNALYEANKQIILSSDKPPKEISLEDRLRSRFEWGLIADMQAPDLETRIAIL---RKKAQLENLTVPNEVIVFIADKIASNIRELEGALNRVIAY--SSLTENEITVELASEALKDILSANKAKVLNCTTIQ-------EAVARYFDIRPEEFKSKKRTRDIAFPRQIAMYLCRELTEMSLPKIGEEFGGRDHTTVIHACEKISEEIESNSETRRAVSEI 436
>gi|83319700|ref|YP_424001.1| chromosomal replication initiator protein DnaA [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|118707|sp|P24116|DNAA_MYCCT Chromosomal replication initiator protein dnaA >gi|216795|dbj|BAA14415.1| DnaA protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283586|gb|ABC01518.1| chromosomal replication initiator protein DnaA [Mycoplasma capricolum subsp. capricolum ATCC 27343] (450 aa)
Score = 435, Expect = 5.9e-41, Identities = 145/428 (33%), Positives = 229/428 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDF-------VKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSI-IESDSDYEI-VSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +E+ YN+Y+   +I+K    N  ++VK+ F        +    NE K+I ++  +I            ++ + INK+   I  K K  ++N       TFEN+ IG  N+ AF A     +    ++  L IYG +G+GKTHLL A  N     F    + Y+  ++F  K    + +   ++E+FKN     D+L+IDD+QFL+ KEK NEIFF IFN     +K +  +SDK P  L   D+R+I+RFN GLSI I K D ++   II + IK   IK   +N AI FI+  ++ D+R ++G ++++ F    N        EEK+ +I I SD   +I  S L  +N   I E +   YG+   ++  K R+K     R + MY+ +E +N +  +IG  F  R+H TV+ A + +E  +K D+ LK  +D + +K
  S:    21 DESVYNDYIKTINIYKKDLSNYVVVVKSQFGLLAIKQFRPTIENEIKKILKQPVNISFTYEQEYQKQLEKTESINKDHSDIISK-KNKKVNEN-----TFENFVIGSSNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNEVCQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKTEVTNEAINFISNYYSDDVRKIKGSVSRLNFWSQQN-------PEEKVITIEIISDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMYLTKEILNHTLAQIGEEFGGRDHTTVINAERKIEMMLKKDKQLKKTVDILKNK 446
>gi|125716888|ref|YP_001034021.1| chromosomal replication initiation protein [Streptococcus sanguinis SK36] >gi|125496805|gb|ABN43471.1| Chromosomal replication initiator protein dnaA, putative [Streptococcus sanguinis SK36] (450 aa)
Score = 435, Expect = 6.0e-41, Identities = 142/424 (33%), Positives = 233/424 (54%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVF--TNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEE------KPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKE-KLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYF-----HLLD-NVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           Y+ +V ++ + K++++   I + +  VK++F   N    I    F I  N  +   +I +EE +       +        +P    I+  L S++TF+N+  G  N  A KAA+L + EN    +  L IYG  GLGKTHLL+A+GN+ ++  P   + YI  E F+    + +  G  +++ FK  + ++DLLLIDDIQ L  K+    E FFN FN L+ +NK IV+TSD+ P  L  +++R+++RF  GL+  I  PD E+  +I I   K   +   F N  +E++A +F+S++R LEG LN I       HL +  +D    I  E IR+  +  S   +      I  D I   +   YGV  K +   +R +     R+V MY+ RE  + S  +IG  F  ++H TV+ A   ++T ++SD++L+  +++I +K
  S:    24 YDFFVAEAKLVKVEEKQAIIFLDSP-VKQLFWEQNLVGVILTAGFEI-FNDQIAGKYIFEEETNTETSKSVVTSPQISTVQPSLPPIDTGLKSKYTFDNFVQGDGNIWA-KAAALAVSENLATTYNPLFIYGGPGLGKTHLLNAIGNQILENIPDARVKYIPAETFINDFLEHLRLG--EMDSFKKIYRSLDLLLIDDIQSLGGKKVSTQEEFFNTFNALHGENKQIVLTSDRSPDHLDNLEERLVTRFKWGLTQNITPPDFET--RIAILRNKIEDLDYIFPNDTLEYLAGQFDSNVRDLEGALNDISLIARVRHLKEITID----IAAEAIRARKQDSSQVTV------IPIDKIQSEVGKFYGVSVKEMKGSRRVQNIVLARQVAMYLTRELTDNSLPKIGREFGGKDHTTVIHAHGKIKTMIESDDNLRLEIESIKNK 448
>gi|114565577|ref|YP_752731.1| initiation of chromosome replication [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336512|gb|ABI67360.1| initiation of chromosome replication [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (436 aa)
Score = 435, Expect = 6.2e-41, Identities = 122/409 (29%), Positives = 219/409 (53%)
  Q:    43 ENVY-ILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKT---LLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +N++ I+V +   KE   + Y +I        M + L     ++    I  E+ + +  P +      L+ ++TF+ + +G  N N F  A+ +    + +K+   L IYG  GLGKTHL+ A+G+  +   P   +MY+ +E F   +  +I +  T +  F+N + ++D+LL+DDIQFL  KE+  E FF+ FN L+  NK +V++SD+ P ++  ++DR+ SRF  GL   I  PD E+   I+ +  +   +  P+S   +++IA   +S+IR LEG L ++      N  P +      + + +E+  D        +I  + I +++   Y ++   +ISKKRNKQ  + R + MY+ R+  + S+ +IG  F  R+H TV+ A + +  ++ SD +L A ++ +  K
  S:    41 DNIFCIIVPDSLTKEWIESRYLDI--------MQNKLRRLIDSRVILSIRTEILSGKSDPVS-----ALNPKYTFDTFVVG--NSNRFAHAACYAVGESPFKSYNPLFIYGGVGLGKTHLMQAIGHHILSRKPNYLVMYVSSEQFTNDMISSIKDDTTSL--FRNKYRSIDVLLVDDIQFLAGKERTQEEFFHTFNTLHESNKQVVISSDRPPRNIPTLEDRLRSRFEWGLITDIQPPDLETRIAILRKKAQGENLNIPYS--VLDYIANYIDSNIRELEGALIRLVAFATINNKPLD------MNTAVEALKDIMPPPRPRKITIETIQKTVAAHYHLEINEIISKKRNKQLVYPRHIAMYLCRKLTDASFPQIGEQFGGRDHTTVMHAHEKLVNELLSDRELVAEIELLCKK 429
>gi|70725002|ref|YP_251916.1| chromosomal replication initiation protein [Staphylococcus haemolyticus JCSC1435] >gi|123762366|sp|Q4LAL5|DNAA_STAHJ Chromosomal replication initiator protein dnaA >gi|68445726|dbj|BAE03310.1| chromosomal replication initiator protein [Staphylococcus haemolyticus JCSC1435] (451 aa)
Score = 435, Expect = 6.3e-41, Identities = 129/432 (29%), Positives = 228/432 (52%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEE----KDINKELPTIEEKPKTL-----EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           E+ +   +++ +N ++ D+ + +I+D    I V ++F  E   + YKE+ +      +   +   F T E+     + +++  T  E  + +     E     ++  TF+ + IG  N+    AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++Y  +E F     K+I     + E F+  + N+D+LLIDDIQF+ NKE+  E FF+ FN L+   K IV++SD+ P  + K++DR+ SRF  GL + I  PD E+   I+ + I++  ++ P    A+ +IA +  S+IR LEG L ++  +  L        +  E ++ II+     +I    +Q       + +   Y V  +   +KKR K  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   +K+D   K  ++++
  S:    12 EVAESEISKSTFNTFLKDTELKEIRDNVAIIFVIHEFYAEWLNSNYKEVIQTIMKDVIGYEVEPKFFTAEQLAELDETSRKSNTPSEPQRQIIEYGHEGTDQFNTHNTFDTFVIGPGNRFP-HAASLAVAEAPAQAYNPLFIYGGVGLGKTHLMHAIGHHVLSNQPNAKVLYTSSEKFTNDFIKSIRN--NEPEAFREKYRNIDVLLIDDIQFIQNKEQTQEEFFHTFNELHQNKKQIVISSDRPPKEIAKLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEENLEIPAE--ALNYIANQIQSNIRELEGALTRLLAYSKLQGRPITTELAAEALKDIIQVPKSKKITIQDIQ-------KVVGHYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKIAKDIKADTIFKQEVEDL 444
>gi|154496124|ref|ZP_02034820.1| hypothetical protein BACCAP_00408 [Bacteroides capillosus ATCC 29799] >gi|150274679|gb|EDN01743.1| hypothetical protein BACCAP_00408 [Bacteroides capillosus ATCC 29799] (426 aa)
Score = 435, Expect = 6.4e-41, Identities = 111/335 (33%), Positives = 192/335 (57%)
  Q:   114 FTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTS-LKIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLL--DNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +TFE + +G  NK A  AA+L + EN   ++  L IYG +GLGKTHLL+A+ +K     P   ++YI+ + F  ++ +AI EG    +EF+  F + D+ L+DD+QF+  +E   E  F+ FN L    + IV T+D+ P   L++DDR+ +RF  GL + I  PD E+ +  II+N K  R         +++IA    S++R +EG +NKI  F  L  ++VD + +     +R + +  +++         + D+IIE +C  Y ++  ++  + R K  +  R++ MY++R   +LS  EIG  F  R+H TV+ +I+ +E  +KS+ ++   + ++
  S:    91 YTFERFVVGSSNKFA-HAAALSVAENPGKSYNPLFIYGESGLGKTHLLYAIAHKIHATRPDFRVVYIKGDAFTNELIQAIREGSN--QEFREKFRSADVFLMDDVQFIAGRESSQEEMFHTFNTLYEAGRQIVFTADRPPKEMLRLDDRLKTRFEWGLPVDIKPPDYET-RVAIIKN-KAIRRGMELPEPVLQYIAENITSNVRQIEGTVNKILAFQELMGESVDVDTVT--RAVRDMFKEKAEF-------LPSADVIIEEVCKFYNIENDALRGQGRTKDTALARQMAMYLIRRMTSLSLKEIGKEFEGRDHTTVMHSIERIENLMKSNAEVAEIIKDL 417
>gi|144900240|emb|CAM77104.1| chromosomal replication initiator protein DnaA [Magnetospirillum gryphiswaldense MSR-1] (458 aa)
Score = 435, Expect = 6.6e-41, Identities = 107/335 (31%), Positives = 188/335 (56%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSI-IESDSDYEIVSNLVQ-----INPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDE 439
           E+   LD RFTF+N+ +G  N+ A  AA    E    ++  L +YG  GLGKTHL+HA+ +   +  P + ++Y+  E F+ +  +A+    T    FK  F +VD+L++DD+QF+  K+   E FF+ FN L  + + IV+++DK P+ L+ ++DR+ SR NSGL   ++    E   ++ I   K  ++        +EF+A +  S++R LEG LN++  H       ++++     RSI +ES  D  ++ +L++     I  + I + +   + +    + S +R++Q +  R+V MY+ ++  + S  EIG  F  R+H TV+ A+K +E    SD+
  S:   118 ELGAQLDPRFTFKNFVVGKPNEFAHAAAVRVAEATAVSFNPLFLYGGVGLGKTHLMHAIAHHIREHNPARRVLYLSAEKFMYRFIRALRSQDTM--SFKEQFRSVDVLMVDDVQFIAGKDATQEEFFHTFNALVDQGRQIVISADKSPSDLEGMEDRLRSRLNSGLVADLHATTYE--LRLGILQSKAEQMGAVVPQKVMEFLAHKITSNVRELEGALNRVIAH-------SQLVG----RSITLESTQD--VLHDLLKASDRRITIEEIQKRVAEHFNIKLAEMSSARRSRQVARPRQVAMYLAKQLTSRSLPEIGRKFGGRDHTTVMHAVKKIEELRSSDQ 443
>gi|163854305|ref|YP_001628603.1| chromosomal replication initiation protein [Bordetella petrii DSM 12804] >gi|163258033|emb|CAP40332.1| chromosomal replication initiator protein [Bordetella petrii] (478 aa)
Score = 435, Expect = 6.8e-41, Identities = 109/322 (33%), Positives = 175/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L++  TF+N+  G  N+ A +AA+L + EN   ++  L +YG  GLGKTHL+HA+GN  V       + Y+  + ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  + ++ K I++TSD  P  L  ID R+ISRF+SGL++ I  P+ E    I++   +   +  P       FIA    S++R LEG L K+     FH  D +  +  + +E ++ ++        VSN  QI  + I +++   Y +    + SK+R    +  R+V MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   142 LNTDLTFDNFVTGKANQLA-RAAALQVAENPGISYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHADQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEAMVAQRKQIIITSDTYPKELAGIDSRLISRFDSGLTVAIEPPELEMRVAILLRKAESEGV--PMPEEVAFFIAKHLRSNVRELEGALRKVLAYARFHGRDVLSVD--VCKEALKDLLS-------VSN-GQITVENIQKTVADFYKIKVADMYSKRRPANIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVLHAVRKI 455
>gi|145297125|ref|YP_001139966.1| chromosomal replication initiator protein DnaA [Aeromonas salmonicida subsp. salmonicida A449] >gi|166201858|sp|A4SH46|DNAA_AERS4 Chromosomal replication initiator protein dnaA >gi|142849897|gb|ABO88218.1| chromosomal replication initiator protein DnaA [Aeromonas salmonicida subsp. salmonicida A449] (456 aa)
Score = 435, Expect = 7.1e-41, Identities = 116/336 (34%), Positives = 185/336 (55%)
  Q:   114 FTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +TFEN+  G  N+ A +AA+  + +N    +  L +YG TGLGKTHLLHAVGN   +      ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I++    +++I  P  +    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R H TVL A + +E   +   D+K    N++
  S:   125 YTFENFVEGKSNQLA-RAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNAIKERKKDAKVIYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKADENQIHLP--DEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAINIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKLADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGREHTTVLHACRKIEQLKEESHDIKEDYSNLI 451
>gi|67924996|ref|ZP_00518381.1| chromosomal replication initiator protein, DnaA [Crocosphaera watsonii WH 8501] >gi|67853170|gb|EAM48544.1| chromosomal replication initiator protein, DnaA [Crocosphaera watsonii WH 8501] (455 aa)
Score = 435, Expect = 7.2e-41, Identities = 122/428 (28%), Positives = 219/428 (51%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDI-------------NKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           N   Y  +   +++  ++D+ + I V+N F+       Y  +  E     +   + +   T++EK++             N     I++ PK  ++NP     + F  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+ +  ++L+P  N+ Y+ TE F   +  +I +    +E F+  +   D+LL+DDIQF+ +KE   E FF+ FN L+   K +V+ SD+ P  +  + DR++SRF+ GL   I  PD E+   I+ +  +   I+ P     IE+IA  + S+IR LEG L +   ++  +  P   +N E I  ++    +       + I+P+III  +   + +  + + S  R ++ S  R++ MY++R+  +LS   IG  F  ++H TVL +   +    K D +L   L  +  +
  S:    21 NSTAYETWFASATVQTVQDDCLIIQVENTFIVNHLRKTYYPLIMEEVEGVVGYPVEIKLTTEQEKNLRLIDKNNENLTHKNATNKLIQDSPKLSQLNPN----YNFSRFVVGPTNRMA-HAASLAVSESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLELYPNANVFYVSTEQFTNDLIASIRQ--DSMEFFREHYRTADILLVDDIQFIEDKEYTQEEFFHTFNTLHEAGKQVVIASDRPPQRIPTLQDRLVSRFSMGLIADIQVPDWETRMAILQKKAEYENIRLPRD--VIEYIATNYTSNIRELEGALIRTVTYISISGLP---MNVENIAPVLNPPMEQ------ITISPEIIITIVAENFHLSVEDLKSSSRRREISLARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVLYSCDKISKLQKKDWELSQQLSTLSDR 446
>gi|188584643|ref|YP_001916188.1| chromosomal replication initiator protein DnaA [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349330|gb|ACB83600.1| chromosomal replication initiator protein DnaA [Natranaerobius thermophilus JW/NM-WN-LF] (453 aa)
Score = 435, Expect = 7.2e-41, Identities = 131/433 (30%), Positives = 225/433 (51%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEK---------DINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLE-GVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +E++++    +F   +   +   ++   ++YI V N+F K+   + YK   E          L + F+   EK         +  K   T ++  +  E    L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +   P   ++YI +E F  +   AI +   K   F+N + NVD+LL+DDIQFL  KE+  E FF+ FN L+  +K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+  +I I   K    K    N  I +IA + +++IR LE G++  I +  + N    +   EE ++ I+ +    ++    +Q       +++   +G+    + +KKR +  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A   + + +K +  L   +D I
  S:    14 EELKQQLSKPSF-ETWFQSTEPVEMSSTDLYISVPNEFTKDWLNSRYKNSIENSLKKISGKQLKIKFLLPGEKIKMEEQNNENEEKPESTSKKSSQGSEHTTWLNPKYTFDTFVIGNANRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVLSHQPNYRVVYISSEKFTNEFINAIRD--NKTVNFRNKYRNVDILLVDDIQFLAGKEQTQEEFFHTFNTLHENDKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQAPDLET--RIAILRKKAYLEKLDIPNDVIVYIANQIDTNIRELEGGLIRVIAYSSMANKKITKETAEEALKDILPNKQPKKMTVEHIQ-------KTVAQYFGLKVDDLKAKKRTRSVAFPRQIAMYLARELTDSSLPKIGDEFGGRDHTTVMHAHDKIASDLKKESHLNETIDEI 446
>gi|187479881|ref|YP_787906.1| chromosomal replication initiator protein [Bordetella avium 197N] >gi|123765885|sp|Q2KTI9|DNAA_BORA1 Chromosomal replication initiator protein dnaA >gi|115424468|emb|CAJ51022.1| chromosomal replication initiator protein [Bordetella avium 197N] (483 aa)
Score = 435, Expect = 7.3e-41, Identities = 112/322 (34%), Positives = 176/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLD--NVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L++  TFEN+  G  N+ A +AA+L + EN   ++  L +YG  GLGKTHL+HA+GN  V       + Y+  + ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  + ++ K I++TSD  P  L  ID R+ISRF+SGL++ I  P+ E    I++   +   +  P       FIA    S++R LEG L K+     FH  +  NVD    + +E ++ ++        VSN  QI  + I +++   Y +    + SK+R    +  R+V MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   147 LNTDLTFENFVTGKANQLA-RAAALQVAENPGTSYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHADQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEAMVAQRKQIIITSDTYPKELSGIDSRLISRFDSGLTVAIEPPELEMRVAILLRKAESEGV--PMPEEVAFFIAKHLRSNVRELEGALRKVLAYARFHGREALNVD----VCKEALKDLLS-------VSN-GQITVENIQKTVADFYKIKVADMYSKRRPANIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVLHAVRKI 460
>gi|160914813|ref|ZP_02077027.1| hypothetical protein EUBDOL_00820 [Eubacterium dolichum DSM 3991] >gi|158433353|gb|EDP11642.1| hypothetical protein EUBDOL_00820 [Eubacterium dolichum DSM 3991] (459 aa)
Score = 435, Expect = 7.6e-41, Identities = 138/414 (33%), Positives = 236/414 (57%)
  Q:    35 SSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD---INKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKA---ASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFH-LLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           S +F I+D+   I V     K++ ++ YK++ +E  SI +   +    + K+E D   INK+           +INP     +TF+++ +G  N+ A  A   A  +  + NN   L I+G++GLGKTHLLHA+GN   +  P+  ++YI +EDF+  + +A+      VEE K    + D LLIDDIQ L       E+FFN++N+L   NK IV+TSD  PT LK I++R+ISRF+SGLS+ +  P+ E+ K I+ + I+    +    +  ++++A RF SD+R LEG LN+++F  +L N D  ++    K    I  ++   + ++ + +N   I +++C  YG+ K  + SK R K  +  R + +Y+ R+ +++ + +IG  F NR+H+T++ + + +   +K  E  +  L  I
  S:    46 SQLFDIRDDLAIITVPYKVNKQIISDLYKDLIKEKLSIVLEHEVECQILLKKEVDSEYINKDALRRSNILFEDKINP----EYTFDSFVVGKNNREAHAASLSACYYPGKFNN--PLFIFGNSGLGKTHLLHAIGNYIKENRPEDKVLYIYSEDFVTLLIEAMKN--KNVEEVKEKICSADYLLIDDIQRLKQSTS-QELFFNMYNKLIRDNKQIVITSDIHPTELKGIENRLISRFSSGLSVSVGSPEFETAKAILQKKIEGRNEEILIEDEVLDYLATRFASDVRKLEGALNELFFKSILYNPDTIDL----KFAKEIFKENPMTVTNDELSVNK--IKKAVCDFYGLTKTQIESKSRTKNIANARHIAVYLCRKHLDMPFAKIGLEFGNRDHSTIMSSYEKMVKLLKDKEQFQQALQQI 452
>gi|86738725|ref|YP_479125.1| chromosomal replication initiator protein DnaA [Frankia sp. CcI3] >gi|86565587|gb|ABD09396.1| chromosomal replication initiator protein DnaA [Frankia sp. CcI3] (562 aa)
Score = 434, Expect = 8.0e-41, Identities = 111/334 (33%), Positives = 178/334 (53%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAF---KAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLG----YGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           E +P    +NP    R+ FE + IG  + N F    A ++       +  L IYG +GLGKTHLLHA+G+  ++L+P   + Y+ +E+F      +I +   + + F+  + ++D+LL+DDIQFL NKE+  E FF+ FN L+   K IV++SD+ P  L  ++DR+ SRF  GL   I  PD E+  +I I + K +  + P     +E+IA     +IR LEG L ++  F  L+    +  + E  +R +I               NPDI   +I       +GV  + +    R++     R++ MY+ RE  +LS  +IG  F  R+H TV+ A + +
  S:   213 ETEPAQARLNP----RYIFETFVIG--DSNRFPHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIGHYALKLYPNMRVKYVSSEEFTNDFINSIRD--DRQQAFQRRYRDIDVLLVDDIQFLENKERTQEEFFHTFNVLHDGEKQIVISSDRSPKQLSALEDRLRSRFEWGLMTDITPPDLET--RIAILSKKAATERLPVPPDVLEYIATHIERNIRELEGALIRVAAFASLNKSHVDRTLAEIVLRDLIPDAG-----------NPDITAAAIMNATAAYFGVSMEDLCGTSRSRVLVTARQIAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKI 534
>gi|78184461|ref|YP_376896.1| chromosomal replication initiation protein [Synechococcus sp. CC9902] >gi|123729943|sp|Q3AYH5|DNAA_SYNS9 Chromosomal replication initiator protein dnaA >gi|78168755|gb|ABB25852.1| chromosomal replication initiator protein DnaA [Synechococcus sp. CC9902] (462 aa)
Score = 434, Expect = 8.4e-41, Identities = 103/334 (30%), Positives = 179/334 (53%)
  Q:   108 PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   + +AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + +V+ SD+ P+ + ++  R+ISRF  GL   I  PD E+   I+ +  ++ R+  P     I++IA RF S+IR LEG L + + F  +  +     +  E +  +++           V ++P  +IE +   + V  + + S  R +  S  R+V MY++R+  +LS   IG  F  ++H TV+ AI+ +E K+ SD  L
  S:   121 PALNPRYVFGRFVVGQNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPGARVAYVSTETFTNDLIQAIRKDG--MQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQVVIASDRPPSQIPRLQQRLISRFQMGLIADIQSPDLETRMAILQKKAEQERMALPRD--LIQYIAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDP------TGQGVAVSPQQVIEKVSEVFDVTAEEMCSSTRRRAVSQARQVGMYLMRQGTDLSLPRIGDTFGGKDHTTVMYAIEQIEKKLASDPKL 443
>gi|244439|gb|AAB21305.1| DnaA protein [Mycoplasma capricolum, Peptide, 450 aa] (450 aa)
Score = 434, Expect = 8.6e-41, Identities = 145/428 (33%), Positives = 229/428 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDF-------VKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSI-IESDSDYEI-VSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +E+ YN+Y+   +I+K    N  ++VK+ F        +    NE K+I ++  +I            ++ + INK+   I  K K  ++N       TFEN+ IG  N+ AF A     +    ++  L IYG +G+GKTHLL A  N     F    + Y+  ++F  K    + +   ++E+FKN     D+L+IDD+QFL+ KEK NEIFF IFN     +K +  +SDK P  L   D+R+I+RFN GLSI I K D ++   II + IK   IK   +N AI FI+  ++ D+R ++G ++++ F    N        EEK+ +I I SD   +I  S L  +N   I E +   YG+   ++  K R+K     R + MY+ +E +N +  +IG  F  R+H TV+ A + +E  +K D+ LK  +D + +K
  S:    21 DESVYNDYIKTINIYKKDLSNYVVVVKSQFGLLAIKQFRPTIENEIKKILKQPVNISFTYEQEYQKQLEKTESINKDHSDIISK-KNKKVNEN-----TFENFVIGSSNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNEVCQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIENDKQLFFSSDKSPELLNGFDNRIITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKTEVTNEAINFISNYYSDDVRKIKGSVSRLNFWSQQN-------PEEKVITIEIISDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMYLTKEILNHTLAQIGEEFGGRDHTTVINAERKIEMMLKKDKQLKKTVDILKNK 446
>gi|163790919|ref|ZP_02185342.1| chromosomal replication initiator protein DnaA [Carnobacterium sp. AT7] >gi|159873761|gb|EDP67842.1| chromosomal replication initiator protein DnaA [Carnobacterium sp. AT7] (358 aa)
Score = 434, Expect = 8.7e-41, Identities = 111/343 (32%), Positives = 189/343 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           L++++TF+ + IG  N+ A  AA +  EE    +  L  YG  GLGKTHL+HA+G++ + L P   + Y+ +E F      +I       E+F+N + +VDLLL+DDIQF  +KE   E FF+ FN L    K IV+TSD+LP  + K+ +R++SRF  GLS+ I  PD E+   I+ +     R++ P   L+  +IA + +S+IR LEG L ++  +  +++ D    +  + ++S++ S     +    +Q       +++   Y +    +  KKR K     R++ MY+ RE  + S  +IG+ F  ++H TV+ A + +   + SD+ LK  + ++  K 
  S:    23 LNTKYTFDTFVIGKGNQMAHAAALVVAEEPGTIYNPLFFYGGVGLGKTHLMHAIGHQMLLLNPDARVKYVSSETFANDFINSIQN--KTQEKFRNEYRSVDLLLVDDIQFFADKEGTQEEFFHTFNALYDDRKQIVLTSDRLPNEIPKLQERLVSRFAWGLSVDITPPDLETRIAILRKKANAERLEIPGDTLS--YIAGQIDSNIRELEGALVRVQAYAAIESRDITTSLAADALKSMLPSAKPTTLTILDIQ-------QAVSKYYQLSIADLKGKKRIKSIVLPRQIAMYLSRELTSNSLPKIGAEFGGKDHTTVIHAYEKIVHALTSDDQLKQEITDLKKKL 357
>gi|54307245|ref|YP_128265.1| chromosomal replication initiation protein [Photobacterium profundum SS9] >gi|61212603|sp|Q6LW50|DNAA_PHOPR Chromosomal replication initiator protein dnaA >gi|46911665|emb|CAG18463.1| Putative DnaA chromosomal replication initiator protein [Photobacterium profundum SS9] (474 aa)
Score = 434, Expect = 8.7e-41, Identities = 115/344 (33%), Positives = 183/344 (53%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           +NP    +  F N+  G  N+    AA   + +N    +  L +YG TGLGKTHLLHAVGN      P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +   I+ P  +    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   139 VNP----KHNFNNFVEGKSNQLGL-AACRQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIADRKPNARVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPREINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAENHNIRLP--DEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMSDMLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIVQLREESHDIKEDYSNLI 469
>gi|119025019|ref|YP_908864.1| chromosomal replication initiator protein DnaA [Bifidobacterium adolescentis ATCC 15703] >gi|154486346|ref|ZP_02027753.1| hypothetical protein BIFADO_00155 [Bifidobacterium adolescentis L2-32] >gi|118764603|dbj|BAF38782.1| chromosomal replication initiator protein DnaA [Bifidobacterium adolescentis ATCC 15703] >gi|154084209|gb|EDN83254.1| hypothetical protein BIFADO_00155 [Bifidobacterium adolescentis L2-32] (499 aa)
Score = 434, Expect = 8.8e-41, Identities = 110/339 (32%), Positives = 188/339 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAIS---EGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKII--IENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           L+   TF+ +  G  N+ A   A    E   +++  L IYG +GLGKTHLL+A+GN  +   P   + Y+ +E+F  +  +A++   +   +++EF   +  VD+LLIDDIQFL+ K+   E FF+ FN L+  NK IV+ SD  P  L+  ++R+ISRF SGL++ +  PD E+   I+  I  +  S I N   NL    IA RF  +IR LEG LN++     L N    + + E+ ++    +D         V+I P  II  +   + +    ++ + R K+ +  R++ MY++RE  ++S N+IG  F  ++H TV+ A   +  +++  +++  ++  +
  S:   155 LNKNATFDTFVPGDSNRFARTVALAVAEGSGHDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPNLKVRYVTSEEFTNEFIEALADTNQSSGQIKEFNRRYREVDVLLIDDIQFLSGKDATLEQFFHTFNTLHQANKRIVIASDVPPKDLQGFNERLISRFESGLTVDVKPPDLETRIAILRMIATMNGSNIPNDVFNL----IAERFTENIRELEGALNRVTAMASLSNQPVTKALAEQTLQDFFTTD---------VEIKPADIITQVAKYFYLTFDDIVGRSRTKKIALARQIAMYLVRELTSMSLNDIGLVFGGKDHTTVMHAYTRINDEMQEKQEIYNYVTEL 488
>gi|33591700|ref|NP_879344.1| chromosomal replication initiation protein [Bordetella pertussis Tohama I] >gi|33598884|ref|NP_886527.1| chromosomal replication initiation protein [Bordetella parapertussis 12822] >gi|61212733|sp|Q7VSE0|DNAA_BORPE Chromosomal replication initiator protein dnaA >gi|61212736|sp|Q7W2K5|DNAA_BORPA Chromosomal replication initiator protein dnaA >gi|33571343|emb|CAE44820.1| chromosomal replication initiator protein [Bordetella pertussis Tohama I] >gi|33575014|emb|CAE39680.1| chromosomal replication initiator protein [Bordetella parapertussis] (469 aa)
Score = 434, Expect = 9.0e-41, Identities = 110/322 (34%), Positives = 175/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L++  TFEN+  G  N+ A +AA+L + EN   ++  L +YG  GLGKTHL+HA+GN  V       + Y+  + ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  + ++ K I++TSD  P  L  ID R+ISRF+SGL++ I  P+ E    I++   +   +  P       FIA    S++R LEG L K+     FH  D +  +  + +E ++ ++        VSN  QI  + I +++   Y +    + SK+R    +  R+V MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   133 LNTDLTFENFVTGKANQLA-RAAALQVAENPGTSYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHADQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEAMVAQRKQIIITSDTYPKELSGIDSRLISRFDSGLTVAIEPPELEMRVAILLRKAESEGV--PMPEEVAFFIAKHLRSNVRELEGALRKVLAYARFHGRDVLTVD--VCKEALKDLLS-------VSN-GQITVENIQKTVADFYKIKVADMYSKRRPANIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVLHAVRKI 446
>gi|116070875|ref|ZP_01468144.1| chromosomal replication initiation protein [Synechococcus sp. BL107] >gi|116066280|gb|EAU72037.1| chromosomal replication initiation protein [Synechococcus sp. BL107] (474 aa)
Score = 434, Expect = 9.3e-41, Identities = 103/341 (30%), Positives = 180/341 (52%)
  Q:   108 PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   + +AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + +V+ SD+ P+ + ++  R+ISRF  GL   I  PD E+   I+ +  ++ R+  P     I++IA RF S+IR LEG L + + F  +  +     +  E +  +++           V ++P  +IE +   + V    + S  R +  S  R+V MY++R+  +LS   IG  F  ++H TV+ AI+ +E K+ SD  L   +  +
  S:   133 PGLNPRYVFGRFVVGQNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPGARVAYVSTETFTNDLIQAIRKDG--MQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQVVIASDRPPSQIPRLQQRLISRFQMGLIADIQSPDLETRMAILQKKAEQERMALPRD--LIQYIAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDP------TGQGVAVSPQQVIEKVSEVFDVTADEMCSSTRRRAVSQARQVGMYLMRQGTDLSLPRIGDTFGGKDHTTVMYAIEQIEKKLASDPKLAGLVQKV 462
>gi|89898823|ref|YP_521294.1| chromosomal replication initiator protein DnaA [Rhodoferax ferrireducens T118] >gi|89343560|gb|ABD67763.1| chromosomal replication initiator protein DnaA [Rhodoferax ferrireducens T118] (470 aa)
Score = 434, Expect = 9.4e-41, Identities = 105/290 (36%), Positives = 159/290 (54%)
  Q:   142 WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           +  L IYG  GLGKTHL+HAVGN+ +   P   ++YI  E F+  + KA        +EFK  + ++DLLLIDD+QF  NKE+  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I   +   I  P   +A  F+A    S++R LEG L KI  +   +  D + ++  E +R ++   +         QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   168 YNPLFIYGGVGLGKTHLMHAVGNRLLADQPNAKVLYIHAEQFVSDVVKAYQR--KTFDEFKERYHSLDLLLIDDVQFFANKERTQEEFFNAFEALLAKKSHIVMTSDTYPKGLTDIHERLVSRFDSGLTVAIEPPELEMRVAILINKARVEGIVMP-EEVAF-FVAKNVRSNVRELEGALRKILAYSRFNQKDISILLAREALRDLLSIQNR--------QISVENIQKTVADYYKIKIADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 447
>gi|186902731|ref|ZP_02975673.1| chromosomal replication initiator protein DnaA [Cyanothece sp. PCC 7424] >gi|186690349|gb|EDU14983.1| chromosomal replication initiator protein DnaA [Cyanothece sp. PCC 7424] (453 aa)
Score = 434, Expect = 9.7e-41, Identities = 116/424 (27%), Positives = 217/424 (51%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKE--------EKDINKELPTIE-EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL--------LDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ++ ++  + I ++  + + I   N F+       Y +I  +     +  ++++   + +        E  ++   PT+  E PK +++NP    ++TF  + +G  N+ A  AA+L + E+    +  L + G  GLGKTHL+ A+ +  +Q++P   + Y+ TE F   +  AI +    ++ F+  +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  ++DR+ISRF+ GL   I  PD E+   I+ +  +   ++ P     IE+IA  + S+IR LEG L +   ++        ++N+ P  ++N    R                ++ P++I+  I   Y V  + +    R ++ S  R++ MY++R+  +LS   IG  F  ++H TV+ +   +    K D DL   L  +  +
  S:    25 FDTWIGTAKIEQLTPQYLVICAANPFILNHLQKNYLQIIADVVEEILGYSIDIQLTSTQGENIAIVGETQVSAYYPTLSGEHPKPIKLNP----KYTFSRFVVGSNNRLA-HAATLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLQMYPDSKVFYVSTEQFTNDLITAIRQ--DSLQSFREHYRTADILLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPKQIPTLEDRLISRFSMGLIADIQVPDLETRMAILQKKAEYENMRLPRE--VIEYIATHYTSNIRELEGALIRAITYISISGLSMTVENLAP--VLNPPVERG---------------EVTPELILNIIAETYKVSVEDLKGNSRRREISLARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVMYSYDKINQLQKKDLDLSQTLSQLSDR 442
>gi|33603963|ref|NP_891523.1| chromosomal replication initiation protein [Bordetella bronchiseptica RB50] >gi|61212740|sp|Q7WDJ9|DNAA_BORBR Chromosomal replication initiator protein dnaA >gi|33568939|emb|CAE35353.1| chromosomal replication initiator protein [Bordetella bronchiseptica RB50] (480 aa)
Score = 433, Expect = 1.0e-40, Identities = 110/322 (34%), Positives = 175/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L++  TFEN+  G  N+ A +AA+L + EN   ++  L +YG  GLGKTHL+HA+GN  V       + Y+  + ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  + ++ K I++TSD  P  L  ID R+ISRF+SGL++ I  P+ E    I++   +   +  P       FIA    S++R LEG L K+     FH  D +  +  + +E ++ ++        VSN  QI  + I +++   Y +    + SK+R    +  R+V MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   144 LNTDLTFENFVTGKANQLA-RAAALQVAENPGTSYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHADQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEAMVAQRKQIIITSDTYPKELSGIDSRLISRFDSGLTVAIEPPELEMRVAILLRKAESEGV--PMPEEVAFFIAKHLRSNVRELEGALRKVLAYARFHGRDVLTVD--VCKEALKDLLS-------VSN-GQITVENIQKTVADFYKIKVADMYSKRRPANIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVLHAVRKI 457
>gi|108802857|ref|YP_642794.1| chromosomal replication initiator protein DnaA [Rubrobacter xylanophilus DSM 9941] >gi|108764100|gb|ABG02982.1| chromosomal replication initiator protein DnaA [Rubrobacter xylanophilus DSM 9941] (450 aa)
Score = 433, Expect = 1.0e-40, Identities = 125/402 (31%), Positives = 208/402 (51%)
  Q:    39 KIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFIT--KEEKDINKELPTIE---EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDED 440
           ++ ++ + I V N F KE   + ++ + EE     +        ++   + +   +E  + E   E   +     +L +++TF+++ IG  N+ A  AA    E     +  L IYG  GLGKTHLL AVG+      P   + Y+  E F      ++ +      EF+  +   D+LLIDDIQFL NK +  E FF+ FN L  +NK IV+ SD+ P  L+ +++R++SRF  GL   I  PD E+   I+ +     R++    +  + FIA + +++IR LEG L +I  +  L        + EE +R I+  DSDY       +I  ++I   +C  +G+ K+ ++   R+K F++ R+V MY+ RE  + S  +IG  F  R+H+TV+ A   +   + SD D
  S:    36 QLYEDGLEISVPNTFAKEYIESRFRPLLEEALDGVLGQEETSIIVSVGGQGRRAGREETSAETGAESVLSARTPRSLKAKYTFDSFVIGAGNRFAHAAALAVAENPGVVYNPLFIYGGVGLGKTHLLRAVGHYVEDQDPTMRVRYVTCEQFTNDFINSMRDNAPL--EFQKRYRENDVLLIDDIQFLENKVETQEAFFHTFNALYEENKQIVIASDRHPKYLQTLENRLVSRFEWGLVTDIQPPDLETRIAILRKKAMMDRLE--VDDEVLTFIASKVSTNIRELEGALVRILAYASLYGRQVTVALAEEVLRDIL-PDSDYR------EIPIELIQHEVCRYFGISKEDLVGTSRSKAFAYPRQVAMYLSRELTDESLPKIGKAFGGRDHSTVMHATNKIANLINSDRD 434
>gi|167751447|ref|ZP_02423574.1| hypothetical protein EUBSIR_02443 [Eubacterium siraeum DSM 15702] >gi|167655693|gb|EDR99822.1| hypothetical protein EUBSIR_02443 [Eubacterium siraeum DSM 15702] (467 aa)
Score = 432, Expect = 1.4e-40, Identities = 134/415 (32%), Positives = 225/415 (54%)
  Q:    38 FKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKEL-----PTIEEKPKTLEI-------------NPTLDSRF--TFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
            K+ + +V + V++ F K++    +K + EE FS  +  ++ V  +  E+  + ++L        +  PK L+              N  L S +  TF+ + +G  NK A+ A    ++E +  +  L IY   GLGKTHLL AV ++  +L P  N++Y   + F +  Y +     + +E FK  + + DLLLIDDIQF+ NK +  +  F+ FN L ++NK I+ TSD+ P  L  I+ R+ISRF  GL   I  P+ E+   II    +   +  P S   ++F+A +  ++IR LEG + KI    L+    P   + ++ +R I    S++E +   V+     II  +   Y V  + + S+KR+ Q S  R+V +YV+     LSY+ IG  F NR+H+T++ AI  V++ +K D   K  +D+++   
  S:    36 LKLNNNHVMLYVESQFSKDMTMANFKTVMEEAFSDLLGFDVEVEILCSEDLTVEQKLKYGIESYADSSPKELQKELDDDDIVKTRLKNSELASNYQHTFDTFIVGDNNKLAYAACKAVVQEPSTRYNPLYIYSEPGLGKTHLLSAVKSEMEKLHPDMNIIYTTADTFTDD-YVSNLRTKSNLEAFKQKYRSCDLLLIDDIQFMANKSETQQELFHTFNSLYNQNKQIIFTSDRPPKELNGIEQRLISRFEQGLLADIAPPEYETRIAIIKRKAELYGMNLPDS--IVDFLADKLKTNIRQLEGAITKINALTLVTGSTPTLNMAQQVVRDI---QSNHEPIPLTVEK----IIAEVGKIYSVTPEDMRSQKRSSQISTARQVAIYVVNRITGLSYSNIGVEFGNRDHSTIVYAINKVKSTIKKDPTFKGMVDDMIKNL 463
>gi|192359033|ref|YP_001980525.1| chromosomal replication initiator protein DnaA [Cellvibrio japonicus Ueda107] >gi|190685198|gb|ACE82876.1| chromosomal replication initiator protein DnaA [Cellvibrio japonicus Ueda107] (534 aa)
Score = 432, Expect = 1.6e-40, Identities = 108/340 (31%), Positives = 178/340 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+S  TF  +  G  N+    AA    E     +  L IYG  GLGKTHL+ AVGN  V   P   ++Y+ +E F+  + KA+      + +FK  + ++D LLIDDIQF   KE+  E FF+ FN L    + I++T D+ P  +  +++R+ SRF  GL++ +  P+ E+   I+I+  +++ I  P    A  FIA R  +++R LEG L ++   +         I+ E +R   E+  D   + +  Q+  D I   +C  Y +    +ISK+R++  +  R+V M + +E  N S  EIG  F  R+H TVL A + ++   +   D++  + N++
  S:   199 LNSACTFATFVEGKSNQLGLAAARQVAENPGGAYNPLFIYGGVGLGKTHLMQAVGNAMVARNPNAKVVYLHSERFVADMVKALQLNA--INDFKRYYRSMDALLIDDIQFFAGKERSQEEFFHTFNSLLEGGRQIILTCDRFPKEINGLEERLKSRFGWGLTVAVEPPELETRVAILIKKAEQANIDLPHE--AAFFIAQRIRANVRDLEGALKRV---IASANFTGRSIDVELVR---EALKDLLALQD-KQVGIDNIQRVVCEYYKIKMNDMISKRRSRSVARPRQVAMALAKELTNHSLPEIGEAFGGRDHTTVLHACRKIKELQEETADIREDMKNLL 529
>gi|145619092|ref|ZP_01775145.1| chromosomal replication initiator protein DnaA [Geobacter bemidjiensis Bem] >gi|144944585|gb|EDJ79657.1| chromosomal replication initiator protein DnaA [Geobacter bemidjiensis Bem] >gi|197085763|gb|ACH37034.1| chromosomal replication initiator protein DnaA [Geobacter bemidjiensis Bem] (458 aa)
Score = 432, Expect = 1.6e-40, Identities = 130/433 (30%), Positives = 228/433 (52%)
  Q:    20 KEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD--INKELPTIEEKP------------------KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K+   E  Y+ ++          + + + V + F ++  T++Y  + +E  S     +  + F   EEK    ++  P  E KP                  +  E+ P L+ ++TFE++  G  N+ A+ A+     +   N+  L IYG  GLGKTHL++A+GN  +   P+  + Y  +E F+ ++  ++     K++EF+N F  +DLLLIDDIQF+  KE   E FF+ FN L   +K IV+TSDK P  +  +++R+ SRF  GL   I  P  E+   I+ +      +  P  ++A+ F+A   NS+IR LEG+L ++  F  L   +    +  E ++ I        IV     I  ++I +++   + +    + S KR K     R++ +Y+ RE    SY EIG  F  ++H+T++ ++K +E ++  D++ KA +++I  K 
  S:    13 KQVLTEQTYSTWIDPLKFLGATVDTIVLEVPSSFFQKWVTDKYLAMIKEAISAVNGKSYQIEFHVAEEKPEAAHEAKPEKEAKPAREKERDKDKEKEKDREKEKKELVPNLNPKYTFESFVSGPSNQFAYAASQAVANKPATNYNPLFIYGGVGLGKTHLVNAIGNHILAKNPKAKICYYSSEKFMNEMINSLRY--KKMDEFRNKFRKMDLLLIDDIQFMAGKEATQEEFFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQPPGVETKVAILKKKSDMHAVNLP-DDVAL-FLAEGANSNIRELEGMLIRLEAFASLTGQEITLSMAREVMKDI--------IVEKTRDITVEMIQKTVAEHFRIKVSELKSDKRIKTLVVPRQIAIYICRELTKASYPEIGEKFGGKDHSTIIHSVKKIEKQIAGDDEFKATVEDIRKKL 456
>gi|193211677|ref|YP_001997630.1| chromosomal replication initiator protein DnaA [Chlorobaculum parvum NCIB 8327] >gi|193085154|gb|ACF10430.1| chromosomal replication initiator protein DnaA [Chlorobaculum parvum NCIB 8327] (493 aa)
Score = 431, Expect = 1.7e-40, Identities = 114/367 (31%), Positives = 194/367 (52%)
  Q:    85 KEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           + ++ ++ E    E      E N  L+ ++TF     G  N  AF AA    +    N +  L+IYG  GLGKTH++ A+GN  ++      ++Y+ +E F      AI  G   ++EF   + N+D+L+IDDIQF   KEK  E  F+IFN L+  NK I++++D+    +K I+DR+ISRFN GLS  I  PD E+ K II   +K++ +        IEFIA    +++R LEG + K+   H LDN + +    +  ++ II          N  Q+  + I +++C  + +    +  K + K+ +  R++ MY+ ++  + S   IG  F  R+H+TV+ A+  +E K+ S  + +  ++ +  +
  S:   131 RAQEPVSAERERFERNRTKFESN--LNPKYTFSTLIRGDCNSLAFAAAKSIAQNPGQNAFNPLVIYGGVGLGKTHMMQAIGNSVLENRISGAVLYVSSEKFAIDFVNAIQNG--NIQEFSAFYRNIDVLIIDDIQFFAGKEKTQEEIFHIFNTLHQANKQIILSADRPIKEIKGIEDRLISRFNWGLSTDIQAPDYETRKAIIQSKLKQNGVN--LDPAVIEFIATNVTNNVRELEGCIVKLLAAHSLDNQEIDLQFTKSTLKDIIR--------YNTKQLTLETIEKAVCSFFSITPNDLKGKSKKKEIAVGRQIAMYLSKDMTDSSLKTIGLHFGGRDHSTVIHALNTIEKKITSSNEERKKIEELKKR 487
>gi|90413732|ref|ZP_01221720.1| chromosomal replication initiation protein [Photobacterium profundum 3TCK] >gi|90325201|gb|EAS41698.1| chromosomal replication initiation protein [Photobacterium profundum 3TCK] (474 aa)
Score = 431, Expect = 1.8e-40, Identities = 113/340 (33%), Positives = 182/340 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++ +  F N+  G  N+    AA   + +N    +  L +YG TGLGKTHLLHAVGN      P   ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL++ I  P+ E+   I+++  +   I+ P  +    FIA R  S++R LEG LN++            I N       I  D   E + +L+ +       D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   139 VNPKHNFNNFVEGKSNQLGL-AACRQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIADRKPNARVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPREINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAENHNIRLP--DEVAFFIAKRLRSNVRELEGALNRV------------IANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMSDMLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIVQLREESHDIKEDYSNLI 469
>gi|33240018|ref|NP_874960.1| chromosomal replication initiation protein [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|37154736|sp|Q51896|DNAA_PROMA Chromosomal replication initiator protein dnaA >gi|33237544|gb|AAP99612.1| ATPase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (461 aa)
Score = 431, Expect = 1.8e-40, Identities = 119/421 (28%), Positives = 213/421 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKE-------LPTIEEKPKTLEIN-----------PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           Y  ++  +     K+  + ++  N F      N Y +  +E         + V    K   + + E        P +E  P +++ +           P L+ R+ F  + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI +   +++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+     IV+ SD+ P+ + ++ +R++SRF+ GL   +  PD E+   I+ +  ++ R+  P     I+FIA RF S+IR LEG L + I F  +  +     +  + I  +++ +         V++ P  +++ +   + V    + S  R +  S  R+V MY++R+  NLS   IG  F  ++H TV+ AI+ VE K+ SD  + + +  I
  S:    22 YETWIRPTEFSGFKNGELTLIAPNSFSSAWLKNNYSQTIQETAEEIFGEPVTVHVKVKANAESSDEHYSSAPITPPLEASPGSVDSSGSSLRLSKKTLPLLNLRYVFNRFVVGPNSRMAHAAAMAVAESPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPGAKVSYVSTETFTNDLILAIRQ--DRMQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHDAGSQIVLASDRPPSQIPRLQERLMSRFSMGLIADVQAPDLETRMAILQKKAEQERVGLPRD--LIQFIAGRFTSNIRELEGALTRAIAFASITGLP----MTVDSIAPMLDPNGQG------VEVTPKQVLDKVAEVFKVTPDEMRSASRRRPVSQARQVGMYLMRQGTNLSLPRIGDTFGGKDHTTVMYAIEQVEKKLSSDPQIASQVQKI 449
>gi|83749733|ref|ZP_00946710.1| DnaA [Ralstonia solanacearum UW551] >gi|83723585|gb|EAP70786.1| DnaA [Ralstonia solanacearum UW551] (531 aa)
Score = 431, Expect = 2.0e-40, Identities = 116/346 (33%), Positives = 181/346 (52%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           T+ E+ +   +NP L    TF+N   G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN  +   P+  + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I+++  +   +  P   +A  F+A    S++R LEG L KI  +   N    EI     I    E+  D   V N  QI+ + I ++    Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 TVHERSR---LNPIL----TFDNLVTGKANQLA-RAAAVQVANNPGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQR--KAFDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVP-EEVAF-FVAKHLRSNVRELEGALRKILAY--SNFHGKEI----TIEVTREALKDLLTVQNR-QISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 518
>gi|187603409|ref|ZP_02989621.1| chromosomal replication initiator protein DnaA [Exiguobacterium sp. AT1b] >gi|187484184|gb|EDU22176.1| chromosomal replication initiator protein DnaA [Exiguobacterium sp. AT1b] (459 aa)
Score = 431, Expect = 2.1e-40, Identities = 133/400 (33%), Positives = 216/400 (54%)
  Q:    43 ENVYILVKNDFVKEVFTNEYKEIFEE------YFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDN-VDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           E  Y+ +  D V+E+  N+ +  F E      Y     +SN ++     +E+ +   LP+ EE          L+ ++ FE + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+      P   + Y+ +E F  +   +I +   K  EF+N + N+D+LLIDDIQFL  KE+  E FF+ FN L++  K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+  +I I   K +      SN  + +IA + +++IR LEG L ++  Y  L+   +DP+  +  E + +I+      +IV   +Q       E +   + +  + + SKKR K  +F R++ MY+ RE    S  +IG  F  R+H TV+ A + + T +K+D +++
  S:    57 ERQYLSLLQDTVEEITNNKLEIHFIEESQAHKYAPADGSSNESIAVTETKEQPV--LLPSKEEGDLG-----QLNDKYIFETFVIGSGNRFA-HAASLAVAEAPARAYNPLFIYGGVGLGKTHLMHAIGHYVKGQKPGARIAYVSSEKFTNEFINSIRD--NKTGEFRNRYRNIDVLLIDDIQFLAGKEQTQEEFFHTFNALHNDQKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLET--RIAILRKKATAEGLDISNEVMLYIANQIDTNIRELEGALTRVVAYAKLVGRPIDPD--VAAEALHNIMPVQEAKKIVIRDIQ-------EVVGQHFNIQVEELNSKKRTKTLAFPRQIAMYLSREMTESSLPKIGEEFGGRDHTTVIHAHEKISTLLKNDVEMQ 447
>gi|121606999|ref|YP_984328.1| chromosomal replication initiator protein DnaA [Polaromonas naphthalenivorans CJ2] >gi|120595968|gb|ABM39407.1| chromosomal replication initiator protein DnaA [Polaromonas naphthalenivorans CJ2] (465 aa)
Score = 431, Expect = 2.1e-40, Identities = 111/320 (34%), Positives = 172/320 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIK 429
           L+S  TF+    G  N+   +AA+L +  +    +  L IYG  GLGKTHL+HA+GNK +   P   ++YI  E F+  + KA        ++FK  + ++DLLLIDD+QFL NK++  E FFN F  L +K  +IVMTSD  P  L  I +R++SRF+SGL++ I  P+ E    I+I          P   +A  F+A    S++R LEG L KI  +    + + +  +  E +R ++   +         QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++
  S:   130 LNSALTFDTLIEGTANRMG-RAAALHVASSLGQLYNPLFIYGGVGLGKTHLMHAIGNKLMADNPAAKVLYIHAEQFVSDVVKAYQR--KTFDDFKERYHSLDLLLIDDVQFLANKDRTQEEFFNAFEALLTKKSHIVMTSDTYPKGLADIHERLVSRFDSGLTVAIEPPELEMRVAILIRKADADGAVLP-EEVAF-FVAKNVRSNVRELEGALRKIQAYSRFSHKEISIQLAREALRDLLSIQNR--------QISVENIQKTVANYYKIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVR 440
>gi|68535063|ref|YP_249768.1| chromosomal replication initiator protein [Corynebacterium jeikeium K411] >gi|123775787|sp|Q4JYF7|DNAA_CORJK Chromosomal replication initiator protein dnaA >gi|68262662|emb|CAI36150.1| chromosomal replication initiator protein [Corynebacterium jeikeium K411] (583 aa)
Score = 431, Expect = 2.2e-40, Identities = 107/332 (32%), Positives = 179/332 (53%)
  Q:   110 LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEE-KIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           L+  +TFEN+ +G  N   A    ++       +  L I+G +GLGKTHLLHA+G+   +L P   + Y+ +E+       +I+      E FK  + N+D+L++DDIQFL NKE   E FF+ FN L+  NK IV++SD+ P  L  ++DR+ +RF  GL   +  PD E+   I+ +  +   ++ P  ++ +  IA R+   IR L+G L ++  +   + +P  +   E  +R I  +D D EIV       P  +IE +   + +    ++ K R K+F   R++ MY+ RE  +LS  ++GS F  R+H TV+ A + V   +  ++ +
  S:   243 LNKNYTFENFVVGSSNNFAAAACRAVAEAPAKAYNPLFIWGESGLGKTHLLHAIGHYAKELQPNMRVKYVSSEELTNDFINSIANDTR--ESFKRRYRNLDMLIVDDIQFLQNKESTQEEFFHTFNALHQANKQIVLSSDRPPRQLTTLEDRLRTRFEGGLITDVQTPDLETRIAILTKKAESDNVQLP-EDVKV-LIASRYEKSIRELDGALIRVTAYCALSHEPLTVETAEIALRDISPADQDVEIV-------PQHVIEVVANYFNLTTDELVGKGRAKKFVQARQIAMYLCRELTDLSLPKLGSAFGGRDHTTVMYAERRVRESLSENKKV 566
>gi|81299909|ref|YP_400117.1| chromosomal replication initiation protein [Synechococcus elongatus PCC 7942] >gi|81168790|gb|ABB57130.1| chromosomal replication initiator protein DnaA [Synechococcus elongatus PCC 7942] (482 aa)
Score = 430, Expect = 2.4e-40, Identities = 117/416 (28%), Positives = 208/416 (50%)
  Q:    33 LDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKEL-PTIEEKPKTLEINP-------------TLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIYFH--------LLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
            D  + ++   N +     +++++ +     ++  E     +   + V   T  E +   EL P I   P    + P              L+ ++ F  + +G  N+ A  AASL + E     +  L + G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI      ++ F+  +   D++++DDIQF+  KE   E FF  FN L+   K IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+    KKS  +N P     IE+IA R+ S+IR LEG L +   +         L N+ P      EK+                 +++P++I++++   + V  + +    R ++ S  R+V MY++R+  +LS  +IG  F  ++H TV+ + + +    +SD  +   L  I
  S:    57 FDGKVLRLSTPNPF---ARNWLQKYYLRTIADVAAEILGHGIELQIGVLSDTSAEPESGAELWPAISPPPAVEVVKPPTTTAGRPPLRSSDLNPKYVFSRFVVGANNRMA-HAASLAIAEYPGREYNPLFLCGGVGLGKTHLMQAIGHYRLEIDPDAKIFYVSTEQFTNDLIAAIRR--DSMQSFREHYRAADVIMVDDIQFIEGKEYTQEEFFYTFNSLHEAGKQIVLASDRPPSQIPRLQERLISRFSMGLIADIQPPDFETRVAIL---QKKSEFENMPLPRDVIEYIAARYTSNIRELEGALTRAVAYASISGLALTLANIAPVLTPPTEKM-----------------ELSPEMILQTVAETFDVSIEDLRGNSRRREVSLARQVGMYLMRQHTDLSLPKIGEQFGGKDHTTVMYSCEKIGQLRQSDPQMGKQLQEI 472
>gi|33863457|ref|NP_895017.1| chromosomal replication initiation protein [Prochlorococcus marinus str. MIT 9313] >gi|61212718|sp|Q7V6H4|DNAA_PROMM Chromosomal replication initiator protein dnaA >gi|33640906|emb|CAE21362.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus str. MIT 9313] (465 aa)
Score = 430, Expect = 2.5e-40, Identities = 118/403 (29%), Positives = 208/403 (51%)
  Q:    41 KDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD------------INKELPTIEEKPKTL-------EINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           +D  + ++  N F        Y +  E   +     ++ V    +EE              I   LPT E    ++        I P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P+  + Y+ TE F   + +AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + K+ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I++IA RF S+IR LEG L + + F  +  +     +  E +  +++ +         V + P  +I+ +   + V  + + S  R +  S  R+V MY++R+  +LS   IG  F  ++H TV+ AI+ VE ++ SD  L +
  S:    38 RDGELTLIAPNSFASNWLRKNYVQTIEAAAAKIYGQSVRVSVQAQEEDSAERVLPPMTSASIPSPLPTAETTTASVAPSSGPRRILPGLNLRYVFNRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEINPEAKVAYVSTETFTNDLIQAIRKDG--MQAFRDRYRATDLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPKLQERLISRFSMGLIADIQSPDLETRMAILQKKAEQERMMLPRD--LIQYIAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDPNGQG------VDVTPQQVIDKVSEVFDVTPQDMRSSSRRRAVSHARQVGMYLMRQGTDLSLPRIGETFGGKDHTTVMYAIEQVEKRLSSDPQLAS 448
>gi|78212507|ref|YP_381286.1| chromosomal replication initiation protein [Synechococcus sp. CC9605] >gi|78196966|gb|ABB34731.1| chromosomal replication initiator protein DnaA [Synechococcus sp. CC9605] (450 aa)
Score = 430, Expect = 2.5e-40, Identities = 103/334 (30%), Positives = 179/334 (53%)
  Q:   108 PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   + +AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + +V+ SD+ P+ + ++  R+ISRF  GL   I  PD E+   I+ +  ++ R+  P     I++IA RF S+IR LEG L + + F  +  +     +  E +  +++           V++ P  +I+ +   + V  + + S  R +  S  R+V MY++R+  +LS   IG  F  ++H TV+ AI+ VE K+ SD  L
  S:   109 PGLNPRYVFGRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPGARVAYVSTETFTNDLIQAIRKDG--MQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQVVIASDRPPSQIPRLQQRLISRFQMGLIADIQSPDLETRMAILQKKAEQERMSLPRD--LIQYIAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDP------TGQGVEVTPQQVIDKVSEVFDVTAEEMCSSTRRRAVSQARQVGMYLMRQGTDLSLPRIGDNFGGKDHTTVMYAIEQVEKKLASDPQL 431
>gi|126730156|ref|ZP_01745968.1| chromosomal replication initiation protein [Sagittula stellata E-37] >gi|126709536|gb|EBA08590.1| chromosomal replication initiation protein [Sagittula stellata E-37] (459 aa)
Score = 430, Expect = 2.6e-40, Identities = 108/353 (30%), Positives = 190/353 (53%)
  Q:    86 EEKDINKELPTIEEKPKTLEIN-----PTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP---FSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSD 438
           EEK     +P  E+ P T   +       LD RFTF+ + +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+  +  Q  P   ++Y+  E F+ +  +A+ E   K+ +FK  F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K +++R+ SR  SGL + ++  D E    I+   ++  R  +P     +  +EF+A R ++++R LEG L +++ F  L     N  + ++ +  ++ +           +I+ D I   +   Y +    +I  KR + F+  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E   + D
  S:    90 EEKAKPLNIPEAEQAPVTSSRDQQLPGAPLDMRFTFDTFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAWELSQRNPGLTVLYLSAEQFMYRFVQALRE--RKMMDFKEMFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPDEIKDLENRIRSRLQSGLVVDLHPTDYELRLGILQSKVEVYRGMHPGLQIDDGVLEFLAHRISTNVRVLEGALTRLFAFASLVGKPINMDLVQDSLADVLRASER--------KISIDEIQRKVAEHYNIRLSDMIGPKRVRNFARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIEELRQQD 443
>gi|42560561|ref|NP_975012.1| chromosomal replication initiator protein DnaA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492057|emb|CAE76654.1| Chromosomal replication initiator protein DnaA [Mycoplasma mycoides subsp. mycoides SC str. PG1] (479 aa)
Score = 430, Expect = 2.7e-40, Identities = 145/428 (33%), Positives = 230/428 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDF-------VKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSI-IESDSDYEI-VSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +E+ YN+Y+   +I K    +  ++VK+ F        ++   NE K I +E  +I            ++++ I K+   I  K K  +IN       TFEN+ IG  N+ AF A     +    ++  L IYG +G+GKTHLL A  N     F    + Y+  ++F  K    + +   ++E+FKN     D+L+IDD+QFL+ KEK NEIFF IFN     +K +  +SDK P  L   D+R+I+RFN GLSI I K D ++   II + IK   IK+  ++ AI FI+  ++ D+R ++G ++++ F    N        EEKI +I I SD   +I  S L  +N   I E +   YG+   ++  K R+K     R + M++ +E +N +  +IG  F  R+H TV+ A + +ET +K D+ LK  +D + +K
  S:    50 DESVYNDYIKTINIHKKGFSDYIVVVKSQFGLLAIKQFRQTIKNEIKNILKEPVNISFTYEQEYKKQLEKDELIKKDHSDIITK-KVKKINEN-----TFENFVIGASNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNKICQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKSEVTSEAINFISNYYSDDVRKIKGSVSRLNFWSQQN-------PEEKIITIEIVSDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMFLTKEILNHTLAQIGEEFGGRDHTTVINAERKIETMLKKDKQLKKTVDILKNK 475
>gi|169627109|ref|YP_001700758.1| chromosomal replication initiator protein DnaA [Mycobacterium abscessus] >gi|169239076|emb|CAM60104.1| Chromosomal replication initiator protein DnaA [Mycobacterium abscessus] (491 aa)
Score = 430, Expect = 2.8e-40, Identities = 111/333 (33%), Positives = 180/333 (54%)
  Q:    99 EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           E P T     +L++R+TFE++ IG  N+ +  AA    E     +  L I+G +GLGKTHLLHA GN   +LFP   + Y+ TE+F      ++ +   +   FK S+ ++D+LL+DDIQF+  KE + E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +  +  R+  P  +  +E IA R   +IR LEG L ++      N  P E+ + E  +R +I         +N +QI+   I+      +    + +    + +  +  R++ MY+ RE  +LS  +IG  F  R+H TV+ A K V
  S:   146 ETPDT-----SLNARYTFESFVIGASNRFSHAAAVAVSEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRD--DRRVAFKRSYRDIDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSDRPPKGLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLDVP--DDVLELIASRIERNIRELEGALIRVTAFASLNKSPIELSLAEIVLRDLIPD-------ANAIQISAATIMAVTAEYFDTTVEELRGPGKTRALAQARQIAMYLCRELTDLSLPKIGQTFG-RDHTTVMYADKKV 464
>gi|25026557|ref|NP_736611.1| chromosomal replication initiation protein [Corynebacterium efficiens YS-314] >gi|38257617|sp|Q8FUL7|DNAA_COREF Chromosomal replication initiator protein dnaA >gi|23491836|dbj|BAC16811.1| putative chromosomal replication initiator protein DnaA [Corynebacterium efficiens YS-314] (573 aa)
Score = 429, Expect = 3.0e-40, Identities = 111/332 (33%), Positives = 181/332 (54%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAI-EFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEE----KIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDED 440
           +L+ ++TFEN+ IG FN+ A  AA    E     +  L I G +GLGKTHLLHAVGN   +L P   + Y+ +E+F      ++ +   + E FK  + N+D+L++DDIQFL  KE   E FF+ FN L+   K I+++SD+ P  L  ++DR+ +RF  GL   I  PD E+   I+   +KK++      +  + E IA RF S IR LEG L ++  Y  L+     N+ I++E     +R I+    D EI +        +I+E     + +   ++    + +  +  R++ MY+ RE  ++S  +IG  F  ++H TV+ A + +  ++    D
  S:   232 SLNPKYTFENFVIGPFNRFANAAAVAVAESPAKAFNPLFISGGSGLGKTHLLHAVGNYAQELQPGLRIKYVSSEEFTNDYINSVRD--DRQESFKRRYRNLDILMVDDIQFLAGKEGTQEEFFHTFNALHQAEKQIILSSDRPPRQLTTLEDRLRTRFEGGLITDIQPPDLETRIAIL---MKKAQADGTHVDREVLELIASRFESSIRELEGALIRVSAYSSLI-----NQPIDKEMAIVALRDILPEPEDMEITA-------PVIMEVTAEYFKISVDTLRGAGKTRAVAHARQLAMYLCRELTDMSLPKIGDVFGGKDHTTVMYADRKIRQEMTEKRD 555
>gi|88807751|ref|ZP_01123263.1| chromosomal replication initiation protein [Synechococcus sp. WH 7805] >gi|88788965|gb|EAR20120.1| chromosomal replication initiation protein [Synechococcus sp. WH 7805] (464 aa)
Score = 429, Expect = 3.1e-40, Identities = 108/349 (30%), Positives = 187/349 (53%)
  Q:    95 PTIEEKPKTLEIN---PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           PT+E  PK  +     P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P+  + Y+ TE F   +  AI   G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I++I+ RF S+IR LEG L + + F  +  +     +  E +  +++           V++ P  +I+ +   +GV    + S  R +  S  R+V M+++R+   LS   IG  F  ++H TV+ AI+ VE K+ SD  L +
  S:   107 PTVEALPKASKAPRRLPGLNMRYVFNRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPEARVFYVSTESFTNDLILAIRRDG--MQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEQERVALPRD--LIQYISGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDPSGQG------VEVTPQQVIDKVSEVFGVSCDDMRSSSRRRAVSQARQVGMFLMRQGTGLSLPRIGDTFGGKDHTTVMYAIEQVEKKLSSDPQLAS 447
>gi|56459113|ref|YP_154394.1| ATPase involved in DNA replication initiation [Idiomarina loihiensis L2TR] >gi|61212492|sp|Q5QY39|DNAA_IDILO Chromosomal replication initiator protein dnaA >gi|56178123|gb|AAV80845.1| ATPase involved in DNA replication initiation [Idiomarina loihiensis L2TR] (454 aa)
Score = 429, Expect = 3.3e-40, Identities = 117/351 (33%), Positives = 184/351 (52%)
  Q:    99 EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           E P    I+P     +TF+N+  G  N+ A +AA++ + EN    +  L +YG TGLGKTHLLHAVGN  +       + YI+ E F++ +  +I    T   EFK  + +VD LLIDDI F  NK+   E FF+ FN L   N+ I+MTSD  P  +  ++DR+ SRF  GL+I I  P+ E+   I++    +  +  P       FIA R  S++R LEG LN++  ++     P  I    E +R +I +      + N        I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + ++    +  D+K    N++
  S:   112 EVPFESNIHP----EYTFDNFVEGKSNQLA-RAAAIQVAENPGGVYNPLFVYGGTGLGKTHLLHAVGNGIMAHKKDAKVFYIRAERFVQDMVNSIRNSSTN--EFKRYYRSVDALLIDDIHFFANKKGSQEEFFHTFNALLEGNQQIIMTSDLYPKEIDGVEDRLKSRFGWGLTIAIEPPELETRVAILMRKADERGLHMPHE--VAFFIAKRLRSNVRELEGALNRVVANVQLTGRPITIDFVREALRDLIAAQEKLVTIDN--------IQKTVAEYYNIKLADILSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIQELKDAQHDIKEDYRNLI 449
>gi|85857846|ref|YP_460048.1| chromosomal replication initiator protein [Syntrophus aciditrophicus SB] >gi|85720937|gb|ABC75880.1| chromosomal replication initiator protein [Syntrophus aciditrophicus SB] (457 aa)
Score = 429, Expect = 3.3e-40, Identities = 133/433 (30%), Positives = 237/433 (54%)
  Q:    16 KEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLE----------INPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFH---LLDNVDPNEIINEEKIRSIIE-SDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           K I+++   +NF   ++    +  ++  +  + V N F K+  T  Y+++  +  S     +  + F+  +E + N        K K +E          I+PTL+  ++FE + +G  N+ A  AA    E+   N+  L IYG  GLGKTHLL+A+G   + ++P  N++Y+  E+F+ ++  +I     K+ +F+  F N+D LL+DDIQF+  KE+  E FF+ FN L+   K IV+TSDK P  +  ++ R+ SRF  GL   I  P+ E+   I+ +  +++ I  P +N+A  +I+    S+IR LEG L +I  +      N+D + +  +E ++ II+  +SD        +I+ + I++++   Y +    + S+ +NK  +  R+V MY+ R+    S+ +IG     R+H+TV+ A   +   +++D  LKA L  I
  S:    16 KIIKEKISPQNF-ETWIRPLKVVSLEGNHASLSVPNKFFKDWLTENYRDVISDAVSSSAGKDYAIDFVILQESEKNSRSAHPARKKKIIEQIPQEKIRPKIHPTLNPNYSFERFVVGSSNQFAHAAAVAVAEQPAKNYNPLFIYGGVGLGKTHLLNAIGLLSMSIYPDMNVVYVSAEEFMNELILSIRY--DKMPQFREKFRNIDCLLMDDIQFIAGKERTQEEFFHTFNTLHDSGKQIVVTSDKFPKDIPNLEGRLRSRFEWGLIADIQPPEIETKIAILEKKAQENNIHIP-TNVAY-YISSHAESNIRELEGFLVRIAAYSSVTGRNIDLDLV--KEVLKDIIKHRESD--------EISFEEILKAVAARYNLKIADIKSQSKNKNIAMARQVTMYMARKLTGSSFPDIGEKIGGRDHSTVIYANNKIRKLLETDSRLKATLQEI 449
>gi|29374662|ref|NP_813814.1| chromosomal replication initiator protein DnaA [Enterococcus faecalis V583] >gi|38257441|sp|Q839Z5|DNAA_ENTFA Chromosomal replication initiator protein dnaA >gi|29342120|gb|AAO79886.1| chromosomal replication initiator protein DnaA [Enterococcus faecalis V583] (447 aa)
Score = 429, Expect = 3.4e-40, Identities = 118/350 (33%), Positives = 193/350 (55%)
  Q:    99 EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDS--DYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           E+ K   +NP    ++TF+ + IG  N+ A  AA +  E+  + +  L  YG  GLGKTHL+HA+G++ +   P   + Y+ +E F  +   +I    +  E+F+  + NVDLLL+DDIQFL  KE   E FF+ FN L ++NK IV+TSD+ P  + K+ +R++SRF  GLS+ I  PD E+   I+ +     R++ P   L+  +IA + +S+IR LEG L +        V     IN E I + + +D+    + V +  Q++   I E +   Y V  K +  KKR K     R++ MY+ RE  + S  +IG+ F  ++H TV+ A + ++  ++ D  ++  +  I
  S:   104 EQSKKAMLNP----KYTFDTFVIGKGNQMAHAAALVVAEDPGSIYNPLFFYGGVGLGKTHLMHAIGHQMLVNQPDAKVKYVSSETFTNEFINSIQTKTS--EQFRKEYRNVDLLLVDDIQFLAEKEATLEEFFHTFNDLYNENKQIVLTSDRPPNDIPKLPERLVSRFAWGLSVDITPPDLETRIAILRKKADAERLEIPDDTLS--YIAGQIDSNIRELEGALVR--------VQAFATINGEDITTSLAADALKSLKSVGSKNQLSILQIQEEVSKYYHVPLKDLKGKKRVKTIVVPRQISMYLAREMTDNSLPKIGAEFGGKDHTTVIHAHEKIQQLLEKDPAIQKEVSEI 441
>gi|1353854|gb|AAC15822.1| DnaA [Prochlorococcus marinus] (461 aa)
Score = 429, Expect = 3.4e-40, Identities = 119/421 (28%), Positives = 212/421 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKE-------LPTIEEKPKTLEIN-----------PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           Y  ++  +     K+  + ++  N F      N Y +  +E         + V    K   + + E        P +E  P +++ +           P L+ R+ F  + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI +   +++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+     IV+ SD+ P+ + ++ +R++SRF+ GL   +  PD E+   I+ +  +  R+  P     I+FIA RF S+IR LEG L + I F  +  +     +  + I  +++ +         V++ P  +++ +   + V    + S  R +  S  R+V MY++R+  NLS   IG  F  ++H TV+ AI+ VE K+ SD  + + +  I
  S:    22 YETWIRPTEFSGFKNGELTLIAPNSFSSAWLKNNYSQTIQETAEEIFGEPVTVHVKVKANAESSDEHYSSAPITPPLEASPGSVDSSGSSLRLSKKTLPLLNLRYVFNRFVVGPNSRMAHAAAMAVAESPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPGAKVSYVSTETFTNDLILAIRQ--DRMQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHDAGSQIVLASDRPPSQIPRLQERLMSRFSMGLIADVQAPDLETRMAILQKKAEHERVGLPRD--LIQFIAGRFTSNIRELEGALTRAIAFASITGLP----MTVDSIAPMLDPNGQG------VEVTPKQVLDKVAEVFKVTPDEMRSASRRRPVSQARQVGMYLMRQGTNLSLPRIGDTFGGKDHTTVMYAIEQVEKKLSSDPQIASQVQKI 449
>gi|33866070|ref|NP_897629.1| chromosomal replication initiation protein [Synechococcus sp. WH 8102] >gi|61212711|sp|Q7U605|DNAA_SYNPX Chromosomal replication initiator protein dnaA >gi|33639045|emb|CAE08051.1| chromosomal replication initiator protein DnaA [Synechococcus sp. WH 8102] (465 aa)
Score = 429, Expect = 3.5e-40, Identities = 104/334 (31%), Positives = 176/334 (52%)
  Q:   108 PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  +I + G K   F++ +   DLLL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P+ + ++  R+ISRF  GL   I  PD E+   I+ +  ++ R+  P     I ++A RF S+IR LEG L + + F  +  +     +  E +  +++           V + P  +I+ +   + V  + ++S  R +  S  R+V MY++R+  +LS   IG  F  ++H TV+ AI+ VE K+ SD  L
  S:   124 PGLNPRYVFGRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPSARVSYVSTETFTNDLIDSIRKDGMKA--FRDRYRAADLLLVDDIQFIEGKEYTQEEFFHTFNALHEAGKQVVIASDRPPSQISRLQQRLISRFQMGLIADIQAPDLETRMAILQKKAEQERMALPRD--LIHYLAGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDP------TGQGVDVTPQQVIDKVSEVFDVTAEEMLSSTRRRAVSQARQVGMYLMRQGTDLSLPRIGDTFGGKDHTTVMYAIEQVEKKLASDPQL 446
>gi|91774357|ref|YP_544113.1| chromosomal replication initiator protein DnaA [Methylobacillus flagellatus KT] >gi|123380248|sp|Q1GXK1|DNAA_METFK Chromosomal replication initiator protein dnaA >gi|91708344|gb|ABE48272.1| chromosomal replication initiator protein DnaA [Methylobacillus flagellatus KT] (470 aa)
Score = 429, Expect = 3.6e-40, Identities = 115/359 (32%), Positives = 190/359 (52%)
  Q:    83 ITKEEKDINKELPT--IEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI---INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           I+K  K ++   P     +KPKTL     L+  F F+N+  G  N+ A +AA++ + EN    +  L IYG  GLGKTH+L A+GN      P   + Y+  E ++  + KA        +EFK  + ++DLLLIDDIQF   K +  E FF  FN L    K I++T D  P  +  +D+R+ +RF+ GL++ +  P+ E    I+++  + +R+          FIA +  S +R LEG LN+I    + N   + I   + +E ++ +I             QI  + I +++   Y +    + SKKR++ F+  R++ M + RE  N S+ EIG  F  R+H TV+ A  ++E   ++D+++
  S:   106 ISKVTKTVSPAKPASAAPKKPKTLTETSGLNPAFRFDNFVTGKANQLA-RAAAIQVAENPGTAYNPLFIYGGVGLGKTHVLQAIGNHLKSQRPDAKIRYLHAERYVSDVVKAYEHKA--FDEFKRQYHSLDLLLIDDIQFFAKKSRTQEEFFYAFNSLIEAKKQIIITCDTYPKEIADVDERLRTRFSWGLTVAVEPPELEMRVAILLKKAEAARVT--LDEDVAFFIAKQVRSSVRELEGALNRII--AMANFTGHAIDVSLAKEALKDLIAVRGR--------QITIENIQKTVADYYKIKVAEMYSKKRSRNFARPRQIAMTLARELTNHSFPEIGEAFGGRHHTTVMHACDEIEQLRQNDQNV 457
>gi|558140|gb|AAA85913.1| putative (446 aa)
Score = 429, Expect = 3.7e-40, Identities = 121/398 (30%), Positives = 203/398 (51%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFIT---KEEKDINKE--LPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVL 425
           ++ ++  S +  + D    I V+N FV       Y  +  E  +      + V  IT   +    I +E  LP +E  PK       L+ ++TF  +     +++   AASL + E+    +  L + G  GLGKTHL+ A+ +  ++++P   + Y+ TE F   +  AI +    +E+F++ + + D LLIDDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  + DR+ISRF+ GL   I  PD E+   I+ +  +  RI+ P     +E+IA  + S+IR LEG L + I +  L NV     +  E I  ++    +       V   P+ II  +   Y +  + ++S  R ++ S  R+V MY++R+  +LS   IG  F  ++H TV+
  S:    24 FDTWIKASVLISLGDGVATIQVENGFVLNHLQKSYGPLLMEVLTDLTGQEITVKLITDGLEPHSLIGQESSLP-METTPKNAT---ALNGKYTFSRFVWA--HQSHGHAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLEMYPNAKVYYVSTERFTNDLITAIRQ--DNMEDFRSYYRSADFLLIDDIQFIKGKEYTQEEFFHTFNSLHEAGKQVVVASDRAPQRIPGLQDRLISRFSMGLIADIQVPDLETRMAILQKKAEYDRIRLP--KEVMEYIASHYTSNIRELEGALIRAIAYTSLSNV----AMTVENIAPVLNPPVEK------VAAAPETIITIVAQHYQLKVEELLSNSRRREVSLARQVGMYLMRQHTDLSLPRIGEAFGGKDHTTVM 410
>gi|55820104|ref|YP_138546.1| chromosomal replication initiation protein [Streptococcus thermophilus LMG 18311] >gi|55821994|ref|YP_140435.1| chromosomal replication initiation protein [Streptococcus thermophilus CNRZ1066] >gi|116626973|ref|YP_819592.1| chromosomal replication initiation protein [Streptococcus thermophilus LMD-9] >gi|122268421|sp|Q03N26|DNAA_STRTD Chromosomal replication initiator protein dnaA >gi|71151807|sp|Q5M226|DNAA_STRT1 Chromosomal replication initiator protein dnaA >gi|71151808|sp|Q5M6L8|DNAA_STRT2 Chromosomal replication initiator protein dnaA >gi|55736089|gb|AAV59731.1| chromosomal replication initiator protein dnaA [Streptococcus thermophilus LMG 18311] >gi|55737979|gb|AAV61620.1| chromosomal replication initiator protein dnaA [Streptococcus thermophilus CNRZ1066] >gi|116100250|gb|ABJ65396.1| ATPase involved in DNA replication initiation [Streptococcus thermophilus LMD-9] (454 aa)
Score = 429, Expect = 3.7e-40, Identities = 145/435 (33%), Positives = 238/435 (54%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKM-NSNLNVFFITKEEKDINKELPTI----------EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNK--EKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           E+ KE   +  ++ YVLD+ + KI+D    IL++   VK++F  +  + F      ++ NS + V ++  +E  +++  PT+          ++ P    +N  L+S++TF+N+  G  N+ +  AASL + ++    +  L IYG  GLGKTHLL+A+GNK +   PQ  + YI  E+F+ +    I     K++E K  + ++D+LLIDDIQ L  K  +   E FFN FN L+  NK IV+TSD+ P  L ++++R+++RF  GL++ I  PD E+   I+   I       P     IE++A +F+S++R LEG L  I   L+ NV   + I  E     I +         L+ I  + I   +   Y V  K + + KR +     R+V MY+ RE  + S  +IG  F  R+H+TVL A   ++  +  D+ L+  +D I +K
  S:    14 ELAKEELTQATFDYYVLDTKLIKIQDNVATILLEE--VKKLFWEKNMQSFILMTGFEVYNSEIKVEYVF-DEALVSETKPTLANNDFSNKREQQTPDLPTLNSDLNSKYTFDNFIQGDENRWSV-AASLAVADSPGATYNPLFIYGGPGLGKTHLLNAIGNKVLHDNPQARIKYITAENFINEFVLHIRL--DKMDELKLKYRHLDVLLIDDIQSLAKKSTQATQEEFFNTFNVLHDNNKQIVLTSDRNPDQLNEMEERLVTRFKWGLTVNITPPDFETRVAILTNKIMDYDYHFPPET--IEYLAGQFDSNVRDLEGALKDI--SLVANVRQLDTITVEVAAEAIRARKIDGPKLTLIPI--EDIQSEVGKFYNVTVKEIKATKRTQNIVLARQVAMYLAREMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMLAQDDSLRIEIDTIKNK 452
>gi|84684521|ref|ZP_01012422.1| chromosomal replication initiation protein [Rhodobacterales bacterium HTCC2654] >gi|84667500|gb|EAQ13969.1| chromosomal replication initiation protein [Rhodobacterales bacterium HTCC2654] (455 aa)
Score = 428, Expect = 4.1e-40, Identities = 102/337 (30%), Positives = 187/337 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           LD RFTF+++ +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+ ++  +  PQ  ++Y+  E F+ +  +A+ +   ++ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K +++R+ SR   GL + ++  D E    ++   +   R   P  ++A   +EF+A R  +++R LEG L +++ F  L   +      +E +  ++ + SD ++    +Q         +   YG+    +I  KR +  +  R+V M + ++    SY +IG  F  R+H+TV+ A+K VE  V +D  +   +D
  S:   115 LDKRFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAHEMTERQPQLRVLYLSAEQFMYRFVQALRD--KQMMDFKHMFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALIDQNKQIIISADRAPGEIKDLEERIKSRLQCGLVVDLHPTDYELRLGVLQSKVAAYRETYPDLSIADGVLEFLAHRITTNVRVLEGALMRLFAFASLVGGEITLDRAQECLTDVLRA-SDRKVTVEEIQ-------RKVAEHYGIRLSDLIGPKRLRSIARPRQVAMKLSKDLTTRSYPDIGRRFGGRDHSTVMHAVKRVEELVSTDHQIAEDVD 447
>gi|67642367|ref|ZP_00441124.1| COG0593: ATPase involved in DNA replication initiation [Burkholderia mallei GB8 horse 4] (431 aa)
Score = 428, Expect = 4.1e-40, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    95 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 418
>gi|107024098|ref|YP_622425.1| chromosomal replication initiation protein [Burkholderia cenocepacia AU 1054] >gi|105894287|gb|ABF77452.1| chromosomal replication initiator protein DnaA [Burkholderia cenocepacia AU 1054] (561 aa)
Score = 428, Expect = 4.2e-40, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   225 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 548
>gi|88854499|ref|ZP_01129166.1| chromosomal replication initiator protein [marine actinobacterium PHSC20C1] >gi|88816307|gb|EAR26162.1| chromosomal replication initiator protein [marine actinobacterium PHSC20C1] (471 aa)
Score = 428, Expect = 4.4e-40, Identities = 118/344 (34%), Positives = 183/344 (53%)
  Q:    93 ELPTIEEKPKT-LEINPT------LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVK 436
           E P IE  P T +E +P       L+ +++F+N+ IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F      +I+     V  F++ +  +D+LLIDDIQFL  K+   E FF+ FN L+  NK +V+TSD  P  L   +DRM SRF  GL   +  PD E+  +I I   K    K    N  +EF+A + +S+IR LEG L ++  F  L+  + +  + +  ++ +I  D D  I        P  II      + +    +    R++  +  R++ MY+ RE  NLS  +IG  F NR+H TV+ A K +   +K
  S:   104 EQPYIEPTPPTPIEQSPPRRSDSRLNPKYSFDNFVIGGSNRFAHAAAVAVAEAPAKAYNPLFIYGGSGLGKTHLLHAIGHYAESLYPGIRVRYVSSEEFTNDFINSIANNRASV--FQSRYREIDILLIDDIQFLQGKDSTQEAFFHTFNTLHDHNKQVVITSDLPPKHLTGFEDRMRSRFEWGLITDVQAPDLET--RIAILRKKAQSEKMQVGNDILEFMASKVSSNIRELEGTLIRVTAFASLNRTEVDMALVQTVLKDLITLDEDNVIA-------PVDIINHTADYFKLTVDDLYGSSRSQAVATARQIAMYLCREMTNLSLPKIGQLFGNRDHTTVMYANKKITELMK 446
>gi|163738134|ref|ZP_02145550.1| chromosomal replication initiation protein [Phaeobacter gallaeciensis BS107] >gi|161388750|gb|EDQ13103.1| chromosomal replication initiation protein [Phaeobacter gallaeciensis BS107] (475 aa)
Score = 428, Expect = 4.6e-40, Identities = 101/335 (30%), Positives = 190/335 (56%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVE 432
           +++ +TL+  P LD RFTF+++ +G  N+ A  AA    E     +  L++YG  GLGKTHL+HA+  +     P+ N++Y+  E F+ +  +A+ E   K+ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   + +     P   +A   +EF+A R ++++R LEG L +++ F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E
  S:   124 KDQGETLQAAP-LDPRFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLVLYGGVGLGKTHLMHAIAWELTARNPELNVLYLSAEQFMYRFVQALRE--RKMMDFKHLFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVRSRLQCGLVVDLHPTDYELRLGILQSKVAQQMQTYPDLRIADGVLEFLAHRISTNVRVLEGALTRLFAFASLVGREIDMELTQDCLADVLRA-SERKITVEEIQ-------RKVSEYYNIRMSDIIGPKRLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIE 453
>gi|83309735|ref|YP_419999.1| chromosomal replication initiation protein [Magnetospirillum magneticum AMB-1] >gi|82944576|dbj|BAE49440.1| ATPase [Magnetospirillum magneticum AMB-1] (477 aa)
Score = 428, Expect = 4.8e-40, Identities = 102/337 (30%), Positives = 187/337 (55%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV-----QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           E+   LD+RFTF+N+ +G  N+ A+ AA    E +  ++  L +YG  GLGKTHL+HA+ +   +  P+++++Y+  E F+ +  +A+   G     FK  F +VD+L+IDD+QF+  K+   E FF+ FN L  + + IV+++DK P+ L+ I++R+ SR   GL   I+    E    I+    ++  +  P     +EF+A +  S++R LEG LN++  H             + +   I  ++  E++ +L+     +I  + I + +   + +    + S +R++Q +  R++ MY+ ++  + S  EIG  F  R+H TV+ A+K VE   + D++ 
  S:   137 ELGAPLDNRFTFKNFVVGKPNEFAWAAARRVAEADQVSFNPLFLYGGVGLGKTHLMHAIAHHIRERNPERSVLYLSAEKFMYRFIRALR--GQDTMSFKEQFRSVDVLMIDDVQFIAGKDATQEEFFHTFNALVDQGRQIVISADKSPSDLEGIEERLRSRMACGLVADIHATTYELRLGILHSKAEQMGVLVP--QKVMEFLAHKIISNVRELEGALNRVVAH------------SQLVGRAITLETTQEVLHDLLRASDRRITIEEIQKKVAEHFTIKLAEMSSARRSRQVARPRQIAMYLAKQLTSRSLPEIGRKFGGRDHTTVMHAVKKVEELKECDQNF 464
>gi|99079842|ref|YP_611996.1| chromosomal replication initiation protein [Silicibacter sp. TM1040] >gi|123252667|sp|Q1GKT2|DNAA_SILST Chromosomal replication initiator protein dnaA >gi|99036122|gb|ABF62734.1| chromosomal replication initiator protein DnaA [Silicibacter sp. TM1040] (470 aa)
Score = 428, Expect = 4.8e-40, Identities = 101/337 (29%), Positives = 193/337 (57%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVE 432
           +++  P+ L+  P LD RFTF+++ +G  N+ A  AA    E     +  L++YG  GLGKTHL+HA+  +  +  P+ N++Y+  E F+ +  +A+ E   K+ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   ++++R   P   +A   +E +A R ++++R LEG L +++ F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E
  S:   117 SVKSPPEDLQAAP-LDPRFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLVLYGGVGLGKTHLMHAIAWELKERNPELNVLYLSAEQFMYRFVQALRE--RKMMDFKHLFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVKSRLQCGLVVDLHPTDYELRLGILQTKVQQNRKNYPDLKIADGVLELLAHRISTNVRVLEGALTRLFAFASLVGREIDMDLTQDCLADVLRA-SERKITVEEIQ-------RKVSEYYNIRMSDIIGPKRLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIE 448
>gi|126738627|ref|ZP_01754332.1| chromosomal replication initiation protein [Roseobacter sp. SK209-2-6] >gi|126720426|gb|EBA17132.1| chromosomal replication initiation protein [Roseobacter sp. SK209-2-6] (489 aa)
Score = 428, Expect = 4.8e-40, Identities = 101/336 (30%), Positives = 189/336 (56%)
  Q:   103 TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSD 438
           +L+  P LD RFTF+++ +G  N+ A  AA    E     +  L++YG  GLGKTHL+HA+  +  +  P  N++Y+  E F+ +  +A+ E   K+ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   ++  +   P   +A   +EF+A R ++++R LEG L +++ F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E    +D
  S:   143 SLQAAP-LDPRFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLVLYGGVGLGKTHLMHAIAWELTEKNPHLNVLYLSAEQFMYRFVQALRE--RKMMDFKHLFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVKSRLQCGLVVDLHPTDYELRLGILQTKVQMQQATYPDLQIADGVLEFLAHRISTNVRVLEGALTRLFAFASLVGREIDMDLTQDCLADVLRA-SERKITVEEIQ-------RKVSEYYNIRMSDIIGPKRLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIEELKSTD 473
>gi|158311868|ref|YP_001504376.1| chromosomal replication initiator protein DnaA [Frankia sp. EAN1pec] >gi|158107273|gb|ABW09470.1| chromosomal replication initiator protein DnaA [Frankia sp. EAN1pec] (527 aa)
Score = 427, Expect = 5.1e-40, Identities = 108/337 (32%), Positives = 177/337 (52%)
  Q:    95 PTIEEKPKTLEINPT-LDSRFTFENYTIGMFNKNAF---KAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           P +   P      P  L+ R+ FE + IG  + N F    A ++       +  L IYG +GLGKTHLLHA+G+  V+L+P+  + Y+  E+F      +I +   +   F+  + ++D+LL+DDIQFL NKE+  E FF+ FN L+   K IV++SD+ P  L  ++DR+ SRF  GL   +  PD E+  +I I + K +  + P     +E+IA     +IR LEG L ++  F  L+    +  + E  +R +I   ++ EI +  +              +GV  + +    R++     R++ MY+ RE  +LS  +IG  F  R+H TV+ A + +
  S:   170 PGLGRDPSPRPSEPARLNPRYLFETFVIG--DSNRFPHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIGHYTVKLYPESKIKYVSMEEFTNDFIASIRD--DRQLAFQRRYRDIDVLLVDDIQFLENKERTQEEFFHTFNVLHDTEKQIVISSDRSPKQLSALEDRLRSRFEWGLITDVTPPDLET--RIAILSKKAATERLPVPPDVLEYIATHIERNIRELEGALIRVAAFASLNKSHVDRTLAEIVLRDLIPDAANPEITAAAIMNATAAY-------FGVSMEDLCGTSRSRVLVTARQIAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKI 499
>gi|172056046|ref|YP_001812506.1| chromosomal replication initiator protein DnaA [Exiguobacterium sibiricum 255-15] >gi|171988567|gb|ACB59489.1| chromosomal replication initiator protein DnaA [Exiguobacterium sibiricum 255-15] (464 aa)
Score = 427, Expect = 5.1e-40, Identities = 128/388 (32%), Positives = 209/388 (53%)
  Q:    61 EYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT---------------------LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLD-NVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           +Y  + E+       S L++ FI  EE      L    E+ + +E+ P                      L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G           + Y+ +E F      +I +   K  +F+N + N+D+LLIDDIQFL  KE+  E FF+ FN L++  K I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+  +I I   K +  +   SN  + +IA + +++IR LEG L ++  Y +L+   +DPN  +  E + +I+ +    ++    +Q       ES+   + +    + +KKR K  +F R++ MY+ RE    S  +IG  F  R+H TV+ A + + T VKSD +    ++ I
  S:    59 QYLSLLEDTVEEVTGSRLDIQFI--EEGQAKHMLDRQNEEVEVMEVAPAKTKAQKTPKSSDELVMSELGQLNEKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGQYVQDQKLGTKIAYVSSEQFTNDFINSIRD--NKTVQFRNKYRNIDVLLIDDIQFLAGKEQTQEEFFHTFNALHNDQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLET--RIAILRKKANAEQLDVSNEVMLYIASQIDTNIRELEGALTRVIAYANLVGRTIDPN--VAAEALHNIMPASEPRKVTIRDIQ-------ESVSKHFNLPFDDLKAKKRTKSIAFPRQIAMYLSREMTESSLPKIGEEFGGRDHTTVIHAHEKISTLVKSDGETGKVIEQI 457
>gi|90415378|ref|ZP_01223312.1| chromosomal replication initiation protein [marine gamma proteobacterium HTCC2207] >gi|90332701|gb|EAS47871.1| chromosomal replication initiation protein [marine gamma proteobacterium HTCC2207] (523 aa)
Score = 427, Expect = 5.7e-40, Identities = 116/356 (32%), Positives = 190/356 (53%)
  Q:    93 ELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSD-YEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           + P I        +   L+S FTF+++  G  N+ A  AA    E    ++  L IYG  GLGKTHL+HAVGN      P   ++Y+ +E F+  + KA+      ++EFK  + +VD LLIDDIQF   KE+  E FF+ +N L  + + +++T D+ P  +  +++R+ SRF  GL++ +  P+ E+   I+I   +++ I+   S  A  FIA R  S++R LEG L ++  H   +     +I+ + IR   ES  D   +   LV I  D I   +   Y +    ++SK+R++  +  R++ M + ++  N S  EIG  F  R+H TVL A + V+    +D D++  L N+
  S:   171 QAPAIITSAAEHSLKSNLNSAFTFDSFVEGKSNQLALAAAQQVAENPGGSYNPLFIYGGVGLGKTHLMHAVGNALRMRKPDAKIVYLHSERFVADMVKALQLKA--IDEFKQFYRSVDALLIDDIQFFAGKERSQEEFFHTYNALLERGQQMILTCDRYPKEINGVEERLKSRFGWGLTVAVEPPELETRVAILINKAEQAGIE--LSRDAAFFIAQRIRSNVRELEGALKRVMAHAQFS---GRVIDIDLIR---ESLKDLLALQDKLVTI--DNIQRVVADYYKLKMSDLLSKRRSRSVARPRQIAMALAKDLTNYSLPEIGESFGGRDHTTVLHACRKVKELEATDRDVERDLKNL 517
>gi|163743748|ref|ZP_02151122.1| chromosomal replication initiation protein [Phaeobacter gallaeciensis 2.10] >gi|161383009|gb|EDQ07404.1| chromosomal replication initiation protein [Phaeobacter gallaeciensis 2.10] (475 aa)
Score = 427, Expect = 5.8e-40, Identities = 101/335 (30%), Positives = 190/335 (56%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVE 432
           +++ +TL+  P LD RFTF+++ +G  N+ A  AA    E     +  L++YG  GLGKTHL+HA+  +     P+ N++Y+  E F+ +  +A+ E   K+ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   + +     P   +A   +EF+A R ++++R LEG L +++ F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E
  S:   124 KDQGETLQAAP-LDPRFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLVLYGGVGLGKTHLMHAIAWELTARNPELNVLYLSAEQFMYRFVQALRE--RKMMDFKHLFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVRSRLQCGLVVDLHPTDYELRLGILQSKVAQQMQTYPDLRIADGVLEFLAHRISTNVRVLEGALTRLFAFASLVGREIDMELTQDCLADVLRA-SERKITVEEIQ-------RKVSEYYNIRMSDIIGPKRLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIE 453
>gi|154503049|ref|ZP_02040109.1| hypothetical protein RUMGNA_00871 [Ruminococcus gnavus ATCC 29149] >gi|153796290|gb|EDN78710.1| hypothetical protein RUMGNA_00871 [Ruminococcus gnavus ATCC 29149] (456 aa)
Score = 427, Expect = 5.9e-40, Identities = 132/446 (29%), Positives = 238/446 (53%)
  Q:     7 IKKKYLIIKKEIEKEFQNENF-YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEI--NPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVE----EFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKII-----IENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +++ +  I  +++ E+ + N  YN ++   +++++ D+ VYILVK     E    +Y   F+   +        V F+T +   I ++  T  +K ++  I     L+ ++TF+ + +G  N N   AASL + ++    +  L +YG  GLGKTHL+H++ +  ++  P K ++Y+ +E F  ++  A+  G    E     F+  + N D+LLIDDIQF+  KE   E FF+ FN L+   K I+++SDK P  ++ ++ R+ +RF  GL   I+ PD E+   I+     ++ +++  I +      +++IA    S+IR LEG LNK I    L+N   +  +  E ++ +I  +       N  +I P++IIE +   + V    +  KKRN +    R++ MY+ R+  +     IG     ++HA+V   +K +E  VK+DE L   ++ I  K 
  S:     4 VEENWEQILNKMKLEYCSSNISYNTWIAPLTVYEVTDDTVYILVKLRASLEHIEEKYLLPFKVCIAEVTGYEYEVSFVTDDHVVIQEKKDTAVKKQQSNAIFEQANLNPKYTFDTFVVGS-NNNFAHAASLAVADSPGEIYNPLFLYGGVGLGKTHLMHSIAHFILEKDPTKKVLYVTSETFTNELIDALKIGKNGNELAMTTFREKYRNNDVLLIDDIQFIIGKESTQEEFFHTFNHLHVSGKQIIISSDKPPKDIETLEARLRTRFEWGLIADISSPDYETRMAILRKKEELDGLERYHIPDE----VMQYIANNITSNIRELEGSLNKLIALANLENKPIDIPLAAEALKDMISPN-------NTREITPELIIEVVSDHFNVPAAELKGKKRNAEIVLPRQIVMYLCRKMTDTPLKTIGLILGGKDHASVSHGVKKIEHDVKTDEALNNTVNIIKKKL 453
>gi|56961783|ref|YP_173505.1| chromosomal replication initiation protein [Bacillus clausii KSM-K16] >gi|61212498|sp|Q5WM31|DNAA_BACSK Chromosomal replication initiator protein dnaA >gi|56908017|dbj|BAD62544.1| chromosome replication initiator protein DnaA [Bacillus clausii KSM-K16] (451 aa)
Score = 427, Expect = 6.1e-40, Identities = 123/401 (30%), Positives = 212/401 (52%)
  Q:    42 DENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLE----------INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           ++ + +   N+F ++   + Y  +  +       + L   F+  +     + LP  E+ P+T                L+ ++TF  + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   AI +   K   F+N + NVD+LLIDDIQF+  K +  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K   +  P  N  + +IA + +++IR LEG L ++  +  L N D N  +  E ++ II +     +    +Q       + +   + V  +   +KKR K  +F R++ MY+ RE  + S  +IGS F  R+H TV+ A + +   + +D++L+
  S:    39 NDTIIVTAPNEFARDWLEDHYSGLTSDIIEQLTGARLTPKFVIPQHNQEEEALP--EQTPQTPPEKDVAGQSTLSQTMLNDKYTFNTFVIGSGNRFA-HAASLAVAEAPARAYNPLFIYGGVGLGKTHLMHAIGHYVMEHNPNAKVVYLSSEKFTNEFINAIRD--NKAVHFRNKYRNVDVLLIDDIQFIAGKIQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAENLDIP--NEVMLYIANQIDTNIRELEGALIRVVAYSSLINQDMNADLAAEALKDIIPNAMPKTLTITDIQ-------KLVGEHFQVKLEDFKAKKRTKSVAFPRQIAMYLSREMTDASLPKIGSEFGGRDHTTVIHAHEKISKLLATDQELQ 439
>gi|15616642|ref|NP_239854.1| chromosomal replication initiator protein DnaA [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11132243|sp|P57128|DNAA_BUCAI Chromosomal replication initiator protein dnaA >gi|25299844|pir||D84931 chromosomal replication initiator protein dnaA [imported] - Buchnera sp. (strain APS) >gi|10038705|dbj|BAB12740.1| chromosomal replication initiator protein dnaA [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (454 aa)
Score = 427, Expect = 6.1e-40, Identities = 133/417 (31%), Positives = 226/417 (54%)
  Q:    33 LDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEE--------------KPKTLEINPTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIII-----ESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+++I +I   N ++L   ++VK+ + N  K+I ++Y     NS L  F I +  K+   +                    K K L     ++ R+ F+N+  G  N+ A  AA        N++  L +YG+TGLGKTHLLHA+GN+ +       ++++ +E F++ + KA+      +E+FK  + +VD LLIDDIQF  +KE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF+ GL+I I+ P+ E+   I+I+   ++ +    SN    FIA    S++R LEG LN++            I+N       I  D   E + +++ +   II      +++   Y +    ++SKKR++  +  R++ M + ++  N S  EIG  FS R+H TVL A   +E   K + D+K    N++
  S:    33 LNNNILEIYAPNKFVL---EWVKDKYLNHLKKILQDYCG--TNSPLIKFEIYQIYKENKLKKNIENNNNNKNEKLIWSNIPKFKNLSYRSNINKRYNFQNFVEGKSNQLARSAAFQAARNPGNSYNPLFLYGATGLGKTHLLHAIGNEILSYKYDIKIIFMNSECFVQDMVKALKNNA--IEKFKLYYRSVDALLIDDIQFFAHKERSQEEFFHTFNTLIEGNQQIILTSDRYPKEINGVEDRLKSRFSWGLTIAIDPPEIETRVAILIKKADQNNVI--LSNEVAFFIAKHLRSNVRELEGALNRV------------ILNSRFTHRAITVDFAREALQDILAVQEKIITIDNIQKTVAKYYKIKVSDLLSKKRSRSIARPRQMAMAMAKKLTNHSLPEIGEAFSGRDHTTVLHACCKIEQLRKENHDIKKDFLNLI 449
>gi|167957122|ref|ZP_02544196.1| chromosomal replication initiation protein [candidate division TM7 single-cell isolate TM7c] (467 aa)
Score = 427, Expect = 6.3e-40, Identities = 107/344 (31%), Positives = 186/344 (54%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +L+ R+TF+N+ +G  N  A+    ++       +  L +YG  GLGKTHL+ A GN+ ++  PQ  ++Y  TE+F++     I     K + F + + NVD+L++DD+QF+  KEK  E FF+ FN L+  NK I+++SDK P S+  + DR+ SRF  G++I I  PD E+  +  I   K S      S    E++A    ++IR LEG LN++     +  ++P+  + E  I +I ++   +        I    II+     + +    V S KR+K  +  R++ MY+LR +++LS+ +I +    ++H T + +I  +E  +K D  ++  ++ I  K 
  S:   132 SLNPRYTFDNFIVGSSNDLAYATCQAVASHPGEKYNPLFLYGGVGLGKTHLMQATGNEIIKNNPQAQILYTTTENFIKDFLDHIR---FKKQGFSSKYRNVDVLIVDDMQFIAGKEKTQEEFFHTFNELHQNNKQIIISSDKPPKSIPTLTDRLRSRFEWGMTIDIQMPDFET--RCAIVEAKASLSGVELSRETAEYLAQNIKTNIRELEGSLNQLLALAEMRGIEPDIQVAEGLIGNIRQTRPRH--------ITAKQIIDKTARYFQLQTSEVCSSKRDKHIALPRQIAMYLLRSELHLSFPKIAAELGRKDHTTAIHSINKIERAIKLDFTIREQVNEIKEKL 465
>gi|61212611|sp|Q6MUM7|DNAA_MYCMS Chromosomal replication initiator protein dnaA (450 aa)
Score = 427, Expect = 6.3e-40, Identities = 145/428 (33%), Positives = 230/428 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDF-------VKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSI-IESDSDYEI-VSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +E+ YN+Y+   +I K    +  ++VK+ F        ++   NE K I +E  +I            ++++ I K+   I  K K  +IN       TFEN+ IG  N+ AF A     +    ++  L IYG +G+GKTHLL A  N     F    + Y+  ++F  K    + +   ++E+FKN     D+L+IDD+QFL+ KEK NEIFF IFN     +K +  +SDK P  L   D+R+I+RFN GLSI I K D ++   II + IK   IK+  ++ AI FI+  ++ D+R ++G ++++ F    N        EEKI +I I SD   +I  S L  +N   I E +   YG+   ++  K R+K     R + M++ +E +N +  +IG  F  R+H TV+ A + +ET +K D+ LK  +D + +K
  S:    21 DESVYNDYIKTINIHKKGFSDYIVVVKSQFGLLAIKQFRQTIKNEIKNILKEPVNISFTYEQEYKKQLEKDELIKKDHSDIITK-KVKKINEN-----TFENFVIGASNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNKICQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKSEVTSEAINFISNYYSDDVRKIKGSVSRLNFWSQQN-------PEEKIITIEIVSDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMFLTKEILNHTLAQIGEEFGGRDHTTVINAERKIETMLKKDKQLKKTVDILKNK 446
>gi|124265194|ref|YP_001019198.1| chromosomal replication initiator protein DnaA [Methylibium petroleiphilum PM1] >gi|167016902|sp|A2SBM4|DNAA_METPP Chromosomal replication initiator protein dnaA >gi|124257969|gb|ABM92963.1| chromosomal replication initiator protein [Methylibium petroleiphilum PM1] (467 aa)
Score = 427, Expect = 6.4e-40, Identities = 106/322 (32%), Positives = 167/322 (51%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIK-NPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L++  TF+    G  N+ A + A+L +       +  L IYG  GLGKTHL+HAVGN  ++  P   ++Y+  E F+  + K         +E K  + ++DLLLIDD+QF   KE+  E FFN F  L +K  +I+MTSD  P  L  ID+R+ SRF++GL++ I  P+ E    I+   +KKS ++  P       F+A    +++R LEG L K+  +      D N  +  E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   132 LNTALTFDTLVPGRANQMA-RTAALHVAGAPGVMYNPLFIYGGVGLGKTHLIHAVGNALLRDKPDARILYLHAEQFITDVVKNYQR--KTFDELKAKYHSLDLLLIDDVQFFAGKERTQEEFFNAFEALLAKRAHIIMTSDTYPKGLADIDERLTSRFDAGLTVAIEPPELEMRVAIL---MKKSDVEGTPMPEDVAFFVAKNVRANVRELEGALRKVLAYARFSQKDINIALAREALKDLLSIQNRQVGVENIQKTVADF--------YKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 444
>gi|163814987|ref|ZP_02206374.1| hypothetical protein COPEUT_01140 [Coprococcus eutactus ATCC 27759] >gi|158449670|gb|EDP26665.1| hypothetical protein COPEUT_01140 [Coprococcus eutactus ATCC 27759] (454 aa)
Score = 426, Expect = 6.6e-40, Identities = 122/417 (29%), Positives = 213/417 (51%)
  Q:    36 SIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKM-----NSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           +++ ++D  VY  +   + +       K++F+ Y    +     N ++ V F  +      ++ PT  E          L   +TFEN+ +G  NK+A        +    + +  L +YG +GLGKTHL+ ++ +  +Q      ++Y+ +  F  +I +AI++  T  EEF+N +  VD+LLIDDIQ+L  K+     FF+ FN L+ + K I+++SDK P  +K +D R  SRF  G+ I I+ PD E+   I+    +   +KN  S    E+IA     ++R LEG LNK+  +  L ++   E + +  ++ +I  D         V I PD+II ++     +    +IS KR++  +  R++ MY+ R+  +     IG  F  ++H+TV   I+ VE K+  D +    +D I+ K 
  S:    35 NVYSVEDNKVYFTLDEKYGQRGIEFLKKKLFDIYLETVLRELFQNDSIQVIFTLQSVMKEEEKQPTYTEDYNEAISKSNLRPDYTFENFIVGESNKHAHATCLAVADSPGQDKFNPLFLYGESGLGKTHLMQSIAHYILQHNSNMKVLYVSSNQFTNEIIEAIAKKTT--EEFRNKYRKVDVLLIDDIQYLIGKDATQNEFFDTFNALHDEGKQIILSSDKPPKEIKTLDVRYRSRFEWGVPIDIHAPDYETRMAILKNKAEIKGLKN-ISEPIFEYIAKNITYNVRELEGALNKLSIYSELGHIKITEDLAKNILKDLISKDEK-------VTITPDLIINTVSEHLNISVNDIISTKRSQDIATARQISMYLCRKYTDKGLKSIGDSFGGKDHSTVHSNIQKVEEKIDKDPEFAEMVDVIIKKL 450
>gi|191163460|ref|ZP_03025334.1| chromosomal replication initiator protein DnaA [Geobacter sp. M21] >gi|190995405|gb|EDV70859.1| chromosomal replication initiator protein DnaA [Geobacter sp. M21] (460 aa)
Score = 426, Expect = 7.1e-40, Identities = 130/433 (30%), Positives = 227/433 (52%)
  Q:    20 KEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD--INKELPTIEEKP--------------------KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K+   E  Y+ ++          + + + V + F ++  T++Y  + +E  S     +  + F   +EK     +E P  E KP                       E+ P L+ ++TFE++  G  N+ A+ A+     +   N+  L IYG  GLGKTHL++A+GN  +   P+  + Y  +E F+ ++  ++     K++EF+N F  +DLLLIDDIQF+  KE   E FF+ FN L   +K IV+TSDK P  +  +++R+ SRF  GL   I  P  E+   I+ +      +  P  ++A+ F+A   NS+IR LEG+L ++  F  L   +    +  E ++ I        IV     I  ++I +++   + +    + S KR K     R++ +Y+ RE    SY EIG  F  ++H+T++ ++K +E ++  D++ KA +++I  K 
  S:    13 KQVLTEQTYSTWIDPLKFLGATVDTIVLEVPSSFFQKWVTDKYLAMIKEAISAVNGKSYQIEFHVADEKPEAAPEEKPEKEGKPAREKEKDKDKEKEKDREKEKDKKELVPNLNPKYTFESFVSGPSNQFAYAASQAVANKPATNYNPLFIYGGVGLGKTHLVNAIGNHILAKNPKAKICYYSSEKFMNEMINSLRY--KKMDEFRNKFRKMDLLLIDDIQFMAGKEATQEEFFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQPPGVETKVAILKKKSDMHAVNLP-DDVAL-FLAEGANSNIRELEGMLIRLEAFASLTGQEITLSMAREVMKDI--------IVEKTRDITVEMIQKTVAEHFRIKVSELKSDKRIKTLVVPRQIAIYICRELTKASYPEIGEKFGGKDHSTIIHSVKKIEKQMAGDDEFKASVEDIRKKL 458
>gi|163797310|ref|ZP_02191263.1| ATPase [alpha proteobacterium BAL199] >gi|159177401|gb|EDP61957.1| ATPase [alpha proteobacterium BAL199] (473 aa)
Score = 426, Expect = 7.6e-40, Identities = 105/344 (30%), Positives = 186/344 (54%)
  Q:   103 TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           T  ++  LD RFTF N+ +G  N+ AF AA    + E   +  L +YG  GLGKTHL+HA+     +  PQ+ ++Y+  E F+ +  +A+    T    FK+ F +VD+L+IDD+QF++ K+   E FF+ FN L  +N+ +++++DK P  L  +++R+ SR   GL   I+ P T  ++  I+++ K  R++    +  +EF+A +  S++R LEG LN+I  H      P  I   +E +  +++S  D  +    +Q         +   + +    + S +R++  +  R++ MY+ ++  + S  EIG  F  R+H TV+ A+K V+    +D      +D
  S:   131 TDALSAPLDPRFTFANFVVGKPNELAFAAARRVADSETVPFNPLFLYGGVGLGKTHLMHAIAWNLREKHPQRRMLYMSAEKFMYQFIRALRFKDTVA--FKDLFRSVDVLMIDDVQFISGKDSTQEEFFHTFNALVDRNRQVIISADKSPNDLDGLEERLRSRLGWGLVADIH-PTTYELRLGILQS-KAERLEVSIPSKVLEFLAHKITSNVRELEGALNRIVAHTTLVGRPITIESTQEGLHDLLKS-HDRRVTIEEIQ-------RKVASHFNLRITDMHSARRSRSIARPRQIAMYLAKQLTHRSLPEIGRKFGGRDHTTVMHAVKKVDELRAADRHFDEDVD 465
>gi|32141219|ref|NP_733620.1| chromosomal replication initiator protein [Streptomyces coelicolor A3(2)] >gi|118710|sp|P27902|DNAA_STRCO Chromosomal replication initiator protein dnaA >gi|153240|gb|AAA26734.1| DnaA [Streptomyces coelicolor A3(2)] >gi|24413863|emb|CAD55464.1| chromosomal replication initiator protein [Streptomyces coelicolor A3(2)] (656 aa)
Score = 426, Expect = 7.6e-40, Identities = 104/331 (31%), Positives = 179/331 (54%)
  Q:   101 PKTLEINPT--LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           P T    PT  L+ ++ F+ + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F  +   +I +G  K + F+  +  +D+LL+DDIQFL +KE   E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +   + ++  P     +EFIA R + +IR LEG L ++      N  P ++ + E  ++ +I    D     +  +I    I+ +    +G+  + +    R +     R++ MY+ RE  +LS  +IG+ F  R+H TV+ A + +
  S:   306 PATGPGEPTARLNPKYLFDTFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDG--KGDSFRKRYREMDILLVDDIQFLADKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAVQEQLNAPPE--VLEFIASRISRNIRELEGALIRVTAFASLNRQPVDLGLTEIVLKDLIPGGED-----SAPEITSTAIMGATADYFGLTVEDLCGTSRGRALVTARQIAMYLCRELTDLSLPKIGALFGGRDHTTVMHADRKI 632
>gi|148239038|ref|YP_001224425.1| chromosomal replication initiation protein [Synechococcus sp. WH 7803] >gi|166215365|sp|A5GJL3|DNAA_SYNPW Chromosomal replication initiator protein dnaA >gi|147847577|emb|CAK23128.1| Chromosomal replication initiator protein dnaA [Synechococcus sp. WH 7803] (464 aa)
Score = 426, Expect = 7.7e-40, Identities = 105/347 (30%), Positives = 184/347 (53%)
  Q:    97 IEEKPKTLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           +   PK L   P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P+  + Y+ TE F   +  AI   G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I++I+ RF S+IR LEG L + + F  +  +     +  E +  +++           V++ P  +I+ +   +GV    + S  R +  S  R+V M+++R+   LS   IG  F  ++H TV+ AI+ +E K+ SD  L +
  S:   112 VTTAPKPLRRLPGLNMRYVFNRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPEARVFYVSTETFTNDLIVAIRRDG--MQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEQERVALPRD--LIQYISGRFTSNIRELEGALTRAVAFASITGMP----MTVESVAPMLDPSGQG------VEVTPQQVIDKVSEVFGVSVDDMRSSSRRRAVSQARQVGMFLMRQGTGLSLPRIGDTFGGKDHTTVMYAIEQIEKKLSSDPQLAS 447
>gi|56798246|dbj|BAD82889.1| DnaA [Burkholderia multivorans] (524 aa)
Score = 426, Expect = 7.8e-40, Identities = 114/337 (33%), Positives = 179/337 (53%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   188 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 511
>gi|109896333|ref|YP_659588.1| chromosomal replication initiator protein DnaA [Pseudoalteromonas atlantica T6c] >gi|109698614|gb|ABG38534.1| chromosomal replication initiator protein DnaA [Pseudoalteromonas atlantica T6c] (474 aa)
Score = 426, Expect = 7.9e-40, Identities = 117/340 (34%), Positives = 188/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           ++  + F+N+  G  N+ A +AAS  + +N    +  L IYG TGLGKTHLLHAVGN  +       ++Y+ +E F++ + KA+      +EEFK  + +VD LLIDDIQF  NKE+  E FF+ FN L   N+ I++TSD+ P  +  ++DR+ SRF  GL+I I  P+ E+   I++    +++I  P  +    FIA R  S++R LEG LN++  +      P  I    E +R ++       +   LV I  D I +++   Y +    ++SK+R++  +  R++ M + +E  N S  EIG  F  R+H TVL A + +    +   D+K    N++
  S:   139 INFNYKFDNFVEGKSNQLA-RAASKQVSDNPGKAYNPLFIYGGTGLGKTHLLHAVGNGIIDNKKDATVVYMHSERFVQDMVKALQNNA--IEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIDGVEDRLKSRFGWGLTIAIEPPELETRVAILMRKALENKIVLP--DEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL------ALQEKLVTI--DNIQKTVAEYYKIKMADILSKRRSRSVARPRQMAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIVQLREESHDIKEDYQNLI 469
>gi|168334923|ref|ZP_02693043.1| DnaA [Epulopiscium sp. 'N.t. morphotype B'] (445 aa)
Score = 426, Expect = 8.0e-40, Identities = 132/443 (29%), Positives = 221/443 (49%)
  Q:     9 KKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEK--DINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKN-PFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +K+  I K +E E  + +F N +   + +  I D+ + I VK+D  K + +  Y ++        ++   N+ FI KE     I K           L     L+ ++TF ++ +G  N+ A  A     +    ++  L +YG  GLGKTHL+ ++ +  ++  P   ++Y  TE F  ++  +I +       F+N + N+D+LLIDDIQF+  KE+  E FF+ FN L   NK I+++SD+ P  ++ ++ R+ SRF  GL   +  PD E+   I+    KK+ ++N    +  ++FIA    S+IR LEG LN+I  F  L N   N  + EE ++  I S     I      I P  I   + + Y +    ++S KR +  S  R++ MY+ R+  NLS  +I   F  R+H T+L     +  ++  DE L  F+  +  K
  S:     5 EKWNSILKLVEIETSSVSF-NTWFKQTKLSNISDDTLTITVKDDLSKSILSTRYFDLIRTSAVTVLDKKYNLEFIIKESNPLSITKIATNRIAIQDPLNAPSNLNPKYTFNSFVVGNSNRMAHAATMAVAKMPAKSYNPLFLYGGVGLGKTHLMQSIAHFTLKHHPNLKVLYTSTEKFTNELINSIRDDQNNA--FRNKYRNIDILLIDDIQFIAGKERTQEEFFHTFNTLYEANKQIIISSDRTPKEIEFLESRLRSRFEWGLIADLQPPDLETRIAIL---KKKAEMENITIDSNVLQFIAETIISNIRELEGALNRIIAFSSLSNETINLELTEEALKDTILSKESISI------ITPSYIQSIVAMTYNITISELLSSKRVRTISRPRQIAMYLCRKLTNLSLTKIAEQFGGRDHTTILHGYDKIAKELVEDEQLAYFITQLELK 441
>gi|189345559|ref|YP_001942088.1| chromosomal replication initiator protein DnaA [Chlorobium limicola DSM 245] >gi|189339706|gb|ACD89109.1| chromosomal replication initiator protein DnaA [Chlorobium limicola DSM 245] (491 aa)
Score = 426, Expect = 8.4e-40, Identities = 118/369 (31%), Positives = 194/369 (52%)
  Q:    83 ITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           I  E +D  + L   E           L++++TFE    G  N  AF AAS  + +N   N +  L+IYG  GLGKTH++ A+GN        + ++Y+ +E F      AI  G  K++EF + +  +D+L+IDDIQF   KEK  E  F+IFN L+  NK I++++D+    +K I+DR+ISRFN GLS  I  PD E+ K II+  + +S +        IEFIA     ++R LEG + K+     LDN + +    +  ++ II   +         Q+  D I +++C  Y +    +  K + K+ +  R++ MY+ +     S   IG  F  R+H+TV+ A+  +E +V++  + +  ++ I  +
  S:   134 IASERRDYERNLMRFETH---------LNTKYTFETLIRGDCNSLAF-AASKSIAQNPGQNAFNPLVIYGGVGLGKTHMIQAIGNSVRTNCLSEKVLYVSSEKFAIDFVNAIQNG--KIQEFSSFYRTIDVLIIDDIQFFAGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKEIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLHQSGVN--LDEAVIEFIATNVTENVRELEGCIVKLLAAQSLDNQEIDLQFTKSTLKDIIRHTTK--------QLTLDTIEKAVCSFYSITPNDLKGKSKKKEIAAGRQMAMYLAKLLTESSLKTIGLHFGGRDHSTVIHALNTIEKRVEAISEERKKIEEIKKR 485
>gi|83719949|ref|YP_443733.1| chromosomal replication initiation protein [Burkholderia thailandensis E264] >gi|123726547|sp|Q2STL6|DNAA_BURTA Chromosomal replication initiator protein dnaA >gi|83653774|gb|ABC37837.1| chromosomal replication initiator protein DnaA [Burkholderia thailandensis E264] (536 aa)
Score = 425, Expect = 8.5e-40, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   200 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 523
>gi|161523181|ref|YP_001578193.1| chromosomal replication initiation protein [Burkholderia multivorans ATCC 17616] >gi|189348958|ref|YP_001944586.1| chromosomal replication initiator protein [Burkholderia multivorans ATCC 17616] >gi|160340610|gb|ABX13696.1| chromosomal replication initiator protein DnaA [Burkholderia multivorans ATCC 17616] >gi|189332980|dbj|BAG42050.1| chromosomal replication initiator protein [Burkholderia multivorans ATCC 17616] (524 aa)
Score = 425, Expect = 9.3e-40, Identities = 114/337 (33%), Positives = 179/337 (53%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   188 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 511
>gi|62425105|ref|ZP_00380242.1| COG0593: ATPase involved in DNA replication initiation [Brevibacterium linens BL2] (530 aa)
Score = 425, Expect = 9.7e-40, Identities = 109/337 (32%), Positives = 178/337 (52%)
  Q:    99 EKPKTLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVE---EFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           E P   ++NP    ++TF+ + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G    QLFP+  + Y+ +E+F+      I    T       F+  +  VD+L+IDDIQFL  K+   E FF+ FN L+++ K +V+TSD+ P  LK  ++R+ SRF  GL   +  PD E+   I+       ++  P  N  +E+IA R +S+IR LEG L ++  F  L++   +  + E  ++  I  D    I +       DI+ ++    + +    +    R++  +  R++ MY+ RE   LS  +IG  F  R+H TV+ A K + T++
  S:   178 EVPGVAQLNP----KYTFDTFVIGASNRFAHAAAFAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIGYYATQLFPEIRVKYVSSEEFVNDFINTIGSSKTSNSLRPAFQRRYREVDILMIDDIQFLQGKDATVEEFFHTFNALHNEVKQVVITSDQPPKMLKGFEERLRSRFEWGLLTDVQPPDMETRFAILRRKAAGEQLDVP--NDVLEYIASRISSNIRELEGALIRVTAFANLNDQQVDVSLAETVLKDFITQDDTPAITA------ADIMGQTAAY-FSLTLDDLCGTSRSRTLTTARQIAMYLCRELTELSLPKIGQAFGGRDHTTVMHANKKIRTQM 507
>gi|34495456|ref|NP_899671.1| chromosomal replication iniciator protein DnaA [Chromobacterium violaceum ATCC 12472] >gi|61212703|sp|Q7P259|DNAA_CHRVO Chromosomal replication initiator protein dnaA >gi|34101312|gb|AAQ57681.1| chromosomal replication iniciator protein DnaA [Chromobacterium violaceum ATCC 12472] (467 aa)
Score = 425, Expect = 1.1e-39, Identities = 113/341 (33%), Positives = 181/341 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMS 450
           L+  FTF+    G  N+ A +AA++ + EN     +  L +YG  GLGKTHL+ A+GN   Q  PQ  + YI  E ++  I +A        +EFK  + ++DLLLIDDIQF   K +  E FF  FN L    K ++MT D  P  ++ +++R+ISRF+ GL+++I  P+ E    I+++  +   IK    N+A  FIA    S++R LEG L ++  Y          E++ +E ++ I+ + +         Q+  D I +++   Y +    + SKKR++  +  R+V M + +E   LS   IG  F  R+H TVL A K +     SD D+    + ++S
  S:   131 LNPSFTFDTLVTGKGNQLA-RAAAMQIAENPGDQAYNPLFVYGGVGLGKTHLIQAIGNHVFQKNPQAKIRYIHAERYVADIMRAYQHKA--FDEFKRYYHSLDLLLIDDIQFFAGKNRTQEEFFYAFNALIEGGKQVIMTCDSYPKQIEGMEERLISRFSWGLTVEIQPPELEMRVAILMKKAEADSIKLE-HNVAF-FIAQNVRSNVRELEGALKRVVAYARFTSQNITLELV-KEALKDILAAGNR--------QVTVDAIQKTVAEYYKIKLSDMHSKKRSRDIARPRQVAMALAKELTQLSLPNIGDAFGGRDHTTVLHACKTITEMRASDADIAHDYEALLS 463
>gi|186474774|ref|YP_001856244.1| chromosomal replication initiator protein DnaA [Burkholderia phymatum STM815] >gi|184191233|gb|ACC69198.1| chromosomal replication initiator protein DnaA [Burkholderia phymatum STM815] (518 aa)
Score = 424, Expect = 1.1e-39, Identities = 114/337 (33%), Positives = 179/337 (53%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   182 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLMDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLNEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYSIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 505
>gi|33867691|gb|AAQ55180.1| DnaA [Mycoplasma mycoides subsp. mycoides LC] (450 aa)
Score = 424, Expect = 1.2e-39, Identities = 143/428 (33%), Positives = 228/428 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDF-------VKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +E+ YN+Y+   +I K    +  ++VK+ F        ++   NE K I +E  +I            ++++ INK+   I  K K  +IN       TFEN+ IG  N+ AF A     +    ++  L IYG +G+GKTHLL A  N     F    + Y+  ++F  K    + +   ++E+FKN     D+L+IDD+QFL+ KEK NEIFF IFN     +K +  +SDK P  L   D+R+I+RFN GLSI I K D ++   II + IK   IK+  ++ AI FI+  ++ D+R ++G ++++ F    N  P E I   +I S +  D      S L  +N   I E +   YG+   ++  K R+K     R + M++ +E +N +  +IG  F  R+H TV+ A + +ET +K D+ LK  +D + +K
  S:    21 DESVYNDYIKTINIHKKGISDYIVVVKSQFGLLAIKQFRQTIENEIKNILKEPVNISFTYEQEYKKQLEKDELINKDHSDIITK-KVKKINEN-----TFENFVIGASNEQAFIAVQTASKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNEVCQNDVLIIDDVQFLSYKEKTNEIFFTIFNNFIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKSEVTSEAINFISNYYSDDVRKIKGSVSRLNFWSQQN--PEEKIITIEIISDLFRDIP---TSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMFLTKEILNHTLAQIGEEFGGRDHTTVINAERKIETMLKKDKQLKKTVDILKNK 446
>gi|28202301|gb|AAO34747.1| chromosomal replication initiator protein dnaA [Clostridium tetani E88] (342 aa)
Score = 424, Expect = 1.2e-39, Identities = 117/346 (33%), Positives = 195/346 (56%)
  Q:   106 INPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ++  L+ ++TF+++ IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  +Q      ++Y+ +E F  ++  +I +   K EEF+N + NVD+LLIDDIQF+  KE+  E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +      +  P  N  + +IA +  S+IR LEG L +I  F  L N + +  +  E ++ II S    ++   L+Q   DI+       + +  +   S +R +  +F R++ MY+ R+  + S  +IG  F  R+H TV+   + + T +K D+ L+  ++ + SK
  S:     1 MSAMLNPKYTFDSFVIGNSNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYILQNNSNVKVVYVSSEKFTNELINSIKD--DKNEEFRNKYRNVDVLLIDDIQFIAGKERTQEEFFHTFNALHEANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQAPDFETRMAILKKKADVEHLNIP--NEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLASEALKDIISSKESNQVTIELIQ---DIVSSY----FNLRVEDFKSSRRTRNVAFPRQIAMYLCRKLTDNSLPKIGEEFGGRDHTTVIHGYEKISTALKKDDSLQKTVNELTSK 338
>gi|188158960|ref|ZP_02998425.1| Chromosomal replication initiator protein DnaA [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|188159862|ref|ZP_02998945.1| Chromosomal replication initiator protein DnaA [Mycoplasma mycoides subsp. mycoides LC str. GM12] (450 aa)
Score = 424, Expect = 1.2e-39, Identities = 143/428 (33%), Positives = 228/428 (53%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDF-------VKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           +E+ YN+Y+   +I K    +  ++VK+ F        ++   NE K I +E  +I            ++++ INK+   I  K K  +IN       TFEN+ IG  N+ AF A     +    ++  L IYG +G+GKTHLL A  N     F    + Y+  ++F  K    + +   ++E+FKN     D+L+IDD+QFL+ KEK NEIFF IFN     +K +  +SDK P  L   D+R+I+RFN GLSI I K D ++   II + IK   IK+  ++ AI FI+  ++ D+R ++G ++++ F    N  P E I   +I S +  D      S L  +N   I E +   YG+   ++  K R+K     R + M++ +E +N +  +IG  F  R+H TV+ A + +ET +K D+ LK  +D + +K
  S:    21 DESVYNDYIKTINIHKKGISDYIVVVKSQFGLLAIKQFRQTIENEIKNILKEPVNISFTYEQEYKKQLEKDELINKDHSDIITK-KVKKINEN-----TFENFVIGASNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNEVCQNDVLIIDDVQFLSYKEKTNEIFFTIFNNSIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNIKSEVTSEAINFISNYYSDDVRKIKGSVSRLNFWSQQN--PEEKIITIEIISGLFRDIP---TSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMFLTKEILNHTLAQIGEEFGGRDHTTVINAERKIETMLKKDKQLKKTVDILKNK 446
>gi|171316345|ref|ZP_02905565.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria MEX-5] >gi|171098474|gb|EDT43276.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria MEX-5] (525 aa)
Score = 424, Expect = 1.3e-39, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 512
>gi|167957210|ref|ZP_02544284.1| chromosomal replication initiator protein DnaA [candidate division TM7 single-cell isolate TM7c] (451 aa)
Score = 424, Expect = 1.3e-39, Identities = 114/370 (30%), Positives = 202/370 (54%)
  Q:    83 ITKEEKDINKELPTI--EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP-FSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           ITK E+      P I   +K  T  +NP    R+TF+N+ +G  N  A+ A  ++       +  L +YG +GLGKTHL+ AVGN+ ++  P   ++YI TE F+ +   +I     K + F + + NVD+L++DD+QF+  KEK  + FF+ FN L+  NK I+++SDK P S+  + DR+ SRF  G++I I  PD E+   I+     K+ I N    +  +E++A  F ++IR LEG LN++  +  + N  P+ +  E  +  I  S   +        +    II+     Y +D K + S +R+K  +  R++ M++LR ++ +S+ +I      ++H T + +I+ +  +  ++  ++  +++I  K 
  S:    92 ITKTERS-GSSAPLILPSKKSHTSNLNP----RYTFDNFIVGSSNDLAYAACQAVASHPGEKYNPLYLYGGSGLGKTHLMQAVGNEIIKKQPSARVLYITTETFVNEFLDSIR---FKKKGFSDKYRNVDVLIVDDMQFIAGKEKTQDEFFHTFNDLHQNNKQIIISSDKPPKSIPTLTDRLRSRFEWGMAIDIQMPDYETRCAIV---KAKAEISNTELDSDVVEYLATNFKTNIRELEGALNRLLAYAEMQNFTPDLMAAEGILGDIKRSRPQH--------VTAKQIIDKTARYYNIDVKDMCSSRRDKFIATPRQIAMFLLRSELKMSFPKIAQELGRKDHTTAMHSIEKITKESLTNVSIREQINDIKDKL 448
>gi|182437493|ref|YP_001825212.1| putative replication initiator protein [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178466009|dbj|BAG20529.1| putative replication initiator protein [Streptomyces griseus subsp. griseus NBRC 13350] (622 aa)
Score = 424, Expect = 1.3e-39, Identities = 102/331 (30%), Positives = 180/331 (54%)
  Q:   101 PKTLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           P   E +  L+ ++ F+ + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F  +   +I +G  K + F+  + +VD+LL+DDIQFL +KE   E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL+  +  P+ E+   I+ +   + ++  P     +EFIA R + +IR LEG L ++      N  P ++ + E  ++ +I    +     +  +I    I+ +    +G+    +    R++     R++ MY+ RE  +LS  +IG+ F  R+H TV+ A + +
  S:   274 PGPGEPHARLNPKYLFDTFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDG--KGDTFRKRYRDVDILLVDDIQFLASKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWGLTTDVQPPELETRIAILRKKAVQEQLNAPPE--VLEFIASRISRNIRELEGALIRVTAFASLNRQPVDLGLTEIVLKDLIPGGEE-----SAPEITAPAIMAATADYFGLTVDDLCGSSRSRVLVTARQIAMYLCRELTDLSLPKIGAQFGGRDHTTVMHADRKI 598
>gi|83815237|ref|YP_444159.1| chromosomal replication initiator protein DnaA [Salinibacter ruber DSM 13855] >gi|83756631|gb|ABC44744.1| chromosomal replication initiator protein DnaA [Salinibacter ruber DSM 13855] (524 aa)
Score = 424, Expect = 1.4e-39, Identities = 104/351 (29%), Positives = 179/351 (50%)
  Q:   102 KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFH-LLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K  E++  L+  +TF+ +  G  N+ A  AA     +    ++   L+YG  GLGKTHL+ A+GN        K + Y+ +E F  +  ++I E   ++ EF   +  VD+L++DD+QF   KEK  E FF+IFN L      IV+++D+ P  +  +++R++SRF  GLS  +  P  ++  +I I   K         +  +EFIA    S+IR LEG L ++  H  L  +D    + +E +  + +  +    V ++ +I        +C   G+ ++ + SK R +  +  R++ MY  ++    S  +IG  F  R+H+TV+ A   VE ++  DE  +  +D I  K 
  S:   177 KNAEVDNQLNDSYTFDRFIEGACNRLARSAAHSIATDPGETSFNPFLVYGGVGLGKTHLIQAIGNHVAARDASKTVFYVSSERFTTEFVQSIQE--NQIGEFSTFYRQVDVLIVDDVQFFGGKEKTQEEFFHIFNALRQAGNQIVLSADRPPREIDGLEERLLSRFQWGLSADLKPPGLDT--RISILRRKAEDDGIDLDDDVVEFIAQSIESNIRELEGALIRLLAHATLHQLDITLDLAKEVLHDLFQERAATLTVDDIQRI--------VCEHLGISQEKMRSKTRKRDVTRARQIAMYFTKKHTQHSLKDIGLHFGGRDHSTVIHANNAVEDRMADDESFRDTVDAIGQKL 519
>gi|189501471|ref|YP_001957188.1| chromosomal replication initiator protein DnaA [Candidatus Amoebophilus asiaticus 5a2] >gi|189496912|gb|ACE05459.1| chromosomal replication initiator protein DnaA [Candidatus Amoebophilus asiaticus 5a2] (477 aa)
Score = 423, Expect = 1.5e-39, Identities = 119/361 (32%), Positives = 198/361 (54%)
  Q:    91 NKELPTIEEKP---------KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL-LDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           N   P++ + P         K L     L+  +TFE +  G  N+ A  AA    ++  NN +  L++YG  GLGKTH++ A+GN+    F  K ++Y  +E F  +  +++      V++F + +   D+L++DD+QFL  KEK  EIFF+IFN L+   K IVMTSD  P  LK + +R++SRF  GL+  + +PD E+   II   I+   I        +E+IA   +++IR LEGV+  +  H  L+  D +  + ++ +++I+  D D E       I+ D + + +   + V  +S+ SK R K+    R+V MY+ +   N S   IG +   R+H+TV+ AI+ V+  + ++   KA  + I  K
  S:   107 NNNQPSLTDSPHNPFTLKNFKDLHQASYLNPNYTFETFIEGDCNQLARSAAQAVAKKPGNNAFNPLMLYGKVGLGKTHIVQALGNEVKAHFSNKFVLYASSEQFTTQFIESLRN--NSVQDFTHFYLQADVLILDDVQFLVGKEKTQEIFFHIFNHLHQSGKQIVMTSDCPPRDLKGLQERLLSRFKWGLTADLQQPDFETRIAIIKNKIQADGID--IGEDLVEYIAQSVDTNIRELEGVIISLIAHASLNKRDVDLGLAKQVLKNIVH-DIDTE-------ISIDYLHKIVTEHFNVSLESIKSKTRKKEIVIARQVAMYLAKHYTNHSLKSIGQYCGGRDHSTVIHAIQAVDDMLHTEHQFKASFEEIKRK 468
>gi|86139417|ref|ZP_01057986.1| chromosomal replication initiation protein [Roseobacter sp. MED193] >gi|85823920|gb|EAQ44126.1| chromosomal replication initiation protein [Roseobacter sp. MED193] (472 aa)
Score = 423, Expect = 1.5e-39, Identities = 103/336 (30%), Positives = 188/336 (55%)
  Q:   103 TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSD 438
           TL+  P LD RFTF+N+ +G  N+ A  AA    E     +  L++YG  GLGKTHL+HA+  +     P  N++Y+  E F+ +  +A+ E   K+ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   ++  +   P   +A   +EF+A R ++++R LEG L +++ F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E    +D
  S:   126 TLQAAP-LDPRFTFDNFVVGKPNELAHAAARRVAEGGPVTFNPLVLYGGVGLGKTHLMHAIAWEITVQNPSLNVLYLSAEQFMYRFVQALRE--RKMMDFKHLFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVKSRLQCGLVVDLHPTDYELRLGILQTKVQLQQQTYPDLEIADGVLEFLAHRISTNVRVLEGALTRLFAFASLVGREIDMDLTQDCLADVLRA-SERKITVEEIQ-------RKVSEYYNIRMSDIIGPKRLRSYARPRQVAMYLCKKLTSRSLPEIGRRFGGRDHTTVMHGVRRIEELKSTD 456
>gi|88813024|ref|ZP_01128266.1| chromosomal replication initiator protein DnaA [Nitrococcus mobilis Nb-231] >gi|88789657|gb|EAR20782.1| chromosomal replication initiator protein DnaA [Nitrococcus mobilis Nb-231] (432 aa)
Score = 423, Expect = 1.6e-39, Identities = 107/340 (31%), Positives = 179/340 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVS---NLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+  FTF+ +  G  N+ A  A+S  +E     +  L IYG  GLGKTHL+HA+GN  +Q  P   ++Y+ +E F+  + KA+      + EFK  +  V+ LLIDDIQF   KE+  E FF+ FN L    + +VM+ D+ P  ++ +++R+ SRF  GL++ I  P+ E+   I++       I+ P       FIA R  S++R LEG L ++          N     E+I       +  ++++    LV I  + I  ++   Y +    ++SK+R++  +  R++ M + +   + S  EIG+ F  R+H TVL A + V   +K+D  L    +N++
  S:    97 LNPNFTFDTFVEGKSNQLARAASSQLVENPGGAYNPLFIYGGVGLGKTHLMHAIGNALLQRLPDAEVLYLHSERFVGDMVKALQHNA--INEFKRYYRGVNALLIDDIQFFAGKERSQEEFFHTFNALLEGQQQVVMSCDRYPKEVQGLEERLKSRFGWGLTVAIEPPEFETRAAILMTKANLEGIELPHE--VAFFIAKRIRSNVRELEGALRRVI--------ANSYFTGERITVEFTKGALRDLLALHDKLVTI--ENIQRTVAEYYKIRLTDLLSKRRSRSITRPRQIAMALAKSLTSHSLPEIGNAFGGRDHTTVLHACRKVAELMKADTRLAEDYNNLL 427
>gi|29830859|ref|NP_825493.1| replication initiator protein [Streptomyces avermitilis MA-4680] >gi|38257424|sp|Q82FD8|DNAA_STRAW Chromosomal replication initiator protein dnaA >gi|29607972|dbj|BAC72028.1| putative replication initiator protein [Streptomyces avermitilis MA-4680] (653 aa)
Score = 423, Expect = 1.6e-39, Identities = 104/331 (31%), Positives = 179/331 (54%)
  Q:   101 PKTLEINPT--LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           P T    PT  L+ ++ F+ + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F  +   +I +G  K + F+  +  +D+LL+DDIQFL +KE   E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +   + ++  P     +EFIA R + +IR LEG L ++      N  P ++ + E  ++ +I    D     +  +I    I+ +    +G+  + +    R +     R++ MY+ RE  +LS  +IG+ F  R+H TV+ A + +
  S:   303 PATGPGEPTARLNPKYLFDTFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDG--KGDSFRKRYREMDILLVDDIQFLADKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAVQEQLNAPPE--VLEFIASRISRNIRELEGALIRVTAFASLNRQPVDLGLTEIVLKDLIPGGED-----SAPEITAPAIMAATADYFGLTVEDLCGTSRGRALVTARQIAMYLCRELTDLSLPKIGAQFGGRDHTTVMHADRKI 629
>gi|134096621|ref|YP_001102282.1| chromosomal replication initiation protein [Saccharopolyspora erythraea NRRL 2338] >gi|133909244|emb|CAL99356.1| chromosomal replication initiator protein DnaA [Saccharopolyspora erythraea NRRL 2338] (592 aa)
Score = 423, Expect = 1.6e-39, Identities = 107/326 (32%), Positives = 177/326 (54%)
  Q:   110 LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVS-NLVQINPD---IIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           L++++TF+ + IG  N+     A +        +  L I+G +GLGKTHLLHAVG+   +LFP   + Y+ TE+F      ++ +   +   F+  + +VD+LL+DDIQFL  KE   E FF+ FN L++ NK IV++SD+ P  L+ ++DR+ +RF  GL   I  P+ E+   I+ +   + R+  P     +EFIA R   +IR LEG L ++      N  P ++ + E  +R +I      EI +  ++ +  D   + I+ +C G G          + K  +  R++ MY+ RE  + S  +IG  F  R+H TV+ A K +  ++
  S:   251 LNAKYTFDTFVIGASNRFAHAAAVAAAEAPARAYNPLFIWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEFTNDFINSLRD--DRQVAFQRRYRDVDVLLVDDIQFLEGKEGTQEEFFHTFNTLHNSNKQIVVSSDRPPKGLRTLEDRLRTRFEWGLITDIQPPELETRIAILRKKAAQDRMNAPAD--VLEFIAARIERNIRELEGALIRVTAFASLNRQPVDVQLAEIVLRDLIPDSQTPEITAPTIMAVTADFFSVTIDDLC-GPG----------KTKALAQARQIAMYLCRELTDSSLPKIGQSFGGRDHTTVMHADKKIRKEM 568
>gi|164686446|ref|ZP_02210474.1| hypothetical protein CLOBAR_00011 [Clostridium bartlettii DSM 16795] >gi|164604457|gb|EDQ97922.1| hypothetical protein CLOBAR_00011 [Clostridium bartlettii DSM 16795] (451 aa)
Score = 422, Expect = 2.0e-39, Identities = 132/442 (29%), Positives = 223/442 (50%)
  Q:     8 KKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEIN--------PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV--ETKVKSDEDLKAFLDNIM 449
           KK   +IK E+      E F+ N V      +     + +L  N+F +++    Y  + E   S   ++   +  I+   +     L T          +        P L+ ++TF+ + IG  N+ A  A     E     +  L +YG  GLGKTHL+HA+G+  ++      ++Y+ +E F  ++  +I     K EEF+N + NVD+LLIDDIQF+  KE   E FF+ FN L+  NK I+++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+    +   I  P  N  + +IA    S+IR LEG L ++  +  L N D +  +  E ++ I+ +    EI  N ++       E +   +G+      SKKR +  ++ R++ MY+ RE  +LS  +IG+ F  R+H TV+ A   +  + +++ + +LK  +D I+
  S:     8 KKTLQLIKGEVASA-SFETFFKNTV----PIETDSNELTLLAPNEFAEDILRTRYLNLIESCLSQLTSNKFEIKIISDSNEVEQNPLKTSNNNHNINNNSNNNIIRNYPRLNPKYTFDTFVIGNSNRFAHAACVAVAESPAKAYNPLFLYGGVGLGKTHLMHAIGHSIMKEQNDAKVVYVSSEKFTNELINSIKS--DKNEEFRNKYRNVDILLIDDIQFIAGKEGTQEEFFHTFNALHEANKQIIISSDRPPKEIPTLEDRLRSRFEMGLIADIQPPDFETRIAILKTKAQIENIDIP--NEVMNYIATYIKSNIRELEGALTRVVAYSSLINKDISYDLAVEALKDIVTTSESQEISVNRIK-------EKVSTTFGIKMDDFNSKKRTRAIAYPRQIAMYLSRELTDLSLPKIGNEFGGRDHTTVIHAHDKISKDLELEKNSELKEKIDKII 446
>gi|170697754|ref|ZP_02888841.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria IOP40-10] >gi|170137369|gb|EDT05610.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria IOP40-10] (525 aa)
Score = 422, Expect = 2.0e-39, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 512
>gi|119485656|ref|ZP_01619931.1| chromosomal replication initiation protein [Lyngbya sp. PCC 8106] >gi|119456981|gb|EAW38108.1| chromosomal replication initiation protein [Lyngbya sp. PCC 8106] (452 aa)
Score = 422, Expect = 2.0e-39, Identities = 109/418 (26%), Positives = 209/418 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELP------TIEEKPKTLEINP-TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           ++ ++  +S  ++++  + I   N F +      YKEI  E     +   + ++  T+ +  +++         T+ E P    + P  L+S++ F  + +G  ++ A  AA    E     +  L + G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI +    ++ F++ +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  + ++ +R+ SRF+ GL   I  PD E+   I+ +  +   ++   S   +E+IA R+ S+IR LEG L +   +   +  P  + +   + S  E   +          +P+ +I+ +   + V  + +    R ++ S  R+V MY++R+  +LS  +IG  F  ++H TV+ + + +      D +L   L
  S:    25 FDTWIKTASAERLENHCLVIRTPNPFARNWLQKHYKEIIAEAAQDILGYPVEIYVTTETQMTLDQAKSQRVWPSTVTETPSNQRLKPPNLNSKYVFSRFVVGANSRLAHAAALAVAESPGREFNPLFLCGGVGLGKTHLMQAIGHYRIEINPDAKVFYVSTEKFTNDLIAAIRK--DSMQSFRDHYRAADVLLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVLASDRPPNQIPRLQERLCSRFSMGLVADIQPPDLETRMAILQKKAEYENVR--LSEGVVEYIASRYTSNIRELEGALIRAVAYTSISGLPMTVESIAPVLSPAEQPQES---------SPEAVIQIVAETFKVSVEDLKGTSRRREISLARQVSMYLMRQHTDLSLPKIGELFGGKDHTTVMYSCEKITQLRNKDLELAQTL 438
>gi|116688025|ref|YP_833648.1| chromosomal replication initiation protein [Burkholderia cenocepacia HI2424] >gi|166201863|sp|A0K2M8|DNAA_BURCH Chromosomal replication initiator protein dnaA >gi|116646114|gb|ABK06755.1| chromosomal replication initiator protein DnaA [Burkholderia cenocepacia HI2424] (525 aa)
Score = 422, Expect = 2.0e-39, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 512
>gi|115350057|ref|YP_771896.1| chromosomal replication initiation protein [Burkholderia ambifaria AMMD] >gi|172059068|ref|YP_001806720.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria MC40-6] >gi|122324479|sp|Q0BJW1|DNAA_BURCM Chromosomal replication initiator protein dnaA >gi|115280045|gb|ABI85562.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria AMMD] >gi|171991585|gb|ACB62504.1| chromosomal replication initiator protein DnaA [Burkholderia ambifaria MC40-6] (525 aa)
Score = 422, Expect = 2.2e-39, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 512
>gi|110677616|ref|YP_680623.1| chromosomal replication initiation protein [Roseobacter denitrificans OCh 114] >gi|123362395|sp|Q16DK6|DNAA_ROSDO Chromosomal replication initiator protein dnaA >gi|109453732|gb|ABG29937.1| chromosomal replication initiator protein DnaA [Roseobacter denitrificans OCh 114] (454 aa)
Score = 422, Expect = 2.2e-39, Identities = 101/335 (30%), Positives = 186/335 (55%)
  Q:    98 EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP---FSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVE 432
           E+ P++      LD+RFTF+N+ +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+ ++     P+ N++Y+  E F+ +  +A+ +   K+ +FK  F +VD+L++DD+QF+  K    E FF+ FN L  +NK I+++ D+ P  +K +++R+ SR   GL + ++  D E    I+   +++ R   P    S+  +EF+A R ++++R LEG L ++  F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  +K +E
  S:   102 EKTPRSTLSTAPLDARFTFDNFIVGKPNELAHAAAKRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAHELRLRRPEMNVLYLSAEQFMYRFVQALRD--RKMMDFKEIFRSVDVLMVDDVQFIAGKGSTQEEFFHTFNALVDQNKQIIISGDRAPGEIKDMEERVKSRLQCGLVVDLHPTDYELRLGILQSKVEQQRKNYPGLDISDGVLEFLAHRISTNVRVLEGALTRLCAFASLVGREIDMELTQDCLSDVLRA-SERKITVEEIQ-------RKVSDHYNIRLSDMIGPKRLRSYARPRQVAMYLSKKMTSRSLPEIGRRFGGRDHTTVMHGVKRIE 432
>gi|11132615|sp|Q9ZH75|DNAA_STRCH Chromosomal replication initiator protein dnaA >gi|3800785|gb|AAD08807.1| DNA replication initiator protein [Streptomyces chrysomallus] (624 aa)
Score = 421, Expect = 2.6e-39, Identities = 100/322 (31%), Positives = 176/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           L+ ++ F+ + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F  +   +I +G  K + F+  + +VD+LL+DDIQFL +KE   E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL+  +  P+ E+   I+ +   + ++  P     +EFIA R + +IR LEG L ++      N  P ++ + E  ++ +I    +     +  +I    I+ +    +G+    +    R +     R++ MY+ RE  +LS  +IG+ F  R+H TV+ A + +
  S:   285 LNPKYLFDTFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDG--KGDTFRKRYRDVDILLVDDIQFLASKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWGLTTDVQPPELETRIAILRKKAVQEQLNAPPE--VLEFIASRISRNIRELEGALIRVTAFASLNRQPVDLGLTEIVLKDLIPGGEE-----SAPEITAPAIMAATADYFGLTVDDLCGSSRTRVLVTARQIAMYLCRELTDLSLPKIGAQFGGRDHTTVMHADRKI 600
>gi|29653365|ref|NP_819057.1| chromosomal replication initiator protein DnaA [Coxiella burnetii RSA 493] >gi|154706441|ref|YP_001423440.1| chromosomal replication initiator protein DnaA [Coxiella burnetii Dugway 5J108-111] >gi|161830473|ref|YP_001595901.1| chromosomal replication initiator protein DnaA [Coxiella burnetii RSA 331] >gi|164685862|ref|ZP_01947694.2| chromosomal replication initiator protein DnaA [Coxiella burnetii 'MSU Goat Q177'] >gi|165924211|ref|ZP_02220043.1| chromosomal replication initiator protein DnaA [Coxiella burnetii RSA 334] >gi|189044636|sp|A9KEU8|DNAA_COXBN Chromosomal replication initiator protein dnaA >gi|189044637|sp|A9N900|DNAA_COXBR Chromosomal replication initiator protein dnaA >gi|38257444|sp|Q83FD8|DNAA_COXBU Chromosomal replication initiator protein dnaA >gi|29540627|gb|AAO89571.1| chromosomal replication initiator protein DnaA [Coxiella burnetii RSA 493] >gi|154355727|gb|ABS77189.1| chromosomal replication initiator protein DnaA [Coxiella burnetii Dugway 5J108-111] >gi|161762340|gb|ABX77982.1| chromosomal replication initiator protein DnaA [Coxiella burnetii RSA 331] >gi|164601379|gb|EAX31682.2| chromosomal replication initiator protein DnaA [Coxiella burnetii 'MSU Goat Q177'] >gi|165916345|gb|EDR34949.1| chromosomal replication initiator protein DnaA [Coxiella burnetii RSA 334] (451 aa)
Score = 421, Expect = 2.7e-39, Identities = 122/422 (28%), Positives = 211/422 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKN----DFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEK---PKTLEINPT---LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIII-----ESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           YN ++      + K   + +L  N    D++ E F N   E+ +E         L +   + E    N   P+  +    P    I+ T   ++S FTF+++  G  N+ A  AA+   E     +  L IYG  GLGKTHL+HAVGN  ++    K ++Y+ +E F+  + KA+      + EFK  + +++ LLIDDIQF   K++  E FF+ FN L    + I++T D+ P  +  +++R+ SRF  GL++ I  P+ E+   I++   ++ ++  P       FIA    S++R LEG L ++            I N       I  D   E + +L+ +   +I      +++   Y +    +++K+RN+  +  R++ M + +E  N S  EIG  F  R+H TVL A + V+  + +  D+     N+M
  S:    24 YNTWIRPLHAIESKQNGLLLLAPNRFVLDWINERFLNRITELLDELSDTPPQIRLQIGSRSTEMPTKNSHEPSHRKAAAPPAGTTISHTQANINSNFTFDSFVEGKSNQLARAAATQVAENPGQAYNPLFIYGGVGLGKTHLMHAVGNAILRKDSSKKVLYLHSERFVADMIKALQHNA--MNEFKRFYRSLNALLIDDIQFFAGKDRSQEEFFHTFNALLDGQQQIILTCDRYPKEINGLEERLQSRFGWGLTVAIEPPELETRVAILMSKAEQLKVHLPHE--VAFFIAKHIQSNVRELEGALKRV------------IANAHFTGQSITVDFTREALKDLLTLQARLITIENIQKTVAEYYKIKVADLLAKRRNRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKVKELLATSLDILEDYKNLM 446
>gi|115372312|ref|ZP_01459622.1| chromosomal replication initiator protein DnaA [Stigmatella aurantiaca DW4/3-1] >gi|115370777|gb|EAU69702.1| chromosomal replication initiator protein DnaA [Stigmatella aurantiaca DW4/3-1] (388 aa)
Score = 421, Expect = 2.7e-39, Identities = 113/345 (32%), Positives = 186/345 (53%)
  Q:   108 PTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSF-DNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           P L  RFTF  + +   N+    AA+   ++  +++  L IYG TGLGKTHLLHAVGN   +  P + ++Y+ +E F  +  +++ E   ++ EF+  F D  D+LLIDDIQFL  +E+  + FF  FN L  +NK IV+TSD +P+ +  ++DR+ SRF  GL   I +P  E+   I+ +  +   +  P  +    FIA     ++R LEG L K+   H L  +        + ++ I+ +    ++ S         I   +   Y V  +++   +R+K  +  R+V MY+ R+    S+ EI S F N++H+TV+ A++ VE   ++D  LK  LD + +K 
  S:    51 PRLSPRFTFGTFVVADSNQLPAAAAAAVADKPGHHYNPLYIYGGTGLGKTHLLHAVGNLIWERNPAQRVVYLSSEQFTNEYVESVRE--HRMTEFRRKFRDECDVLLIDDIQFLGKREETQKEFFYTFNTLYEQNKAIVLTSDTVPSEIPGLEDRLRSRFAMGLLTDIREPSYETRVAILQKKAEAEGLGLP--DDVAHFIAKHIQKNVRELEGALVKLSAIHSLSRLPVTVEFAAQVLKDILPTHQSVDVES---------IQREVARYYKVTVEALREDRRHKALAHARQVAMYLSRKLTKSSFPEIASRF-NKDHSTVISAVRKVEGLRETDAGLKRELDELEAKL 385
>gi|75906226|ref|YP_320522.1| chromosomal replication initiation protein [Anabaena variabilis ATCC 29413] >gi|123745335|sp|Q3MHA9|DNAA_ANAVT Chromosomal replication initiator protein dnaA >gi|75699951|gb|ABA19627.1| chromosomal replication initiator protein, DnaA [Anabaena variabilis ATCC 29413] (460 aa)
Score = 421, Expect = 2.7e-39, Identities = 112/359 (31%), Positives = 188/359 (52%)
  Q:    93 ELPT---IEEKP-KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL--------LDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ELPT   I E P +  + N  L++++ F  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+G+   ++ P   + Y+ TE F   +  AI      ++ F+  +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  + +R+ SRF+ GL   I  PD E+   I+ +  +  +I+ P     IE+IA  F S+IR LEG L +   ++        + N+ P  +   EKI +                  P+ I+  I   + +  + + S  R ++ S+ R++ MY++R+  +LS+  IG  F  ++H TVL +   +   V+SD  L   L  +  +
  S:    97 ELPTTNSIYETPNQNRQPNTELNAKYVFSRFVVGANNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIGHYRWEICPDSKIFYVSTEQFTNDLITAIRN--DSMQSFREHYRAADVLLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPNQIPSLQERLCSRFSMGLIADIQAPDLETRMAILQKKSEYEKIRLPRD--VIEYIATNFTSNIRELEGALTRALAYISIWGLPMTVANLAPVLVTPTEKIAA-----------------TPEAILTVIADNFDISVEDLKSNSRRREISWARQIGMYLMRQHTDLSFPRIGEEFGGKDHTTVLYSCDKIAQLVESDRGLSQTLRQLSDR 448
>gi|23335939|ref|ZP_00121170.1| COG0593: ATPase involved in DNA replication initiation [Bifidobacterium longum DJO10A] (506 aa)
Score = 421, Expect = 2.7e-39, Identities = 104/336 (30%), Positives = 177/336 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAI---SEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFL 445
           L+  FTF+++  G  N+ A   A    E    ++  L IYG +GLGKTHLL+A+GN  +   P   + Y+ +E+F  +   A+   ++   ++ EF   +  VD+LLIDDIQFL  KE   + FF+ FN L+  NK IV+ SD  P +LK  + R+ISRF SGL++ +  PD E+  +I I  +  S   +   +  ++ IA RF  +IR LEG L ++    + ++    +                   +  V+I P  II  +   + +  + ++ K R K  +  R++ MY+ RE  ++S  +IG  F  R+H TV+ A   +  +++  +++  ++
  S:   157 LNKNFTFDSFVPGDSNRFARTVALAVAEGSGQDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPGLKVRYVTSEEFTNEFIDALQNPNQSQGQIAEFNRRYRQVDVLLIDDIQFLGGKEATLDQFFHTFNALHQANKRIVIASDVAPKNLKGFEARLISRFESGLTVDVKPPDLET--RIAILRMIASMNGSKIPSDVLDLIAERFTENIRELEGALTRVT--AVASLSNQPVXXXXXXXXXXXXXXXXXFFTTDVEIKPTDIISQVAKYFHLTFEDLVGKSRTKNVAVPRQIAMYLAREMTSMSLMDIGQVFGGRDHTTVMHACTRISDRMQQKQEIYNYV 493
>gi|68171134|ref|ZP_00544543.1| chromosomal replication initiator protein, DnaA [Ehrlichia chaffeensis str. Sapulpa] >gi|88658026|ref|YP_507606.1| chromosomal replication initiation protein [Ehrlichia chaffeensis str. Arkansas] >gi|123722775|sp|Q2GG27|DNAA_EHRCR Chromosomal replication initiator protein dnaA >gi|67999459|gb|EAM86099.1| chromosomal replication initiator protein, DnaA [Ehrlichia chaffeensis str. Sapulpa] >gi|88599483|gb|ABD44952.1| chromosomal replication initiator protein DnaA [Ehrlichia chaffeensis str. Arkansas] (464 aa)
Score = 421, Expect = 2.8e-39, Identities = 131/430 (30%), Positives = 223/430 (51%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDS---SIFKIKDENVYILVK--NDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEIN-----PTLDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +I K+I+ +     FY N + DS    +  I +E   +L+     F+KE     Y +   +Y+  +  S  +V       +D N  +   +++ K +  N       LD RFTF+N+ +G  N+ AF AA    E N   +    L +YG  GLGKTHL+HA+    ++   ++ + Y+  E F+ +   A+      +  FK  F +VD+L++DD+QF++ K+   E FF+ FN L  +NK +V+++D+ P+ L  +++R+ SR   GL   IN+   E    I+   ++K  I  P  N  +EF+A    S+IR LEG LNK+  H               +   I  DS  +I+S+L++ N      + I   +   + +    + S +R +  +  R+V MY+ ++    S  EIG  F  R+HATV+ A+K +E  + +D  L+
  S:    23 VIWKDIQVKLHK--FYGNAIYDSWLSVLVYINNEGGKVLLSAPTRFIKEWILVHYLDQILKYWQDEDQSVCSVDICVVNNQDTNLLVNIKDQQDKEVRNNYDHLSSPLDPRFTFDNFVVGKPNELAFAAARRVAESNEPISGSNPLFLYGGVGLGKTHLMHAIAWYIIKSSSKRKIAYLSAEKFMYQYVTALRS--KDIMLFKEQFRSVDILMVDDVQFISGKDSTQEEFFHTFNALIDQNKQLVISADRSPSDLDGVEERIKSRLGWGLVADINETTFELRLGILQLKVEKMGINIP--NKVLEFLAKNIKSNIRELEGALNKVVAH------------SSLVGCSITLDSASDILSDLLRANHKSVTLECIQRKVAEFFNIKITDMYSTRRLRTLARPRQVAMYLSKKLTQKSLPEIGKSFGGRDHATVIHAVKQIEKLIDTDSKLR 453
>gi|56552252|ref|YP_163091.1| chromosomal replication initiator protein [Zymomonas mobilis subsp. mobilis ZM4] >gi|59802902|sp|Q9S493|DNAA_ZYMMO Chromosomal replication initiator protein dnaA >gi|56543826|gb|AAV89980.1| chromosomal replication initiator protein [Zymomonas mobilis subsp. mobilis ZM4] (484 aa)
Score = 421, Expect = 2.9e-39, Identities = 106/357 (29%), Positives = 188/357 (52%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKK-SRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           T  EK    E     + R+ F+N+ +G  N  A++AA  F E    ++  L +YG TGLGKTHL+HAVG ++++  P    +Y+  E F+     ++    T    FK    + DLL+IDD+QF+  K+   E FF+  N + +  + +V+++D+ P  L +I+ R++SR + GL   +N  D E    II++ ++   ++  P     + F+A R  +++R LEG LN++  +  L N   N     E +  ++ +      V +        I + +C  Y +    + SK+R++  +  R+V MY+ ++  + S  EIG  F  R+H TV+ AI+ +E    +DED+ + +  +M +F
  S:   134 TSPEKKAEGEDQNQFEERYNFDNFVVGKANDLAYRAACTFAEGGKLDFNPLFLYGGTGLGKTHLMHAVGIEYLKRHPNSTALYMSAEKFMYDFVASMRAKDT--HSFKARLRSADLLMIDDVQFIAGKDSTQEEFFHTMNEVITAGRRLVISADRSPQDLERIESRILSRLSWGLVADVNPADFELRLNIILKKLEAMPQVSMPED--IVFFLAKRICTNVRELEGALNRVVAYATLSNRPINMDFVTETLADLLRTTQQRVTVED--------IQKRVCDHYHLKLADMSSKRRDRVIARPRQVAMYLSKQLTSRSLPEIGQRFGGRDHTTVIHAIRQIEKLRITDEDVDSDVRLLMRQF 482
>gi|166365030|ref|YP_001657303.1| chromosomal replication initiation protein [Microcystis aeruginosa NIES-843] >gi|189044599|sp|B0JGA6|DNAA_MICAN Chromosomal replication initiator protein dnaA >gi|166087403|dbj|BAG02111.1| chromosomal replication initiator protein [Microcystis aeruginosa NIES-843] (444 aa)
Score = 421, Expect = 2.9e-39, Identities = 104/347 (29%), Positives = 183/347 (52%)
  Q:   105 EINPT--LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           E++PT  L+ ++ F  + +G  N+ A  AA    E     +  L + G  GLGKTHL+ A+G+  ++L+PQ  + Y+ TE F   +  AI +    +E F+N + + D+LL+DD+QF+  KE   E FF+ FN L+   K +V+ SD+LP  +  + DR+ISRF+ GL   I  PD E+   I+ +  +   ++ P     IE+IA+ + S+IR LEG L +   ++  +  P  +   E I  ++            +  +P+II+  +   + +    +    R ++ SF R++ MY++R+  +LS   IG  F  ++H TV+ +   +      D  L+  L  ++ +
  S:    99 ELSPTNQLNPKYNFSRFVVGPTNRMAHAAALAVAELPGREFNPLFLCGGVGLGKTHLMQAIGHYRLELYPQSRVFYVSTEQFTNDLITAIRQ--DSMESFRNHYRHADILLVDDLQFIEGKEYTQEEFFHTFNTLHEAGKQVVLASDRLPKQIPSLQDRLISRFSMGLVADIQAPDIETRMAILQKKAEYENLRLPRE--VIEYIAVNYTSNIRELEGALIRATTYISISGLPMTV---ENIAPVLNPPMAK------IATSPEIIMAVVAEKFQLSIADLKGNSRRREISFARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVIYSCDKINLSQHQDRQLQEILAQLIER 436
>gi|134294129|ref|YP_001117864.1| chromosomal replication initiation protein [Burkholderia vietnamiensis G4] >gi|166201869|sp|A4J9S6|DNAA_BURVG Chromosomal replication initiator protein dnaA >gi|134137286|gb|ABO53029.1| chromosomal replication initiator protein DnaA [Burkholderia vietnamiensis G4] (525 aa)
Score = 421, Expect = 2.9e-39, Identities = 113/337 (33%), Positives = 177/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ +  N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVAHNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 512
>gi|172038580|ref|YP_001805081.1| chromosomal replication initiator protein [Cyanothece sp. ATCC 51142] >gi|171700034|gb|ACB53015.1| chromosomal replication initiator protein [Cyanothece sp. ATCC 51142] (455 aa)
Score = 421, Expect = 3.0e-39, Identities = 124/428 (28%), Positives = 215/428 (50%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEK-----DINKE-LPTI-------EEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           N   Y  ++  +++   +D  + I V+N F+       Y  +  E     +   + V   T +E+     D NK+ L +        +E PK  ++NP    R+ F  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+    ++L+P  N+ Y+ TE F   +  +I +    +E F+  +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  + DR++SRF+ GL   I  PD E+   I+ +  +   I+ P     IE+IA  + S+IR LEG L +   ++  +      +  E I  ++    +       +  +P+III+ +   + V  + +    R ++ S  R++ MY++R+  +LS   IG  F  ++H TVL +   +    K D DL   L  +  +
  S:    21 NPTAYETWIASATVQTFQDNCLVIQVENPFILNHLQKTYYSLILEEVETIVGYPIAVKLTTSQEQNLRIVDKNKDNLSSTKLQNKRQQESPKLNQLNP----RYNFSRFVVGPTNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAYYRLELYPNANVFYVSTEQFTNDLITSIRQ--DSMENFREHYRTADILLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPKRIPSLQDRLVSRFSMGLIADIQVPDLETRMAILQKKAEYENIRLPRD--VIEYIATNYTSNIRELEGALIRAVTYISIS---GLSMTVENIAPVLNPPMEQ------ITASPEIIIQIVAENFNVSVEDLKGSSRRREISLARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVLYSCDKISKLQKKDWDLSQQLSELSDR 446
>gi|71905643|ref|YP_283230.1| chromosomal replication initiator protein DnaA [Dechloromonas aromatica RCB] >gi|123760693|sp|Q47K71|DNAA_DECAR Chromosomal replication initiator protein dnaA >gi|71845264|gb|AAZ44760.1| chromosomal replication initiator protein, DnaA [Dechloromonas aromatica RCB] (465 aa)
Score = 421, Expect = 3.0e-39, Identities = 101/326 (30%), Positives = 179/326 (54%)
  Q:   114 FTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVET-KVKSDE 439
           FTF+N  +G  N  A +AA++ +  N    +  L IYG  GLGKTHL+HA+GN      P+K + Y+  ED+   + +A  +     + FK ++ ++D+LL+DD+QF N K +  E FF +FN L    K I++T D  P  +  +DDR+++RF+ GL+++I  P+ E    I+ +  +   I+    +    FIA    S++R LEG L K+  +           +   I   +  ++  +++ ++  +  D I +++   Y +    + SKKR +  +  R+V M++ RE  + S+ EIG  F  R+H TV+ A+K +++ ++K +E
  S:   135 FTFDNLVVGKANDLA-RAAAVQVANNPGGAYNPLFIYGGAGLGKTHLIHAIGNTIATENPEKIVRYVHAEDYYSDVVRAYQQ--KSFDSFKRTYRSLDVLLLDDVQFFNGKNRSQEEFFFLFNALIEARKQIIITCDTYPKDINGLDDRLVTRFDWGLTVQIEPPELEMRVAILKKKAEAEGIQ--LDDEVAFFIAKHLRSNVRELEGALKKVLAY--------SSFHGRVIALDLAKEALKDVIGSVRNVGMDNIQKTVADYYKIKVAELFSKKRTRAIARPRQVAMWLCREVTSHSFPEIGDAFGGRDHTTVIHAVKTIDSLRIKENE 451
>gi|50841497|ref|YP_054724.1| chromosomal replication initiator protein DnaA [Propionibacterium acnes KPA171202] >gi|61212561|sp|Q6ABL5|DNAA_PROAC Chromosomal replication initiator protein dnaA >gi|50839099|gb|AAT81766.1| chromosomal replication initiator protein DnaA [Propionibacterium acnes KPA171202] (500 aa)
Score = 421, Expect = 3.0e-39, Identities = 119/385 (30%), Positives = 205/385 (53%)
  Q:    47 ILVKNDFVKEVFTN----EYKEIFEEYF------SIKMNSNLNVFFITKEEKDINKELPTIEEKPKTL------EINPT----------LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           + V N+F ++   +    E +E+  ++F      +I ++ +L +     + +D  +E+P  +  PK           PT          L+ ++TF+++ IG  N+     A ++      ++  LLIYG +GLGKTHLLHA+G   +  +    + Y+ TE+       AI  G  +  EF+ S+ +VD+LL+DDIQFL +K +  E FF+ FN L++  K IVMTSD+ P  L+ ++ R+ SRF  GL   I  PD E+   I+   +   +I        +EFIA R  ++IR LEG L ++      N  P +I + E  ++ +I    +         + P+ II      + +    ++   R +     R++ MY+ RE  +LS  +IG+ F  ++H TV+ A + +
  S:    74 VAVPNEFARDRLESKMRYELEELLSDHFHKAIHLAITIDPDLELALGAPDHEDEEEEVPPAQFVPKVTVGVTEPSARPTTTIDDDEGNRLNPKYTFDSFVIGASNRFAHAAAVAVAEAPGKSYNPLLIYGGSGLGKTHLLHAIGRYVMSYYDNVKVKYVSTEELTNDFINAI--GTNRTTEFRRSYRDVDVLLVDDIQFLQSKIQTQEEFFHTFNTLHNAQKQIVMTSDRPPKLLEALEPRLRSRFEWGLLTDIQPPDLETRIAILRRKVAAEKIT--VEPDVLEFIASRIQTNIRELEGALIRVTAFASLNQQPVDISLAEVVLKDLIPEGRE-------TPVTPERIIAETADYFDISADDLLGTSRAQTLVTARQIAMYLCRELTDLSLPKIGAEFGGKDHTTVMHADRKI 476
>gi|119355858|ref|YP_910502.1| chromosomal replication initiator protein DnaA [Chlorobium phaeobacteroides DSM 266] >gi|119353207|gb|ABL64078.1| chromosomal replication initiator protein DnaA [Chlorobium phaeobacteroides DSM 266] (490 aa)
Score = 420, Expect = 3.5e-39, Identities = 112/342 (32%), Positives = 186/342 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L+ ++ FE    G  N  AF AAS  + +N   N +  L+IYG  GLGKTH++ A+GN   +    + ++Y+ +E F      AI  G  K++EF + + N+D+L+IDDIQF   KEK  E  F+IFN L+  NK I+++SD+    +K I+DR+ISRFN GLS  I  PD E+ K II+  +++S +        IEFIA     ++R LEG + K+     LDN + +    +  ++ II   +         Q+  D I +++C  + +    +  K + K+ +  R++ MY+ +     S   IG  F  R+H+TV+ A+  V  +++   D +  ++ +  +
  S:   151 LNPKYVFETLIRGDCNSLAF-AASKSVAQNPGLNAFNPLVIYGGVGLGKTHMMQAIGNSVRKNCLSEKVLYVSSEKFAVDFVNAIQNG--KIQEFSSFYRNIDVLIIDDIQFFAGKEKTQEEIFHIFNTLHQTNKQIILSSDRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLEQSGVN--LDESVIEFIATNVTENVRELEGCIVKLLAAQSLDNREIDLHFTKSTLKDIIRHTTK--------QLTLDTIEKAVCSFFAITPNDLKGKSKKKEIATGRQIAMYLAKNLTESSLKTIGLHFGGRDHSTVIHAVNTVGNRMEQQSDERKKIEELKKR 484
>gi|145294043|ref|YP_001136864.1| chromosomal replication initiation protein [Corynebacterium glutamicum R] >gi|166201881|sp|A4Q9R9|DNAA_CORGB Chromosomal replication initiator protein dnaA >gi|140843963|dbj|BAF52962.1| hypothetical protein [Corynebacterium glutamicum R] (524 aa)
Score = 420, Expect = 3.7e-39, Identities = 118/352 (33%), Positives = 192/352 (54%)
  Q:    89 DINKELPTIEEKPK-TLEINP----TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAI-EFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEE----KIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDED 440
           D   EL T +  P+ T   NP    +L+ ++TFE++ IG FN+ A  AA    E     +  L I G +GLGKTHLLHAVGN   +L P   + Y+ +E+F      ++ +   + E FK  + N+D+L++DDIQFL  KE   E FF+ FN L+  +K I+++SD+ P  L  ++DR+ +RF  GL   I  PD E+   I+   +KK++      +  + E IA RF S IR LEG L ++  Y  L+     N+ I++E     +R I+    D EI +        +I+E     + +   ++    + +  +  R++ MY+ RE  ++S  +IG  F  ++H TV+ A + +  ++    D
  S:   158 DPEPELATPQRIPRETPAHNPNREVSLNPKYTFESFVIGPFNRFANAAAVAVAESPAKAFNPLFISGGSGLGKTHLLHAVGNYAQELQPGLRIKYVSSEEFTNDYINSVRD--DRQETFKRRYRNLDILMVDDIQFLAGKEGTQEEFFHTFNALHQADKQIILSSDRPPKQLTTLEDRLRTRFEGGLITDIQPPDLETRIAIL---MKKAQTDGTHVDREVLELIASRFESSIRELEGALIRVSAYSSLI-----NQPIDKEMAIVALRDILPEPEDMEITA-------PVIMEVTAEYFEISVDTLRGAGKTRAVAHARQLAMYLCRELTDMSLPKIGDVFGGKDHTTVMYADRKIRQEMTEKRD 506
>gi|73666899|ref|YP_302915.1| chromosomal replication initiation protein [Ehrlichia canis str. Jake] >gi|72394040|gb|AAZ68317.1| chromosomal replication initiator protein DnaA [Ehrlichia canis str. Jake] (452 aa)
Score = 420, Expect = 3.7e-39, Identities = 130/430 (30%), Positives = 225/430 (52%)
  Q:    13 IIKKEIEKEFQNENFYNNYVLDS---SIFKIKDENVYILVK--NDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDIN-----KELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN---NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP-----DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK 442
           +I K+I+ +     FY N + DS    +  + +E   +L+     F+KE     Y +   +Y+  +  S  +V       +D N     K+    E +     ++  LD RFTF+N+ +G  N+ AF AA    E N+       L +YG  GLGKTHL+HA+    ++   ++ + Y+  E F+ +   A+      +  FK  F +VD+L++DD+QF++ K+   E FF+ FN L  +NK +V+++D+ P+ L  +++R+ SR   GL   IN+   E    I+   ++K  I  P  N  +EF+A    S+IR LEG LNK+  H               +   I  DS  +I+S+L++ N      + I + +   + +    + S +R +  +  R+V MY+ ++    S  EIG  F  R+HATV+ A+K +E  +++D+ L+
  S:    11 VIWKDIQSKLHK--FYGNAIYDSWLSVLVYVNNEGGKVLLSAPTRFIKEWILVHYLDQILKYWQDEDKSVCSVDICVVNNQDTNLIVNVKDQQGNEIRNNYDHLSSPLDPRFTFDNFVVGKPNELAFAAARRVAESNDPISGSNPLFLYGGVGLGKTHLMHAIAWYIIKSSSKRKIAYLSAEKFMYQYVTALRS--KDIMLFKEQFRSVDILMVDDVQFISGKDSTQEEFFHTFNALIDQNKQLVISADRSPSDLDGVEERIKSRLGWGLVADINETTFELRLGILQLKVEKMGINIP--NKVLEFLAKNIKSNIRELEGALNKVVAH------------SSLVGCSITLDSASDILSDLLRANHKSVTLECIQKKVAEFFNIKMTDMYSTRRLRTLARPRQVAMYLSKKLTQKSLPEIGKSFGGRDHATVIHAVKQIEKLIETDDKLR 441
>gi|124516518|gb|EAY58026.1| ATPase involved in DNA replication initiation [Leptospirillum sp. Group II UBA] (465 aa)
Score = 420, Expect = 3.8e-39, Identities = 127/412 (30%), Positives = 220/412 (53%)
  Q:    32 VLDSSIFKIKDENVYILVKNDFVKEVFTNEY-KEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEE----------KPKTLEI--------NPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           +L  ++ +   +   +LV + F++ +  N Y K++   +  +  N  ++   + + E    K+   +            KP  L +        N  L+ R+ FENY +G+ N+ A  AA       +  +    ++GS GLGKTHL+ A+GN  + L+P   ++YI TE FL ++  AI     K+ EF+  +  +D+L++DD+QFL+ KE+  E  F  FN L    K I+++SD +P  +  ++ R+ SRF  GL   I  PD E+  +I+   + + ++  P     + F+A    S+IR LEG + ++  Y +L+      + I  E  R+++   SD   +S    I+ D I++ +   + V  K + SKKR+K     R V +Y++RE    SY EIG     R+H+T + + K VE K++SD  L +
  S:    31 LLKGAVLEGGKDGYSVLVGSSFIQRLVQNRYYKDLLTAFREVTQNPEISFDVLVQPENVPRKKRKVVRNSGPEGGLSPGKPVPLPLGEDRSPSWNSNLNPRYFFENYVVGVCNQFAHAAAFAIANNPSKAYNPFYLFGSVGLGKTHLVSAIGNCMIALYPSLKVLYITTESFLNEMVSAIK--FNKMNEFRERYRKIDVLIMDDVQFLSGKERTQEELFYTFNALYENGKQIILSSDCMPNDIPTLEGRLKSRFGWGLIADIQIPDFETKVEILKGKMAQEKVDLPMD--VVYFLANSIKSNIRELEGAMIRLGAYGNLM-----GKPITIEVARNLL---SDLMPLSR-ESISVDRILQEVADYFKVLPKEIRSKKRHKTLVTARHVAVYLIRELTQKSYPEIGRELGGRDHSTAIYSFKMVEEKLESDPALTS 452
>gi|170731357|ref|YP_001763304.1| chromosomal replication initiator protein DnaA [Burkholderia cenocepacia MC0-3] >gi|169814599|gb|ACA89182.1| chromosomal replication initiator protein DnaA [Burkholderia cenocepacia MC0-3] (525 aa)
Score = 420, Expect = 3.8e-39, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 512
>gi|5354184|gb|AAD42393.1|AF157493_1 chromosomal replication initiator protein [Zymomonas mobilis] (484 aa)
Score = 420, Expect = 3.9e-39, Identities = 106/357 (29%), Positives = 188/357 (52%)
  Q:    96 TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKK-SRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           T  EK    E     + R+ F+N+ +G  N  A++AA  F E    ++  L +YG TGLGKTHL+HAVG ++++  P    +Y+  E F+     ++    T    FK    + DLL+IDD+QF+  K+   E FF+  N + +  + +V+++D+ P  L +I+ R++SR + GL   +N  D E    II++ ++   ++  P     + F+A R  +++R LEG LN++  +  L N   N     E +  ++ +      V +        I + +C  Y +    + SK+R++  +  R+V MY+ ++  + S  EIG  F  R+H TV+ AI+ +E    +DED+ + +  +M +F
  S:   134 TSPEKKAEGEDQNQFEERYNFDNFVVGKANDLAYRAACTFAEGGKLDFNPLFLYGGTGLGKTHLMHAVGIEYLKRHPNSTALYMSAEKFMYDFVASMRAKDT--HSFKARLRSADLLMIDDVQFIAGKDSTQEEFFHTMNEVITAGRRLVISADRSPQDLERIESRILSRLSWGLVADVNPADFELRLNIILKKLEAMPQVSMPED--IVFFLAKRICTNVRELEGALNRVVAYATLSNRPINMDFVTETLADLLRTTQQPVTVED--------IQKRVCDHYHLKLADMSSKRRDRVIARPRQVAMYLSKQLTSRSLPEIGQRFGGRDHTTVIHAIRQIEKLRITDEDVDSDVRLLMRQF 482
>gi|15674251|ref|NP_268424.1| chromosomal replication initiation protein [Streptococcus pyogenes M1 GAS] >gi|19745202|ref|NP_606338.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS8232] >gi|21909537|ref|NP_663805.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS315] >gi|28894913|ref|NP_801263.1| chromosomal replication initiation protein [Streptococcus pyogenes SSI-1] >gi|50913347|ref|YP_059319.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS10394] >gi|56808865|ref|ZP_00366576.1| COG0593: ATPase involved in DNA replication initiation [Streptococcus pyogenes M49 591] >gi|71902668|ref|YP_279471.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS6180] >gi|71909815|ref|YP_281365.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS5005] >gi|94987632|ref|YP_595733.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS9429] >gi|94989510|ref|YP_597610.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS10270] >gi|94991498|ref|YP_599597.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS2096] >gi|139472889|ref|YP_001127604.1| chromosomal replication initiation protein [Streptococcus pyogenes str. Manfredo] >gi|122987157|sp|Q1JP60|DNAA_STRPC Chromosomal replication initiator protein dnaA >gi|123382367|sp|Q1JEA5|DNAA_STRPB Chromosomal replication initiator protein dnaA >gi|123382466|sp|Q1JJA7|DNAA_STRPD Chromosomal replication initiator protein dnaA >gi|123761459|sp|Q48VX2|DNAA_STRPM Chromosomal replication initiator protein dnaA >gi|166215363|sp|A2RBX3|DNAA_STRPG Chromosomal replication initiator protein dnaA >gi|61212508|sp|Q5XEM7|DNAA_STRP6 Chromosomal replication initiator protein dnaA >gi|61222629|sp|P0A3A4|DNAA_STRP1 Chromosomal replication initiator protein dnaA >gi|61222631|sp|P0A3A5|DNAA_STRP3 Chromosomal replication initiator protein dnaA >gi|61222632|sp|P0A3A6|DNAA_STRP8 Chromosomal replication initiator protein dnaA >gi|8037923|gb|AAF71535.1|AF255728_1 chromosomal initiator protein DnaA [Streptococcus pyogenes] >gi|13621326|gb|AAK33146.1| Chromosomal initiator protein [Streptococcus pyogenes M1 GAS] >gi|19747291|gb|AAL96837.1| chromosomal replication initiator protein [Streptococcus pyogenes MGAS8232] >gi|21903717|gb|AAM78608.1| chromosomal initiator protein [Streptococcus pyogenes MGAS315] >gi|28810158|dbj|BAC63096.1| chromosomal initiator protein [Streptococcus pyogenes SSI-1] >gi|50902421|gb|AAT86136.1| chromosomal replication initiator protein [Streptococcus pyogenes MGAS10394] >gi|71801763|gb|AAX71116.1| chromosomal replication initiator protein [Streptococcus pyogenes MGAS6180] >gi|71852597|gb|AAZ50620.1| chromosomal replication initiator protein [Streptococcus pyogenes MGAS5005] >gi|94541140|gb|ABF31189.1| chromosomal replication initiator protein [Streptococcus pyogenes MGAS9429] >gi|94543018|gb|ABF33066.1| Chromosomal replication initiator protein dnaA [Streptococcus pyogenes MGAS10270] >gi|94545006|gb|ABF35053.1| Chromosomal replication initiator protein dnaA [Streptococcus pyogenes MGAS2096] >gi|134271135|emb|CAM29345.1| chromosomal replication initiator protein [Streptococcus pyogenes str. Manfredo] (451 aa)
Score = 419, Expect = 4.3e-39, Identities = 141/424 (33%), Positives = 226/424 (53%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVF--TNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEIN--PT----LDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNK--EKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           Y  +V D+ + K+      I +  D +KE+F   N    I    F +  N+ ++V ++ +E+  I +    I +KPK   +N  PT    L+S+++FEN+  G  N+ A  A+ ++       +  L I+G  GLGKTHLL+A+GN  +   P   + YI  E+F+ +    I      ++E K  F N+DLLLIDDIQ L  K      E FFN FN L++ NK IV+TSD+ P  L  ++DR+++RF  GL++ I  PD E+   I+   I++      F    IE++A +F+S++R LEG L  I     F  +D +  +  I  E IR+  +      +      I  + I   +   YGV  K + + KR +     R+V M++ RE  + S  +IG  F  R+H+TVL A   ++  +  DE L+  ++ I +K
  S:    25 YEFFVHDARLLKVDKHIATIYL--DQMKELFWEKNLKDVILTAGFEV-YNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNSLPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLNAIGNSVLLENPNARIKYITAENFINEFVIHIRL--DTMDELKEKFRNLDLLLIDDIQSLAKKTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDFETRVAILTNKIQEYNFI--FPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD--IAAEAIRARKQDGPKMTV------IPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLAREMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNK 449
>gi|52840257|ref|YP_094056.1| chromosomal replication initiator protein DnaA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54292965|ref|YP_125380.1| chromosomal replication initiator protein DnaA [Legionella pneumophila str. Lens] >gi|54295984|ref|YP_122353.1| chromosomal replication initiator protein DnaA [Legionella pneumophila str. Paris] >gi|148358140|ref|YP_001249347.1| chromosomal replication initiator protein DnaA [Legionella pneumophila str. Corby] >gi|166214678|sp|A5I9F1|DNAA_LEGPC Chromosomal replication initiator protein dnaA >gi|61212502|sp|Q5X0L8|DNAA_LEGPL Chromosomal replication initiator protein dnaA >gi|61212504|sp|Q5X990|DNAA_LEGPA Chromosomal replication initiator protein dnaA >gi|61212515|sp|Q5ZZK8|DNAA_LEGPH Chromosomal replication initiator protein dnaA >gi|52627368|gb|AAU26109.1| chromosomal replication initiator protein DnaA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53749769|emb|CAH11149.1| Chromosomal replication initiator protein DnaA [Legionella pneumophila str. Paris] >gi|53752797|emb|CAH14231.1| Chromosomal replication initiator protein DnaA [Legionella pneumophila str. Lens] >gi|148279913|gb|ABQ54001.1| chromosomal replication initiator protein DnaA [Legionella pneumophila str. Corby] (452 aa)
Score = 419, Expect = 4.5e-39, Identities = 106/340 (31%), Positives = 187/340 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+ +F F+++  G  N+ A +AAS+ + E   + +  L IYG  GLGKTHL+HA+GN  ++  P+  ++Y+ +E F+  + KA+      + EFK  + +++ LLIDDIQF   K++  E FF+ FN L    + I++TSD+ P  ++ +++R+ SRF  GL++ +  P+ E+   I+I   ++S I+ P+      FIA R  S++R LEG L ++  +      P  I    E +R ++        + N        I +++   Y V    ++SK+R++  +  R++ M + +E  N S  EIG  F  ++H TV+ A + V+  ++ D D      N+M
  S:   117 LNKKFVFDSFVEGNSNQLA-RAASMQVAERPGDAYNPLFIYGGVGLGKTHLMHAIGNSILKNNPEAKVLYLHSERFVADMVKALQT--NSINEFKRFYRSLNALLIDDIQFFAGKDRSQEEFFHTFNALLEGQQQIILTSDRYPKEIEGMEERLKSRFGWGLTVAVEPPELETRVAILISKAEQSNIELPYE--VAFFIAKRIRSNVRELEGALRRVIANAHFTGKPITIEFVHEALRDLLALQDKLVTIEN--------IQKTVAEYYKVKVADLLSKRRSRSIARPRQMAMALSKELTNHSLPEIGDHFGGKDHTTVIHACRKVKELIQDDSDFAEDYKNLM 447
>gi|19551251|ref|NP_599253.1| chromosomal replication initiation protein [Corynebacterium glutamicum ATCC 13032] >gi|62388893|ref|YP_224295.1| chromosomal replication initiation protein [Corynebacterium glutamicum ATCC 13032] >gi|38257663|sp|Q8NUD8|DNAA_CORGL Chromosomal replication initiator protein dnaA >gi|21322765|dbj|BAB97394.1| ATPase involved in DNA replication initiation [Corynebacterium glutamicum ATCC 13032] >gi|41324226|emb|CAF18566.1| CHROMOSOMAL REPLICATION INITIATOR PROTEIN [Corynebacterium glutamicum ATCC 13032] (524 aa)
Score = 419, Expect = 4.8e-39, Identities = 118/352 (33%), Positives = 192/352 (54%)
  Q:    89 DINKELPTIEEKPK-TLEINP----TLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAI-EFIALRFNSDIRTLEGVLNKI--YFHLLDNVDPNEIINEE----KIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDED 440
           D   EL T +  P+ T   NP    +L+ ++TFE++ IG FN+ A  AA    E     +  L I G +GLGKTHLLHAVGN   +L P   + Y+ +E+F      ++ +   + E FK  + N+D+L++DDIQFL  KE   E FF+ FN L+  +K I+++SD+ P  L  ++DR+ +RF  GL   I  PD E+   I+   +KK++      +  + E IA RF S IR LEG L ++  Y  L+     N+ I++E     +R I+    D EI +        +I+E     + +   ++    + +  +  R++ MY+ RE  ++S  +IG  F  ++H TV+ A + +  ++    D
  S:   158 DPEPELATPQRIPRETPAHNPNREVSLNPKYTFESFVIGPFNRFANAAAVAVAESPAKAFNPLFISGGSGLGKTHLLHAVGNYAQELQPGLRIKYVSSEEFTNDYINSVRD--DRQETFKRRYRNLDILMVDDIQFLAGKEGTQEEFFHTFNALHQADKQIILSSDRPPKQLTTLEDRLRTRFEGGLITDIQPPDLETRIAIL---MKKAQTDGTHVDREVLELIASRFESSIRELEGALIRVSAYSSLI-----NQPIDKEMAIVALRDILPEPEDMEITA-------PVIMEVTAEYFEISVDTLRGAGKTRAVAHARQLAMYLCRELTDMSLPKIGDVFGGKDHTTVMYADRKIRQEMTEKRD 506
>gi|119385558|ref|YP_916613.1| chromosomal replication initiation protein [Paracoccus denitrificans PD1222] >gi|119376153|gb|ABL70917.1| chromosomal replication initiator protein DnaA [Paracoccus denitrificans PD1222] (448 aa)
Score = 419, Expect = 4.9e-39, Identities = 104/342 (30%), Positives = 180/342 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           E+   LDSRFTFEN+ +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+  +     P+  ++Y+  E F+ +  +A+ +    V +FK  F  V +L++DD+QF+  K+   E FF+ FN L  + K IV+++D+ P  +K +++R+ SR   GL + ++  D E    I+       R + P   +A   +EF+A R  S++R LEG L +++ F  L   +    + +E +  I+         +N  +++ + I   +   Y +    +I  KR +  +  R++ MY+ ++  + S  EIG  F  R+H T++  +K +E    SD  L   +D
  S:   103 ELAAPLDSRFTFENFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAREIQIRQPEARVLYLSAEQFMYRFVQALRD--RTVMDFKELFRTVSVLMVDDVQFIAGKDSTQEEFFHTFNTLVDQGKQIVISADRAPGEIKDMEERIKSRLQCGLVVDLHPTDYELRLGILQSKTDSFRAQYPGLLIAPGVLEFLAHRITSNVRVLEGALQRLFAFASLMGREITLDMTQECLADILR--------ANDRKVSIEEIQRKVAEHYNIRLADMIGPKRVRTVARPRQIAMYLAKQMTSRSLPEIGRRFGGRDHTTIMHGVKKIEELRGSDRSLSEDID 440
>gi|69936424|ref|ZP_00631250.1| chromosomal replication initiator protein, DnaA [Paracoccus denitrificans PD1222] (480 aa)
Score = 419, Expect = 4.9e-39, Identities = 104/342 (30%), Positives = 180/342 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           E+   LDSRFTFEN+ +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+  +     P+  ++Y+  E F+ +  +A+ +    V +FK  F  V +L++DD+QF+  K+   E FF+ FN L  + K IV+++D+ P  +K +++R+ SR   GL + ++  D E    I+       R + P   +A   +EF+A R  S++R LEG L +++ F  L   +    + +E +  I+         +N  +++ + I   +   Y +    +I  KR +  +  R++ MY+ ++  + S  EIG  F  R+H T++  +K +E    SD  L   +D
  S:   135 ELAAPLDSRFTFENFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAREIQIRQPEARVLYLSAEQFMYRFVQALRD--RTVMDFKELFRTVSVLMVDDVQFIAGKDSTQEEFFHTFNTLVDQGKQIVISADRAPGEIKDMEERIKSRLQCGLVVDLHPTDYELRLGILQSKTDSFRAQYPGLLIAPGVLEFLAHRITSNVRVLEGALQRLFAFASLMGREITLDMTQECLADILR--------ANDRKVSIEEIQRKVAEHYNIRLADMIGPKRVRTVARPRQIAMYLAKQMTSRSLPEIGRRFGGRDHTTIMHGVKKIEELRGSDRSLSEDID 472
>gi|81427617|ref|YP_394614.1| chromosomal replication initiation protein A [Lactobacillus sakei subsp. sakei 23K] >gi|123755887|sp|Q38ZS4|DNAA_LACSS Chromosomal replication initiator protein dnaA >gi|78609256|emb|CAI54303.1| Chromosomal replication initiation protein A [Lactobacillus sakei subsp. sakei 23K] (448 aa)
Score = 419, Expect = 5.1e-39, Identities = 123/396 (31%), Positives = 209/396 (52%)
  Q:    51 NDFVKEVFTNEYKEIFEEYFSIKM--------NSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT------LDSRFTFENYTIGMFNKNAFKAASLFLEENNN-WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLK-AFLD 446
           N+ + EV +  +KE +E   + K+           L   F+   E D    L   EE   T    PT      L+S++TF+ +  G  N+ A  AA +  EE    +  L +YG  GLGKTHL+ A+G++ ++  P+ N+ Y+ +E F      +I       E+F+  + NVDLLL+DDIQF  +KE   E FF+ FN L +  K IV+TSD+LP  + K+ +R++SRF  GL + I  PD E+   I+        ++ P   L+  +IA + +S++R LEG L ++  +  + N +    +  + ++ +       ++     Q++   I   +   Y +    +  +KR K+    R++ MY+ RE  + S  +IG  F  ++H TV+ A + +   + +D++LK A LD
  S:    39 NELLIEVPSVLHKEYWENNLATKVVEGAYEFAEIELTPIFVLPGESDNLTPLEPEEEHVLTKAETPTFLRETHLNSKYTFDTFVTGKGNQMAHAAALVVSEEPGVLYNPLFLYGGVGLGKTHLMQAIGHQLLESKPETNVKYVTSEAFANDFINSIQTKNQ--EKFRQEYRNVDLLLVDDIQFFADKEGTQEEFFHTFNDLYNDKKQIVLTSDRLPNEIPKLQERLVSRFKWGLPVDITPPDLETRIAILRNKADAEHLEIPEDTLS--YIAGQIDSNVRELEGALVRVQAYATMQNAEITTSLAADALKGL-------KLNGKSSQLSIAKIQSVVAKYYSLTVADLKGRKRVKEIVLPRQIAMYLAREMTDSSLPKIGQEFGGKDHTTVMHAHERISQSLTTDQNLKDAILD 441
>gi|154508239|ref|ZP_02043881.1| hypothetical protein ACTODO_00733 [Actinomyces odontolyticus ATCC 17982] >gi|153797873|gb|EDN80293.1| hypothetical protein ACTODO_00733 [Actinomyces odontolyticus ATCC 17982] (476 aa)
Score = 419, Expect = 5.2e-39, Identities = 120/333 (36%), Positives = 186/333 (55%)
  Q:   108 PT-LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGT---KVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI--YFHLL-DNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDED 440
           PT L+ +FTF+ + IG  N+ A  AA    E     +  L IYG +GLGKTHLL A+G+  + + P   + Y+ +E+F  +   AI    T   +VE F   +  +D+LLIDDIQF+ +KE+  E FF+ FN L+S NK IV+TSD  P  LK  +DRM SRF+SGL + +  PD E+  +I I + K        +    E++A R +S+IR LEG L +I  +  L  + +D N  + +  ++  + +  D EI  +L       I+    + +GV  + + S +R+      R++ MY+ RE  +LS  +IG  F  R+H TV+ A K +   +K   +
  S:   128 PTHLNPKFTFDTFVIGPSNRFAHAAALAASETPGTAFNPLFIYGDSGLGKTHLLQAIGHNALSMMPHLKVRYVNSEEFTNEFINAIRLNKTDNSQVEAFHRRYRELDILLIDDIQFIGDKEQTVEGFFHTFNALHSANKQIVLTSDLPPAQLKGFEDRMRSRFSSGLLVDVQPPDLET--RIAILHKKADAEGLEVTPEVFEYVASRISSNIRELEGALVRIGAWASLYQERIDLN--LAQMMLKDFVSNPDDNEITVSL-------IMSQCAVYFGVTIEQMGSSERSHNVVEARQIAMYLCRELTDLSLPKIGQAFG-RDHTTVMHANKKISKLMKEKRE 457
>gi|158336233|ref|YP_001517407.1| chromosomal replication initiation protein [Acaryochloris marina MBIC11017] >gi|189044628|sp|B0CDM2|DNAA_ACAM1 Chromosomal replication initiator protein dnaA >gi|158306474|gb|ABW28091.1| chromosomal replication initiator protein DnaA [Acaryochloris marina MBIC11017] (455 aa)
Score = 419, Expect = 5.3e-39, Identities = 102/333 (30%), Positives = 180/333 (54%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           +L+ ++ F  Y +G  N+ A  AA L + E+    +  L + G  GLGKTHL+ A+G+  +++ P   + YI TE F   +  AI + G  +++F+  +  VD++L+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P+ + ++ +R+ SRF+ GL   I  PD E+   I+ +  +   I+ P     IE+IA  + S+IR LEG L +   ++  +  P   +N E I  ++   +        +  +P+ II ++   YG+    +    R ++ S  R++ MY++R+  +LS  +IG  F  ++H TV+ +   V    K + +L
  S:   117 SLNPKYVFSRYVVGPNNRMA-HAACLAVAESPGREFNPLFLCGGVGLGKTHLMQAIGHYRLEISPNSRIFYISTEQFTNDLIAAIRKDG--MQKFREHYRAVDVMLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVLASDRPPSQIPRLQERLCSRFSMGLIADIQPPDLETRMAILQKKAEYENIRLPRE--VIEYIASSYTSNIRELEGALIRAVAYISISGLP---MNVENIAPVLNPPTAK------ISASPESIINAVADTYGISIDDLKGNSRRREISMARQIGMYLMRQHTDLSLPKIGEEFGGKDHTTVMYSCDKVSDLQKKNPEL 438
>gi|171913561|ref|ZP_02929031.1| chromosomal replication initiation protein [Verrucomicrobium spinosum DSM 4136] (526 aa)
Score = 419, Expect = 5.4e-39, Identities = 107/352 (30%), Positives = 188/352 (53%)
  Q:    88 KDINKELPTIEEKPKT--------------LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL-LDNVDP-NEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDE 439
           K+  K++  + +KP+               L +   L++RF+F  + +G     +   A    E+    +  L ++G+ GLGKTHL+ A+G + +   P+K + Y+ +E F  +  +A+    +KV  F+  +  VD+LLIDDIQF   K    E FF+ FN L +  K IV+TSD+ P+ +K ++ R++SRF  G++ +I  PD E+   I+ + +    ++    +  + F+A    +++R LEG L ++  H+ L N  P  + I E  +R I+E      +  + +Q    ++ E     + +    + S +R    +  R++ M++ RE    S  EIG  F  R+H TV+ A K V TK  S+E
  S:   152 KEAAKKMDRVTDKPEVATGPLFESDSRFNRLLMESGLNTRFSFNAFVVGPNCTYSCAVAKAVAEKPGRTYNPLFLHGAVGLGKTHLMQAIGREILHNKPKKVVRYVTSEAFTNEYIEALRH--SKVSAFRQKYRKVDVLLIDDIQFFAGKGSTQEEFFHTFNDLFNSFKQIVLTSDRAPSEIKNLEARLVSRFEWGMATQIESPDLETRTAILRQKMVDWCVQ--VDDWVLSFLAENIRTNVRRLEGALMRVAAHISLGNGGPLTQTIVETLLRDILEEPDAKAVTIDWIQ---KVVAEH----FDIRLADMTSHRRPASIAIPRQIAMHLARELTKSSLKEIGDAFGGRDHGTVIHACKAVSTKANSEE 510
>gi|163745035|ref|ZP_02152395.1| chromosomal replication initiation protein [Oceanibulbus indolifex HEL-45] >gi|161381853|gb|EDQ06262.1| chromosomal replication initiation protein [Oceanibulbus indolifex HEL-45] (453 aa)
Score = 419, Expect = 5.4e-39, Identities = 113/418 (27%), Positives = 214/418 (51%)
  Q:    25 ENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPT---------LDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLA---IEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSD----EDLK 442
           +N Y  ++       ++D  V + V  +F     +  + ++     +        + F   ++     + P    +  T  + PT         LD RF+F+N+ +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+  +  +  P  N++Y+  E F+ +  +A+ +   K+ +FK  F +VD+L++DD+QF+  K+   E FF+ FN L  ++K I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   ++  R   P   +A   +EF+A R  S++R LEG L +++ F  L   + +  + ++ +  ++ +           +I+ + I   +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  ++ +E    SD    EDL+
  S:    19 QNNYTTWIEPLVPGDVEDGIVTLKVPTNFFGNYVSQNFSDLILHEINAAGTDATRLNFALNQQPANAADKPAPAARQTTAAVKPTANSQLSTAPLDPRFSFDNFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIARELHERRPDMNVLYLSAEQFMYRFVQALRD--RKMMDFKEIFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQHKQIIISADRAPGEIKDLEDRVKSRLQCGLIVDLHPTDYELRLGILQSKVEVQRKTYPDLEVADGVLEFLAHRITSNVRVLEGALTRLFAFASLVGREIDMGLTQDCLADVLRASER--------KISVEEIQRKVSDHYNIRLSDMIGPKRLRSYARPRQVAMYLCKQMTSRSLPEIGRRFGGRDHTTVMHGVRRIEELKVSDGQIAEDLE 445
>gi|182411827|ref|YP_001816893.1| chromosomal replication initiator protein DnaA [Opitutus terrae PB90-1] >gi|177839041|gb|ACB73293.1| chromosomal replication initiator protein DnaA [Opitutus terrae PB90-1] (467 aa)
Score = 418, Expect = 6.1e-39, Identities = 107/338 (31%), Positives = 177/338 (52%)
  Q:   109 TLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLD 446
           TL+ R TFE + +G  N+     A ++       +  L IYG TGLGKTHL+HA+G+  ++  P   + Y+ TE F  +  +A+ E    + +F+  + +VD+LLIDD+QFL  KE++ E FF+ FN L    K +V++SD+  + + K++ R++SRF  GL   I  PD E+  ++ I   K + +K       + FIA   + +IR LEG L K+  +      P ++   E    ++  D   E   N++ I  + I + +   Y +    + SK+R    +  R++ MY+ R     S  EIG  F  R+H TV+ A K V+  ++ D   +  +D
  S:   130 TLNPRNTFETFVVGSNNQMAHAAALAVAQAPAQAYNPLFIYGDTGLGKTHLMHAIGHAILRNNPDARVAYLSTEKFTNEFIQALQE--NSLTKFRQRYRHVDVLLIDDVQFLAGKERIQEEFFHTFNDLFESGKQVVLSSDRRASEIQKLESRLVSRFEWGLPADIQAPDFET--RLAILRSKAACMKFDLPAPILNFIAQNISKNIRRLEGALIKVASYSALTSKPLDLATTE----MLLQDVLMEQAQNVLTI--ETIQKRVADHYQIRHSDMTSKRRPNNIAIPRQIAMYLTRTLTKHSLQEIGEAFGGRDHGTVIHACKAVDNMMEQDSTTRGSID 459
>gi|149278936|ref|ZP_01885070.1| chromosomal replication initiator protein [Pedobacter sp. BAL39] >gi|149230215|gb|EDM35600.1| chromosomal replication initiator protein [Pedobacter sp. BAL39] (490 aa)
Score = 418, Expect = 6.2e-39, Identities = 109/363 (30%), Positives = 200/363 (55%)
  Q:    90 INKEL--PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFH-LLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           INK++  P I    K L+++P L+S +TFENY  G  N+ A  A      +    ++  L+IYG  GLGKTHL  A+GN+  +  P K ++Y+  E F ++   ++      + +F N +  +D++++DD+   + KEK  +IFF+IFN L+   K I+++SDK P  L  +++R++SRF  GLS  +  PD E+   I+ + +    I+ P     +E++A   ++++R LEG +  +     L+  D +  + ++ +++ I++ S         +I+ + I + +C  + V    V S  R ++    R++ MY+ +     S   IG+FF  R+H+TV+ A + VE  + +D+  K ++ +I  K 
  S:   131 INKDIKNPFIIPGLKKLQVDPQLNSNYTFENYIEGDCNRLARSAGYAVAAKPGGTSFNPLMIYGGVGLGKTHLAQAIGNEIKRNMPDKLVIYVSCEKFCQQFVDSLKN--NTINDFVNFYQAMDVIIMDDVHNFSGKEKTQDIFFHIFNHLHQSGKQIILSSDKSPKDLVGLEERLLSRFKWGLSADLQVPDLETRIAILKKKMYADGIELPAE--VVEYVAHNIDNNVRELEGAMVSLLAQSTLNKKDIDLDLAKQMLKNFIKNTSK--------EISMEYIQKLVCEYFEVPVDMVKSATRKREIVQARQISMYLSKSHTKSSLKTIGAFFGGRDHSTVIYACQTVEDLIDTDKKFKGYVHDIQKKL 487
>gi|51891139|ref|YP_073830.1| chromosomal replication initiation protein [Symbiobacterium thermophilum IAM 14863] >gi|61212552|sp|Q67TK7|DNAA_SYMTH Chromosomal replication initiator protein dnaA >gi|51854828|dbj|BAD38986.1| chromosomal replication initiation protein [Symbiobacterium thermophilum IAM 14863] (458 aa)
Score = 418, Expect = 6.6e-39, Identities = 119/422 (28%), Positives = 210/422 (49%)
  Q:    30 NYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEE--KDINKE---------------LPTIEEKPKTL-EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNNWKT---LLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV------QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           N+V  +    + ++ + + V+ +F K    + Y  +  +        N+ + F+      +D   E                P  E+  + L  INP    ++TFE + +G  N N F  A+         +T   L IYG  GLGKTHL+HA+G+  +Q  P   + Y+ TE F  +   AI +G T    F+N +  VD+LLIDDIQFL  KE   E F++ FN +   NK IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  +   I+ P  +    +IA    ++IR LEG L ++            +     ++  +  D   + + +++      QI    I + +   Y +  +    + R++  ++ R++ MY+ RE  + S  +IG  F  R+H TV+ A + +   ++SD      ++ ++++
  S:    27 NWVRSTRPVAVVEDTIIVGVQGEFAKHRMESRYAPLLRQALRDLTKRNMQLKFVANPNVIEDPAAEPVDAPNVADLPAGTSAPAAEQNARLLGYINP----KYTFETFVVG--NSNRFAHAAALAVAETPARTYNPLFIYGGVGLGKTHLMHAIGHYVLQHNPTAKVAYVSTETFTNEFIMAIQKGSTTA--FQNRYRKVDVLLIDDIQFLAGKEATQEEFYHTFNAIREANKQIVISSDRPPKEIPTLEDRLRSRFEWGLICDIQPPDLETRTAILRKKAQSEGIQVP--DEVTNYIATNIETNIRELEGALTRV------------VAYANMLKCPLTYDLAVQALKDILPPVRPKQITIATIKQVVAEHYNIRMQDFEVRNRSRAVAYPRQIAMYLARELTDSSLPKIGEEFGGRDHTTVIHACEKIAKDIQSDPAFAHTIEQLIAR 454
>gi|171056693|ref|YP_001789042.1| chromosomal replication initiator protein DnaA [Leptothrix cholodnii SP-6] >gi|170774138|gb|ACB32277.1| chromosomal replication initiator protein DnaA [Leptothrix cholodnii SP-6] (510 aa)
Score = 418, Expect = 6.6e-39, Identities = 109/347 (31%), Positives = 177/347 (51%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           PT+        +NP L    TF+    G  N+ A  AA  +     + +  L IYG  GLGKTHL+HAVGN  ++  P   ++Y+  E F+  + +         +E K  + ++DLLLIDD+QF   K++  E FFN F  L +K  +I+MTSD  P  L  ID+R+ SRF++GL++ I  P+ E    I+++       + P  ++A  F+A    +++R LEG L K+  +        EI     I    E+  D   + N  Q++ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  + + + +L
  S:   164 PTLSPAVSRGRLNPAL----TFDTLVPGRANQMARTAALHVVGAPGHMYNPLFIYGGVGLGKTHLIHAVGNALIRDNPDARVLYLHAEQFISDVVRNYQR--KTFDELKAKYHSLDLLLIDDVQFFAGKDRTQEEFFNAFEALLAKRAHIIMTSDTYPKGLVDIDERLTSRFDAGLTVAIEPPELEMRVAILMKKSDAEGSRMP-EDVAF-FVAKNVRANVRELEGALRKVLAY--SRFSHKEI----SINLAREALKDLLSIQNR-QVSVENIQKTVADFYKIKIADMYSKKRPASIARPRQIAMYLAKEMTQKSLPEIGELFGGRDHTTVLHAVRKIGGERQKNTEL 497
>gi|152994044|ref|YP_001338879.1| chromosomal replication initiator protein DnaA [Marinomonas sp. MWYL1] >gi|189044598|sp|A6VR65|DNAA_MARMS Chromosomal replication initiator protein dnaA >gi|150834968|gb|ABR68944.1| chromosomal replication initiator protein DnaA [Marinomonas sp. MWYL1] (516 aa)
Score = 418, Expect = 6.6e-39, Identities = 110/340 (32%), Positives = 183/340 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQ-----INPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L++ FTF+N+  G  N+ A  AA+L + EN    +  L IYG  GLGKTHL+ AVG + ++  P   ++Y+ +E F+  + KA+      + +FK  + +VD LLIDDIQF   K++  E FF+ FN L    + +++T D+ P  ++ ++DR+ SRF  GL++ I  P+ E+   I++    +S IK  + +    FIA +  S++R LEG L ++            I N       I  D   E + +L+      +N D I   +   Y +    ++SK+R++  +  R+V M + +E  N S  EIG  F  R+H T L AI+ ++    +D D++     +M
  S:   181 LNNSFTFDNFIEGKSNQLA-HAAALQVAENPGGAYNPLFIYGGVGLGKTHLMQAVGTEMMRHNPNAKVVYLHSERFVADMVKALQLNA--INDFKRYYRSVDALLIDDIQFFAGKDRTQEEFFHTFNALLEGGQQMILTCDRYPKEIQGLEDRLKSRFGWGLTVAIEPPELETRVAILMRKADESGIKLSYDSAF--FIAQKIRSNVRELEGALKRV------------IANSHFTGRAITPDFVRESLKDLLALQDKLVNIDNIQRIVAEYYKIKISDLLSKRRSRSVARPRQVAMSLAKELTNHSLPEIGDAFGGRDHTTALHAIRKIKELQDTDSDIREDYKQLM 511
>gi|77917619|ref|YP_355434.1| chromosomal replication initiator protein DnaA [Pelobacter carbinolicus DSM 2380] >gi|77543702|gb|ABA87264.1| chromosomal replication initiator protein DnaA [Pelobacter carbinolicus DSM 2380] (452 aa)
Score = 418, Expect = 6.7e-39, Identities = 108/339 (31%), Positives = 187/339 (55%)
  Q:   110 LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           L+SR+TFE + +G  N+  +  A ++       +  L IYG  GLGKTHL++AVGN  ++  P+  + Y  +E F+ ++  ++     K++EF+  F ++D+LLIDD+QF+  KE+  E FF+ FN L   +K IV+TSDK P  +  +++R+ SRF  GL   I  PD E+ + I+    +++ I  P   +A+ F+A   +S+IR LEG L +I  +      P  +   +++   I  +   E+    +Q       + +   Y +    + S KR K     R++ MY+ R+  + SY EIG  F  ++H+T++ AIK +E  +  D  L++ ++N+
  S:   117 LNSRYTFETFVLGSSNQFASAAATAVANNPATTYNPLFIYGGVGLGKTHLVNAVGNAILKKNPEMKVCYYTSEKFMNELINSLRYA--KMDEFRTKFRSMDVLLIDDVQFIAGKERTQEEFFHTFNALYDSHKQIVVTSDKFPKEIPGLEERLRSRFEWGLIADIQAPDMETKQAILKMKAEQNGIDLP-KEVAL-FLASAVSSNIRELEGYLVRIGAYASLTATPITLSMAQEVLKDILVEKRRELTVEEIQ-------KLVATHYSIKISDLKSAKRMKALVLPRQIAMYLSRQLTSCSYPEIGERFGGKDHSTIIHAIKKIEKAMDEDYQLRSVINNL 446
>gi|119509172|ref|ZP_01628323.1| chromosomal replication initiation protein [Nodularia spumigena CCY9414] >gi|119466338|gb|EAW47224.1| chromosomal replication initiation protein [Nodularia spumigena CCY9414] (459 aa)
Score = 418, Expect = 7.1e-39, Identities = 108/355 (30%), Positives = 187/355 (52%)
  Q:    87 EKDINKELP----TIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           E ++  ELP    T E  P+  +    L+S++ F  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+G+   Q+ P   + Y+ TE F   +  AI      ++ F+  +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  + ++ +R+ SRF+ GL   +  PD E+   I+ +  +   I+ P     IE+IA  + ++IR LEG L +   ++     P  +   E I  ++E  S+       V   P++I+  I   + +  + + S  R ++ S+ R++ MY++R+  +LS   IG  F  ++H TV+ +   +   ++SD  L
  S:    92 ESEVTWELPSQSMTAESVPQNKQPPKDLNSKYVFSRFVVGANNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIGHYRSQICPDSKIFYVSTEQFTNDLITAIRN--DSMQNFREHYRAADVLLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPHHIPQLQERLCSRFSMGLIADVQTPDLETRMAILQKKAEYENIRLPRD--VIEYIASNYTNNIRELEGALIRALAYISIWGLPMTV---ENITPVLERQSEK------VAATPEVILSVIGDNFAISIEDLKSNSRRREISWARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVIYSCDKIAQLLQSDRTL 439
>gi|116493575|ref|YP_805309.1| DNA replication ATPase initiation [Lactobacillus casei ATCC 334] >gi|122264962|sp|Q03D55|DNAA_LACC3 Chromosomal replication initiator protein dnaA >gi|116103725|gb|ABJ68867.1| DNA replication ATPase initiation [Lactobacillus casei ATCC 334] (449 aa)
Score = 417, Expect = 7.7e-39, Identities = 111/349 (31%), Positives = 186/349 (53%)
  Q:    95 PTIEEKPK--TLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           P +EE  +  T +    L+ ++TF+++ IG  N+     A ++       +  L IYG  GLGKTHL+ A+GN  +   P  N+ Y+ +E+F      +I     + E+F+  + NVDLLL+DDIQF  +KE   E FF+ FN L    K IV+TSD+LP  + K+ +R++SRFN GLS+ +  PD E+   I+        +  P   L+  +IA +  S++R LEG L ++  F  + N D    +  + ++++   D          Q+    I+ ++   + +  + +  KKR KQ    R++ MY+ RE  + S  +IG     ++H TV+ A + +   + +DE+LKA
  S:    94 PAVEEDDQNLTFKAKTHLNPKYTFDHFVIGKGNQMAHAAALAVAEAPGTTYNPLFIYGGVGLGKTHLMQAIGNLVLGNNPAANIKYVTSENFANDFINSIQT--KQQEQFRQEYRNVDLLLVDDIQFFGDKEATQEEFFHTFNTLYENMKQIVLTSDRLPNEIPKLQERLVSRFNKGLSVDVTPPDLETRIAILRNKADAEDLSIPDDTLS--YIAGQIESNVRDLEGALVRVQAFSTMKNEDITTSLAADALKALKLDDRSG-------QLTIPQILNAVAKYFQLTVQDLKGKKRVKQIVIPRQIAMYLAREMTDNSLPKIGQEIGGKDHTTVIHAHEKIMASMTTDENLKA 436
>gi|167834929|ref|ZP_02461812.1| chromosomal replication initiation protein [Burkholderia thailandensis MSMB43] (412 aa)
Score = 417, Expect = 7.7e-39, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    76 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 399
>gi|78187985|ref|YP_378323.1| chromosomal replication initiator protein, DnaA [Chlorobium chlorochromatii CaD3] >gi|78170184|gb|ABB27280.1| chromosomal replication initiator protein, DnaA [Chlorobium chlorochromatii CaD3] (492 aa)
Score = 417, Expect = 7.8e-39, Identities = 107/342 (31%), Positives = 183/342 (53%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L++++ F+    G  N  AF AA    +    N +  L+IYG  GLGKTH++ AVGN   +      ++Y+ +E F      AI  G  K++EF + + ++D+L+IDDIQF + KEK  E  F+IFN L+  NK I++++D+    +K I+DR+ISRFN GLS  I  PD E+ K II+  ++ + +     +  IEFIA     ++R LEG + K+     LDN D +    +  ++ II   +         Q+  D I + +   + +    +  K + K+ +  R++ MY+ +   + S   IG  F  R+H+TV+ A+  +  +V+   + +  ++ I  +
  S:   153 LNTKYIFDTLIRGDCNSLAFAAAKAVSQNPGQNAFNPLVIYGGVGLGKTHMMQAVGNSVRENRLTDRVLYVSSEKFAIDFVNAIQNG--KIQEFSSFYRSIDVLIIDDIQFFSGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLQHNGVT--LDDAVIEFIATNVTENVRELEGCIVKLLAAQSLDNRDIDLAFTKSTLKDIIRHTTK--------QLTLDTIEKGVSSYFSITSNDLKGKSKKKEIAVGRQIAMYLAKMLTDSSLKTIGLHFGGRDHSTVIHAVSTISKRVEQISEERKRIEEIKKR 486
>gi|24378533|ref|NP_720488.1| chromosomal replication initiation protein [Streptococcus mutans UA159] >gi|38257598|sp|Q8DWN9|DNAA_STRMU Chromosomal replication initiator protein dnaA >gi|24376381|gb|AAN57794.1|AE014853_1 chromosomal replication initiator protein, DnaA [Streptococcus mutans UA159] (452 aa)
Score = 417, Expect = 8.1e-39, Identities = 135/424 (31%), Positives = 225/424 (53%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVF--TNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLE------INPTLDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKE--KLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ++ +V D+ + K++     IL+  D +K++F   N    +    F +  N+ +++ ++ +E +  +      + K   L       +   L+ +++F+N+ IG  N+ AF A+ S+       +  L IYG  GLGKTHLL+A+GN  +   P+  + YI  E+F+ +    I      ++E K  F N+DLLLIDDIQ L  K      E FFN FN L+  NK IV+TSD+ P  L  ++ R+++RF  GL++ I  PD E+  ++ I N K       F +  IE++A +F+S++R LEG L  I   L+ N    ++I  E     I +    +    ++ I  + I + +   YGV  K + S KR +     R+V MY+ RE  + S  +IG  F  R+H+TVL A   ++  +  D+ LK  ++ I +K
  S:    25 FDFFVSDAKLLKVEGNIATILL--DDMKKLFWEKNLQPVVLTAGFEV-FNTEISIEYVFEETQSTSNSPQISQNKTAELATETLPFVQNDLNPKYSFDNFVIGDENRWAFTASVSVADLPGTTYNPLFIYGGPGLGKTHLLNAIGNSVLASNPKARIKYISAENFINEFVVHIRL--QNMDELKKKFRNLDLLLIDDIQSLAKKSLAATQEEFFNTFNALHDNNKQIVLTSDRTPDDLNDLEQRLVTRFKWGLTVNITPPDFET--RVAILNNKIQEYNYSFLSETIEYLAGQFDSNVRDLEGALKDI--SLVANFKKLDVITVEVAAEAIRARKQ-DSSPKMIVIPIEDIQKQVGKFYGVTVKEIKSTKRTQNIVLARQVGMYLAREMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMLAQDDSLKIEMETIKNK 450
>gi|126660126|ref|ZP_01731245.1| chromosomal replication initiation protein [Cyanothece sp. CCY0110] >gi|126618569|gb|EAZ89319.1| chromosomal replication initiation protein [Cyanothece sp. CCY0110] (456 aa)
Score = 417, Expect = 8.3e-39, Identities = 120/428 (28%), Positives = 217/428 (50%)
  Q:    24 NENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD---INKEL----------PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           N   +  ++  +++   +D  + I V+N F+       Y  +  E     +  +++V   T +E++   ++K+            T ++ PK  ++NP     + F  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+ +  ++L+P  N+ Y+ TE F   +  +I +    +E F+  +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  + DR++SRF+ GL   I  PD E+   I+ +  +   I  P     IE+IA  + S+IR LEG L +   ++  +      +  E I  ++    +       + ++PD+II+ I   + V  + +    R ++ S  R++ MY++R+  +LS   IG  F  ++H TVL +   +    K D DL   L  +  +
  S:    21 NPTAFETWLASATVQTFQDNCLVIQVENPFILNHLQKTYYSLIVEEVETIVGYSISVKLTTSQEQNWKIVDKDEYNYSSNKLNNKTDKQSPKLSQLNP----HYNFSRFVVGPTNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLELYPNANVFYVSTEQFTNDLITSIRQ--DSMEHFREHYRTADILLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPKRIPSLQDRLVSRFSMGLIADIQVPDLETRMAILQKKAEYENIVLPRD--VIEYIATNYTSNIRELEGALIRAVTYISIS---GLSMTVENIAPVLNPPMEQ------ISVSPDVIIKIIAENFNVSIEDLKGSSRRREISLARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVLYSCDKISKLQKKDWDLSQQLSELSDR 446
>gi|169830220|ref|YP_001716202.1| chromosomal replication initiator protein DnaA [Candidatus Desulforudis audaxviator MP104C] >gi|169637064|gb|ACA58570.1| chromosomal replication initiator protein DnaA [Candidatus Desulforudis audaxviator MP104C] (445 aa)
Score = 417, Expect = 8.5e-39, Identities = 116/410 (28%), Positives = 219/410 (53%)
  Q:    42 DENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNV-FFITKEEKDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN-NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV------QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           ++ + I V N F ++     Y  + +  F       + + F + +E  ++ K L    +K  T +++  L+ ++TF+++ +G  N+ A  AA    +     +  L +YG  GLGKTHL+HA+G+  +    +  + Y+ +E F   +  AI +  T   +F++ + ++D+LLIDDIQFL  KE+  E FF+ FN L    K IV++SD+ P  +  +++R+ SRF  GL   I  PD E+   I+ + + +S   +   +  I +IA R  S+IR LEG   ++  +   N            R+I+  ++  EI+ N++      QI   +I + +   Y +  + + +KKR +  ++ R++ MY+ RE  +LS  +IG  F  R+H TVL A + +  ++++D  ++  ++ ++ +
  S:    40 NKTLLIEVPNHFSRDWLHERYAPLLKHSFETLAGHEVAIKFLLAREVPEVKKYLSRPLDKLST-DLS-ALNPKYTFDSFVVGNSNRFAHAAAFAVADTPVKAYNPLFLYGGVGLGKTHLMHAIGHHILGNHSRYRIAYVTSERFTNDLINAIKDDQTP--QFRSKYRSIDILLIDDIQFLAGKERTQEEFFHTFNSLYEDAKQIVISSDRPPKEIPTLEERLRSRFEWGLITDIQPPDLETRIAILRKKL-QSEENSLVPDETILYIADRIQSNIRELEGAFIRVSAYASLN------------RTIVSPENAAEILKNILPPHKPKQITCSLIQQVVAGYYKLRPEDLKAKKRTRNVAYPRQIAMYLTRELTDLSLPKIGDEFGGRDHTTVLHACEKINQEIQADPSVQEIINELIRR 441
>gi|74316019|ref|YP_313759.1| chromosomal replication initiator protein DnaA [Thiobacillus denitrificans ATCC 25259] >gi|74055514|gb|AAZ95954.1| chromosomal replication initiator protein, DnaA [Thiobacillus denitrificans ATCC 25259] (457 aa)
Score = 417, Expect = 8.9e-39, Identities = 113/338 (33%), Positives = 176/338 (52%)
  Q:   104 LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           + INP     FTF+N+  G  N+ A +AA+L + EN    +  L +YG  GLGKTHLL A+GN   Q  P   + YI   D+++ + KA      + ++ K  + ++DLLLIDDIQFL  K++  E FF +FN L    K IV+T D  P  +  +DDR+ SRF  GL++ +  P+ E    I++   +   +     N+A  FIA +  S++R LEG L + I F           + +E +R +I S S    + N+ +   D         Y +    + SKKR +  +  R++ M + +E  N S  EIG  F  R+H TV+ A + V    +++ D+
  S:   120 MRINPG----FTFDNFVSGRANQLA-RAAALQIAENPGVAYNPLFVYGGVGLGKTHLLQAIGNTVRQTNPAARISYIHANDYVDDVVKAYLN--KQFDDLKRRYMSLDLLLIDDIQFLAKKDRTQEEFFYVFNSLIENKKQIVITCDTFPKEISGLDDRLKSRFAWGLTVAVEPPELEMRVAILLAKARAESVTLD-ENVAF-FIAKQVRSNVRELEGALKRVIAFSRFHEKPITMELVKEALRDLIASTSRMVSIENIQKTVADF--------YKIKVADMFSKKRTRNLARPRQIAMALAKELTNQSLPEIGESFGGRDHTTVIHACRKVAELRETEADI 444
>gi|53715109|ref|YP_101101.1| chromosomal replication initiation protein [Bacteroides fragilis YCH46] >gi|60683067|ref|YP_213211.1| chromosomal replication initiation protein [Bacteroides fragilis NCTC 9343] >gi|81313879|sp|Q5L9D0|DNAA_BACFN Chromosomal replication initiator protein dnaA >gi|61212532|sp|Q64PL4|DNAA_BACFR Chromosomal replication initiator protein dnaA >gi|52217974|dbj|BAD50567.1| chromosomal replication initiator protein DnaA [Bacteroides fragilis YCH46] >gi|60494501|emb|CAH09298.1| putative chromosomal replication initiator protein [Bacteroides fragilis NCTC 9343] (476 aa)
Score = 417, Expect = 9.1e-39, Identities = 123/432 (28%), Positives = 230/432 (53%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEE--YFSIKMNSNL--NVFFITKEEKDINKE------------LPTIEEK--------PKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQ-----INPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           EI ++   E+ Y  + +     K +D+ + + V + F  E   +++ ++  +  Y  I   + L  NV         +N+E            LP ++E+        P   +++P L+  + FE +  G  NK +   A    E      +  L ++G++G+GKTHL +A+G +  +L+P K ++Y+    F  +   ++    T   +F N +  +D+L+IDDIQ      K    FF+IFN L+   K +++TSD+ P  L+ +++R+++RF  G+  ++ KP  E  K I+   I +  ++  F +  I++IA   N  +R LEG++  I  H       + I N+E     I+ D    IV  +V+     +  D II  +C  + ++  ++ +K R ++    R+V MY+ +   + S ++IG F  N++HATVL A K V+ + + D+  ++ L+NI
  S:    15 EIIRDNVPESTYKTWFVPIVPLKYEDKTLIVQVPSQFFYEFLEDKFVDLLRKTLYKVIGDGTKLMYNVLVDKSSGATVNQESTTRSTAIPQSGLPRVDERKAPGLLRAPAVQDLDPHLNPNYNFETFIEGYSNKLSRSVAEAVAENPAKTVFNPLFLHGASGVGKTHLANAIGTRIKELYPDKRVLYVSAHLFQVQYTDSVRNNTTN--DFINFYQTIDVLIIDDIQEFAGVTKTQNTFFHIFNHLHQNGKQLILTSDRAPVLLQGMEERLLTRFKWGMVAELEKPTVELRKNILRNKIHRDGLQ--FPSEVIDYIAENVNESVRDLEGIVISIMAH-------STIYNKE-----IDLDLAQRIVRKVVRCETKAVTIDDIINVVCKHFDLESSAIHTKSRKREVVQARQVAMYLAKTHTDFSTSKIGKFIGNKDHATVLHACKTVKGQCEVDKGFRSDLENI 462
>gi|72160407|ref|YP_288064.1| chromosomal replication initiator protein DnaA [Thermobifida fusca YX] >gi|123774818|sp|Q47U23|DNAA_THEFY Chromosomal replication initiator protein dnaA >gi|71914139|gb|AAZ54041.1| bacterial chromosomal replication initiator protein, DnaA [Thermobifida fusca YX] (615 aa)
Score = 417, Expect = 9.4e-39, Identities = 107/340 (31%), Positives = 192/340 (56%)
  Q:    94 LPTIEEKPKTLEI----------NPT------LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVET 433
           +P+ E+ P T  +          NPT      L+ ++TF+ + IG  N+     A ++       +  L +YG +GLGKTHLLHA+G+   +L+    + Y+ +E+F  +   +I +G  K + F+  + ++D+LL+DDIQFL NKE+  E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +   +  +  P     +EFIA + +++IR LEG L ++  F  L+    +  +    +R +I +D   EI +       +I+ ++    +G+  + +    R++     R++ MY+ RE  +LS  +IG  F  R+H TV+ A + + +
  S:   239 VPSAEQPPVTPPLGVTERGDGSTNPTSGGPDQLNPKYTFDTFVIGSSNRFAHAAAVAVAEAPAKAYNPLFVYGGSGLGKTHLLHAIGHYTQRLYEGARVRYVSSEEFTNEFINSIRDG--KADGFRRRYRDIDVLLVDDIQFLENKEQTQEEFFHTFNTLHNSNKQIVISSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAAQEGLNAPPE--VLEFIASKISTNIRELEGALIRVTAFASLNRQSVDLHLTSIVLRDLIPNDEVPEITA------AEIMAQTASY-FGLTPEDLCGTSRSRVLVTARQIAMYLCRELTDLSLPKIGQQFG-RDHTTVMHADRKIRS 585
>gi|191636825|ref|YP_001985991.1| Chromosomal replication initiator protein dnaA [Lactobacillus casei] >gi|190711127|emb|CAQ65133.1| Chromosomal replication initiator protein dnaA [Lactobacillus casei BL23] (449 aa)
Score = 416, Expect = 9.5e-39, Identities = 111/349 (31%), Positives = 185/349 (53%)
  Q:    95 PTIEEKPK--TLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           P +EE  +  T +    L+ ++TF+ + IG  N+     A ++       +  L IYG  GLGKTHL+ A+GN  +   P  N+ Y+ +E+F      +I     + E+F+  + NVDLLL+DDIQF  +KE   E FF+ FN L    K IV+TSD+LP  + K+ +R++SRFN GLS+ +  PD E+   I+        +  P   L+  +IA +  S++R LEG L ++  F  + N D    +  + ++++   D          Q+    I+ ++   + +  + +  KKR KQ    R++ MY+ RE  + S  +IG     ++H TV+ A + +   + +DE+LKA
  S:    94 PAVEEDDQNLTFKAKTHLNPKYTFDRFVIGKGNQMAHAAALAVAEAPGTTYNPLFIYGGVGLGKTHLMQAIGNLVLDNNPAANIKYVTSENFANDFINSIQT--KQQEQFRQEYRNVDLLLVDDIQFFGDKEATQEEFFHTFNTLYENMKQIVLTSDRLPNEIPKLQERLVSRFNKGLSVDVTPPDLETRIAILRNKADAEDLSIPDDTLS--YIAGQIESNVRDLEGALVRVQAFSTMKNEDITTSLAADALKALKLDDRSG-------QLTIPQILNAVAKYFQLTVQDLKGKKRVKQIVIPRQIAMYLAREMTDNSLPKIGQEIGGKDHTTVIHAHEKIMASMTTDENLKA 436
>gi|113953832|ref|YP_731136.1| chromosomal replication initiation protein [Synechococcus sp. CC9311] >gi|123327711|sp|Q0I8T6|DNAA_SYNS3 Chromosomal replication initiator protein dnaA >gi|113881183|gb|ABI46141.1| chromosomal replication initiator protein DnaA [Synechococcus sp. CC9311] (468 aa)
Score = 416, Expect = 9.7e-39, Identities = 102/336 (30%), Positives = 180/336 (53%)
  Q:   108 PTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           P L+ R+ F  + +G  ++     A ++       +  L I G  GLGKTHL+ A+G+  +++ P+  + Y+ TE F   +  AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ R+  P     I++I+ RF S+IR LEG L + + F  +  +     +  E +  +++           V + P  +IE +   + V    + S  R +  S  R+V M+++R+  +LS   IG  F  ++H TV+ AI+ VE K+ +D  L +
  S:   127 PGLNMRYVFNRFVVGPNSRMAHAAALAVAEAPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPEARVFYVSTETFTNDLITAIRKDG--MQAFRDRYRAADLILVDDIQFIEGKEYTQEEFFHTFNALHDAGRQIVIASDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEQERVALPRD--LIQYISGRFTSNIRELEGALTRAVAFSSITGIP----MTVESVAPMLDPSGQG------VDVTPQQVIEKVSEVFDVTADDMRSSSRRRAVSQARQVGMFLMRQGTDLSLPRIGDTFGGKDHTTVIYAIEQVEKKLATDPQLAS 451
>gi|145221421|ref|YP_001132099.1| chromosomal replication initiation protein [Mycobacterium gilvum PYR-GCK] >gi|145213907|gb|ABP43311.1| chromosomal replication initiator protein DnaA [Mycobacterium gilvum PYR-GCK] (492 aa)
Score = 416, Expect = 9.9e-39, Identities = 108/333 (32%), Positives = 182/333 (54%)
  Q:   103 TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           +L +N  L+ R+TFE + IG  N+ A  AASL + E     +  L I+G +GLGKTHLLHA GN   +LFP   + Y+ TE+F      ++ +   +   FK ++ ++D+LL+DDIQF+  K+ + E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +  +  R+  P  +  +E IA R   +IR LEG L ++  F  L+    ++ + E  +R +I            +QI+   I+ +    +      +    + +  +  R++ MY+ RE  +LS  +IG  F  R+H TV+ A K +  ++
  S:   148 SLSVN--LNRRYTFETFVIGASNRFA-HAASLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRD--DRRASFKRTYRDIDVLLVDDIQFIEGKDGIQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLDVP--DDVLELIASRIERNIRELEGALIRVTAFASLNKTSIDKSLAEIVLRDLISD-------PGTMQISTAAIMAATAEYFETSVDELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFG-RDHTTVMYAEKKIRAEM 469
>gi|194335183|ref|YP_002016977.1| chromosomal replication initiator protein DnaA [Pelodictyon phaeoclathratiforme BU-1] >gi|194307660|gb|ACF42360.1| chromosomal replication initiator protein DnaA [Pelodictyon phaeoclathratiforme BU-1] (487 aa)
Score = 416, Expect = 1.0e-38, Identities = 110/342 (32%), Positives = 185/342 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L+S++TF+    G  N  AF A+    +    N +  L+IYG  GLGKTH++ A+GN   +    + ++Y+ +E F      AI  G  K++EF + + ++D+L+IDDIQF + KEK  E  F+IFN L+  NK I++++D+    +K I+DR+ISRFN GLS  I  PD E+ K II+  + +S +        IEFIA     ++R LEG + K+     LDN + +    +  ++ II   +         ++  D I +++C  + +    +  K + K+ +  R+V MY+ +   + S   IG  F  R+H+TV+ A+     KV +  D +  ++ I  +
  S:   148 LNSKYTFDTLIRGDCNSLAFAASKSVAQSPGQNAFNPLVIYGGVGLGKTHMMQAIGNSVRENRLSERVLYVSSEKFAIDFVNAIQNG--KIQEFSSFYRSIDVLIIDDIQFFSGKEKTQEEIFHIFNTLHQSNKQIILSADRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLHQSGVN--LDETVIEFIATNVTENVRELEGCIVKLLAAQSLDNREIDLQFTKSTLKDIIRHTTK--------RLTLDTIEKAVCSYFSITPNDLKGKSKKKEIAVGRQVAMYLSKLLTDSSLKTIGLHFGGRDHSTVIHAVNTTTKKVDTIGDERKKIEEIKKR 481
>gi|167620899|ref|ZP_02389530.1| chromosomal replication initiation protein [Burkholderia thailandensis Bt4] (401 aa)
Score = 416, Expect = 1.1e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    65 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 388
>gi|167582970|ref|ZP_02375844.1| chromosomal replication initiation protein [Burkholderia thailandensis TXDOH] (392 aa)
Score = 416, Expect = 1.1e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    56 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 379
>gi|2109445|gb|AAC45336.1| initiator protein [Streptococcus pneumoniae] (453 aa)
Score = 416, Expect = 1.1e-38, Identities = 135/435 (31%), Positives = 232/435 (53%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEI-----FEEYFSIKMNSNLNVFFITKEEKDINKE-------LPTIEEKPKTLEI---NPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKE-KLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYF--HLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           E  +E    + Y+ Y + + + K+++    I +    ++ V+  + K+I     FE Y     ++ +   +I  + +D           L   +  PK + I   +  L  ++TF+N+  G  N  A  AA    E+    +  L IYG  GLGKTHLL+A+GN+ ++  P   + YI  E F+      +  G  ++E+FK ++ ++DLLLIDDIQ L+ K+    E FFN FN L+ K K IV+TSD+ P  L+ +++R+++RF+ GL+  I  PD E+  +I I   K   +   F +  +E++A +F+S++R LEG +N I     +    D    I  E IR+  +       VS ++ I  D I   +   YGV  K +   +R +     R+V MY+ RE  + S  +IG  F  ++H TV+ A   +++ +  D++L+  +++I  K
  S:    12 EFAQERLTRSMYDFYAIQAELIKVEENVATIFLPRSEMEMVWEKQLKDIIVVAGFEIY-----DAEITPHYIFTKPQDTTSSQGEEATNLTLYDYSPKLVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTHLLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLG--EMEKFKKTYRSLDLLLIDDIQSLSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPPDFET--RIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDITIDIAAEAIRARKQD------VSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMYLSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKK 451
>gi|91781385|ref|YP_556591.1| chromosomal replication initiation protein [Burkholderia xenovorans LB400] >gi|123359273|sp|Q147F0|DNAA_BURXL Chromosomal replication initiator protein dnaA >gi|91685339|gb|ABE28539.1| chromosomal replication initiator protein DnaA [Burkholderia xenovorans LB400] (544 aa)
Score = 416, Expect = 1.1e-38, Identities = 112/351 (31%), Positives = 184/351 (52%)
  Q:    91 NKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI---INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           N E  ++ E+ K   +NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E ++  I+    +S   +   ++A  F+A    S++R LEG L KI  +        EI   + +E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   197 NGETDSMYERSK---LNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLMDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELE-MRVAILMRKAQSEFVSLNEDVAF-FVAKHLRSNVRELEGALRKILAY--SKFHGREITIEVTKEALKDLLTVQNRQISVENIQKTTADF--------YSIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 531
>gi|120401029|ref|YP_950858.1| chromosomal replication initiation protein [Mycobacterium vanbaalenii PYR-1] >gi|166214685|sp|A1T102|DNAA_MYCVP Chromosomal replication initiator protein dnaA >gi|119953847|gb|ABM10852.1| chromosomal replication initiator protein DnaA [Mycobacterium vanbaalenii PYR-1] (494 aa)
Score = 416, Expect = 1.2e-38, Identities = 106/326 (32%), Positives = 180/326 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           L+ R+TF+ + IG  N+ A  AASL + E     +  L I+G +GLGKTHLLHA GN   +LFP   + Y+ TE+F      ++ +   +   FK ++ ++D+LL+DDIQF+  K+ + E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +  +  R+  P     +E IA R   +IR LEG L ++  F  L+    ++ + E  +R +I         S+ +QI+   I+ +    +    + +    + +  +  R++ MY+ RE  +LS  +IG  F  R+H TV+ A K +  ++
  S:   155 LNRRYTFDTFVIGASNRFA-HAASLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRD--DRRASFKRTYRDIDVLLVDDIQFIEGKDGIQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLDVPGD--VLELIASRIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLISD-------SSTMQISTAAIMAATAEYFETSVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFG-RDHTTVMYAEKKIRAEM 471
>gi|160893411|ref|ZP_02074196.1| hypothetical protein CLOL250_00960 [Clostridium sp. L2-50] >gi|156864806|gb|EDO58237.1| hypothetical protein CLOL250_00960 [Clostridium sp. L2-50] (454 aa)
Score = 415, Expect = 1.2e-38, Identities = 118/365 (32%), Positives = 202/365 (55%)
  Q:    88 KDINKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN---NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL-LDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K+ +KE+ T EE  + +     L  ++TFE + +G  NK A  A  L + ++   + +  L +YG  GLGKTHL+ ++ +  +Q      ++Y+ +  F  +I +AI +   K +EF+  +  VD+LLIDDIQ+L  KE   + FF+ FN L+ + K I+++SDK P  +K +++R  SRF  G+ I I+ PD E+   I+   ++ +  KN   N+ +E+IA     ++R LEG LNKI  +  L NV   E + +  ++ +I  +++       V I PD+II ++     +    + S KR++  +  R++ MY+ R+        IG  F  ++H+TVL  IK VE ++ +D +    +D IM K 
  S:    93 KNDSKEIVTSEEYNEAI-TKSNLYPKYTFETFVVGESNKLA-HATCLAVADSPGLDKFNPLFLYGGAGLGKTHLMQSIAHYILQHNKNMKVLYVPSNKFTNEIVEAIKK--NKTDEFREKYRTVDVLLIDDIQYLIGKESTQQEFFDTFNALHDEGKQIILSSDKPPKEIKTLEERFRSRFEWGVPIDIHAPDYETRMAILKNKVEMNGYKNISDNI-LEYIANNVTYNVRELEGALNKISVYAELGNVTITEDLAKNILKDMISKETN-------VAITPDLIINTVSEHLNISVDDIKSSKRSQDVANARQISMYLCRKFTTKGLKTIGDVFGGKDHSTVLSNIKRVEERIANDPEYAETIDVIMKKL 450
>gi|187922036|ref|YP_001893678.1| chromosomal replication initiator protein DnaA [Burkholderia phytofirmans PsJN] >gi|187713230|gb|ACD14454.1| chromosomal replication initiator protein DnaA [Burkholderia phytofirmans PsJN] (545 aa)
Score = 415, Expect = 1.3e-38, Identities = 112/351 (31%), Positives = 184/351 (52%)
  Q:    91 NKELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI---INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           N E  ++ E+ K   +NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E ++  I+    +S   +   ++A  F+A    S++R LEG L KI  +        EI   + +E ++ ++   +    V N+ +   D         Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   198 NGETDSMYERSK---LNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLMDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELE-MRVAILMRKAQSEFVSLNEDVAF-FVAKHLRSNVRELEGALRKILAY--SKFHGREITIEVTKEALKDLLTVQNRQISVENIQKTTADF--------YSIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 532
>gi|118578450|ref|YP_899700.1| chromosomal replication initiator protein DnaA [Pelobacter propionicus DSM 2379] >gi|166214687|sp|A1AJX2|DNAA_PELPD Chromosomal replication initiator protein dnaA >gi|118501160|gb|ABK97642.1| chromosomal replication initiator protein DnaA [Pelobacter propionicus DSM 2379] (450 aa)
Score = 415, Expect = 1.3e-38, Identities = 125/429 (29%), Positives = 226/429 (52%)
  Q:    20 KEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIE----------EKPKTLE---INPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKI-YFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           ++  +E+ +  ++   S     D  V++ V   F KE     Y+++     S+       +  + +EE D N E+P  E          E+P T +    + +L+ ++TFE +  G  N+     A ++     + +  L IYG  GLGK+HLL+A+G+      P  ++ Y   E F+ ++  A+ +   ++++F++ F N+D+LL+DDIQF++ K    E FF+ FN L    K IV+TSDK P  +  +++R+ SRF  GL   I  PD E+   I+ +  + +RI+ P     I F+A     +IR LEG+L ++  +  L  +     +  E ++ II  D   +I   L+Q    ++ E     +G+    + S KR K F   R++ +++ R+  + SY +IG+ F  ++H+TV+ A K ++  +K D  L   +++I
  S:    13 EKVMSESDFTTWIQPISYSHADDTTVFLTVPTLFFKEWIDEHYRQVLVGALSVTAGKKYFIELVVQEE-DQNAEVPQAEDLIIKGHQEIEQPVTSQPETSSSSLNPKYTFELFVSGTGNQFAHAAAMAVANNPADTYNPLFIYGGVGLGKSHLLNAIGHTIRSSSPNLSVCYCSAEKFMYEMVNALRQ--KRMDQFRSRFRNLDVLLVDDIQFISGKVGTQEEFFHTFNALYDMQKQIVITSDKFPREISDLEERLRSRFEWGLIADIQPPDLETKIAILKKKSEITRIQLPED--VIYFLASSDTRNIRELEGMLIRLGAYSSLQGIPITLDMARENLKEII-GDRRKDITVELIQ---KVVAEQ----FGLKMADLKSSKRLKNFVQARQIAIWLCRDMTSFSYPDIGAKFGGKDHSTVIYAAKKIDLALKDDPKLSRIIEDI 444
>gi|149912812|ref|ZP_01901346.1| chromosomal replication initiator protein DnaA [Roseobacter sp. AzwK-3b] >gi|149813218|gb|EDM73044.1| chromosomal replication initiator protein DnaA [Roseobacter sp. AzwK-3b] (473 aa)
Score = 415, Expect = 1.3e-38, Identities = 104/333 (31%), Positives = 181/333 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP---FSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSD----EDLK 442
           LD RFTF+++ +G  N+ A  AA    E     +  L +YG  GLGKTHL+HA+  +  Q  P+  ++Y+  E F+ +  +A+ +   K+ +FK  F +VD+L++DD+QF+  KE   E FF+ FN L  +NK IV++ D+ P  +  ++DR+ SR   GL + ++  D E    I+    +    + P    SN  +EF+A R ++++R LEG L +++ F  L   +    + ++ +  I+ +           +++ + I   +   Y +    +I  KR + F+  R+V MY+ ++  + S  EIG  F  R+H TV+  +K +E     D    EDL+
  S:   133 LDERFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAWELKQRSPELTVLYLSAEQFMYRFVQALRD--RKMMDFKELFRSVDVLMVDDVQFIAGKESTQEEFFHTFNALVDQNKQIVISGDRAPGEIANLEDRIKSRLQCGLVVDLHPTDYELRLGILQSKSEHYARQYPDLKLSNGVLEFLAHRISTNVRVLEGALTRLFAFASLVGHEITLELTQDCLADILRASER--------KVSVEEIQRQVADHYNIRLSEMIGPKRLRAFARPRQVAMYLCKQMTSRSLPEIGRRFGGRDHTTVMHGVKRIEELQMQDAQIAEDLE 465
>gi|94993397|ref|YP_601495.1| chromosomal replication initiation protein [Streptococcus pyogenes MGAS10750] >gi|123080159|sp|Q1J960|DNAA_STRPF Chromosomal replication initiator protein dnaA >gi|94546905|gb|ABF36951.1| Chromosomal replication initiator protein dnaA [Streptococcus pyogenes MGAS10750] (451 aa)
Score = 415, Expect = 1.3e-38, Identities = 140/424 (33%), Positives = 225/424 (53%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVF--TNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEIN--PT----LDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNK--EKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           Y  +V D+ + K+      I +  D +KE+F   N    I    F +  N+ ++V ++ +E+  I +    I +KPK   +N  PT    L+ +++FEN+  G  N+ A  A+ ++       +  L I+G  GLGKTHLL+A+GN  +   P   + YI  E+F+ +    I      ++E K  F N+DLLLIDDIQ L  K      E FFN FN L++ NK IV+TSD+ P  L  ++DR+++RF  GL++ I  PD E+   I+   I++      F    IE++A +F+S++R LEG L  I     F  +D +  +  I  E IR+  +      +      I  + I   +   YGV  K + + KR +     R+V M++ RE  + S  +IG  F  R+H+TVL A   ++  +  DE L+  ++ I +K
  S:    25 YEFFVHDARLLKVDKHIATIYL--DQMKELFWEKNLKDVILTAGFEV-YNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNSLPTVTSDLNPKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLNAIGNSVLLENPNARIKYITAENFINEFVIHIRL--DTMDELKEKFRNLDLLLIDDIQSLAKKTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDFETRVAILTNKIQEYNFI--FPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD--IAAEAIRARKQDGPKMTV------IPIEEIQTQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLAREMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNK 449
>gi|189218018|ref|YP_001938660.1| Chromosomal replication initiator protein dnaA, ATPase [Methylokorus infernorum V4] >gi|189184876|gb|ACD82061.1| Chromosomal replication initiator protein dnaA, ATPase [Methylacidiphilum infernorum V4] (454 aa)
Score = 415, Expect = 1.3e-38, Identities = 119/361 (32%), Positives = 197/361 (54%)
  Q:    92 KELPTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINP------DIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSKF 452
           K LP  E+K    E +  L+++F+FEN+ +G  ++ A  AA    E     +  L +YG  GLGKTHL+ A+GN  V+      + Y+ +E F  +  +AI +G   + +F+  +  +D+LLIDDIQFL  KE+  E FF+ FN L   +K IV++ D+ P+SL+ ++ R+ISRF  GL+ +I  P  E    I+   +K   +        +EFIA R  +++R LEG LN++  +          I++E   ++ E+ S   ++ +L+ + P      ++I + +C  Y +    ++SK+R    +  R V MY+ R   NLS ++IG  F  R+H TVL A + +  K+  D DL   +  I  + 
  S:    99 KSLPR-EDKSSIFE-SKGLNTKFSFENFVVGPNSEFAAAAAKAVAESPAKAYNPLFLYGKVGLGKTHLMQAIGNHIVEKNKWILVQYVTSEQFTNEFIEAIQKG--SIGQFRKKYRQIDVLLIDDIQFLAGKERSQEEFFHTFNCLFDGSKQIVLSGDEAPSSLQNLEKRLISRFEWGLTAEILPPGIEVRLAILKHKLKNYSLS--IDEKILEFIAERIKTNVRQLEGALNRLCAY--------ASIHKEGKITLEETQS---LLKDLISLQPSKTITIEMIQKRVCEAYDIRFSDMVSKRRISAIALPRMVAMYLARRLTNLSLSQIGENFGGRDHGTVLHAQRTISEKMSKDPDLAQLIKKITEQL 450
>gi|118615920|ref|YP_904252.1| chromosomal replication initiation protein [Mycobacterium ulcerans Agy99] >gi|166214684|sp|A0PKB2|DNAA_MYCUA Chromosomal replication initiator protein dnaA >gi|118568030|gb|ABL02781.1| chromosomal replication initiator protein DnaA [Mycobacterium ulcerans Agy99] (510 aa)
Score = 415, Expect = 1.3e-38, Identities = 107/327 (32%), Positives = 184/327 (56%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           +L+ R+TF+ + IG  N+ A  AA+L + E     +  L I+G +GLGKTHLLHA GN   +LFP   + Y+ TE+F      ++ +   +   FK S+ +VD+LL+DDIQF+  KE + E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +  +  R+  P  +  +E IA     +IR LEG L ++  F  L+    ++ + E  +R +I +D+D       +QI+   I+ +    +    + +    + +  +  R++ MY+ RE  +LS  +IG  F  R+H TV+ A + + +++
  S:   170 SLNRRYTFDTFVIGASNRFA-HAATLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRD--DRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVP--DDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVLRDLI-ADAD------TMQISAATIMAATVEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFG-RDHTTVMYAQRKILSEM 487
>gi|108796982|ref|YP_637179.1| chromosomal replication initiation protein [Mycobacterium sp. MCS] >gi|119866066|ref|YP_936018.1| chromosomal replication initiation protein [Mycobacterium sp. KMS] >gi|126432614|ref|YP_001068305.1| chromosomal replication initiation protein [Mycobacterium sp. JLS] >gi|123179824|sp|Q1BG61|DNAA_MYCSS Chromosomal replication initiator protein dnaA >gi|166214681|sp|A3PSD7|DNAA_MYCSJ Chromosomal replication initiator protein dnaA >gi|166214682|sp|A1U8S0|DNAA_MYCSK Chromosomal replication initiator protein dnaA >gi|108767401|gb|ABG06123.1| chromosomal replication initiator protein DnaA [Mycobacterium sp. MCS] >gi|119692155|gb|ABL89228.1| chromosomal replication initiator protein DnaA [Mycobacterium sp. KMS] >gi|126232414|gb|ABN95814.1| chromosomal replication initiator protein DnaA [Mycobacterium sp. JLS] (495 aa)
Score = 415, Expect = 1.3e-38, Identities = 109/333 (32%), Positives = 182/333 (54%)
  Q:    99 EKPKTLEINP-TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           E P   + N  +L+ R+TF+ + IG  N+ A  AA+L + E     +  L I+G +GLGKTHLLHA GN   +LFP   + Y+ TE+F      ++ +   +   FK S+ ++D+LL+DDIQF+  KE + E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +  +  R+  P  +  +E IA     +IR LEG L ++  F  L+    ++ + E  +R +I   S        +QI+   I+ +    +    + +    + +  +  R++ MY+ RE  +LS  +IG  F  R+H TV+ A K +
  S:   144 ETPAAEDPNAVSLNRRYTFDTFVIGASNRFA-HAATLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRD--DRKASFKRSYRDIDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLDVP--DDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLISDAST-------MQISTAAIMAATAEYFETTIEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFG-RDHTTVMYAEKKI 468
>gi|184199647|ref|YP_001853854.1| chromosomal replication initiator protein DnaA [Kocuria rhizophila DC2201] >gi|183579877|dbj|BAG28348.1| chromosomal replication initiator protein DnaA [Kocuria rhizophila DC2201] (564 aa)
Score = 415, Expect = 1.4e-38, Identities = 112/339 (33%), Positives = 175/339 (51%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAI--SEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVET 433
           P   E   +  +NP    ++ F+++ IG  N+ A  AA    E     +  L IYG +GLGKTHLLHA+G+   +L+P+  + Y+ +E+F      +I   EG +    FK  + NVDLLLIDDIQFL  KE   E FF+ FN L++  K IV+TSD  P  L    +RM SRF  GL   +  P+ E+   I+ +      +  P  +  +E+IA   +++IR LEG L ++      N  P ++ + E  ++ +I  D   EI +         I+      + +    + SK R +     R++ MY+LRE  ++S  +IG     R+H TV+ A + + T
  S:   212 PADSEWDSSARLNP----KYVFDSFVIGQSNRFAHAAAFAVAETPAKAYNPLFIYGDSGLGKTHLLHAIGHYAKRLYPKMRVRYVNSEEFTNDFINSIRDDEGSS----FKGIYRNVDLLLIDDIQFLAGKEHTQEEFFHTFNALHNHEKQIVITSDMPPKQLTGFAERMRSRFEWGLITDVQPPELETRIAILRKKAISEGMDAP--DDVMEYIASHISTNIRELEGALIRVTAFASLNKQPVDLPLAELVLKDLITDDGGQEITAA-------SILGQTAAFFNITLDELKSKSRTRTLVTARQIAMYLLRELTDMSLPKIGQELGGRDHTTVMHADRKIRT 538
>gi|152963973|ref|YP_001359757.1| chromosomal replication initiator protein DnaA [Kineococcus radiotolerans SRS30216] >gi|189044597|sp|A6W3V4|DNAA_KINRD Chromosomal replication initiator protein dnaA >gi|151358490|gb|ABS01493.1| chromosomal replication initiator protein DnaA [Kineococcus radiotolerans SRS30216] (518 aa)
Score = 415, Expect = 1.4e-38, Identities = 107/336 (31%), Positives = 178/336 (52%)
  Q:   100 KPKTLEINPTLDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           +P T   N  L+ ++ FE + IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+    L+P   + Y+ +E+F      +I +   K + F+    +VD+LLIDDIQFL+NK +  E FF+ FN L++ +K +V+TSD  P  L   ++RM SRF  GL   +  PD E+   I+ +     R++ P  +   E+IA + +S+IR LEG L ++      N  P ++ + E  +R +I ++   EI +         I+      + V  + +    R++     R++ MY+ RE   LS  +IG  F  R+H TV+ A + ++ ++
  S:   168 RPTTRIENSRLNPKYIFETFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYAQNLYPGVQVRYVNSEEFTNDFINSIRD--DKAQAFQRRHRDVDVLLIDDIQFLSNKVQTQEEFFHTFNTLHNASKQVVITSDLPPKQLSGFEERMRSRFEWGLITDVQPPDLETRIAILRKKAIGERLEVP--DDVNEYIASKISSNIRELEGALIRVTAFASLNRQPVDMQLAEIVLRDLIPNEETPEITAA-------AIMGQTASYFSVTLEDLCGTSRSRTLVTARQIAMYLCRELTELSLPKIGQHFGGRDHTTVMHAERKIKQQM 495
>gi|78064659|ref|YP_367428.1| chromosomal replication initiation protein [Burkholderia sp. 383] >gi|123729088|sp|Q39L82|DNAA_BURS3 Chromosomal replication initiator protein dnaA >gi|77965404|gb|ABB06784.1| chromosomal replication initiator protein, DnaA [Burkholderia sp. 383] (525 aa)
Score = 415, Expect = 1.4e-38, Identities = 113/337 (33%), Positives = 178/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +       + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   + N   ++A  F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:   189 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGV-NLSEDVAF-FVAKHLRSNVRELEGALRKILAYSKFHG----------REISIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL 512
>gi|157412981|ref|YP_001483847.1| chromosomal replication initiation protein [Prochlorococcus marinus str. MIT 9215] >gi|167016903|sp|A8G3T0|DNAA_PROM2 Chromosomal replication initiator protein dnaA >gi|157387556|gb|ABV50261.1| chromosomal replication initiator protein DnaA [Prochlorococcus marinus str. MIT 9215] (464 aa)
Score = 415, Expect = 1.5e-38, Identities = 124/394 (31%), Positives = 206/394 (52%)
  Q:    55 KEVFTNEYKEIFEEYFSIKMNS----NLNVFFITKEEKDINKELPTIEEKPKTLEINPT-LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           KE+  ++ K +F+   +I  +S    NL+   +  + K  +     I   PK    NP  L+ R+ F+ + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  V++ P+  + Y+ TE F   +   I   G  +   ++ +  VDL+LIDDIQFL  KE   E FF+ FN L+     IV+ SD+ P  L  I +R+ISRF+ G++  I  PD E+   I+ +  ++ R+  P     I+FIA RF S+IR LEG   + + F  +  +     +  + I  +++ +S   +V+      P  +I+ +   + V    +IS  R K  S  R++ MY++R   +LS   IG  F  ++H TV+ AI+ VE K+ +D ++ + +  I
  S:    67 KEICGHDVKVVFKSETNISSDSINKENLDEQIVNHKTKLFHNNNQDIS--PKNRSKNPNGLNLRYVFKRFVVGPNSRLAHAAALAVAESPGREFNPLFICGGVGLGKTHLMQAIGHYRVEIDPEAKVKYVSTETFTNDVISGIRRDG--MTAIRDKYRKVDLILIDDIQFLEGKEYTQEEFFHTFNALHESGSQIVIASDRPPNQLSGIQERLISRFSMGMTADIQPPDLETRTAILQKKAEQERMSLPRD--LIQFIAGRFTSNIRELEGAFTRAVAFASITGLP----MTVQSIAPMLDPNSVGVVVT------PTQVIKKVSDFFKVSTDELISSSRRKPVSQARQIGMYLMRHGTDLSLPRIGDEFGGKDHTTVMYAIEQVEKKLSTDPNIASQVQKI 452
>gi|169632030|ref|YP_001705766.1| DNA replication initiator protein, transcriptional regulator of replication and housekeeping genes [Acinetobacter baumannii SDF] >gi|169150822|emb|CAO99422.1| DNA replication initiator protein, transcriptional regulator of replication and housekeeping genes [Acinetobacter baumannii] (465 aa)
Score = 415, Expect = 1.5e-38, Identities = 112/336 (33%), Positives = 186/336 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV----ETKVKSDEDLKAFL 445
           L+ +FTF  +  G  N+ A +     L +   +    L +YG TGLGKTHL+ AVGN  +Q  P   +MY+ +E F++    ++ +G  KVEEFK +  ++DLLL+DDI  L  KE     FF  FN L  ++K I++TSD+ P  L ++D R++SRF+ GLS+ +  PD E+  +I+++  + S +  P  N A+ FIA +  +++R LEG LNK+         P ++ +  E ++ ++   +    V N+ ++  +         + +  K ++  KR + ++  R++ M + RE    S+ EIG  F  R+H+TV+ A + V    E     DED K  L
  S:   129 LNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQHNPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKG--KVEEFKKNCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLVSRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLP-RNCAL-FIAQQVVANVRELEGALNKVVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEY--------FRIPLKELVGPKRTRIYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKNLL 460
>gi|167900712|ref|ZP_02487917.1| chromosomal replication initiation protein [Burkholderia pseudomallei NCTC 13177] (408 aa)
Score = 415, Expect = 1.5e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    72 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 395
>gi|56695074|ref|YP_165421.1| chromosomal replication initiation protein [Silicibacter pomeroyi DSS-3] >gi|71151804|sp|Q5LWV4|DNAA_SILPO Chromosomal replication initiator protein dnaA >gi|56676811|gb|AAV93477.1| chromosomal replication initiator protein DnaA [Silicibacter pomeroyi DSS-3] (468 aa)
Score = 415, Expect = 1.5e-38, Identities = 98/323 (30%), Positives = 183/323 (56%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNP---FSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVE 432
           LD RFTF+++ +G  N+ A  AA    E     +  L++YG  GLGKTHL+HA+  +     P+ N++Y+  E F+ +  +A+ E   ++ +FK+ F +VD+L++DD+QF+  K+   E FF+ FN L  +NK I++++D+ P  +K ++DR+ SR   GL + ++  D E    I+   ++  R   P    ++  +EF+A R ++++R LEG L +++ F  L   + +  + ++ +  ++ + S+ +I    +Q         +   Y +    +I  KR + ++  R+V MY+ ++  + S  EIG  F  R+H TV+  +K +E
  S:   128 LDPRFTFDSFVVGKPNELAHAAARRVSEGGPVTFNPLVLYGGVGLGKTHLMHAIAWELKVKRPELNVLYLSAEQFMYRFVQALRE--RRMMDFKHLFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVKSRLQCGLVVDLHPTDYELRLGILQTKVQMYRTTYPDLVIADGVLEFLAHRISTNVRVLEGALTRLFAFASLVGREIDMELTQDCLADVLRA-SERKITVEEIQ-------RKVSDYYNIRLSDIIGPKRLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVKRIE 446
>gi|193075921|gb|ABO10498.2| DNA replication initiator protein [Acinetobacter baumannii ATCC 17978] (465 aa)
Score = 415, Expect = 1.5e-38, Identities = 114/341 (33%), Positives = 188/341 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV----ETKVKSDEDLKAFLDNIMS 450
           L+ +FTF  +  G  N+ A +     L +   +    L +YG TGLGKTHL+ AVGN  +Q  P   +MY+ +E F++    ++ +G  KVEEFK +  ++DLLL+DDI  L  KE     FF  FN L  ++K I++TSD+ P  L ++D R++SRF+ GLS+ +  PD E+  +I+++  + S +  P  N A+ FIA +  +++R LEG LNK+         P ++ +  E ++ ++   +    V N+ ++  +         + +  K +I  KR + ++  R++ M + RE    S+ EIG  F  R+H+TV+ A + V    E     DED K  L  + S
  S:   129 LNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQHNPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKG--KVEEFKKNCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLVSRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLP-RNCAL-FIAQQVVANVRELEGALNKVVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEY--------FRIPLKELIGPKRTRIYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKNLLRLLQS 465
>gi|196249894|ref|ZP_03148590.1| chromosomal replication initiator protein DnaA [Geobacillus sp. G11MC16] >gi|196210770|gb|EDY05533.1| chromosomal replication initiator protein DnaA [Geobacillus sp. G11MC16] (351 aa)
Score = 415, Expect = 1.5e-38, Identities = 111/318 (34%), Positives = 177/318 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEA 427
           L+ ++TF+ + IG  N+ A  AASL + E     +  L IYG  GLGKTHL+HA+G+  ++  P   ++Y+ +E F  +   AI +   + ++F+N + NVD+LLIDDIQFL  KE+  E FF+ FN L+ ++K IV++SD+ P  +  ++DR+ SRF  GL   I  PD E+   I+ +  K      P  N  + +IA + +S+IR LEG L ++  +  L N +    +  E ++ II S     I    +Q         +   + +  +   +KKR K  +F R++ MY+ RE  + S  +IG  F  R+H TV+ A
  S:    25 LNPKYTFDTFVIGSGNRFA-HAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRD--NRPDDFRNKYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGFDIP--NEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLAAEALKDIIPSAKPKVITIQDIQ-------RVVGQHFNIKLEDFKAKKRTKSVAFPRQIAMYLSRELTDCSLPKIGDEFGGRDHTTVIHA 334
>gi|148259022|ref|YP_001233149.1| chromosomal replication initiation protein [Acidiphilium cryptum JF-5] >gi|146400703|gb|ABQ29230.1| chromosomal replication initiator protein DnaA [Acidiphilium cryptum JF-5] (482 aa)
Score = 414, Expect = 1.6e-38, Identities = 109/414 (26%), Positives = 208/414 (50%)
  Q:    28 YNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKT----------------LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENNN--WKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV-----QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           Y N++  + +  +  + V +++   F+++    EY  +   ++  +  +   V   T+      +     E +PKT                 +++  LD RFTF+ + +G  N+ A+  A    + + +  +  L +YG  GLGKTHL+HA+  +  Q   +  + Y+  E F+ K   A+    T   EFKN   +VD+L++DD+QFL  K+   E FF+ FN L    K I++++DK P+ L  I+DR+ +R   G+   ++    E   ++ I   K +R         +EF+A +  +++R LEG LN++  H                   +  ++ +E++ +L+     +I  + I + +   Y +    + S +R +  +  R++ MY+ ++  + S  EIG  F NR+H TV+ A+  V   +++D D 
  S:    48 YRNWLRQAVLHGLDGDEVTVMLPTRFLRDWVNKEYGNLLTAFWQAENPAVRRVDIRTRPAGTSERAPDLAEVEPKTAIARPAAAARREAEERPDMSAPLDPRFTFDTFVVGKPNEFAYACARRVADGHASPGFNPLFLYGGVGLGKTHLMHAIAWELSQRSDEVTVAYMSAEKFMHKFVSALRRQSTI--EFKNELRSVDVLMVDDLQFLIGKDGTQEEFFHTFNALVDSGKQIIVSADKSPSDLSGIEDRLRTRLGCGMVADVHATTYE--LRLAILEAKAARAGVVVPGRVMEFLAQKITANVRELEGALNRLIAH------------ANLFERPVTLETAHEVLHDLLRAYDRKITIEEIQKQVAEHYNIRVSEMSSARRARNIARPRQIAMYLAKQLTSRSLPEIGRKFGNRDHTTVMHAVSKVTELIEADPDF 469
>gi|167892200|ref|ZP_02479602.1| chromosomal replication initiation protein [Burkholderia pseudomallei 7894] (397 aa)
Score = 414, Expect = 1.7e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    61 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 384
>gi|167843721|ref|ZP_02469229.1| chromosomal replication initiation protein [Burkholderia pseudomallei B7210] >gi|167908929|ref|ZP_02496020.1| chromosomal replication initiation protein [Burkholderia pseudomallei 112] (389 aa)
Score = 414, Expect = 1.7e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    53 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 376
>gi|167822116|ref|ZP_02453587.1| chromosomal replication initiation protein [Burkholderia pseudomallei 9] (386 aa)
Score = 414, Expect = 1.7e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    50 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 373
>gi|167813575|ref|ZP_02445255.1| chromosomal replication initiation protein [Burkholderia pseudomallei 91] (391 aa)
Score = 414, Expect = 1.7e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    55 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 378
>gi|15902045|ref|NP_357595.1| chromosomal replication initiation protein [Streptococcus pneumoniae R6] >gi|116516053|ref|YP_815417.1| chromosomal replication initiation protein [Streptococcus pneumoniae D39] >gi|148984545|ref|ZP_01817833.1| chromosomal replication initiation protein [Streptococcus pneumoniae SP3-BS71] >gi|148988886|ref|ZP_01820301.1| chromosomal replication initiation protein [Streptococcus pneumoniae SP6-BS73] >gi|148997957|ref|ZP_01825470.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae SP11-BS70] >gi|149013383|ref|ZP_01834092.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae SP19-BS75] >gi|149020159|ref|ZP_01835133.1| chromosomal replication initiation protein [Streptococcus pneumoniae SP23-BS72] >gi|168484307|ref|ZP_02709259.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae CDC1873-00] >gi|168491771|ref|ZP_02715914.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae CDC0288-04] >gi|168493999|ref|ZP_02718142.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae CDC3059-06] >gi|169832473|ref|YP_001693435.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae Hungary19A-6] >gi|182682971|ref|YP_001834718.1| chromosomal replication initiation protein [Streptococcus pneumoniae CGSP14] >gi|122279578|sp|Q04N63|DNAA_STRP2 Chromosomal replication initiator protein dnaA >gi|38257595|sp|Q8DRQ4|DNAA_STRR6 Chromosomal replication initiator protein dnaA >gi|15457529|gb|AAK98805.1| DNA biosynthesis, initiation, binding protein [Streptococcus pneumoniae R6] >gi|116076629|gb|ABJ54349.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae D39] >gi|147755967|gb|EDK63010.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae SP11-BS70] >gi|147762906|gb|EDK69854.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae SP19-BS75] >gi|147923322|gb|EDK74436.1| chromosomal replication initiation protein [Streptococcus pneumoniae SP3-BS71] >gi|147925697|gb|EDK76773.1| chromosomal replication initiation protein [Streptococcus pneumoniae SP6-BS73] >gi|147930837|gb|EDK81818.1| chromosomal replication initiation protein [Streptococcus pneumoniae SP23-BS72] >gi|168994975|gb|ACA35587.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae Hungary19A-6] >gi|172042405|gb|EDT50451.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae CDC1873-00] >gi|182628305|gb|ACB89253.1| chromosomal replication initiation protein [Streptococcus pneumoniae CGSP14] >gi|183573942|gb|EDT94470.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae CDC0288-04] >gi|183576010|gb|EDT96538.1| chromosomal replication initiator protein DnaA [Streptococcus pneumoniae CDC3059-06] (453 aa)
Score = 414, Expect = 1.7e-38, Identities = 135/435 (31%), Positives = 232/435 (53%)
  Q:    17 EIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEI-----FEEYFSIKMNSNLNVFFITKEEKDINKE-------LPTIEEKPKTLEI---NPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN-NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKE-KLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYF--HLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           E  +E    + Y+ Y + + + K+++    I +    ++ V+  + K+I     FE Y     ++ +   +I  + +D           L   +  PK + I   +  L  ++TF+N+  G  N  A  AA    E+    +  L IYG  GLGKTHLL+A+GN+ ++  P   + YI  E F+      +  G  ++E+FK ++ ++DLLLIDDIQ L+ K+    E FFN FN L+ K K IV+TSD+ P  L+ +++R+++RF+ GL+  I  PD E+  +I I   K   +   F +  +E++A +F+S++R LEG +N I     +    D    I  E IR+  +       VS ++ I  D I   +   YGV  K +   +R +     R+V MY+ RE  + S  +IG  F  ++H TV+ A   +++ +  D++L+  +++I  K
  S:    12 EFAQERLTRSMYDFYAIQAELIKVEENVATIFLPRSEMEMVWEKQLKDIIVVAGFEIY-----DAEITPHYIFTKPQDTTSSQVEEATNLTLYDYSPKLVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTHLLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLG--EMEKFKKTYRSLDLLLIDDIQSLSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPPDFET--RIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDITIDIAAEAIRARKQD------VSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMYLSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKK 451
>gi|50953926|ref|YP_061214.1| chromosomal replication initiator protein [Leifsonia xyli subsp. xyli str. CTCB07] >gi|61212563|sp|Q6AHN6|DNAA_LEIXX Chromosomal replication initiator protein dnaA >gi|50950408|gb|AAT88109.1| chromosomal replication initiator protein [Leifsonia xyli subsp. xyli str. CTCB07] (473 aa)
Score = 414, Expect = 1.7e-38, Identities = 107/327 (32%), Positives = 176/327 (53%)
  Q:   110 LDSRFTFENYTIGMFNK-NAFKAASLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVK 436
           L+S+++F+N+ IG  N+     A ++       +  L IYG +GLGKTHLLHA+G+  + L+P   + Y+ +E+F      +I+    +   F+  + N+D+LLIDDIQFL    +  E FF+ FN L+  NK +V+TSD  P  L   +DRM SRF  GL   +  PD E+   I+ +  +  +I+ P  +  +EF+A + +S+IR LEG L ++  F  L+    +  + +  ++ +I  D D  I        P  II +    + +    +    R++  +  R++ MY+ RE  NLS  +IG  F  R+H TV+ A K +   +K
  S:   134 LNSKYSFDNFVIGQSNRFAHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIGHYAMSLYPGIRVRYVSSEEFTNDFINSIAN--NRGSSFQARYRNIDILLIDDIQFLQRAVETQEAFFHTFNTLHDHNKQVVITSDLPPKHLTGFEDRMRSRFEWGLITDVQVPDLETRIAILRKKAQSEKIQVP--DDILEFMASKISSNIRELEGTLIRVTAFASLNRTPVDMPLVQTVLKDLITLDDDNVIA-------PTDIITNTAEYFKLTVDDLYGSSRSQAVATARQIAMYLCRELTNLSLPKIGQLFGGRDHTTVMYANKKISELMK 452
>gi|167916970|ref|ZP_02504061.1| chromosomal replication initiation protein [Burkholderia pseudomallei BCC215] (406 aa)
Score = 414, Expect = 1.7e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    70 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 393
>gi|152981050|ref|YP_001351691.1| chromosomal replication initiator protein DnaA [Janthinobacterium sp. Marseille] >gi|166214676|sp|A6STW2|DNAA_JANMA Chromosomal replication initiator protein dnaA >gi|151281127|gb|ABR89537.1| chromosomal replication initiator protein DnaA [Janthinobacterium sp. Marseille] (460 aa)
Score = 414, Expect = 1.8e-38, Identities = 107/322 (33%), Positives = 177/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           +++  TF+++  G  N+ A +AA++ +  N  +++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  +  A    G   ++FK  + ++DLLLIDDIQF   K +  E FF  F  L +  K I++TSD  P  +  +DDR+ISRF+SGL++ +  P+ E    I+++   +  +   FS+    F+A    S++R LEG L KI     FH  D       I  E ++  ++   D   V N  QI+ + I +++   + +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   125 INTALTFDSFVTGKANQLA-RAAAIQVANNPGSSYNPLFLYGGVGLGKTHLIHAIGNQVLADNPDVKIRYIHAEQYVRDVVTAYQRKG--FDDFKRYYHSLDLLLIDDIQFFGGKSRTQEEFFYAFEALIAAKKQIIITSDTYPKEITGMDDRLISRFDSGLTVAVEPPELEMRVAILLKKAVQEGVT--FSDDVAFFVAKHLRSNVRELEGALRKILAYSRFHGKD-------ITIEVVKDALK---DLLSVQNR-QISVENIQKTVADFFNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 437
>gi|188568821|ref|ZP_02829014.2| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 2] (457 aa)
Score = 414, Expect = 1.8e-38, Identities = 134/415 (32%), Positives = 222/415 (53%)
  Q:    35 SSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFS--IKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLD-SRFTFENYTIGMFNKNAFKAASLFL----EENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPD-TESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV---QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           + + K+ D  +YI+V + F K +    +  I  +Y S   K  + +N  FI + EK +      ++E       N + +  R+ F N  I  FN+ A KA    L    E ++    L ++G  G+GKTH++ A GN+F    P   + Y + +DF  K   A ++G + VEEFK    + +LL+ +DIQ + +++   E+FFNIFN +      I++TSD+ P  L    DR+ISR  SGL  KI++PD  E+IK  II N  + + K   ++ A E+IA  F++DIR + G L +I F   ++++ N +I ++    IIE   + +I SN++   Q+ P+ +IE I     ++   + S  R     + R +  YVL+ K+NL+  EIG   S R H T+  ++  VE  +      +A   N++
  S:    32 AKVHKVYDGVLYIIVASAFEKTIINGNFINIISKYLSEEFKKENIVNFQFIVENEKVLINSNFLVKETVIKNRFNFSDEIMRYNFNNLVISDFNRKAVKAIESLLSTNYENSSMCNPLFLFGKVGIGKTHIVAAAGNQFANSNPNLKIYYYEGQDFFRKFCSASAKGTSHVEEFKKEIASANLLIFEDIQNIQSRDSAAELFFNIFNDIKLNGGKIILTSDRTPNELNGFHDRIISRLASGLQCKISQPDKNEAIK--IINNWFEFKKKYQITDEAKEYIAEGFHTDIRQMIGNLKQICFWADNDLNENLVITKD---FIIECSVENDIPSNIIVKQQLKPEQVIEIIAKELNLNVDLIKSTTRKNSIVWARDIVCYVLKNKLNLTLTEIGKLLSGREHTTISHSVNKVEKILADKNSQEALQINLI 453
>gi|116619146|ref|YP_821302.1| chromosomal replication initiator protein DnaA [Solibacter usitatus Ellin6076] >gi|116222308|gb|ABJ81017.1| chromosomal replication initiator protein DnaA [Solibacter usitatus Ellin6076] (437 aa)
Score = 414, Expect = 1.8e-38, Identities = 99/340 (29%), Positives = 179/340 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAA-SLFLEENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           L+ +FTF ++ +G  N+ A  AA S+    + ++  L +YG  G+GKTHL+HA+G + +  F    ++Y  +E F+ ++   I     ++++F   +   D+LLIDDIQ L NKE+  E FF+ FN L+   K IV++SD  P  +  + +R+ SRF  GL   I  PD E+   I+ +  +   ++ P  +    F+A +  S++R LEG L K+  +      P  +   +++   +    D  +  + +Q       +++   + + +  +  K   K+  + R+V MY+++E  N S  EIG  F  ++H TV+ +I  +E   +SD +L   L ++M
  S:   103 LNPKFTFNSFVVGACNQFAHAAAKSVATNPSRSYNPLFLYGGVGMGKTHLMHAIGRQLIDQFGSMRIIYTSSERFMNEMISCIRT--ERMQQFHQRYREADVLLIDDIQLLGNKERTQEEFFHTFNELHDHQKQIVISSDSPPKDIPGLLERLRSRFEWGLMADIQPPDLETKMAILDKKAEIEGVELP--DDVRTFMASKTKSNVRELEGALVKLIAYSSLTGTPIHLQMAQQVLKHLVHVQDRRVTMDSIQ-------KAVAEKFSIKQSQLKEKSNTKKVVYPRQVAMYLVKELTNASLPEIGRAFGGKHHTTVIHSINKIEKDRQSDPELNRLLHSLM 433
>gi|167736497|ref|ZP_02409271.1| chromosomal replication initiation protein [Burkholderia pseudomallei 14] (385 aa)
Score = 414, Expect = 1.9e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    49 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 372
>gi|167717462|ref|ZP_02400698.1| chromosomal replication initiation protein [Burkholderia pseudomallei DM98] (381 aa)
Score = 414, Expect = 2.0e-38, Identities = 113/337 (33%), Positives = 176/337 (52%)
  Q:   105 EINPTLDSRFTFENYTIGMFNKNAFKAASLFLEENN--NWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           ++NP L    TF+N+  G  N+ A +AA++ + +N   ++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  + KA        ++FK  + ++DLLLIDDIQF + K +  E FF  F  L +    +++TSD  P  +  IDDR+ISRF+SGL++ I  P+ E    I++   +   +    S     F+A    S++R LEG L KI     FH            E  I    E+  D   V N  QI+ + I +++   Y +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +  +   D  L
  S:    45 KLNPVL----TFDNFVTGKANQLA-RAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKA--FDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVS--LSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHG----------REITIELTKEALKDLLTVQNR-QISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQL 368
>gi|116075382|ref|ZP_01472642.1| chromosomal replication initiation protein [Synechococcus sp. RS9916] >gi|116067579|gb|EAU73333.1| chromosomal replication initiation protein [Synechococcus sp. RS9916] (469 aa)
Score = 414, Expect = 2.0e-38, Identities = 106/349 (30%), Positives = 185/349 (53%)
  Q:    95 PTIEEKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNK-IYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKA 443
           P     P+ L   P L+ R+ F  + +G  ++ A  AA    E     +  L I G  GLGKTHL+ A+G+  +++ P   + Y+ TE F   +  AI + G  ++ F++ +   DL+L+DDIQF+  KE   E FF+ FN L+   + IV+ SD+ P+ + ++ +R+ISRF+ GL   I  PD E+   I+ +  ++ ++  P     I++++ RF S+IR LEG L + + F  +  +     +  E +  +++           V++ P  +I+ +   + V    + S  R +  S  R+V M+++R+  +LS   IG  F  ++H TV+ AI+ VE K+ SD  L +
  S:   118 PGQTRAPRRL---PGLNRRYVFNRFVVGPNSRMAHAAALAVAESPGREFNPLFICGGVGLGKTHLMQAIGHYRLEIDPDARVSYVSTETFTNDLIVAIRKDG--MQAFRDRYRATDLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVIASDRPPSQIPRLQERLISRFSMGLIADIQAPDLETRMAILQKKAEQEKVSLPRD--LIQYLSGRFTSNIRELEGALTRAVAFASITGLP----MTVESVAPMLDPSGQG------VEVTPQQVIDKVSEVFDVSADDMRSSSRRRTVSQARQVGMFLMRQGTDLSLPRIGETFGGKDHTTVMYAIEQVEKKLSSDPQLAS 452
>gi|169794207|ref|YP_001712000.1| DNA replication initiator protein, transcriptional regulator of replication and housekeeping genes [Acinetobacter baumannii AYE] >gi|184156325|ref|YP_001844664.1| ATPase [Acinetobacter baumannii ACICU] >gi|169147134|emb|CAM84993.1| DNA replication initiator protein, transcriptional regulator of replication and housekeeping genes [Acinetobacter baumannii] >gi|183207919|gb|ACC55317.1| ATPase [Acinetobacter baumannii ACICU] (465 aa)
Score = 414, Expect = 2.0e-38, Identities = 113/341 (33%), Positives = 188/341 (55%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEE--NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV----ETKVKSDEDLKAFLDNIMS 450
           L+ +FTF  +  G  N+ A +     L +   +    L +YG TGLGKTHL+ AVGN  +Q  P   +MY+ +E F++    ++ +G  KVEEFK +  ++DLLL+DDI  L  KE     FF  FN L  ++K I++TSD+ P  L ++D R++SRF+ GLS+ +  PD E+  +I+++  + S +  P  N A+ FIA +  +++R LEG LNK+         P ++ +  E ++ ++   +    V N+ ++  +         + +  K ++  KR + ++  R++ M + RE    S+ EIG  F  R+H+TV+ A + V    E     DED K  L  + S
  S:   129 LNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQHNPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKG--KVEEFKKNCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLVSRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLP-RNCAL-FIAQQVVANVRELEGALNKVVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEY--------FRIPLKELVGPKRTRIYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKNLLRLLQS 465
>gi|159026644|emb|CAO86578.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (444 aa)
Score = 414, Expect = 2.1e-38, Identities = 102/342 (29%), Positives = 178/342 (52%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLE-ENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           L+ ++ F  + +G  N+ A  AA    E     +  L + G  GLGKTHL+ A+G+  ++L+PQ  + Y+ TE F   +  AI +    +E F+N + + D+LL+DD+QF+  KE   E FF+ FN L+   K +V+ SD+LP  +  + DR+ISRF+ GL   I  PD E+   I+ +  +   ++ P     IE+IAL + S+IR LEG L +   ++  +  P  +   E I  ++            +  +P+II+  +   + +    +    R ++ SF R++ MY++R+  +LS   IG  F  ++H TV+ +   +      D  L+  L  ++ +
  S:   106 LNPKYNFSRFVVGPTNRMAHAAALAVAELPGREFNPLFLCGGVGLGKTHLMQAIGHYRLELYPQSRVFYVSTEQFTNDLITAIRQ--DSMESFRNHYRHADILLVDDLQFIEGKEYTQEEFFHTFNTLHEAGKQVVLASDRLPKQIPSLQDRLISRFSMGLVADIQAPDIETRMAILQKKAEYENLRLPRE--VIEYIALNYTSNIRELEGALIRATTYISISGLPMTV---ENIAPVLNPPMAK------IATSPEIIMAVVAEKFQLSIADLKGNSRRREISFARQIGMYLMRQHTDLSLPRIGEEFGGKDHTTVIYSCDKINLSQHQDRQLQEILAQLIER 436
>gi|17229501|ref|NP_486049.1| chromosomal replication initiation protein [Nostoc sp. PCC 7120] >gi|38257719|sp|Q8YVG9|DNAA_ANASP Chromosomal replication initiator protein dnaA >gi|17131099|dbj|BAB73708.1| chromosomal replication initiator protein [Nostoc sp. PCC 7120] (459 aa)
Score = 413, Expect = 2.1e-38, Identities = 111/358 (31%), Positives = 187/358 (52%)
  Q:    94 LPT---IEEKP-KTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHL--------LDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIMSK 451
           LPT   I E P +  + N  L++++ F  + +G  N+ A  AASL + E+    +  L + G  GLGKTHL+ A+G+   ++ P   + Y+ TE F   +  AI      ++ F+  +   D+LL+DDIQF+  KE   E FF+ FN L+   K +V+ SD+ P  +  + +R+ SRF+ GL   I  PD E+   I+ +  +  +I+ P     IE+IA  F S+IR LEG L +   ++        + N+ P  +   EKI +                  P+ I+  I   + +  + + S  R ++ S+ R++ MY++R+  +LS+  IG  F  ++H TVL +   +   V+SD  L   L  +  +
  S:    99 LPTTNIINETPNQNRQPNTELNAKYVFSRFVVGANNRMA-HAASLAVAESPGREFNPLFLCGGVGLGKTHLMQAIGHYRWEICPNSKIFYVSTEQFTNDLITAIRN--DSMQSFREHYRAADVLLVDDIQFIEGKEYTQEEFFHTFNTLHEAGKQVVIASDRPPNQIPSLQERLCSRFSMGLIADIQAPDLETRMAILQKKSEYEKIRLPRD--VIEYIATNFTSNIRELEGALTRALAYISIWGLPMTVANLAPVLVTPMEKIEA-----------------TPEAILTVIADNFDISIEDLKSNSRRREISWARQIGMYLMRQHTDLSFPRIGEEFGGKDHTTVLYSCDKIAQLVESDRGLSQTLRQLSDR 449
>gi|183980036|ref|YP_001848327.1| chromosomal replication initiator protein DnaA [Mycobacterium marinum M] >gi|183173362|gb|ACC38472.1| Chromosomal replication initiator protein DnaA [Mycobacterium marinum M] (510 aa)
Score = 413, Expect = 2.2e-38, Identities = 105/327 (32%), Positives = 181/327 (55%)
  Q:   109 TLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY-FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKV 435
           +L+ R+TF+ + IG  N+ A  AA+L + E     +  L I+G +GLGKTHLLHA GN   +LFP   + Y+ TE+F      ++ +   +   FK S+ +VD+LL+DDIQF+  KE + E FF+ FN L++ NK IV++SD+ P  L  ++DR+ +RF  GL   +  P+ E+   I+ +  +  R+  P  +  +E IA     +IR LEG L ++  F  L+    ++ + E  +R +I         +  +QI+   I+ +    +    + +    + +  +  R++ MY+ RE  +LS  +IG  F  R+H TV+ A + + +++
  S:   170 SLNRRYTFDTFVIGASNRFA-HAATLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRD--DRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVP--DDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVLRDLIAD-------AGTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFG-RDHTTVMYAQRKILSEM 487
>gi|167951344|ref|ZP_02538418.1| chromosomal replication initiator protein DnaA [Endoriftia persephone 'Hot96_1+Hot96_2'] (424 aa)
Score = 413, Expect = 2.2e-38, Identities = 123/405 (30%), Positives = 207/405 (51%)
  Q:    45 VYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELP--------TIEEKPK---TLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIV-SNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           + +L  N FV +   N Y +I   Y          +  I    +    +LP        TIE   K      I   L+  FTFE++  G  N+ A +AAS+ +  N    +  L IYG  GLGKTHL+HAVGN  +   P   ++Y+ +E F+  + +A+     K++EFK  + +V+ LLIDDIQF   KE+  E FF+ FN L    + I+++SD+ P  +K +++R+ SRF  GL++ I  PD E+  ++ I   K  ++     +    FI  +  S+IR LEG L ++          N     ++I      ++  +++ +   Q+  + I +++C  + +    ++S KR++  +  R++ M + +E  N S  EIGS F  R+H TV+ A K +     SD  +     N++
  S:    13 IRLLAPNTFVLDWVRNHYIKIINSYLDEICKDERPIVEIIIGTRKKPTQLPDRSVKKQATIERSDKLESVSAIESNLNRSFTFESFVEGKSNQLA-RAASMQIASNPGKAYNPLFIYGGVGLGKTHLMHAVGNAILSENPNAKVLYLHSERFVADMVRALQH--NKIDEFKKRYRSVNALLIDDIQFFAGKERSQEEFFHTFNALFESQQQIILSSDRFPKEVKGLEERLKSRFGWGLTVAIEPPDLET--RVAILKSKALQLNVELGDEVAFFIGKKIRSNIRELEGALRRVV--------ANSTFTGKEISIEFSKNALRDMLAAQAKQVTIENIQKTVCEYFQIRTSDLLSAKRSRSIARPRQIAMTLAKELTNHSLPEIGSAFGGRDHTTVIHANKKINELRDSDPRIAEDYSNLL 419
>gi|134093295|ref|YP_001098370.1| chromosomal replication initiator protein dnaA [Herminiimonas arsenicoxydans] >gi|166214675|sp|A4G154|DNAA_HERAR Chromosomal replication initiator protein dnaA >gi|133737198|emb|CAL60241.1| Chromosomal replication initiator protein DnaA [Herminiimonas arsenicoxydans] (460 aa)
Score = 413, Expect = 2.3e-38, Identities = 107/322 (33%), Positives = 177/322 (54%)
  Q:   110 LDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIY----FHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDV 431
           +++  TF+++  G  N+ A +AA++ +  N  +++  L +YG  GLGKTHL+HA+GN+ +   P   + YI  E ++  +  A    G   ++FK  + ++DLLLIDDIQF   K +  E FF  F  L +  K I++TSD  P  +  +DDR+ISRF+SGL++ +  P+ E    I+++   +  +   FS+    F+A    S++R LEG L KI     FH  D       I  E ++  ++   D   V N  QI+ + I +++   + +    + SKKR    +  R++ MY+ +E    S  EIG  F  R+H TVL A++ +
  S:   125 INTALTFDSFVTGKANQLA-RAAAIQVANNPGSSYNPLFLYGGVGLGKTHLIHAIGNQVLADNPNVKIRYIHAEQYVRDVVTAYQRKG--FDDFKRYYHSLDLLLIDDIQFFGGKSRTQEEFFYAFEALIAAKKQIIITSDTYPKEITGMDDRLISRFDSGLTVAVEPPELEMRVAILLKKAVQEGVT--FSDDVAFFVAKHLRSNVRELEGALRKILAYSRFHGKD-------ITIEVVKDALK---DLLSVQNR-QISVENIQKTVADFFNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKI 437
>gi|118594214|ref|ZP_01551561.1| dnaA; chromosomal replication initiator protein [Methylophilales bacterium HTCC2181] >gi|118439992|gb|EAV46619.1| dnaA; chromosomal replication initiator protein [Methylophilales bacterium HTCC2181] (445 aa)
Score = 413, Expect = 2.4e-38, Identities = 126/401 (31%), Positives = 206/401 (51%)
  Q:    41 KDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKD-INKELPTIEEK--PKTLEINPT--LDSRFTFENYTIGMFNKNAFKAASLFLEE-NNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEI-INEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDL 441
           K + + I   N FV +       +      S   N +  V+ + K+ K   + E P   E+  PKT + N T  L+  F FEN+  G  N+ A  AA    E+    +  L IYG  GLGKTHL+HA+GN    + P   + Y+  E ++  + KA        + FK ++ ++DLLLIDDIQF+  K +  E FF  FN L    K I++T D  P  +  +D+R+ +RF+ GL++ I+ P+ E    I+++   + +IK   S     F+A +  S++R LEG LN+I         P ++ + +E ++ +I             QI+ + I +++   Y +    + SKKR++ FS  R++ M + RE  NLS+ EI   F  R+H TV+ A  ++E+    D+ +
  S:    37 KLKQLVISAPNQFVLQWVKERLNDKLCSLLSDNANISSIVYTVIKKTKGPASLEAPKASEEAVPKT-KSNKTNGLNKSFNFENFVTGKANQLACAAARQIAEKPGTTYNPLFIYGGVGLGKTHLMHAIGNHLKAIQPNAKVKYLHAERYVHDVVKAYEN--KDFDSFKKNYHSLDLLLIDDIQFIAKKNRTQEEFFYAFNTLIENKKQIIITCDSYPKEIVGVDERLRTRFSWGLTVSIDPPELEMRVAILLKKALEHKIK--LSEEVAFFVAKQIRSNVRELEGALNRIVAMSNFTGKPIDLGLAKESLKDLIAVRGR--------QISVENIQKTVADYYKIKISDIHSKKRSRNFSRPRQIAMSLTRELTNLSFPEIAEAFGGRHHTTVMHACDEIESLRLGDQGI 432
>gi|169335349|ref|ZP_02862542.1| hypothetical protein ANASTE_01761 [Anaerofustis stercorihominis DSM 17244] >gi|169258087|gb|EDS72053.1| hypothetical protein ANASTE_01761 [Anaerofustis stercorihominis DSM 17244] (456 aa)
Score = 412, Expect = 2.7e-38, Identities = 131/418 (31%), Positives = 224/418 (53%)
  Q:    31 YVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFFITKEEKDINKELPTIEEKPKT---------LEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSL-KIDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           Y  D+   ++ DE   IL++  +   V  N  K   + Y  +K     +   +  E + I+ E+   E KP           ++ NP    ++TF+++ +G  N+ A  AASL + +     +  L IYG  GLGKTHL+HA+    ++  P K ++ + +E FL +   AI +  T V+ F+N + N D+LLIDDIQF+  K +    FF+ FN L   NK I++TSDK P  +  ++DR+ SRF+ GL   I+ PD E+   I+ +  K+   +   SN  + +IA    S+IR LEG+L K+       +  NE  N+     +++      I  +  +I+ D+I + +C  Y + K  ++SK+R K  +F R++ MY+ RE  + S   IG ++  R+H+TV+     ++ ++K++  L+  +  I
  S:    37 YENDTFFLQVPDEGNKILLEGQYAVLV-ENALKYYTQRYIKVKFVVASSNDMVYSENEAID-EIAAAEPKPSVEYNVYNTSYIQFNP----KYTFDSFVVGPNNRFA-HAASLAVADAPAKKYNPLFIYGGVGLGKTHLMHAIAQHILRKDPTKKVVLLSSEQFLNEFLDAI-QNKTNVQ-FRNKYRNADVLLIDDIQFIAGKNETQNEFFHTFNALQGSNKQIILTSDKPPKEIPHLEDRLRSRFSLGLICDISMPDFETRLAILRKKAKEENYQ--VSNEILNYIAENIESNIRELEGLLLKV-------MALNEFYNKPLTLDLVKKQLKDIIDISDKKISMDLITKVVCDYYNISKADILSKRRTKNIAFPRQISMYLSRELTDSSLPAIGDYYGGRDHSTVIHGYDKIKEELKTNGTLEEEIKKI 448
>gi|148262086|ref|YP_001228792.1| chromosomal replication initiator protein DnaA [Geobacter uraniireducens Rf4] >gi|189044596|sp|A5GDX1|DNAA_GEOUR Chromosomal replication initiator protein dnaA >gi|146395586|gb|ABQ24219.1| chromosomal replication initiator protein DnaA [Geobacter uraniireducens Rf4] (449 aa)
Score = 412, Expect = 2.8e-38, Identities = 137/442 (30%), Positives = 231/442 (52%)
  Q:     7 IKKKYLIIKKEIEKEFQNENFYNNYVLDSSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFSIKMNSNLNVFF-----ITKEEKDINKELPTIE------EKPKTLEINPTLDSRFTFENYTIGMFNKNAFKAASLFLEEN--NNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPDTESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLVQINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNI 448
           ++K +L  +  I+K    +  YN ++       + D+N+ + V + F+KE  T +Y  +  E  S   +    + F     I  E K ++   P I+      E  K ++I   L+ ++TF+++  G  N+ A  AAS  +  N  +N+  L IYG  GLGKTHLL A+GN   +   +  + Y  +E F+ ++   +     K++EF+N F  +D+LLIDDIQF+  KE   E FF+ FN L   +K IV+TSDK P  +  +++R+ SRF  GL   I  PD E+  KI I   K         N    F+A    S++R LEG+L  I      ++  +E I     R I++      IV     I  ++I + +   + +    + S KR K F   R++ +++ RE    SY EIG  F  ++H+T++ ++K +E ++ +D ++K  ++N+
  S:     1 MEKVWLEAQSNIKKVLTPQT-YNTWIKPIRFHTLTDDNLTLEVPSKFIKEWVTEKYLPMIVEAISSLTSVKYQIEFKITEKIPLESKPVDNFTPVIKDNEPSKETNKNIDITANLNPKYTFDSFVCGASNQFA-HAASQAVASNPASNYNPLFIYGGVGLGKTHLLIAIGNHIKENNKKAKICYYSSEKFMNEMINCLRY--KKMDEFRNKFRKMDILLIDDIQFMAGKEATQEEFFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQPPDIET--KIAILKKKSDLNSITLPNDVALFLASSATSNVRELEGML--IRLGAYASLTGSE-ITLNMARDILKDI----IVEKTKDITVEMIQKHVAEHFKIKVSELKSDKRLKTFVVPRQIAIFICRELTKSSYPEIGEKFGGKDHSTIIHSVKKIEKQMANDLEIKNIVENL 443
>gi|171920679|ref|ZP_02931905.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178837|ref|ZP_02554521.2| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024340|ref|ZP_02570604.2| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039268|ref|ZP_02527988.2| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 8] >gi|188518434|ref|ZP_02556546.2| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524209|ref|ZP_03004269.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530769|ref|ZP_03005092.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867373|ref|ZP_03079377.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903415|gb|EDT49704.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209472|gb|EDU06515.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018604|gb|EDU56644.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998012|gb|EDU67109.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660031|gb|EDX53411.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660849|gb|EDX54102.1| chromosomal replication initiator protein DnaA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (457 aa)
Score = 412, Expect = 2.9e-38, Identities = 134/415 (32%), Positives = 221/415 (53%)
  Q:    35 SSIFKIKDENVYILVKNDFVKEVFTNEYKEIFEEYFS--IKMNSNLNVFFITKEEKDINKELPTIEEKPKTLEINPTLD-SRFTFENYTIGMFNKNAFKAASLFL----EENNNWKTLLIYGSTGLGKTHLLHAVGNKFVQLFPQKNLMYIQTEDFLEKIYKAISEGGTKVEEFKNSFDNVDLLLIDDIQFLNNKEKLNEIFFNIFNRLNSKNKYIVMTSDKLPTSLK-IDDRMISRFNSGLSIKINKPD-TESIKKIIIENIKKSRIKNPFSNLAIEFIALRFNSDIRTLEGVLNKIYFHLLDNVDPNEIINEEKIRSIIESDSDYEIVSNLV---QINPDIIIESICLGYGVDKKSVISKKRNKQFSFVRKVCMYVLREKINLSYNEIGSFFSNRNHATVLEAIKDVETKVKSDEDLKAFLDNIM 449
           + + K+ D  +YI+V + F K +    +  I  +Y S   K  + +N  FI + EK +      ++E       N + +  R+ F N  I  FN+ A KA    L    E ++    L ++G  G+GKTH++ A GN+F    P   + Y + +DF  K   A ++G + VEEFK    + +LL+ +DIQ + +++   E+FFNIFN +      I++TSD+ P  L    DR+ISR  SGL  KI++PD  E+IK  II N  + + K   ++ A E+IA  F++DIR + G L +I F   ++++ N +I ++    IIE   + +I SN++   Q+ P+ +IE I     +    + S  R     + R +  YVL+ K+NL+  EIG   S R H T+  ++  VE  +      +A   N++
  S:    32 AKVHKVYDGVLYIIVASAFEKTIINGNFINIISKYLSEEFKKENIVNFQFIVENEKVLINSNFLVKETVIKNRFNFSDEIMRYNFNNLVISDFNRKAVKAIESLLSTNYENSSMCNPLFLFGKVGIGKTHIVAAAGNQFANSNPNLKIYYYEGQDFFRKFCSASAKGTSHVEEFKKEIASANLLIFEDIQNIQSRDSAAELFFNIFNDIKLNGGKIILTSDRTPNELNGFHDRIISRLASGLQCKISQPDKNEAIK--IINNWFEFKKKYQITDEAKEYIAEGFHTDIRQMIGNLKQICFWADNDLNENLVITKD---FIIECSVENDIPSNIIVKQQLKPEQVIEIIAKELNLKVDLIKSTTRKNSIVWARDIVCYVLKNKLNLTLTEIGKLLSGREHTTISHSVNKVEKILADKNSQEALQINLI 453
>gi|119896293|ref|YP_931506.1| chromosomal replication initiator protein [Azoarcus sp. BH72] ><