>gi|26553462|ref|NP_757396.1| rRNA methylase [Mycoplasma penetrans HF-2] >gi|26453468|dbj|BAC43800.1| rRNA methylase [Mycoplasma penetrans HF-2] (161 aa)
Score = 765, Expect = 4.2e-80, Identities = 161/161 (100%), Positives = 161/161 (100%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK
  S:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
>gi|31544522|ref|NP_853100.1| hypothetical protein MGA_1195 [Mycoplasma gallisepticum R] >gi|31541367|gb|AAP56668.1| CspR [Mycoplasma gallisepticum R] (165 aa)
Score = 386, Expect = 4.0e-36, Identities = 79/160 (49%), Positives = 113/160 (70%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +N+VL++P+ P N GNI+R+CVGFNATLH+I PFGF + D+R KRAGLDYWDHL  K+Y D+ DF  QN +++N  +FL TK A+  +SN+  K+ L  D+ I+ VFG+ET GL  +++ KY+   +KI M++ IRSFNL+NSV    +       F ++K
  S:     7 INVVLYRPQDPRNAGNIARSCVGFNATLHLIHPFGFFITDERFKRAGLDYWDHLNLKQYADFDDFIKQNQIDEN--LFLFTKKANNYLSNIDFKEYLDHDQRIYLVFGQETNGLPDQLLNKYQDNLVKIPMHNAIRSFNLANSVICALYELSRQNQFKNVK 165
>gi|15900400|ref|NP_345004.1| RNA methyltransferase [Streptococcus pneumoniae TIGR4] >gi|111657132|ref|ZP_01407916.1| hypothetical protein SpneT_02001643 [Streptococcus pneumoniae TIGR4] >gi|148983867|ref|ZP_01817186.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP3-BS71] >gi|148993522|ref|ZP_01823013.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP9-BS68] >gi|148996883|ref|ZP_01824601.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP11-BS70] >gi|149003702|ref|ZP_01828547.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP14-BS69] >gi|149012635|ref|ZP_01833632.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP19-BS75] >gi|168482732|ref|ZP_02707684.1| CspR [Streptococcus pneumoniae CDC1873-00] >gi|168485607|ref|ZP_02710115.1| CspR [Streptococcus pneumoniae CDC1087-00] >gi|168488175|ref|ZP_02712374.1| CspR [Streptococcus pneumoniae SP195] >gi|168576802|ref|ZP_02722652.1| CspR [Streptococcus pneumoniae MLV-016] >gi|14971957|gb|AAK74644.1| RNA methyltransferase, TrmH family [Streptococcus pneumoniae TIGR4] >gi|147757458|gb|EDK64497.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP11-BS70] >gi|147758264|gb|EDK65265.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP14-BS69] >gi|147763440|gb|EDK70377.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP19-BS75] >gi|147924014|gb|EDK75126.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP3-BS71] >gi|147927891|gb|EDK78912.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP9-BS68] >gi|172043851|gb|EDT51897.1| CspR [Streptococcus pneumoniae CDC1873-00] >gi|183571281|gb|EDT91809.1| CspR [Streptococcus pneumoniae CDC1087-00] >gi|183572995|gb|EDT93523.1| CspR [Streptococcus pneumoniae SP195] >gi|183577487|gb|EDT98015.1| CspR [Streptococcus pneumoniae MLV-016] (167 aa)
Score = 349, Expect = 7.3e-32, Identities = 72/159 (45%), Positives = 109/159 (68%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP+NTGNI+RTC   N+ LH+I+P GF ++D++MKRAGLDYWD L+   Y+   DF SQ       K++LI+KFA+K  S +   +L+ DE+ +F+FGRE KGL  + M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L+
  S:     4 HIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFISQ----MKGKLYLISKFAEKVYSEV---DLSTDEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLE 156
>gi|148988231|ref|ZP_01819694.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP6-BS73] >gi|149025477|ref|ZP_01836413.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP23-BS72] >gi|168490616|ref|ZP_02714759.1| CspR [Streptococcus pneumoniae CDC0288-04] >gi|147926695|gb|EDK77768.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP6-BS73] >gi|147929427|gb|EDK80423.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP23-BS72] >gi|183574827|gb|EDT95355.1| CspR [Streptococcus pneumoniae CDC0288-04] (167 aa)
Score = 348, Expect = 9.4e-32, Identities = 72/159 (45%), Positives = 109/159 (68%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP+NTGNI+RTC   N+ LH+I+P GF ++D++MKRAGLDYWD L+   Y+   DF SQ       K++LI+KFA+K  S +   +L+ DE+ +F+FGRE KGL  + M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L+
  S:     4 HIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFISQ----MKGKLYLISKFAEKIYSEV---DLSTDEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLE 156
>gi|153853541|ref|ZP_01994921.1| hypothetical protein DORLON_00910 [Dorea longicatena DSM 13814] >gi|149753696|gb|EDM63627.1| hypothetical protein DORLON_00910 [Dorea longicatena DSM 13814] (163 aa)
Score = 347, Expect = 1.5e-31, Identities = 68/149 (45%), Positives = 99/149 (66%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL +PEIP NTGNI RTCV  N  LH+I P GF LN+K +KRAG+DYW+HL  + Y D++DF  +   N  +K+++ T  A K  +     E+  + + + +FG+E+ G+  EI+ ++K+  ++I M  +IRS NL NSVAIV +
  S:     1 MLNIVLHEPEIPANTGNIGRTCVATNTRLHLIEPLGFRLNEKNLKRAGMDYWEHLDVRTYIDYNDFLEK---NPGAKIYMATTKAPKVYT-----EVNYEPDCYIMFGKESAGIPEEILVEHKEDCVRIPMVGDIRSLNLGNSVAIVLY 141
>gi|116515392|ref|YP_815944.1| TrmH family RNA methyltransferase [Streptococcus pneumoniae D39] >gi|116075968|gb|ABJ53688.1| TrmH family RNA methyltransferase [Streptococcus pneumoniae D39] (167 aa)
Score = 346, Expect = 1.9e-31, Identities = 71/159 (44%), Positives = 110/159 (69%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP+NTGNI+RTC   N+ LH+I+P GF ++D++MKRAGLDYWD L+   Y+   DF SQ       K++LI+KFA+K  S++   +L+ +E+ +F+FGRE KGL  + M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L+
  S:     4 HIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFMSQ----MKGKLYLISKFAEKVYSDV---DLSTNEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLE 156
>gi|15902476|ref|NP_358026.1| rRNA methylase [Streptococcus pneumoniae R6] >gi|15457998|gb|AAK99236.1| rRNA methylase [Streptococcus pneumoniae R6] (180 aa)
Score = 346, Expect = 2.1e-31, Identities = 71/159 (44%), Positives = 110/159 (69%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP+NTGNI+RTC   N+ LH+I+P GF ++D++MKRAGLDYWD L+   Y+   DF SQ       K++LI+KFA+K  S++   +L+ +E+ +F+FGRE KGL  + M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L+
  S:    17 HIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFMSQ----MKGKLYLISKFAEKVYSDV---DLSTNEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLE 169
>gi|124522441|ref|ZP_01697032.1| RNA methyltransferase, TrmH family, group 2 [Bacillus coagulans 36D1] >gi|124496108|gb|EAY43727.1| RNA methyltransferase, TrmH family, group 2 [Bacillus coagulans 36D1] (157 aa)
Score = 345, Expect = 2.2e-31, Identities = 68/148 (45%), Positives = 97/148 (65%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++VL+QPEIP NTGNI+RTC G   TLH+IRP GF  +DK +KRAGLDYW H+    YD   +F  +   N + +V+ I  F +K  ++   D    D+ ++F+FGRET GL ++++EK K   L+I M   +RS NLSN+ AI+ +
  S:     3 LHVVLYQPEIPANTGNIARTCAGTGTTLHLIRPLGFSTDDKMLKRAGLDYWKHVNIVYYDSLEEFFEK---NADGEVYYIETFGEKPFTDF--DFSDPDKNLYFMFGRETSGLPNDLIEKNKDRCLRIPMTDKVRSLNLSNTAAILVY 145
>gi|149005602|ref|ZP_01829341.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP18-BS74] >gi|147762542|gb|EDK69502.1| RNA methyltransferase, TrmH family protein [Streptococcus pneumoniae SP18-BS74] (167 aa)
Score = 344, Expect = 3.0e-31, Identities = 71/159 (44%), Positives = 108/159 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP+NTGNI+RTC   N+ LH+I+P GF ++D++MKRAGLDYWD L+   Y+   D  SQ       K++LI+KFA+K  S +   +L+ DE+ +F+FGRE KGL  + M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L+
  S:     4 HIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDVISQ----MKGKLYLISKFAEKVYSEV---DLSTDEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLE 156
>gi|12045205|ref|NP_073016.1| RNA methyltransferase [Mycoplasma genitalium G37] >gi|1723153|sp|P47588|Y346_MYCGE Uncharacterized tRNA/rRNA methyltransferase MG346 >gi|3844929|gb|AAC71571.1| RNA methyltransferase, TrmH family, group 2 [Mycoplasma genitalium G37] >gi|166078946|gb|ABY79564.1| RNA methyltransferase, TrmH family, group 2 [synthetic Mycoplasma genitalium JCVI-1.0] (166 aa)
Score = 344, Expect = 3.2e-31, Identities = 69/160 (43%), Positives = 104/160 (65%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           ++NIVLF PEIP NTGNI R+C  F A LH+I+P+GF LNDKRM RAGL+ WD ++  E+  W  F      NK   ++L+TK  DK+   +       + E++FVFG+ETKGL   IM+ +K+ Q++I + +++RS NL+N+V  + + Y     +++L
  S:     5 VINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKIQLFEHKSWEHFLQATTENKT--IWLLTKSGDKTPDQICMTNKLPN-ELYFVFGQETKGLPKTIMDNFKQNQIRIPIWNSVRSINLANAVVCILYEYSKQNQYSNL 161
>gi|46907168|ref|YP_013557.1| RNA methyltransferase [Listeria monocytogenes str. 4b F2365] >gi|47092144|ref|ZP_00229937.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes str. 4b H7858] >gi|153166251|ref|ZP_01926870.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL N1-017] >gi|153201634|ref|ZP_01943443.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes HPB2262] >gi|167014293|ref|ZP_02276826.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL J1-194] >gi|167214107|ref|ZP_02284414.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL R2-503] >gi|167217144|ref|ZP_02286780.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL J1-175] >gi|167453608|ref|ZP_02319831.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL J2-064] >gi|88979161|sp|Q721N0|Y956_LISMF Uncharacterized tRNA/rRNA methyltransferase LMOf2365_0956 >gi|46880435|gb|AAT03734.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes str. 4b F2365] >gi|47019584|gb|EAL10324.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes str. 4b H7858] >gi|133727767|gb|EBA29465.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL N1-017] >gi|133735942|gb|EBA37640.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes HPB2262] (169 aa)
Score = 344, Expect = 3.4e-31, Identities = 74/158 (46%), Positives = 101/158 (63%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +IVL+QPEIP NTGNISRTC G +  LH+IRP GF  +DK +KRAGLDYWD++K   YD   +F  +   N+  + + ITKF     S++   +  KD   FFVFG+ET GL   +++K ++  L+I M  +IRS NLSN+ AI+A+      NF  L
  S:     4 HIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEFFEK---NEGGEFYYITKFGRHVYSDIDYSDPNKD--YFFVFGKETTGLPDALLQKNEENCLRIPMTDHIRSLNLSNTAAILAYEALRQQNFGAL 156
>gi|89097638|ref|ZP_01170526.1| RNA methyltransferase, TrmH family, group 2 [Bacillus sp. NRRL B-14911] >gi|89087497|gb|EAR66610.1| RNA methyltransferase, TrmH family, group 2 [Bacillus sp. NRRL B-14911] (159 aa)
Score = 344, Expect = 3.5e-31, Identities = 66/148 (44%), Positives = 96/148 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +++VL+QPEIP NTGNI+RTC   + TLH+IRP GF  +DK +KRAGLDYW H+    YD   +F  +   N   + F +TKF  K  ++    +  K+++ +F+FG+ET GL +E+ E  K   L+I M  N+RS NLSN+ AI+ +
  S:     5 IHVVLYQPEIPANTGNIARTCAATDTTLHLIRPLGFSTDDKMLKRAGLDYWQHVTILYYDSLDEFYEK---NAGGEFFYLTKFGQKPYTSFEYSD--KEKDYYFIFGKETTGLPAEVKENNKDRALRIPMTGNVRSLNLSNTAAILIY 147
>gi|55820364|ref|YP_138806.1| rRNA methyltransferase [Streptococcus thermophilus LMG 18311] >gi|55822253|ref|YP_140694.1| rRNA methyltransferase [Streptococcus thermophilus CNRZ1066] >gi|55736349|gb|AAV59991.1| rRNA methyltransferase, TrmH family [Streptococcus thermophilus LMG 18311] >gi|55738238|gb|AAV61879.1| rRNA methyltransferase, TrmH family [Streptococcus thermophilus CNRZ1066] (184 aa)
Score = 344, Expect = 3.5e-31, Identities = 70/147 (47%), Positives = 104/147 (70%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKD-EEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLF+P IP+NTGNI+RTC   N+ LH+IRP GF ++DK+MKRAGLDYWD L    YD+ +DF S+   N   ++ L+TKFADK+ S    +E+  D E+ +F+FGRE  GL  + M ++ +  ++I MN  ++RS N+SN+V ++ +
  S:    20 HIVLFEPRIPQNTGNIARTCAATNSPLHIIRPMGFPIDDKKMKRAGLDYWDKLDITYYDNLADFMSK---NHAGRLHLVTKFADKTYS----EEVYADGEDHYFMFGREDTGLPEDFMREHPEKAIRIPMNDEHVRSLNVSNTVCMIVY 161
>gi|116627199|ref|YP_819818.1| rRNA methyltransferase, TrmH family [Streptococcus thermophilus LMD-9] >gi|116100476|gb|ABJ65622.1| Predicted rRNA methylase (SpoU class) [Streptococcus thermophilus LMD-9] (169 aa)
Score = 343, Expect = 3.7e-31, Identities = 70/147 (47%), Positives = 104/147 (70%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKD-EEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLF+P IP+NTGNI+RTC   N+ LH+IRP GF ++DK+MKRAGLDYWD L    YD+ +DF S+   N   ++ L+TKFADK+ S    +E+  D E+ +F+FGRE  GL  + M ++ +  ++I MN  ++RS N+SN+V ++ +
  S:     5 HIVLFEPRIPQNTGNIARTCAATNSPLHIIRPMGFPIDDKKMKRAGLDYWDKLDITYYDNLADFMSK---NHAGRLHLVTKFADKTYS----EEVYADGEDHYFMFGREDTGLPEDFMREHPEKAIRIPMNDEHVRSLNVSNTVCMIVY 146
>gi|13508260|ref|NP_110209.1| putative rRNA methylase [Mycoplasma pneumoniae M129] >gi|2500863|sp|P75257|Y521_MYCPN Uncharacterized tRNA/rRNA methyltransferase MG346 homolog >gi|1673994|gb|AAB95969.1| putative rRNA methylase [Mycoplasma pneumoniae M129] (166 aa)
Score = 343, Expect = 3.9e-31, Identities = 69/150 (46%), Positives = 98/150 (65%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHY 151
           +NIVLF PEIP NTGNI R+C  F A LH+I+P+GF LNDKRM RAGL+ WD ++  E+  W  F      NK   ++L+TK    +   +   +    E+++FVFG+ETKGL   +ME+Y + Q++I + + +RS NLSN+VA V + Y
  S:     6 INIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKVQMFEHKSWEHFIETTPPNK--AIWLLTKSGTTTPDQINM-QTDNREQLYFVFGQETKGLPQTLMEQYSQNQVRIPIWNPVRSINLSNTVACVLYEY 152
>gi|24380081|ref|NP_722036.1| putative rRNA methylase [Streptococcus mutans UA159] >gi|24378075|gb|AAN59342.1|AE014999_10 putative rRNA methylase [Streptococcus mutans UA159] (182 aa)
Score = 342, Expect = 5.2e-31, Identities = 73/147 (49%), Positives = 102/147 (69%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           ++VLFQP+IP NTGNI+RTC   N +LH+IRP GF ++DK+MKRAGLDYWD L    YD  +DF   N+   + K+ LITKFA+K+ S+   D+    E  +F+FGRE KGL  E M ++ +  L+I MN  ++RS NLSN+V ++ +
  S:    19 HVVLFQPQIPANTGNIARTCAATNTSLHIIRPMGFPIDDKKMKRAGLDYWDKLDVHFYDSLNDF--MNIC--SGKLHLITKFANKTYSDENYDD---SEHHYFLFGREDKGLPEEFMRQHSEKALRIPMNDQHVRSLNLSNTVCMIVY 159
>gi|116872332|ref|YP_849113.1| RNA methyltransferase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741210|emb|CAK20332.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (169 aa)
Score = 341, Expect = 7.6e-31, Identities = 70/147 (47%), Positives = 98/147 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL+QPEIP NTGNISRTC G +  LH+IRP GF  +DK +KRAGLDYWD++K   YD   +F  +   N   + + ITKF     S++   +  KD   FFVFG+ET GL  E++++ ++  L+I M  +IRS NLSN+ A++A+
  S:     4 HIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEFFEK---NAGGEFYYITKFGRHVYSDIDYSDPNKD--YFFVFGKETTGLPDELLQENEENCLRIPMTDHIRSLNLSNTAAVLAY 145
>gi|160893756|ref|ZP_02074540.1| hypothetical protein CLOL250_01310 [Clostridium sp. L2-50] >gi|156864741|gb|EDO58172.1| hypothetical protein CLOL250_01310 [Clostridium sp. L2-50] (163 aa)
Score = 340, Expect = 8.3e-31, Identities = 70/149 (46%), Positives = 99/149 (66%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL +PE+P NTGNI RTCV   A LH+I P GF +N+K++KRAGLDYWD L    YDD++DF  +   N  +K+++ T    KS    T  ++  +E+ + +FG+E+ G+  EI+  YK+  ++I M   IRS NL+NSVAIV +
  S:     1 MLNIVLHEPEMPANTGNIGRTCVAAGARLHLIEPLGFQINEKQLKRAGLDYWDKLDVTIYDDFNDFLKK---NPGAKIYMATT---KSKQKYT--DVNYEEDAYIMFGKESAGIPEEILLDYKETAVRIPMFPEIRSLNLANSVAIVLY 141
>gi|16802975|ref|NP_464460.1| hypothetical protein lmo0935 [Listeria monocytogenes EGD-e] >gi|47096222|ref|ZP_00233820.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes str. 1/2a F6854] >gi|153173867|ref|ZP_01929562.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL N3-165] >gi|153179052|ref|ZP_01932293.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes F6900] >gi|153186457|ref|ZP_01936758.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes J0161] >gi|153190343|ref|ZP_01937745.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes J2818] >gi|153197516|ref|ZP_01941747.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes 10403S] >gi|167403987|ref|ZP_02308801.1| hypothetical protein LmonocytFSL_07136 [Listeria monocytogenes FSL J2-003] >gi|16410337|emb|CAC99013.1| lmo0935 [Listeria monocytogenes] >gi|47015367|gb|EAL06302.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes str. 1/2a F6854] >gi|126941132|gb|EBA19026.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes J0161] >gi|127632937|gb|EBA22362.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes 10403S] >gi|127766029|gb|EBA26372.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes J2818] >gi|133730701|gb|EBA32399.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes FSL N3-165] >gi|133733207|gb|EBA34905.1| RNA methyltransferase, TrmH family, group 2 [Listeria monocytogenes F6900] (169 aa)
Score = 340, Expect = 9.1e-31, Identities = 73/158 (46%), Positives = 101/158 (63%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +IVL+QPEIP NTGNISRTC G +  LH+IRP GF  +DK +KRAGLDYWD++K   YD   +F  +   N+  + + ITKF     S++   +  KD   FFVFG+ET GL   ++++ ++  L+I M  +IRS NLSN+ AI+A+      NF  L
  S:     4 HIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEFFEK---NEGGEFYYITKFGRHVYSDIDYSDTNKD--YFFVFGKETTGLPDALLQENEENCLRIPMTDHIRSLNLSNTAAILAYEALRQQNFGAL 156
>gi|70726108|ref|YP_253022.1| hypothetical protein SH1107 [Staphylococcus haemolyticus JCSC1435] >gi|68446832|dbj|BAE04416.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (156 aa)
Score = 339, Expect = 1.2e-30, Identities = 71/158 (44%), Positives = 98/158 (62%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +IVLFQPEIP NTGNI+RTC G N  LH+I+P GF  +DK +KRAGLDYW+H+    +D   DF          + +L+TKF  ++ S+   D   +D + +F+FGRET GL   + +KY    L+I M+ NIRS NLSN+ A++ +      NF  L
  S:     4 HIVLFQPEIPANTGNIARTCAGTNTHLHLIKPLGFSTDDKMLKRAGLDYWEHVNITYHDSIEDFFDAT----QGEYYLLTKFGKQTYSDF--DFSKEDTDYYFIFGRETTGLPDWVKDKYADTALRIPMSENIRSLNLSNTAALLIYEALRQQNFPGL 155
>gi|126649466|ref|ZP_01721707.1| CspR [Bacillus sp. B14905] >gi|126593791|gb|EAZ87714.1| CspR [Bacillus sp. B14905] (157 aa)
Score = 339, Expect = 1.3e-30, Identities = 67/148 (45%), Positives = 97/148 (65%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+IVL+QPEIP NTGNI+RTC G N +LH+IRP GF  +DK +KRAGLDYW  +    +D   DF +    +K+  V+LI  ++D+  +  T D   K+ +I+F+FG+ET GL  E   + +   L+I  + ++RS NLSN+ AIV +
  S:     3 LHIVLYQPEIPANTGNIARTCAGTNTSLHLIRPLGFSTDDKMLKRAGLDYWHSVNVVYHDSLDDFIA---YSKDGDVYLIETYSDEPFT--THDFSDKERDIYFMFGKETTGLPKEFAYERRNMCLRIPQSDHVRSLNLSNTAAIVIY 145
>gi|418440|sp|P32813|YGL3_BACST Uncharacterized tRNA/rRNA methyltransferase in gldA 3'region (ORF3) >gi|142979|gb|AAA22478.1| ORF3 is homologous to an ORF downstream of the spoT gene of E.coli; ORF3 (157 aa)
Score = 338, Expect = 1.4e-30, Identities = 68/148 (45%), Positives = 95/148 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++VLFQPEIP NTGNI+RTC   N  LH+IRP GF  +DK ++RAGLDYW+ +    YD    F  Q   N+N   + ITKF  +  ++    + +K  EIFF+FGRET GL  E++ + +   L+I M  N+R+ NLSN+ AI+ +
  S:     3 LHVVLFQPEIPANTGNIARTCAATNTALHLIRPLGFSTDDKMLRRAGLDYWEFVNIHYYDSLDHFFQQ---NQNGDFYYITKFGKRYYTSYDFSDPSK--EIFFIFGRETTGLPKELLAENEDRCLRIPMTENVRALNLSNTAAILVY 145
>gi|157150281|ref|YP_001450942.1| rRNA methylase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075075|gb|ABV09758.1| rRNA methylase [Streptococcus gordonii str. Challis substr. CH1] (168 aa)
Score = 338, Expect = 1.6e-30, Identities = 68/159 (42%), Positives = 108/159 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP+NTGNI+RTC   NA LH+I+P GF ++D++MKRAGLDYWD L    Y+   DF    +   + +++L++KFA+K  S   +++ +K+ + +F+FGRE KGL  E M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L+
  S:     5 HIVLFEPQIPQNTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLDISYYESLEDF----MEKMDGQLYLVSKFAEKVYS---EEDFSKEGKHYFMFGREDKGLPEEFMRQHPEKALRIPMNDQHVRSLNVSNTVCMIVYEALRQQNFVGLE 157
>gi|154685355|ref|YP_001420516.1| hypothetical protein RBAM_009210 [Bacillus amyloliquefaciens FZB42] >gi|154351206|gb|ABS73285.1| CspR [Bacillus amyloliquefaciens FZB42] (157 aa)
Score = 338, Expect = 1.7e-30, Identities = 73/159 (45%), Positives = 101/159 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           L++VL+QPEIP NTGNI+RTC   + TLH+IRP GF  +DK +KRAGLDYW+ +K   +D   + FE+     +N K F ITKF  K  ++   D    +E+ FFVFGRET GL  E++E      L++ M  ++RS NLSN+ AI+ +      N+ DL
  S:     3 LHVVLYQPEIPANTGNIARTCAATDTTLHLIRPLGFSTDDKMLKRAGLDYWEFVKVVYHDSLEELFEAY----ENGKFFFITKFGQKPHTSF--DYSNTEEDFFFVFGRETSGLPKELIENNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDL 156
>gi|152974303|ref|YP_001373820.1| RNA methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152023055|gb|ABS20825.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus subsp. cytotoxis NVH 391-98] (162 aa)
Score = 337, Expect = 2.1e-30, Identities = 68/159 (42%), Positives = 100/159 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +N+VL+QPEIP NTGNI+RTC    A LH+IRP GF  +DK +KRAGLDYW+H+K   YD   +F  +   N++ + F +TK+ +K+ +    D    ++  +FVFGRET GL + I+++     L+I M   +RS NLSN+ AI+ +      N+  L
  S:     3 VNVVLYQPEIPANTGNIARTCAATGAGLHLIRPLGFSTDDKMLKRAGLDYWEHVKITYYDSIEEFYEK---NQDGEFFYLTKYGEKAHTAF--DYSNPEKNYYFVFGRETNGLPANIIQENFDHCLRIPMTDKVRSLNLSNTAAILVYEAFRQQNYPGL 156
>gi|1381681|gb|AAB02738.1| CspR (157 aa)
Score = 336, Expect = 2.8e-30, Identities = 72/160 (45%), Positives = 101/160 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           L++VL+QPEIP NTGNI+RTC   N TLH+IRP GF  +DK +KRAGLDYW+ +    +D   + FE+     K  K F ITKF  +  ++    +L  DE+ FFVFGRET GL  ++++      L++ M  ++RS NLSN+ AI+ +      N+ DLK
  S:     3 LHVVLYQPEIPANTGNIARTCAATNTTLHLIRPLGFSTDDKMLKRAGLDYWEFVNVVYHDSLEELFEAY----KKGKFFFITKFGQQPHTSFDYTDL--DEDYFFVFGRETSGLPKDLIQNNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDLK 157
>gi|22537728|ref|NP_688579.1| RNA methyltransferase [Streptococcus agalactiae 2603V/R] >gi|76786761|ref|YP_330206.1| RNA methyltransferase [Streptococcus agalactiae A909] >gi|77409466|ref|ZP_00786159.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae COH1] >gi|22534618|gb|AAN00452.1|AE014264_7 RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae 2603V/R] >gi|76561818|gb|ABA44402.1| RNA methyltransferase, TrmH family [Streptococcus agalactiae A909] >gi|77171933|gb|EAO75109.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae COH1] (182 aa)
Score = 335, Expect = 3.2e-30, Identities = 72/159 (45%), Positives = 105/159 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP NTGNI+RTC   NA LH+IRP GF ++DK+MKRAGLDYWD L    YD   +F    +++   KV LI+KFADK  S+   +    D++ +F+FGRE KGL    M ++ +  L+I MN  ++RS N+SN+V ++ +      +F +L+
  S:    19 HIVLFEPQIPANTGNIARTCAATNAPLHIIRPMGFPIDDKKMKRAGLDYWDKLDVSFYDGLEEF----MLSCRGKVHLISKFADKVYSD---ENYNDDQDHYFMFGREDKGLPETFMREHAEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQSFPNLE 171
>gi|25011677|ref|NP_736072.1| hypothetical protein gbs1637 [Streptococcus agalactiae NEM316] >gi|77407097|ref|ZP_00784097.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae H36B] >gi|77414904|ref|ZP_00791009.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae 515] >gi|24413217|emb|CAD47296.1| Unknown [Streptococcus agalactiae NEM316] >gi|77159049|gb|EAO70255.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae 515] >gi|77174292|gb|EAO77161.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae H36B] (182 aa)
Score = 335, Expect = 3.3e-30, Identities = 72/159 (45%), Positives = 105/159 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP NTGNI+RTC   NA LH+IRP GF ++DK+MKRAGLDYWD L    YD   +F    +++   KV LI+KFADK  S+   +    D++ +F+FGRE KGL    M ++ +  L+I MN  ++RS N+SN+V ++ +      +F +L+
  S:    19 HIVLFEPQIPANTGNIARTCAATNAPLHIIRPMGFPIDDKKMKRAGLDYWDKLDVSFYDSLEEF----MLSCRGKVHLISKFADKVYSD---ENYNDDQDHYFMFGREDKGLPETFMREHAEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQSFPNLE 171
>gi|30018734|ref|NP_830365.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus ATCC 14579] >gi|30260705|ref|NP_843082.1| RNA methyltransferase [Bacillus anthracis str. Ames] >gi|42779682|ref|NP_976929.1| RNA methyltransferase [Bacillus cereus ATCC 10987] >gi|47525820|ref|YP_017169.1| RNA methyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47567107|ref|ZP_00237823.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus G9241] >gi|49183542|ref|YP_026794.1| RNA methyltransferase [Bacillus anthracis str. Sterne] >gi|49476831|ref|YP_034807.1| RNA methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52144766|ref|YP_082062.1| RNA methyltransferase [Bacillus cereus E33L] >gi|65317966|ref|ZP_00390925.1| COG0219: Predicted rRNA methylase (SpoU class) [Bacillus anthracis str. A2012] >gi|75761277|ref|ZP_00741258.1| 23S rRNA methyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|118476236|ref|YP_893387.1| RNA methyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|165871765|ref|ZP_02216409.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0488] >gi|166985757|ref|ZP_02257030.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus AH187] >gi|166995024|ref|ZP_02261484.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus AH820] >gi|167635710|ref|ZP_02394021.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0442] >gi|167640663|ref|ZP_02398924.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0193] >gi|167935399|ref|ZP_02522474.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus AH1134] >gi|168136301|ref|ZP_02579530.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus B4264] >gi|168142617|ref|ZP_02585846.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus G9842] >gi|168159423|ref|ZP_02594656.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus H3081.97] >gi|170708207|ref|ZP_02898653.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0389] >gi|177653797|ref|ZP_02935898.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0174] >gi|190568180|ref|ZP_03021089.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis Tsiankovskii-I] >gi|196034754|ref|ZP_03102162.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus W] >gi|196041372|ref|ZP_03108666.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus NVH0597-99] >gi|196046793|ref|ZP_03114015.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus 03BB108] >gi|29894275|gb|AAP07566.1| 23S rRNA methyltransferase [Bacillus cereus ATCC 14579] >gi|30254073|gb|AAP24568.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. Ames] >gi|42735599|gb|AAS39537.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus ATCC 10987] >gi|47500968|gb|AAT29644.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. 'Ames Ancestor'] >gi|47556163|gb|EAL14498.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus G9241] >gi|49177469|gb|AAT52845.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. Sterne] >gi|49328387|gb|AAT59033.1| RNA methyltransferase, TrmH family, group 2 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978235|gb|AAU19785.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus E33L] >gi|74491236|gb|EAO54471.1| 23S rRNA methyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|118415461|gb|ABK83880.1| RNA methyltransferase, TrmH family, group 2 [Bacillus thuringiensis str. Al Hakam] >gi|164712490|gb|EDR18023.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0488] >gi|167511378|gb|EDR86763.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0193] >gi|167528969|gb|EDR91725.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0442] >gi|170126863|gb|EDS95744.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0389] >gi|172081189|gb|EDT66265.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis str. A0174] >gi|190560672|gb|EDV14648.1| RNA methyltransferase, TrmH family, group 2 [Bacillus anthracis Tsiankovskii-I] >gi|195992797|gb|EDX56757.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus W] >gi|196022328|gb|EDX61013.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus 03BB108] >gi|196027857|gb|EDX66470.1| RNA methyltransferase, TrmH family, group 2 [Bacillus cereus NVH0597-99] (162 aa)
Score = 335, Expect = 3.9e-30, Identities = 67/159 (42%), Positives = 100/159 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +++VL+QPEIP NTGNI+RTC      LH+IRP GF  +DK +KRAGLDYW H+K   YD   +F  +   NK+ + F +TK+ +K+ +    D   ++++ +FVFGRET GL + ++E+     L+I M   +RS NLSN+ AI+ +      N+  L
  S:     3 VHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKMLKRAGLDYWQHVKITYYDSIEEFYEK---NKDGEFFYLTKYGEKAHTAF--DYSKREKDYYFVFGRETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGL 156
>gi|157691625|ref|YP_001486087.1| rRNA methyltransferase-like protein [Bacillus pumilus SAFR-032] >gi|194014805|ref|ZP_03053422.1| RNA methyltransferase, TrmH family, group 2 [Bacillus pumilus ATCC 7061] >gi|157680383|gb|ABV61527.1| rRNA methyltransferase-like protein [Bacillus pumilus SAFR-032] >gi|194013831|gb|EDW23396.1| RNA methyltransferase, TrmH family, group 2 [Bacillus pumilus ATCC 7061] (157 aa)
Score = 334, Expect = 4.1e-30, Identities = 70/159 (44%), Positives = 98/159 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           L++VL+QPEIP NTGNI+RTC   N TLH+IRP GF  +DK +KRAGLDYW +     +D   + FE+    +   + F ITKF  K  +     +L  DE+ FFVFGRET GL  +++E+     L++ M  ++RS NLSN+ AI+ +       + DL
  S:     3 LHVVLYQPEIPANTGNIARTCAATNTTLHLIRPLGFSTDDKMLKRAGLDYWKYANVVYHDSLDELFEA----HPKGQFFYITKFGQKPHTTFDYSQL--DEDYFFVFGRETSGLPKDLIERNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQQYRDL 156
>gi|163938472|ref|YP_001643356.1| RNA methyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163860669|gb|ABY41728.1| RNA methyltransferase, TrmH family, group 2 [Bacillus weihenstephanensis KBAB4] (162 aa)
Score = 334, Expect = 4.7e-30, Identities = 68/159 (42%), Positives = 98/159 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +++VL+QPEIP NTGNI+RTC      LH+IRP GF  +DK +KRAGLDYW H+K   YD   +F  +   NK+ + F +TK+ +K+ +     +  KD   +FVFGRET GL + ++E+     L+I M   +RS NLSN+ AI+ +      N+  L
  S:     3 VHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKMLKRAGLDYWQHVKVTYYDSIEEFYEK---NKDGEFFYLTKYGEKAHTAFNYSKREKD--YYFVFGRETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGL 156
>gi|60416311|sp|P69001|Y934_LISIN Uncharacterized tRNA/rRNA methyltransferase lin0934 (169 aa)
Score = 334, Expect = 5.0e-30, Identities = 69/147 (46%), Positives = 97/147 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL+QPEIP NTGNISRTC G +  LH+IRP GF  +DK +KRAGLDYWD++K   YD   +F  +   N   + + ITKF     S++   +  K+   FFVFG+ET GL  E+++  ++  L+I M  +IRS NLSN+ A++A+
  S:     4 HIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEFFEK---NAGGEFYYITKFGRHVYSDVDYSDPNKN--YFFVFGKETTGLPDELLQANEENCLRIPMTDHIRSLNLSNTAAVLAY 145
>gi|77412361|ref|ZP_00788672.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae CJB111] >gi|77161581|gb|EAO72581.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae CJB111] (182 aa)
Score = 330, Expect = 1.2e-29, Identities = 71/159 (44%), Positives = 104/159 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP NTGNI+RTC    A LH+IRP GF ++DK+MKRAGLDYWD L    YD   +F    +++   KV LI+KFADK  S+   +    D++ +F+FGRE KGL    M ++ +  L+I MN  ++RS N+SN+V ++ +      +F +L+
  S:    19 HIVLFEPQIPANTGNIARTCAATXAPLHIIRPMGFPIDDKKMKRAGLDYWDKLDVSFYDSLEEF----MLSCRGKVHLISKFADKVYSD---ENYNDDQDHYFMFGREDKGLPETFMREHAEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQSFPNLE 171
>gi|16077958|ref|NP_388774.1| rRNA methylase-like protein [Bacillus subtilis subsp. subtilis str. 168] >gi|2633216|emb|CAB12721.1| rRNA methylase homolog [Bacillus subtilis subsp. subtilis str. 168] (160 aa)
Score = 330, Expect = 1.2e-29, Identities = 71/160 (44%), Positives = 100/160 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           L++VL+ PEIP NTGNI+RTC   N TLH+IRP GF  +DK +KRAGLDYW+ +    +D   + FE+     K  K F ITKF  +  ++    +L  DE+ FFVFGRET GL  ++++      L++ M  ++RS NLSN+ AI+ +      N+ DLK
  S:     6 LHVVLYHPEIPANTGNIARTCAATNTTLHLIRPLGFSTDDKMLKRAGLDYWEFVNVVYHDSLEELFEAY----KKGKFFFITKFGQQPHTSFDYTDL--DEDYFFVFGRETSGLPKDLIQNNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDLK 160
>gi|89894053|ref|YP_517540.1| hypothetical protein DSY1307 [Desulfitobacterium hafniense Y51] >gi|89333501|dbj|BAE83096.1| hypothetical protein [Desulfitobacterium hafniense Y51] (155 aa)
Score = 330, Expect = 1.2e-29, Identities = 62/148 (41%), Positives = 96/148 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           LNIVL +PEIP NTGN++R C    A LH+++P GF ++DK +KRAGLDYWD L    Y+++++FE++   N     +L T  A +        ++   +  + +FG+ETKGL+ EI+ +Y +  L++ M ++ RS NLSNSVA+V +
  S:     4 LNIVLVEPEIPPNTGNVARLCAATGAALHLVKPLGFEISDKHLKRAGLDYWDMLDIHIYENYAEFEAK---NPQGPRYLATTKAQR-----LHTDIHYQQGGYILFGKETKGLSPEILARYPETTLRLPMRADARSLNLSNSVAVVVY 143
>gi|109646383|ref|ZP_01370287.1| tRNA/rRNA methyltransferase (SpoU) [Desulfitobacterium hafniense DCB-2] >gi|109641629|gb|EAT51183.1| tRNA/rRNA methyltransferase (SpoU) [Desulfitobacterium hafniense DCB-2] (155 aa)
Score = 330, Expect = 1.2e-29, Identities = 62/148 (41%), Positives = 96/148 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           LNIVL +PEIP NTGN++R C    A LH+++P GF ++DK +KRAGLDYWD L    Y+++++FE++   N     +L T  A +        ++   +  + +FG+ETKGL+ EI+ +Y +  L++ M ++ RS NLSNSVA+V +
  S:     4 LNIVLVEPEIPPNTGNVARLCAATGAALHLVKPLGFEISDKHLKRAGLDYWDMLDIHIYENYAEFEAK---NPQGPRYLATTKAQR-----LHTDIHYQQGGYILFGKETKGLSPEILARYPETTLRLPMRADARSLNLSNSVAVVVY 143
>gi|138894170|ref|YP_001124623.1| rRNA methylase [Geobacillus thermodenitrificans NG80-2] >gi|134265683|gb|ABO65878.1| rRNA methylase [Geobacillus thermodenitrificans NG80-2] (157 aa)
Score = 328, Expect = 2.1e-29, Identities = 67/148 (45%), Positives = 92/148 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++VL+QPEIP NTGNI+RTC   +  LH+IRP GF  +DK +KRAGLDYW ++    YD   +  ++       + + ITKF  +   +    +  KD  IFFVFGRET GL  E++E  K   L+I MN  +RS NLSN+ AI+ +
  S:     3 LHVVLYQPEIPANTGNIARTCAATDTALHLIRPLGFSTDDKMLKRAGLDYWPYVNISYYDSIDELFAR---FPGGEFYFITKFGQQYYDSFDFSDQEKD--IFFVFGRETTGLPKELLEANKDRCLRIPMNDKVRSLNLSNTAAILVY 145
>gi|52079368|ref|YP_078159.1| rRNA methylase-like protein [Bacillus licheniformis ATCC 14580] >gi|52784729|ref|YP_090558.1| hypothetical protein BLi00957 [Bacillus licheniformis ATCC 14580] >gi|52002579|gb|AAU22521.1| rRNA methylase homolog [Bacillus licheniformis ATCC 14580] >gi|52347231|gb|AAU39865.1| CspR [Bacillus licheniformis DSM 13] (157 aa)
Score = 328, Expect = 2.5e-29, Identities = 68/159 (42%), Positives = 98/159 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           L++VL+QPEIP NTGNI+RTC   + TLH+IRP GF  +DK +KRAGLDYW+ +    +D   +       +   + F ITKF  K  ++   D   ++E+ FFVFGRET GL  E++E+     L++ M  ++RS NLSN+ AI+ +      N+ DL
  S:     3 LHVVLYQPEIPANTGNIARTCAATDTTLHLIRPLGFSTDDKMLKRAGLDYWEFVNVVYHDSLDELFD---AHPEGRFFFITKFGQKPHTSF--DYSDQNEDYFFVFGRETNGLPKELIEQNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDL 156
>gi|125718574|ref|YP_001035707.1| rRNA methylase, putative [Streptococcus sanguinis SK36] >gi|125498491|gb|ABN45157.1| RRNA methylase, putative [Streptococcus sanguinis SK36] (184 aa)
Score = 327, Expect = 2.6e-29, Identities = 68/158 (43%), Positives = 103/158 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +IVLF+P+IP+NTGNI+RTC   N+ LH+I+P GF ++D++MKRAGLDYWD L    Y+   DF  Q     + +++LI+KFA+K  S   ++    +   +F+FGRE KGL  E M ++ +  L+I MN  ++RS N+SN+V ++ +      NF  L
  S:    21 HIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLDITYYESLDDFMEQ----MDGQLYLISKFAEKVYS---EENFAAEGSHYFMFGREDKGLPEEFMRRHPEKALRIPMNDQHVRSLNVSNTVCMIVYEALRQQNFAGL 172
>gi|27468455|ref|NP_765092.1| putative rRNA methylase [Staphylococcus epidermidis ATCC 12228] >gi|57867280|ref|YP_188960.1| RNA methyltransferase [Staphylococcus epidermidis RP62A] >gi|27316002|gb|AAO05136.1|AE016749_82 putative rRNA methylase [Staphylococcus epidermidis ATCC 12228] >gi|57637938|gb|AAW54726.1| RNA methyltransferase, TrmH family, group 2 [Staphylococcus epidermidis RP62A] (156 aa)
Score = 326, Expect = 3.4e-29, Identities = 66/147 (44%), Positives = 93/147 (63%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL+QPEIP NTGNI+RTC G    LH+I+P GF   DK +KRAGLDYW+H+    +D   +F      N     +L+TKF  ++ S+        +E+ +F+FG+ET GL   + EKY K  L+I M+ NIRS NLSN+ A++ +
  S:     4 HIVLYQPEIPANTGNIARTCAGTLTHLHLIKPLGFSTEDKMLKRAGLDYWEHVNITYHDSIEEF----FANTEGHYYLLTKFGKQTYSDFNFS--NTNEDYYFIFGKETTGLPEWVKEKYAKTALRIPMSDNIRSLNLSNTAALLIY 144
>gi|160878312|ref|YP_001557280.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium phytofermentans ISDg] >gi|160426978|gb|ABX40541.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium phytofermentans ISDg] (166 aa)
Score = 325, Expect = 4.7e-29, Identities = 67/160 (41%), Positives = 101/160 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +NI+LF+PEIP NTGNI RTCV     LH+I P GF L++K +KRAGLDYW  L    Y+++ DF  +   N N+K+++ T  A    +     E++ + + F +FG+E+ G+  EI+ + K+  ++I M  +IRS NLSNSVAIV +      NF+ ++
  S:     1 MNIILFEPEIPANTGNIGRTCVATGTKLHLIEPLGFRLDEKEIKRAGLDYWKDLDVTVYENYDDFLRR---NPNAKIYMATTKARHVYT-----EVSYEPDCFIMFGKESAGIPEEILLENKETSIRIPMIGDIRSLNLSNSVAIVLYEALRQQNFDHMR 152
>gi|149181311|ref|ZP_01859809.1| RNA methyltransferase, TrmH family, group 2 [Bacillus sp. SG-1] >gi|148851036|gb|EDL65188.1| RNA methyltransferase, TrmH family, group 2 [Bacillus sp. SG-1] (160 aa)
Score = 325, Expect = 5.3e-29, Identities = 65/148 (43%), Positives = 97/148 (65%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +++VL+QPEIP NTGNI+RTC   + TLH+IRP GF  +DK ++RAGLDYW  ++   YD   +F  +   N+  + + +TK+ +   S    D   K+++ +F+FGRET GL  E++E  K   L+I MN+N RS NLSN+ AI+ +
  S:     3 IHVVLYQPEIPANTGNIARTCAATDTTLHLIRPLGFSTDDKMLRRAGLDYWQFVEINYYDSIEEFFEK---NEGGEFYYLTKYGENVHSGY--DYSNKEKDYYFIFGRETTGLPDEVIENNKDRCLRIPMNNNARSLNLSNTAAILVY 145
>gi|154505239|ref|ZP_02041977.1| hypothetical protein RUMGNA_02753 [Ruminococcus gnavus ATCC 29149] >gi|153794437|gb|EDN76857.1| hypothetical protein RUMGNA_02753 [Ruminococcus gnavus ATCC 29149] (166 aa)
Score = 324, Expect = 6.3e-29, Identities = 67/157 (42%), Positives = 97/157 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           MLNIVL +PEIP NTGNI RTCV  N  LH+I P GF LN+K +KRAG+DYW  L  + Y ++ DF  +   N  +K+++ T  A K  +     E+  + + + +FG+E+ G+  EI+  +K+  ++I M  +IRS NL NSVAI+ +      NF
  S:     1 MLNIVLHEPEIPANTGNIGRTCVATNTRLHLIEPLGFRLNEKALKRAGMDYWADLDVRTYINFEDFLEK---NPGAKIYMATTKAPKVYT-----EVQYEPDCYIMFGKESAGIPEEILVNHKEDCVRIPMVGDIRSLNLGNSVAIILYEALRQQNF 149
>gi|104773701|ref|YP_618681.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513698|ref|YP_812604.1| rRNA methylase (SpoU class) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422782|emb|CAI97421.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093013|gb|ABJ58166.1| Predicted rRNA methylase (SpoU class) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (185 aa)
Score = 324, Expect = 6.3e-29, Identities = 69/147 (46%), Positives = 98/147 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVLF+PEIP+NTGNI+RTC G N  L +I P GF L+DK +KRA LDY   ++ + +DD   F +   +  N++++LI+KF+ K  +++   + +KD   +FVFGRET GL    M +Y    L+I M+  IR+FNLSNS AIV F
  S:     4 HIVLFEPEIPDNTGNIARTCAGTNTVLDLIEPLGFRLDDKHLKRAVLDYGGEVEIRRHDDLRAFLAT--LPDNAEMYLISKFSSKVYTDVDYTDESKD--YYFVFGRETTGLPETFMRQYADRNLRIPMSDKIRAFNLSNSAAIVIF 146
>gi|153815564|ref|ZP_01968232.1| hypothetical protein RUMTOR_01800 [Ruminococcus torques ATCC 27756] >gi|145847206|gb|EDK24124.1| hypothetical protein RUMTOR_01800 [Ruminococcus torques ATCC 27756] (167 aa)
Score = 324, Expect = 6.8e-29, Identities = 63/149 (42%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI RTCV     LH+I P GF L++K +KRAG+DYW+ L    Y D++DF  +   N  +K+++ T  A K  +     E   + + + +FG+E+ G+  EI+  ++   ++I M   IRS NL NSVA+V +
  S:     1 MLNIVLYEPEIPANTGNIGRTCVATGTRLHLIEPLGFKLSEKALKRAGMDYWNDLDVTTYIDYADFLEK---NPGAKIYMATTKAKKVYT-----EAAYEPDCYIMFGKESAGIPEEILVDHEDTCVRIPMMGQIRSLNLGNSVAVVLY 141
>gi|116494421|ref|YP_806155.1| rRNA methylase (SpoU class) [Lactobacillus casei ATCC 334] >gi|116104571|gb|ABJ69713.1| Predicted rRNA methylase (SpoU class) [Lactobacillus casei ATCC 334] (169 aa)
Score = 322, Expect = 9.9e-29, Identities = 64/147 (43%), Positives = 95/147 (64%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVLF+P IP NTGNI+RTC   N+ LH+I+P GF  +DK ++RAGLDYW  ++   +D   DF +   V +   ++LITKFAD++ S+  +D    D++ +F+FG+ET GL    M  +    L+I M  N+R+ NLSN  A+V +
  S:     4 HIVLFEPLIPANTGNIARTCAATNSYLHLIKPLGFETDDKHLRRAGLDYWQRVRIIYHDSLDDFMAT--VKEPQYLYLITKFADQTYSD--RDYADIDQDHYFLFGKETTGLPEGFMRDHADQCLRIPMTDNVRALNLSNCAALVIY 146
>gi|116492956|ref|YP_804691.1| rRNA methylase (SpoU class) [Pediococcus pentosaceus ATCC 25745] >gi|116103106|gb|ABJ68249.1| Predicted rRNA methylase (SpoU class) [Pediococcus pentosaceus ATCC 25745] (172 aa)
Score = 321, Expect = 1.5e-28, Identities = 64/147 (43%), Positives = 97/147 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLF+P +P NTGNI+RTC G N  LH+I+P GF +NDK +KRAGLDYWD ++   +++  +F +   V    ++F+++KFA ++ S         DE+ + +FG+ET GL    M +Y++  ++I  N  NIR+ NLSNS AIV +
  S:     4 HIVLFEPLMPANTGNIARTCAGTNTVLHLIKPLGFTINDKTVKRAGLDYWDKVEIVYHENLPEFLAT--VPDKKRLFVVSKFAKRAYSQADYTSENNDEDNYLLFGKETTGLPEAFMRQYEECAIRIPQNDENIRALNLSNSAAIVIY 149
>gi|15924845|ref|NP_372379.1| putative rRNA methylase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927429|ref|NP_374962.1| hypothetical protein SA1672 [Staphylococcus aureus subsp. aureus N315] >gi|21283525|ref|NP_646613.1| hypothetical protein MW1796 [Staphylococcus aureus subsp. aureus MW2] >gi|49484097|ref|YP_041321.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486674|ref|YP_043895.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82751510|ref|YP_417251.1| rRNA methylase-like protein [Staphylococcus aureus RF122] >gi|156980171|ref|YP_001442430.1| hypothetical protein SAHV_1840 [Staphylococcus aureus subsp. aureus Mu3] >gi|13701648|dbj|BAB42941.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247627|dbj|BAB58017.1| putative rRNA methylase [Staphylococcus aureus subsp. aureus Mu50] >gi|21204966|dbj|BAB95661.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49242226|emb|CAG40933.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245117|emb|CAG43583.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82657041|emb|CAI81478.1| rRNA methylase homolog [Staphylococcus aureus RF122] >gi|156722306|dbj|BAF78723.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (156 aa)
Score = 321, Expect = 1.5e-28, Identities = 66/147 (44%), Positives = 95/147 (64%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL+QPEIP NTGNI+RTC G N  LH+I+P GF  +DK +KRAGLDYW+ +    +D    F        N + +L+TKF  K+ S+   D    D++ +F+FG+ET GL   + EKY+   L+I M+ +IRS NLSN+ A++ +
  S:     4 HIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITYHDSIEAFFEAT----NGEYYLLTKFGKKTYSDF--DFSNHDKDFYFIFGKETTGLPDWVKEKYQDTALRIPMSEHIRSLNLSNTAALLIY 144
>gi|42518756|ref|NP_964686.1| hypothetical protein LJ0831 [Lactobacillus johnsonii NCC 533] >gi|41583042|gb|AAS08652.1| hypothetical protein LJ_0831 [Lactobacillus johnsonii NCC 533] (185 aa)
Score = 320, Expect = 1.9e-28, Identities = 66/145 (45%), Positives = 97/145 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           ++VL++P +P NTGNI+RTC G N  L +I P GF +++K+MKRAGLDYWD +  + +DD   F   N +  N +++LI+KF+ K+ + +   +  KD   +FVFG+ET GL    M +Y    L+I M+ NIR +NLSNSVA+V
  S:     4 HVVLYEPLMPANTGNIARTCAGTNTVLDLIEPLGFQIDNKKMKRAGLDYWDKVDIRMHDDLEAF--LNTLGPNDEMYLISKFSSKNYAQVDYTDPNKD--YYFVFGKETTGLPETFMREYYDRNLRIPMSDNIRCYNLSNSVAMV 144
>gi|148268327|ref|YP_001247270.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150394389|ref|YP_001317064.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|147741396|gb|ABQ49694.1| RNA methyltransferase, TrmH family, group 2 [Staphylococcus aureus subsp. aureus JH9] >gi|149946841|gb|ABR52777.1| RNA methyltransferase, TrmH family, group 2 [Staphylococcus aureus subsp. aureus JH1] (156 aa)
Score = 320, Expect = 2.0e-28, Identities = 66/147 (44%), Positives = 95/147 (64%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL+QPEIP NTGNI+RTC G N  LH+I+P GF  +DK +KRAGLDYW+ +    +D    F        N + +L+TKF  K+ S+   D    D++ +F+FG+ET GL   + EKY+   L+I M+ +IRS NLSN+ A++ +
  S:     4 HIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITYHDSIEAFFEAT----NGEYYLLTKFGKKTYSDF--DFSNHDKDFYFIFGKETTGLPDWVKEKYQDTTLRIPMSEHIRSLNLSNTAALLIY 144
>gi|110803755|ref|YP_698630.1| rRNA methylase-like protein cspR [Clostridium perfringens SM101] >gi|110684256|gb|ABG87626.1| rRNA methylase-like protein cspR [Clostridium perfringens SM101] (153 aa)
Score = 320, Expect = 2.1e-28, Identities = 66/160 (41%), Positives = 103/160 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVL+QPEIP+NTGNI+RTCV  N+ LH+I+P GF+++DK +KRAGLDYW  L  + ++ + DF  +     + K++L T  A+        DE+  +EE F +FGRE+ G+  ++   +   ++ + +N+  RS NLSN+VAI+A+       F ++K
  S:     3 LNIVLYQPEIPQNTGNIARTCVLTNSKLHIIKPMGFVIDDKHLKRAGLDYWSQLDLEIHESYEDFMKK---YGDKKIYLSTTHAEDHY-----DEVKYEEEAFIMFGRESAGVPEDVHNAHHGIKVPM-INTTTRSLNLSNTVAIIAYEALRQIGFPNMK 153
>gi|57650645|ref|YP_186738.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|87160191|ref|YP_494488.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300] >gi|88195679|ref|YP_500485.1| hypothetical protein SAOUHSC_01988 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221959|ref|YP_001332781.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510073|ref|YP_001575732.1| TrmH family RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727407|ref|ZP_02759684.1| TrmH family RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57284831|gb|AAW36925.1| RNA methyltransferase, TrmH family, group 2 [Staphylococcus aureus subsp. aureus COL] >gi|87126165|gb|ABD20679.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203237|gb|ABD31047.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374759|dbj|BAF68019.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368882|gb|ABX29853.1| TrmH family RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (156 aa)
Score = 319, Expect = 2.3e-28, Identities = 66/147 (44%), Positives = 95/147 (64%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL+QPEIP NTGNI+RTC G N  LH+I+P GF  +DK +KRAGLDYW+ +    +D    F        N + +L+TKF  K+ S+   D    D++ +F+FG+ET GL   + EKY+   L+I M+ +IRS NLSN+ A++ +
  S:     4 HIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITYHDSIEAFFEVT----NGEYYLLTKFGKKTYSDF--DFSNHDKDFYFIFGKETTGLPDWVKEKYQDTALRIPMSEHIRSLNLSNTAALLIY 144
>gi|146297844|ref|YP_001192435.1| tRNA/rRNA methyltransferase (SpoU) [Flavobacterium johnsoniae UW101] >gi|146152262|gb|ABQ03116.1| tRNA/rRNA methyltransferase (SpoU) [Flavobacterium johnsoniae UW101] (151 aa)
Score = 318, Expect = 3.0e-28, Identities = 67/147 (45%), Positives = 99/147 (67%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           MLN+VL +PEIP NTGNI R CVG  + LH+I PFGF++NDK +KR+GLDYW HL   EY +  ++  Q  +  +S+VFL++  ++KS     ++E    +  + VFG+E+ GL++  M +++   L I M+  IRSFN++NSVA V
  S:     1 MLNVVLVEPEIPNNTGNIGRLCVGTESRLHLIHPFGFVINDKNLKRSGLDYWVHLDVTEYQNVEEWIQQ--IPDHSRVFLMSSHSEKS---YLENEFQDGD--WLVFGKESVGLSAAFMARFEN-HLTIPMSPLIRSFNIANSVAFV 139
>gi|153810968|ref|ZP_01963636.1| hypothetical protein RUMOBE_01359 [Ruminococcus obeum ATCC 29174] >gi|149832856|gb|EDM87939.1| hypothetical protein RUMOBE_01359 [Ruminococcus obeum ATCC 29174] (166 aa)
Score = 318, Expect = 3.3e-28, Identities = 68/160 (42%), Positives = 100/160 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVL +PEIP NTGNI RTCV  +  LH+I P GF L++K +KRAG+DYW  L    Y D+ DF  +   N N+K++  T  A K     T  ++  +E+ + +FG+E+ G+  EI+ ++K   ++I M + IRS NLSNSVAIV +      +F+ ++
  S:     4 LNIVLLEPEIPANTGNIGRTCVATDTKLHLIEPLGFSLSEKALKRAGMDYWKDLDVTTYLDYEDFLEK---NPNAKIYYATTKALK-----TYTDVQYEEDCYIMFGKESAGIPEEILMEHKDNCVRIPMINEIRSLNLSNSVAIVLYEALRQNHFDHMQ 155
>gi|56419019|ref|YP_146337.1| rRNA methylase [Geobacillus kaustophilus HTA426] >gi|56378861|dbj|BAD74769.1| rRNA methylase [Geobacillus kaustophilus HTA426] (157 aa)
Score = 318, Expect = 3.3e-28, Identities = 65/148 (43%), Positives = 92/148 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++VL+QPEIP NTGNI+RTC   + +LH+IRP GF  +DK +KRAGLDYW ++    YD   +  ++       + + ITKF  +   +   D    ++ IFFVFGRET GL  E++E      L+I MN  +RS NLSN+ AI+ +
  S:     3 LHVVLYQPEIPANTGNIARTCAATDTSLHLIRPLGFSTDDKMLKRAGLDYWPYVNISYYDSLDELFAR---FPEGEFYFITKFGRRYYDSF--DFSDTEKHIFFVFGRETTGLPKELLEANMDRCLRIPMNDKVRSLNLSNTAAILVY 145
>gi|15674520|ref|NP_268694.1| 23S rRNA methyltransferase [Streptococcus pyogenes M1 GAS] >gi|71910126|ref|YP_281676.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS5005] >gi|139474353|ref|YP_001129069.1| 23S rRNA methyltransferase [Streptococcus pyogenes str. Manfredo] >gi|13621623|gb|AAK33415.1| putative rRNA methylase [Streptococcus pyogenes M1 GAS] >gi|71852908|gb|AAZ50931.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS5005] >gi|134272600|emb|CAM30867.1| SpoU rRNA methylase family protein [Streptococcus pyogenes str. Manfredo] (182 aa)
Score = 316, Expect = 5.4e-28, Identities = 65/147 (44%), Positives = 99/147 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLFQP+IP+NTGNI+RTC   NA LH+I+P GF ++D++MKRAGLDYWD L+   YD    F +Q     + ++ LI+KFA   ++N ++      +  +F+FGRE  GL  + M ++ +  L+I MN  ++RS N+SN+V +V +
  S:    19 HIVLFQPQIPQNTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQC----HGQLHLISKFA---VNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIY 159
>gi|125972651|ref|YP_001036561.1| RNA methyltransferase [Clostridium thermocellum ATCC 27405] >gi|196251411|ref|ZP_03150081.1| RNA methyltransferase, TrmH family, group 2 [Clostridium thermocellum DSM 4150] >gi|125712876|gb|ABN51368.1| RNA methyltransferase, TrmH family, group 2 [Clostridium thermocellum ATCC 27405] >gi|196199374|gb|EDX94201.1| RNA methyltransferase, TrmH family, group 2 [Clostridium thermocellum DSM 4150] (164 aa)
Score = 316, Expect = 5.6e-28, Identities = 65/159 (40%), Positives = 97/159 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +N+VL +PEIP+NTGNI+RTC    A LH+++P GF + D+ +KRAGLDYWD +  K YD +S+   +    K    +  T  A K  +     ++   ++ F VFG+ET GL  E++ + K++ ++I M  +IRS NLSNSVAI+ +      NF  L
  S:     3 INVVLVEPEIPQNTGNIARTCAAVGANLHLVKPLGFSVEDRYLKRAGLDYWDKVNIKYYDSFSELRDK---YKEHIFYYSTTKAQKLYT-----DVKYPDDCFIVFGKETAGLPEELLVENKEWCIRIPMRDDIRSLNLSNSVAIIVYEALRQNNFAGL 153
>gi|150391330|ref|YP_001321379.1| tRNA/rRNA methyltransferase (SpoU) [Alkaliphilus metalliredigens QYMF] >gi|149951192|gb|ABR49720.1| tRNA/rRNA methyltransferase (SpoU) [Alkaliphilus metalliredigens QYMF] (165 aa)
Score = 316, Expect = 5.6e-28, Identities = 64/148 (43%), Positives = 100/148 (67%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN--SNIRSFNLSNSVAIVAF 149
           L++VL +PEIP+NTGNI+RTCV   ATLH+I P GF +++K++KRAGLDYW+ L    YD ++DF  +   NK+ KV+  T  A K+ S +   +    ++ + +FG+ET G+  EI++ +++  ++I M      RS NLSN+V+IV +
  S:    11 LHVVLLEPEIPQNTGNIARTCVATGATLHLIGPMGFSIDEKQVKRAGLDYWELLDLNYYDRYADFLEK---NKHPKVYCATTKAQKNHSEVAYPQ----DDTYIMFGKETAGIPKEILKDHEETCIRIPMVDIERARSLNLSNAVSIVVY 153
>gi|21909807|ref|NP_664075.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS315] >gi|28896500|ref|NP_802850.1| 23S rRNA methyltransferase [Streptococcus pyogenes SSI-1] >gi|21903993|gb|AAM78878.1| putative RNA methyltransferase [Streptococcus pyogenes MGAS315] >gi|28811754|dbj|BAC64683.1| putative rRNA methylase [Streptococcus pyogenes SSI-1] (182 aa)
Score = 316, Expect = 5.7e-28, Identities = 65/147 (44%), Positives = 99/147 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLFQP+IP+NTGNI+RTC   NA LH+I+P GF ++D++MKRAGLDYWD L+   YD    F +Q     + ++ LI+KFA   ++N ++      +  +F+FGRE  GL  + M ++ +  L+I MN  ++RS N+SN+V +V +
  S:    19 HIVLFQPQIPQNTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQC----HGQLHLISKFA---VNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIY 159
>gi|149180216|ref|ZP_01858721.1| RNA methyltransferase, TrmH family, group 2 [Bacillus sp. SG-1] >gi|148852408|gb|EDL66553.1| RNA methyltransferase, TrmH family, group 2 [Bacillus sp. SG-1] (156 aa)
Score = 316, Expect = 5.9e-28, Identities = 63/148 (42%), Positives = 96/148 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +N+VL+QPEIP NT NI+ TC   +  LH+IRP GF  ++K +KRAGLDYW+ +    YD   +F S+N    + + + I  + +K+ S+    ++TK  E +F+FG+ET GL  ++ E+Y    L+I MN N+RS NLSN+ AI+ +
  S:     3 INVVLYQPEIPANTANIALTCAVTDTALHLIRPIGFSTDEKMIKRAGLDYWESVNITYYDSLEEFFSKN----HGEFYYIETYGEKAHSSFDFSDVTK--EHYFMFGKETTGLPEDLPERYHGHFLRIPMNDNVRSLNLSNTAAILVY 144
>gi|19745529|ref|NP_606665.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS8232] >gi|19747648|gb|AAL97164.1| putative rRNA methylase [Streptococcus pyogenes MGAS8232] (182 aa)
Score = 316, Expect = 5.9e-28, Identities = 65/147 (44%), Positives = 99/147 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLFQP+IP+NTGNI+RTC   NA LH+I+P GF ++D++MKRAGLDYWD L+   YD    F +Q     + ++ LI+KFA   ++N ++      +  +F+FGRE  GL  + M ++ +  L+I MN  ++RS N+SN+V +V +
  S:    19 HIVLFQPQIPQNTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQC----HGQLHLISKFA---VNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIY 159
>gi|18310293|ref|NP_562227.1| hypothetical protein CPE1311 [Clostridium perfringens str. 13] >gi|18144973|dbj|BAB81017.1| conserved hypothetical protein [Clostridium perfringens str. 13] (153 aa)
Score = 315, Expect = 7.0e-28, Identities = 65/160 (40%), Positives = 103/160 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVL+QPEIP+NTGNI+RTCV  N+ LH+I+P GF+++DK +KRAGLDYW  L  + ++ + DF  +     + K++L T  A+        DE+  +E  F +FGRE+ G+  ++   +   ++++ +N+  RS NLSN+VAI+A+       F ++K
  S:     3 LNIVLYQPEIPQNTGNIARTCVLTNSKLHIIKPMGFVIDDKHLKRAGLDYWSQLDLEIHESYEDFMKK---YGDKKIYLSTTHAEDHY-----DEVKYEEGAFIMFGRESAGVPEDVHNAHHGIKVQM-INTTTRSLNLSNTVAIIAYEALRQIGFPNMK 153
>gi|148543814|ref|YP_001271184.1| RNA methyltransferase [Lactobacillus reuteri F275] >gi|184153219|ref|YP_001841560.1| rRNA methylase [Lactobacillus reuteri F275] >gi|148530848|gb|ABQ82847.1| RNA methyltransferase, TrmH family, group 2 [Lactobacillus reuteri F275] >gi|183224563|dbj|BAG25080.1| rRNA methylase [Lactobacillus reuteri F275] (169 aa)
Score = 315, Expect = 8.0e-28, Identities = 68/158 (43%), Positives = 101/158 (63%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +IVLF+P  P NTGNI+RTC G N  LH+I+P GF  +DK MKRAGLDYWD +K   ++D   F     +   +++++++KFA    S++   + T + + +F+FG+ET GL    M+KY +  ++I  N +NIR+ NLSNS AIV +      NF +L
  S:     4 HIVLFEPLFPANTGNIARTCAGTNTELHLIKPLGFSTDDKHMKRAGLDYWDKVKITYHEDLPSF--MKTIPDINRLYIVSKFATHDYSDV---DYTGEGDHYFLFGKETTGLPERFMQKYPENAIRIPQNDNNIRALNLSNSAAIVIYEALRQQNFPNL 157
>gi|110799392|ref|YP_695961.1| RNA methyltransferase [Clostridium perfringens ATCC 13124] >gi|168207654|ref|ZP_02633659.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens E str. JGS1987] >gi|168211765|ref|ZP_02637390.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens B str. ATCC 3626] >gi|168215129|ref|ZP_02640754.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens CPE str. F4969] >gi|168218192|ref|ZP_02643817.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens NCTC 8239] >gi|169343200|ref|ZP_02864215.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens C str. JGS1495] >gi|110674039|gb|ABG83026.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens ATCC 13124] >gi|169298658|gb|EDS80737.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens C str. JGS1495] >gi|170661014|gb|EDT13697.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens E str. JGS1987] >gi|170710281|gb|EDT22463.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens B str. ATCC 3626] >gi|170713470|gb|EDT25652.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens CPE str. F4969] >gi|182379790|gb|EDT77269.1| RNA methyltransferase, TrmH family, group 2 [Clostridium perfringens NCTC 8239] (153 aa)
Score = 314, Expect = 8.6e-28, Identities = 65/160 (40%), Positives = 102/160 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVL+QPEIP+NTGNI+RTCV  N+ LH+I+P GF+++DK +KRAGLDYW  L  + ++ + DF  +     + K++L T  A+        DE+  +E  F +FGRE+ G+  ++   +   ++ + +N+  RS NLSN+VAI+A+       F ++K
  S:     3 LNIVLYQPEIPQNTGNIARTCVLTNSKLHIIKPMGFVIDDKHLKRAGLDYWSQLDLEIHESYEDFMKK---YGDKKIYLSTTHAEDHY-----DEVKYEEGAFIMFGRESAGVPEDVHNAHHGIKVPM-INTTTRSLNLSNTVAIIAYEALRQIGFPNMK 153
>gi|86132670|ref|ZP_01051263.1| rRNA methyltransferase [Cellulophaga sp. MED134] >gi|85816912|gb|EAQ38097.1| rRNA methyltransferase [Dokdonia donghaensis MED134] (150 aa)
Score = 314, Expect = 9.0e-28, Identities = 69/149 (46%), Positives = 96/149 (64%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNS-NIRSFNLSNSVAIVAF 149
           MLNIVL  PEIP NTGNI R  +G    LH+++PFGF ++D R+KRAGLDYW HL  + YD+  DF  +N     +K+  ++    KS       ++  +E++F VFG+E+KGL  EI EK+     KI + S +IRS NL+N+V IVA+
  S:     1 MLNIVLINPEIPNNTGNIGRLALGSGCRLHLVKPFGFKIDDTRLKRAGLDYWQHLDVQYYDNTEDFFKKNAF---AKMAFLSSHGTKS-----HYDIPFEEDLFLVFGKESKGLPKEITEKHPDQLYKIPLFSEHIRSLNLANAVGIVAY 142
>gi|73662249|ref|YP_301030.1| putative rRNA methylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494764|dbj|BAE18085.1| putative rRNA methylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (156 aa)
Score = 312, Expect = 1.4e-27, Identities = 64/147 (43%), Positives = 93/147 (63%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVLFQP+IP NTG+I+RTC G    LH+I+P GF  +DK +KRAGLDYW+ +    Y++   F      N +   +L+TKF  K+ S+   D    + + FF+FGRET GL   + + Y +  L+I MN NIRS NLSN+ +++ +
  S:     4 HIVLFQPQIPGNTGSIARTCAGTYTHLHLIKPLGFSTDDKMLKRAGLDYWESVNITYYENIESF----FENTDGTYYLLTKFGKKTYSDF--DFTDTEHDHFFIFGRETTGLPDWVKDAYAETALRIPMNDNIRSLNLSNTASLLIY 144
>gi|50913684|ref|YP_059656.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS10394] >gi|71902967|ref|YP_279770.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS6180] >gi|94987942|ref|YP_596043.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94991826|ref|YP_599925.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS2096] >gi|94993702|ref|YP_601800.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS10750] >gi|50902758|gb|AAT86473.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS10394] >gi|71802062|gb|AAX71415.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS6180] >gi|94541450|gb|ABF31499.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94545334|gb|ABF35381.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS2096] >gi|94547210|gb|ABF37256.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS10750] (194 aa)
Score = 312, Expect = 1.5e-27, Identities = 65/147 (44%), Positives = 99/147 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLFQP+IP+NTGNI+RTC   NA LH+I+P GF ++D++MKRAGLDYWD L+   YD    F +Q     + ++ LI+KFA   ++N ++      +  +F+FGRE  GL  + M ++ +  L+I MN  ++RS N+SN+V +V +
  S:    31 HIVLFQPQIPQNTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQC----HGQLHLISKFA---VNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIY 171
>gi|94989816|ref|YP_597916.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS10270] >gi|94543324|gb|ABF33372.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS10270] (194 aa)
Score = 312, Expect = 1.5e-27, Identities = 65/147 (44%), Positives = 99/147 (67%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLFQP+IP+NTGNI+RTC   NA LH+I+P GF ++D++MKRAGLDYWD L+   YD    F +Q     + ++ LI+KFA   ++N ++      +  +F+FGRE  GL  + M ++ +  L+I MN  ++RS N+SN+V +V +
  S:    31 HIVLFQPQIPQNTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQC----HGQLHLISKFA---VNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIY 171
>gi|116629974|ref|YP_815146.1| rRNA methylase (SpoU class) [Lactobacillus gasseri ATCC 33323] >gi|116095556|gb|ABJ60708.1| Predicted rRNA methylase (SpoU class) [Lactobacillus gasseri ATCC 33323] (209 aa)
Score = 312, Expect = 1.7e-27, Identities = 65/145 (44%), Positives = 96/145 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           ++VL++P +P NTGNI+RTC G N  L +I P GF +++K+MKRAGLDYWD +  + +DD   F     +  N +++LI+KF+ K+ + +   +  KD   +FVFG+ET GL    M +Y    L+I M+ NIR +NLSNSVA+V
  S:    28 HVVLYEPLMPANTGNIARTCAGTNTILDLIEPLGFQIDNKKMKRAGLDYWDKVDIRMHDDLDAF--LKTLGPNDEMYLISKFSSKNYAQVDYTDPNKD--YYFVFGKETTGLPETFMREYYDRNLRIPMSDNIRCYNLSNSVAMV 168
>gi|58336980|ref|YP_193565.1| rRNA methylase [Lactobacillus acidophilus NCFM] >gi|58254297|gb|AAV42534.1| rRNA methylase [Lactobacillus acidophilus NCFM] (184 aa)
Score = 312, Expect = 1.7e-27, Identities = 64/145 (44%), Positives = 96/145 (66%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           ++VL++P +P NTGNI+RTC G N  L +I P GF +++K+MKRAGLDYWD +K   +DD + F     +  + +++LI+KF+ K+  ++  D     +  +FVFG+ET GL    M +Y    L+I M+ NIR +NLSNSVA+V
  S:     4 HVVLYEPLMPANTGNIARTCAGTNTVLDLIEPLGFQIDNKKMKRAGLDYWDKVKVHRHDDLNAFLKS--LGPDDEMYLISKFSSKNYVDV--DYTDSKKNYYFVFGKETTGLPETFMREYYDRNLRIPMSDNIRCYNLSNSVAMV 144
>gi|194468370|ref|ZP_03074356.1| RNA methyltransferase, TrmH family, group 2 [Lactobacillus reuteri 100-23] >gi|194453223|gb|EDX42121.1| RNA methyltransferase, TrmH family, group 2 [Lactobacillus reuteri 100-23] (169 aa)
Score = 311, Expect = 2.1e-27, Identities = 65/147 (44%), Positives = 97/147 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLF+P  P NTGNI+RTC G N  LH+I+P GF  +DK MKRAGLDYWD +K   ++D   F     +   +++++++KFA    S++   + T + + +F+FG+ET GL    M+KY +  ++I  N +NIR+ NLSNS AIV +
  S:     4 HIVLFEPLFPANTGNIARTCAGTNTELHLIKPLGFSTDDKHMKRAGLDYWDKVKITYHEDLPSF--MKTIPDINRLYIVSKFATHDYSDV---DYTGEGDHYFLFGKETTGLPERFMQKYPENAIRIPQNDNNIRALNLSNSAAIVIY 146
>gi|172056702|ref|YP_001813162.1| RNA methyltransferase [Exiguobacterium sibiricum 255-15] >gi|171989223|gb|ACB60145.1| RNA methyltransferase, TrmH family, group 2 [Exiguobacterium sibiricum 255-15] (157 aa)
Score = 308, Expect = 4.9e-27, Identities = 58/148 (39%), Positives = 99/148 (66%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +++V++QPEIP+NTGNISRTC   ++ LH+IRP GF  +DK++KRAGLDYW+ +  + +D   +   +   + +   + ITK+ +K  S +  D    +E+ FFVFGRETKGL   ++++  +  +++  ++ +RS N+SN+ AI+ +
  S:     3 IHVVMYQPEIPQNTGNISRTCAATHSVLHLIRPLGFSTDDKQLKRAGLDYWEFVDVRYHDSLEELWDK---HPDGTFYYITKYGEKYPSQV--DLSNVEEDYFFVFGRETKGLPLNVIDENLERCIRLPQSNLVRSLNVSNTAAIIVY 145
>gi|158319987|ref|YP_001512494.1| RNA methyltransferase [Alkaliphilus oremlandii OhILAs] >gi|158140186|gb|ABW18498.1| RNA methyltransferase, TrmH family, group 2 [Alkaliphilus oremlandii OhILAs] (156 aa)
Score = 305, Expect = 9.2e-27, Identities = 66/158 (41%), Positives = 98/158 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN--SNIRSFNLSNSVAIVAFHYHFLTNFN 158
           ML++VL +PEIP+NTGNI+RTC    + LH+I P GF +++K +KRAGLDYW+ L  + YD + +F S+   N  + ++  T  A+K+ S +   E    E  + +FG+ET G+   I+ + K+  ++I M      RS NLSNSVAIV   Y  L  +N
  S:     1 MLHVVLLEPEIPQNTGNIARTCAATGSVLHLIGPMGFSIDEKHVKRAGLDYWELLDLRYYDSYEEFLSK---NPEATIYYATTKAEKAHSEMVYPE----ENCYIMFGKETAGIPKNILNENKETCIRIPMVDLEKARSLNLSNSVAIVV--YEVLRQYN 151
>gi|118444087|ref|YP_877482.1| RNA methyltransferase [Clostridium novyi NT] >gi|118134543|gb|ABK61587.1| RNA methyltransferase, TrmH family, group 2 [Clostridium novyi NT] (160 aa)
Score = 305, Expect = 9.7e-27, Identities = 70/160 (43%), Positives = 102/160 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSIS-NLTKDELTKDEEI------FFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVLF+PEIP+NTGNI RTCV  N+ LH+I+P GF ++DK +KRAGLDYW HL  + ++ + D              +I K+ D +I  + TK+     +E+      F VFGRE+ GL   I ++Y + ++++ M  +  RS NLSN+V+IVA+       F D+K
  S:     7 LNIVLFEPEIPQNTGNIGRTCVLTNSKLHLIKPLGFRIDDKSLKRAGLDYWPHLDVEVHESFDD--------------MIKKYPDANIYLSTTKEAKYHHDEVKYKTGDFIVFGRESSGLPEYIRDRYVENRIRVPMIKTTTRSLNLSNTVSIVAYEALRQLGFPDMK 160
>gi|118725198|ref|ZP_01573841.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium cellulolyticum H10] >gi|118665430|gb|EAV72049.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium cellulolyticum H10] (164 aa)
Score = 305, Expect = 1.1e-26, Identities = 64/160 (40%), Positives = 99/160 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
            NIVL +PEIP+NTGNI RTC    + LH++ P GF + DK +KRAGLDYW+    + Y++  +F+ +N+     K F  +    K+++N     +  +++ F VFG+ET GL  E+++  K++ ++I M + IRS NLSNS AIV +      NF ++K
  S:     3 FNIVLVEPEIPQNTGNIVRTCAATGSVLHLVGPLGFSIEDKYLKRAGLDYWNEADVRYYNNLDEFKKKNV----GKTFYYS--TTKAVNNYCN--VNFEDDCFIVFGKETAGLPEELLKGNKEYCIRIPMKNGIRSLNLSNSAAIVLYEALRQQNFKEMK 154
>gi|28378810|ref|NP_785702.1| rRNA methyltransferase [Lactobacillus plantarum WCFS1] >gi|28271647|emb|CAD64553.1| rRNA methyltransferase [Lactobacillus plantarum WCFS1] (170 aa)
Score = 305, Expect = 1.1e-26, Identities = 62/147 (42%), Positives = 97/147 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKI-EMNSNIRSFNLSNSVAIVAF 149
           +I LF+P +P NTGNI+RTC G +  LH+I P GF ++DK +KRAGLDYWD +    + D  DF +   +   ++++L++KFA+   +++   +  KD   +F+FG+ET GL    M KY +  ++I + +S+IR+ NLSNS AIV +
  S:     4 HIALFEPLMPANTGNIARTCAGTDTALHLIEPLGFKIDDKHLKRAGLDYWDSVDITYHADLQDFLAS--IPDLNQLYLVSKFAEHDYTDVDYSDTGKDH--YFLFGKETTGLPEPFMRKYPEKAIRIPQDDSHIRALNLSNSAAIVIY 147
>gi|28210123|ref|NP_781067.1| rRNA methyltransferase [Clostridium tetani E88] >gi|28202559|gb|AAO35004.1| rRNA methyltransferase [Clostridium tetani E88] (162 aa)
Score = 303, Expect = 1.7e-26, Identities = 70/160 (43%), Positives = 100/160 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVLFQPEIP+NTGNI+RTCV  ++ LH+I+P GF L++K +KRAGLDYW  L  + ++ + D   +    K+ K +  T  + K+ S++  +E       F VFGRET GL   + E  +   +K+ M  S+ RS NLSN+VAIV +      NF ++K
  S:    10 LNIVLFQPEIPQNTGNIARTCVLTDSKLHLIKPLGFSLDEKHLKRAGLDYWSQLSLEIHESYEDLRKK---YKDGKFYFSTTHSTKTYSDVEFEEGD-----FIVFGRETSGLPDYVREDNRDTCIKVPMIKSSTRSLNLSNTVAIVTYEALRQMNFPNMK 162
>gi|154484057|ref|ZP_02026505.1| hypothetical protein EUBVEN_01766 [Eubacterium ventriosum ATCC 27560] >gi|149735099|gb|EDM50985.1| hypothetical protein EUBVEN_01766 [Eubacterium ventriosum ATCC 27560] (164 aa)
Score = 302, Expect = 2.5e-26, Identities = 63/160 (39%), Positives = 95/160 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +N++L +PEIP+NTGNI RTC      LH+I P GF +N+K +KRAG+DYWD L    YD + DF  Q   +   K+++ T    K+    T  E   D+  + +FG+E+ G+  EI+   +   ++I MN  IRS NL+NSVAIV +      +F+ ++
  S:     1 MNVILLEPEIPQNTGNIGRTCCATGTKLHLIEPMGFRINEKNLKRAGMDYWDDLDVTIYDSFKDFMDQ---HPGIKIWMATT---KAPHRYTDVEFGPDD--YIMFGKESAGIPEEILVDNEDTCIRIPMNPEIRSLNLANSVAIVLYEALRQNDFHGMQ 152
>gi|151570247|gb|EDN35901.1| hypothetical protein FTCG_00082 [Francisella tularensis subsp. novicida GA99-3549] (155 aa)
Score = 302, Expect = 2.5e-26, Identities = 64/149 (42%), Positives = 96/149 (64%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M+NI L++PEIP NTGNI R C    A LH+I PFGF L DK+++RAGLDY +    K Y ++++F  Q   NK+ +++  T  A +    +   + + D+    +FG ET+GL ++++E  K+ QLKI M+ N RS NLSNSVA++ +
  S:     1 MINIALYEPEIPPNTGNIIRLCANVGAKLHLIEPFGFKLEDKQLRRAGLDYHEFADLKIYKNFAEFYQQ---NKDKQIWACTTKAKQYYHQV---DFSCDD--ILLFGPETRGLPADVLELLKQTQLKIPMHKNSRSLNLSNSVAVILY 141
>gi|87312115|ref|ZP_01094220.1| spoU rRNA Methylase family protein [Blastopirellula marina DSM 3645] >gi|87285143|gb|EAQ77072.1| spoU rRNA Methylase family protein [Blastopirellula marina DSM 3645] (168 aa)
Score = 302, Expect = 2.5e-26, Identities = 59/149 (39%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +++IVL +PEIP NTGNI RTCV   A L +++P GF++ND+ +KRAG+DYW HL+ +  +DW+  + +    K+ + F +TK A +S +  T D   +D     V G E+KGL  E++    +  + + M + +RS NLS + A VA+
  S:     6 VIHIVLHEPEIPPNTGNIGRTCVAIGAKLWLVKPLGFLVNDRELKRAGMDYWQHLEWEVVEDWAHLQER---LKDRRFFYLTKTAKRSYT--TVDFQLEDA---IVLGAESKGLPPELLATTPENNISVPMRTEVRSLNLSATAATVAY 146
>gi|154495837|ref|ZP_02034533.1| hypothetical protein BACCAP_00117 [Bacteroides capillosus ATCC 29799] >gi|150275035|gb|EDN02083.1| hypothetical protein BACCAP_00117 [Bacteroides capillosus ATCC 29799] (163 aa)
Score = 301, Expect = 3.2e-26, Identities = 61/149 (40%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLN+VL +PEIP+NTGNI+RTC    + LH+I+P GF ++D+ +KRAGLDYW  +    Y++  DF ++        ++L+T  A +S +     E    +E +  FG+ET GL  E  E ++   ++I M  + RS NL+NSVAIV +
  S:     1 MLNLVLVEPEIPQNTGNIARTCAATRSRLHLIKPLGFDISDRAVKRAGLDYWHMVDLTVYENLEDFFAR---TGAKDLWLMTTKAPRSYA-----EAEFRDECWLFFGKETAGLPREFREAHRDRCIRIPMRPDARSLNLANSVAIVTY 141
>gi|110005185|emb|CAK99512.1| putative trna /rrna methyl transferase protein [Spiroplasma citri] (174 aa)
Score = 300, Expect = 3.5e-26, Identities = 58/148 (39%), Positives = 96/148 (64%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +NI+LF+PEI +N G I RTCV  NA LH+I PFGFI +++ + R+  +Y D    + Y+DW+ F     +N N K++  T++A +  S +   + TKDE+IF +FGRE+ G+ + I++++     +I M+  +RS N++N+V IV +
  S:     7 INIILFEPEIAQNVGAIMRTCVAINAKLHLIEPFGFIFDERFITRSSANYVDFADYETYNDWNHFLQ---LNPNLKLYCATRYAQQPHSAI---DFTKDEKIFILFGRESTGIPTAILKEHLARTFRIPMSEKVRSLNVANTVGIVGY 148
>gi|126698145|ref|YP_001087042.1| putative RNA methylase [Clostridium difficile 630] >gi|145955989|ref|ZP_01804989.1| hypothetical protein CdifQ_04000591 [Clostridium difficile QCD-32g58] >gi|168694949|ref|ZP_02727226.1| putative RNA methylase [Clostridium difficile QCD-37x79] >gi|168715557|ref|ZP_02747834.1| putative RNA methylase [Clostridium difficile QCD-63q42] >gi|168726032|ref|ZP_02758309.1| putative RNA methylase [Clostridium difficile QCD-76w55] >gi|168733347|ref|ZP_02765624.1| putative RNA methylase [Clostridium difficile QCD-97b34] >gi|196124321|ref|ZP_03116070.1| putative RNA methylase [Clostridium difficile ATCC 43255] >gi|196162386|ref|ZP_03122947.1| putative RNA methylase [Clostridium difficile CIP 107932] >gi|115249582|emb|CAJ67399.1| putative RNA methylase [Clostridium difficile 630] (156 aa)
Score = 300, Expect = 3.9e-26, Identities = 66/148 (44%), Positives = 91/148 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--NSNIRSFNLSNSVAIVAF 149
           LNIVL +PEIP+NTGNI RTC    +TLH+++P GF L+DK +KR GLDYWD    + YD + + + +     NSK F  T  A +S S     ++  +E  F VFG+ETKGL   +++      +++ M      RS NLSNSVAIV +
  S:     3 LNIVLVEPEIPQNTGNIIRTCAATGSTLHLVKPLGFSLDDKHLKRCGLDYWDIADIQYYDSFEELQEK---YPNSKYFFSTTKAKQSHS-----DVKYEENCFIVFGKETKGLPEPLLKANMDTCIRVPMLDVEKARSLNLSNSVAIVVY 144
>gi|150026034|ref|YP_001296860.1| rRNA methyltransferase [Flavobacterium psychrophilum JIP02/86] >gi|149772575|emb|CAL44058.1| Probable rRNA methyltransferase [Flavobacterium psychrophilum JIP02/86] (151 aa)
Score = 298, Expect = 6.3e-26, Identities = 67/147 (45%), Positives = 92/147 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           MLNIVL +PEIP NTGNI R CVG    LH+I PFGF +NDK +KR+GLDYW HL   +Y +  ++  Q  +   S+VF+++  A  S       E    E  + VFG+E+ GL+ EI+  ++   L I M+  IRS+N++NSVA V
  S:     1 MLNIVLVEPEIPNNTGNIGRLCVGTGNRLHLIHPFGFEINDKNLKRSGLDYWVHLDWFQYKNTQEWIDQ--IPDKSRVFMMSSHAQTSYY-----EANFQEGDWLVFGKESVGLSKEILNLFEN-HLTIPMSDKIRSYNIANSVAFV 139
>gi|78044914|ref|YP_359968.1| RNA methyltransferase [Carboxydothermus hydrogenoformans Z-2901] >gi|77997029|gb|ABB15928.1| RNA methyltransferase, TrmH family, group 2 [Carboxydothermus hydrogenoformans Z-2901] (153 aa)
Score = 298, Expect = 6.6e-26, Identities = 61/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL +PEIP NTGNI+RTC    +TLH+++P GF   DK +KRAGLDYWD ++   ++++ +   +       + F ++    +        E++     F VFG+ET+GL  E++E  K+F  +I M   IRS NLSN+VAIV +
  S:     1 MFNIVLVEPEIPYNTGNIARTCAATGSTLHLVKPLGFSTEDKYLKRAGLDYWDKVRVIYHENFQELREK---YPEGRFFYLSTKGKRYYH-----EVSYKPGDFLVFGKETQGLPQELLEANKEFTFRIPMLPQIRSLNLSNTVAIVVY 141
>gi|56707605|ref|YP_169501.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670076|ref|YP_666633.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. tularensis FSC198] >gi|56604097|emb|CAG45096.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320409|emb|CAL08479.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. tularensis FSC 198] >gi|151568367|gb|EDN34021.1| RNA methyltransferase [Francisella tularensis subsp. tularensis FSC033] (155 aa)
Score = 298, Expect = 7.0e-26, Identities = 64/149 (42%), Positives = 96/149 (64%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M++I L++PEIP NTGNI R C    A LH+I PFGF L DK+++RAGLDY +    K Y ++++F  Q   NK+ +++  T    K+     K + + D+    +FG ET+GL ++++E  K+ QLKI M+ N RS NLSNSVA++ +
  S:     1 MISIALYEPEIPPNTGNIIRLCANVGAKLHLIEPFGFKLEDKQLRRAGLDYHEFADLKIYKNFAEFYQQ---NKDKQIWACTT---KAKQYYHKVDFSCDD--ILLFGPETRGLPADVLELLKQTQLKIPMHKNSRSLNLSNSVAVILY 141
>gi|15613586|ref|NP_241889.1| rRNA methylase [Bacillus halodurans C-125] >gi|10173638|dbj|BAB04742.1| rRNA methylase [Bacillus halodurans C-125] (157 aa)
Score = 298, Expect = 7.3e-26, Identities = 60/148 (40%), Positives = 89/148 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+IVL+QPEIP NTGNI+RTC G N  LH+IRP GF  +D+ +KRAG DYW ++    YD   +  +      + + + I     K+ ++    + +KD    FVFGRET GL ++++E++     +I     +RS NLSN+ AIV +
  S:     3 LHIVLYQPEIPANTGNIARTCAGTNTELHLIRPLGFSTDDRMLKRAGCDYWPNVNIHYYDSVDELFA---TFPDGEFYFIETVGSKNYADFDYSDGSKDH--LFVFGRETTGLPNDLIEQHLDRCFRIPQTDKVRSLNLSNTAAIVIY 145
>gi|118497153|ref|YP_898203.1| RNA methyltransferase [Francisella tularensis subsp. novicida U112] >gi|134302459|ref|YP_001122429.1| RNA methyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|194323451|ref|ZP_03057228.1| RNA methyltransferase, TrmH family [Francisella tularensis subsp. novicida FTE] >gi|118423059|gb|ABK89449.1| RNA methyltransferase, SpoU family [Francisella tularensis subsp. novicida U112] >gi|134050236|gb|ABO47307.1| RNA methyltransferase, TrmH family, group 2 [Francisella tularensis subsp. tularensis WY96-3418] >gi|151571701|gb|EDN37355.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. novicida GA99-3548] >gi|194322306|gb|EDX19787.1| RNA methyltransferase, TrmH family [Francisella tularensis subsp. novicida FTE] (155 aa)
Score = 298, Expect = 7.6e-26, Identities = 63/149 (42%), Positives = 96/149 (64%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M++I L++PEIP NTGNI R C    A LH+I PFGF L DK+++RAGLDY +    K Y ++++F  Q   NK+ +++  T  A +    +   + + D+    +FG ET+GL ++++E  K+ QLKI M+ N RS NLSNSVA++ +
  S:     1 MISIALYEPEIPPNTGNIIRLCANVGAKLHLIEPFGFKLEDKQLRRAGLDYHEFADLKIYKNFAEFYQQ---NKDKQIWACTTKAKQYYHQV---DFSCDD--ILLFGPETRGLPADVLELLKQTQLKIPMHKNSRSLNLSNSVAVILY 141
>gi|148378220|ref|YP_001252761.1| hypothetical protein CBO0217 [Clostridium botulinum A str. ATCC 3502] >gi|153934114|ref|YP_001382621.1| hypothetical protein CLB_0258 [Clostridium botulinum A str. ATCC 19397] >gi|153935647|ref|YP_001386173.1| hypothetical protein CLC_0273 [Clostridium botulinum A str. Hall] >gi|168177550|ref|ZP_02612214.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] >gi|170757793|ref|YP_001779848.1| hypothetical protein CLD_0558 [Clostridium botulinum B1 str. Okra] >gi|170758628|ref|YP_001785548.1| hypothetical protein CLK_3399 [Clostridium botulinum A3 str. Loch Maree] >gi|148287704|emb|CAL81769.1| putative RNA methylase [Clostridium botulinum A str. ATCC 3502] >gi|152930158|gb|ABS35658.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC 19397] >gi|152931561|gb|ABS37060.1| conserved hypothetical protein [Clostridium botulinum A str. Hall] >gi|169123005|gb|ACA46841.1| conserved hypothetical protein [Clostridium botulinum B1 str. Okra] >gi|169405617|gb|ACA54028.1| conserved hypothetical protein [Clostridium botulinum A3 str. Loch Maree] >gi|182671246|gb|EDT83220.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] (155 aa)
Score = 297, Expect = 8.3e-26, Identities = 68/160 (42%), Positives = 96/160 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVLFQPEIP+NTGNI+RTCV  N+ LH+I+P GF L++K ++RAGLDYW +L    Y+ + +   +    K+S  +  T   +    N   D    D + F VFGRE+ GL  EI +      +++ M N+  RS NLSN+VA+V +       F D+K
  S:     3 LNIVLFQPEIPQNTGNIARTCVLTNSRLHLIKPLGFSLDEKHLRRAGLDYWQYLDLSIYESYEELREK---YKDSNFYFSTTHGN----NFYTDVKYSDGD-FIVFGRESSGLPDEIRDSDPSKCIRVPMINTTTRSLNLSNTVAVVTYEALRQVGFPDMK 155
>gi|146296318|ref|YP_001180089.1| RNA methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409894|gb|ABP66898.1| RNA methyltransferase, TrmH family, group 2 [Caldicellulosiruptor saccharolyticus DSM 8903] (154 aa)
Score = 297, Expect = 8.8e-26, Identities = 66/148 (44%), Positives = 92/148 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +NIVL +PEIP NTGNI+RTC    + LH+I P GF L DK +KRAGLDYW +L  K Y D +DF  +   N+++ VF    F+ K     T+   T  +  + +FG+ET GL   ++E+      +I M S++RS NLSN+VAIV +
  S:     3 INIVLHEPEIPYNTGNIARTCACTGSKLHLIEPLGFSLEDKYLKRAGLDYWQYLDVKIYKDLNDFFEK---NRDANVFY---FSTKGKQYYTQAPYT--DNCYLMFGKETAGLPQWLIEQNIHKTYRIPMISDVRSLNLSNAVAIVLY 142
>gi|147678560|ref|YP_001212775.1| rRNA methylase [Pelotomaculum thermopropionicum SI] >gi|146274657|dbj|BAF60406.1| predicted rRNA methylase [Pelotomaculum thermopropionicum SI] (152 aa)
Score = 297, Expect = 9.0e-26, Identities = 61/160 (38%), Positives = 95/160 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +++VL +PEIP NTGNI+RTC    ATLH+I+P GF   D+ +KRAGLDYW+ ++   +D + +F +     +  + +L T  A +  +     E++ +     VFG+ETKGL  EI++ Y   Q+++ M    RS NL+N+VA+V +       F  LK
  S:     1 MHVVLVEPEIPANTGNIARTCAATGATLHLIKPLGFSTEDRYLKRAGLDYWNLVRVLYHDSFGEFAAS---YRGCRFYLATTKARRLYT-----EVSYEPGSCLVFGKETKGLPPEILDGYPDGQIRVPMIDGARSLNLANAVAVVLYEALRQQGFPGLK 152
>gi|54114343|gb|AAV29805.1| NT02FT1078 [synthetic construct] (155 aa)
Score = 297, Expect = 9.8e-26, Identities = 64/149 (42%), Positives = 96/149 (64%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M++I L++PEIP NTGNI R C    A LH+I PFGF L DK+++RAGLDY +    K Y ++++F  Q   NK+ +++  T    K+     K + + D+    +FG ET+GL ++++E  K+ QLKI M+ N RS NLSNSVA++ +
  S:     1 MISIALYEPEIPPNTGNIIRLCANVGAKLHLIEPFGFKLEDKQLRRAGLDYHEFADLKIYKNFAEFYQQ---NKDKQIWACTT---KAKQYYHKVDFSCDD--ILLFGPETRGLPADVLELLKQTQLKIPMHKNSRSLNLSNSVAVILY 141
>gi|83590714|ref|YP_430723.1| RNA methyltransferase TrmH, group 2 [Moorella thermoacetica ATCC 39073] >gi|83573628|gb|ABC20180.1| RNA methyltransferase TrmH, group 2 [Moorella thermoacetica ATCC 39073] (155 aa)
Score = 296, Expect = 1.1e-25, Identities = 61/148 (41%), Positives = 89/148 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++VL+QPEIP+NTGNI+RTC      LH+I P GF L++K +KRAGLDYW+ +   E+  W+ F        ++  + ++    K     TK +   D+  F VFG ET+GL + I+E      L++ M   +RS NL+NSVAIV +
  S:     3 LHVVLYQPEIPQNTGNIARTCALTGTFLHLIHPLGFRLDEKHLKRAGLDYWEEVNILEHSTWAAFRE---AYPDANCYYLST---KGQRRYTKVDYRPDD--FLVFGPETRGLPASILEPAGDRVLRVPMRPGLRSLNLANSVAIVLY 142
>gi|149370475|ref|ZP_01890164.1| predicted rRNA methylase (SpoU class) [unidentified eubacterium SCB49] >gi|149356026|gb|EDM44583.1| predicted rRNA methylase (SpoU class) [unidentified eubacterium SCB49] (151 aa)
Score = 296, Expect = 1.2e-25, Identities = 60/148 (40%), Positives = 97/148 (65%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSN-IRSFNLSNSVAIVAF 149
           LNIVL  PEIP NTGNI R  +   A LH+I+PFGF ++D R+KRAGLDYW H++   Y+   +F     +NK+  + L++   DKS+      ++  +++I  +FG+E+ GL +EI++K+     KI ++S+ IRS N++N+V++  +
  S:     3 LNIVLVCPEIPNNTGNIGRLSLATGAHLHLIKPFGFEISDSRLKRAGLDYWKHIELTIYESIEEFYK---INKDKNIVLLSSHGDKSVW-----DIPFEDDIMLLFGKESSGLPAEILKKHPDNLYKIPLHSDHIRSINIANAVSVTVY 143
>gi|89210039|ref|ZP_01188432.1| RNA methyltransferase TrmH, group 2 [Halothermothrix orenii H 168] >gi|89160379|gb|EAR80034.1| RNA methyltransferase TrmH, group 2 [Halothermothrix orenii H 168] (162 aa)
Score = 296, Expect = 1.2e-25, Identities = 68/160 (42%), Positives = 94/160 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +NIVL +PEIP+NTGNI+RTC    ++LH+I P GF ++D+ +KRAGLDYWD L    YD   +   +    K+S  +  T  A KS      D ++  E  F VFG+ET GL   +++   +  ++I M  N RS NLSNSVAI+ +      NF  LK
  S:     1 MNIVLVEPEIPQNTGNIARTCAVTGSSLHLIEPLGFSIDDRYLKRAGLDYWDKLDIYYYDSLEELMKK---YKDSNFYFATTKAPKSY-----DIVSYQENDFIVFGKETAGLPESLLKNNIENCIRIPMKDNTRSLNLSNSVAIILYEALRQLNFPGLK 152
>gi|153938142|ref|YP_001389580.1| hypothetical protein CLI_0282 [Clostridium botulinum F str. Langeland] >gi|152934038|gb|ABS39536.1| conserved hypothetical protein [Clostridium botulinum F str. Langeland] (155 aa)
Score = 296, Expect = 1.3e-25, Identities = 68/160 (42%), Positives = 96/160 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVLFQPEIP+NTGNI+RTCV  N+ LH+I+P GF L++K ++RAGLDYW +L    Y+ + +   +    K+S  +  T   +    N   D    D + F VFGRE+ GL  EI +      +++ M N+  RS NLSN+VA+V +       F D+K
  S:     3 LNIVLFQPEIPQNTGNIARTCVLTNSRLHLIKPLGFSLDEKHLRRAGLDYWQYLDLSIYESYEELREK---YKDSNFYFSTTHGN----NFYTDVKYSDGD-FIVFGRESSGLPDEIKDSDPSKCIRVPMINTTTRSLNLSNTVAVVTYEALRQVGFPDMK 155
>gi|167038402|ref|YP_001665980.1| tRNA/rRNA methyltransferase (SpoU) [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038864|ref|YP_001661849.1| tRNA/rRNA methyltransferase (SpoU) [Thermoanaerobacter sp. X514] >gi|166853104|gb|ABY91513.1| tRNA/rRNA methyltransferase (SpoU) [Thermoanaerobacter sp. X514] >gi|166857236|gb|ABY95644.1| tRNA/rRNA methyltransferase (SpoU) [Thermoanaerobacter pseudethanolicus ATCC 33223] (156 aa)
Score = 295, Expect = 1.5e-25, Identities = 68/160 (42%), Positives = 99/160 (61%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNI--RSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LN+VL +PEIP+NTGNI+RTCV   + LH+++P GF +++K +KRAGLDYW  L    YD+   F  Q   NK  K +L T  A K   ++  ++ +     + +FG+ET GL   ++EKY +  ++I M+  I  RS NLSNSVAIV +       F ++K
  S:     3 LNVVLVEPEIPQNTGNIARTCVLTGSRLHLVKPLGFSIDEKYVKRAGLDYWPLLDLTVYDNLEQFLEQ---NKGKKFYLATTKARKYYHDVKYEDNS-----YILFGKETAGLPKWLIEKYYEDCIRIPMHEVISTRSLNLSNSVAIVLYEALRQLGFPNMK 156
>gi|20806774|ref|NP_621945.1| rRNA methylase (SpoU class) [Thermoanaerobacter tengcongensis MB4] >gi|20515234|gb|AAM23549.1| predicted rRNA methylase (SpoU class) [Thermoanaerobacter tengcongensis MB4] (156 aa)
Score = 295, Expect = 1.6e-25, Identities = 62/148 (41%), Positives = 97/148 (65%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNI--RSFNLSNSVAIVAF 149
           LN+VL +PEIP+NTGNI+RTCV   + LH+++P GF +++K ++RAGLDYW  L    Y++  +F  +   +K  K +L T  A+K        E+  ++E F +FG+ET GL   ++++Y +  ++I M+  I  RS NLSNSVAI+ +
  S:     3 LNVVLVEPEIPQNTGNIARTCVLTGSRLHLVKPLGFSIDEKDVRRAGLDYWPLLDLTVYENLQEFLEK---HKGKKFYLATTRANKYYH-----EVKYEDEAFLIFGKETTGLPQWLIDEYYEDCIRIPMHEKILWRSLNLSNSVAIIVY 144
>gi|152994588|ref|YP_001339423.1| RNA methyltransferase [Marinomonas sp. MWYL1] >gi|150835512|gb|ABR69488.1| RNA methyltransferase, TrmH family, group 2 [Marinomonas sp. MWYL1] (157 aa)
Score = 294, Expect = 1.9e-25, Identities = 63/149 (42%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGN+ R C      LH+I P GF L DK+++RAGLDY +  + K Y D+  F +QN +         T +A  +  + T  E +  E    VFG ET+GL +E +E     Q L++ M +N RS NLSN+VA++ +
  S:     1 MLHIVLYQPEIPPNTGNVIRLCANTGYHLHLIEPLGFELEDKKLRRAGLDYHEFTRLKRYPDFQAFVNQNEIG--------TIYALTTKGSHTHSEASFAENDVLVFGPETRGLPAEFIEALPPAQRLRLPMQANSRSLNLSNTVAVMVY 142
>gi|15893988|ref|NP_347337.1| tRNA-methylase (SpoU class) [Clostridium acetobutylicum ATCC 824] >gi|15023579|gb|AAK78677.1|AE007585_4 Predicted tRNA-methylase (SpoU class) [Clostridium acetobutylicum ATCC 824] (160 aa)
Score = 294, Expect = 2.1e-25, Identities = 66/148 (44%), Positives = 93/148 (62%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           LNIVLFQPEIP+NTGNI+RTCV  N+ LH+I+P GF L++K ++RAGLDYW  L    YD + +   +    K+S  +  T        N   D++  ++  F +FGRE+ GL  EI E      +++ M  ++ RS NLSN+VAIVA+
  S:     8 LNIVLFQPEIPQNTGNIARTCVLTNSKLHLIKPLGFSLDEKHLRRAGLDYWKDLDLSLYDSYDELREK---YKDSTFYFSTTHG-----NGFYDDVKFNQGDFIIFGRESCGLPDEIRESDPDRCIRVPMVKTSTRSLNLSNTVAIVAY 148
>gi|15673131|ref|NP_267305.1| hypothetical protein L161988 [Lactococcus lactis subsp. lactis Il1403] >gi|12724112|gb|AAK05247.1|AE006347_5 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (169 aa)
Score = 293, Expect = 2.3e-25, Identities = 62/149 (41%), Positives = 94/149 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           M +I LF+P I  NTGNI+RTC   N  LH+I PFGF ++DK +KRAGLDYWD +    + +  DF   N +N   +++L++KFA+   S++   +  KD   +F+FGRE  GL  E M +++   ++I MN  ++RS NLSN   ++ +
  S:     1 MNHIALFEPRIHFNTGNIARTCAATNTVLHLIEPFGFEISDKHLKRAGLDYWDKVNIVYHKNLDDF--MNSINDGGQLYLVSKFAEHVYSDVDYSDDEKDH--YFLFGREDTGLPEEFMHEHRDECIRIPMNDEHVRSLNLSNCACMIVY 146
>gi|116617771|ref|YP_818142.1| rRNA methylase (SpoU class) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096618|gb|ABJ61769.1| Predicted rRNA methylase (SpoU class) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (170 aa)
Score = 293, Expect = 2.5e-25, Identities = 64/159 (40%), Positives = 104/159 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKI-EMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P +P NTGNI+RT  G +A LH+I P GF L+DK +KRAGLDYWDH+K  ++    DF   + + +   ++L++KFA++  +    +    D + +F+FG+ET GL    M +  +  ++I + +S++RS NLSN+VAIV +      +F++L+
  S:     4 HIVLFEPLMPANTGNIARTTAGTDAVLHLIEPLGFELDDKHVKRAGLDYWDHVKLVKHPSLPDF--LDTLAETDNLYLVSKFANQDYTQ--PNYAQNDTDNYFLFGKETTGLPEVFMRQNPEKAIRIPQDDSHVRSLNLSNTVAIVLYEALRQQSFSNLE 159
>gi|90962111|ref|YP_536027.1| 23S rRNA methyltransferase [Lactobacillus salivarius UCC118] >gi|90821305|gb|ABD99944.1| 23S rRNA methyltransferase [Lactobacillus salivarius UCC118] (170 aa)
Score = 293, Expect = 2.8e-25, Identities = 62/147 (42%), Positives = 94/147 (63%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           +IVLF+P +P NTGNI+RTC G N  LH+I P GF  +DK MKRAGLDYWD +K   + +   F     + +N ++++++KFA K+ +    D    ++E +F+FG+ET GL    M +  +  ++I  N  +IR+ NLSN+ AIV +
  S:     4 HIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAF--LETIPENGELYIVSKFASKAYTE--ADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSNTAAIVVY 147
>gi|150015482|ref|YP_001307736.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium beijerinckii NCIMB 8052] >gi|149901947|gb|ABR32780.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium beijerinckii NCIMB 8052] (162 aa)
Score = 292, Expect = 3.3e-25, Identities = 65/160 (40%), Positives = 102/160 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK------DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVL++PEIP+NTGNI+RTCV   + LH+I+P GF +N+K+++RAGLDYW  L  + +D + +F              + K+ +K+I   T       DE++  E  F +FGRE+ G+  E+  ++  F++ + + S+ RS NLSN+VAIVA+       F ++K
  S:    12 LNIVLYEPEIPQNTGNIARTCVLTGSKLHLIKPLGFEINEKQVRRAGLDYWKDLDLEIHDSYEEF--------------LKKYGEKTIYLSTTHGETHFDEISFKEGDFIMFGRESSGVPEEVHNRHIGFRVPM-IKSSTRSLNLSNTVAIVAYEALRQIGFPNMK 162
>gi|114567616|ref|YP_754770.1| rRNA methylase (SpoU class) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338551|gb|ABI69399.1| rRNA methylase (SpoU class) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (152 aa)
Score = 290, Expect = 5.2e-25, Identities = 59/148 (39%), Positives = 87/148 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + IVL +PEIP+NTGNI+RTC      LH+++P GF L D+ +KRAGLDYWD +   E   W  F      N  +  +L T  A ++       +++  ++ + VFGRE+ GL   I++ +   Q++I M    RS NLSNSVAI+ +
  S:     1 MQIVLVEPEIPQNTGNIARTCALTKTALHLVKPLGFSLADRFLKRAGLDYWDKV---EVQLWESFGDLLEANPGAAFYLATTRAGQAYH-----QVSYPQDSWLVFGRESSGLPISILKSFPDTQIRIPMQDIGRSLNLSNSVAIILY 140
>gi|56963235|ref|YP_174966.1| rRNA methylase [Bacillus clausii KSM-K16] >gi|56909478|dbj|BAD64005.1| rRNA methylase [Bacillus clausii KSM-K16] (157 aa)
Score = 290, Expect = 6.2e-25, Identities = 65/148 (43%), Positives = 87/148 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+IVL+QPEIP NTGNI+RTC G NATLH+IRP GF   D+ +KRAG DYW ++    YD   + FE+          + I     K  ++   D    + + FFVFG+ET GL + + E   +  L+I     IRS NLSN+ AIV +
  S:     3 LHIVLYQPEIPANTGNIARTCAGTNATLHLIRPLGFSTEDRMLKRAGCDYWPNVTIHYYDSIEELFETY----PEGLFYYIETVGSKPYTDF--DFRNTEVDHFFVFGKETTGLPNHLTEANTERCLRIPQTDLIRSLNLSNTAAIVLY 145
>gi|116690871|ref|YP_836494.1| RNA methyltransferase [Burkholderia cenocepacia HI2424] >gi|116648960|gb|ABK09601.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia cenocepacia HI2424] (172 aa)
Score = 288, Expect = 9.0e-25, Identities = 62/149 (41%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  PEIP NTGN+ R C    A LH+I P GF L+D RM+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D +   L+ D        +FVFG ET+GL +E++E++   Q +++ M  + RS NLSN+VA+V F
  S:    17 MFNVVLVAPEIPPNTGNVIRLCANTGAHLHLIEPLGFPLDDARMRRAGLDYHEYAQMRVHRDWDAFVAAETPDP-ARMFAFTTRGSGRFHDHAF--LSGD--------WFVFGSETRGLPAELLERFPNEQRVRLPMRPDNRSLNLSNTVAVVVF 160
>gi|85373106|ref|YP_457168.1| putative RNA methylase [Erythrobacter litoralis HTCC2594] >gi|84786189|gb|ABC62371.1| putative RNA methylase [Erythrobacter litoralis HTCC2594] (152 aa)
Score = 288, Expect = 9.2e-25, Identities = 60/150 (40%), Positives = 90/150 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSN-IRSFNLSNSVAIVAFH 150
           M  IVL  PEIP NTG + RTCV  +  L +I P GF ++DKR+KR+GLDYW H++  E   W  F ++    +  ++FL  ++A +S     + +  KD   + VFGRETKGL   I+  ++   + + M S+ +RS NL+N+VA  A+ 
  S:     1 MTAIVLVHPEIPGNTGAVGRTCVALDMELVLIHPLGFAIDDKRVKRSGLDYWPHIRLVECASWDAFLAER-APRADQLFLFEEYAPRS---FYEPDYPKDA--YLVFGRETKGLPQGIVAAHRAQMVSLPMRSDKVRSLNLANTVAAAAYQ 145
>gi|13357828|ref|NP_078102.1| rRNA methylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971944|ref|ZP_02554221.1| rRNA methylase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282436|ref|ZP_02690103.1| rRNA methylase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308590|ref|ZP_02691265.1| rRNA methylase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762254|ref|YP_001752351.1| rRNA methylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11357050|pir||F82913 rRNA methylase UU268 [imported] - Ureaplasma urealyticum >gi|6899239|gb|AAF30677.1|AE002123_10 rRNA methylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827831|gb|ACA33093.1| rRNA methylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902611|gb|EDT48900.1| rRNA methylase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675800|gb|EDT87705.1| rRNA methylase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700642|gb|EDU18924.1| rRNA methylase [Ureaplasma parvum serovar 6 str. ATCC 27818] (172 aa)
Score = 288, Expect = 9.8e-25, Identities = 64/160 (40%), Positives = 106/160 (66%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMK----RAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           MLNIVLF+PEI  NTGNI+R CVGF+A LH++RP+GFIL+ KR      RA  ++ + LK  EYDD+++F ++N ++ + +++  T++  K+  +     + +   ++ VFG+E+ G+   I++KY    ++I  + N+RS N++NSVA+  +      NF DL
  S:     1 MLNIVLFEPEIILNTGNIARMCVGFDANLHLVRPYGFILDKKRFHKDFIRASTNHLNALKLYEYDDFNEFINKNNISGD-EIYFFTRYGTKTPCDYQYQNIIQ-HNVYLVFGKESTGIDHNILKKYPHNWIRIPTSINLRSLNIANSVAMGIYEVVRQNNFKDL 162
>gi|81428093|ref|YP_395092.1| putative rRNA methyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|78609734|emb|CAI54780.1| Putative rRNA methyltransferase [Lactobacillus sakei subsp. sakei 23K] (169 aa)
Score = 288, Expect = 1.1e-24, Identities = 62/147 (42%), Positives = 90/147 (61%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +IVL++P IP NTGNI+RTC G +  L +I P GF  +DK +KRAGLDYWD +K   + +   F     V     ++LITKFA ++ S+    + + D   +F+FG+ET GL    M + +   L+I M+ +IR+ NLSN  A+V F
  S:     4 HIVLYEPLIPANTGNIARTCAGTDTVLDLIEPLGFETDDKHLKRAGLDYWDQVKINYHKNLDAF--LETVPDRKHLYLITKFAKQAYSDQDVTDTSVDH--YFMFGKETTGLPETFMRENEDQCLRIPMSDHIRALNLSNCAALVIF 146
>gi|78067649|ref|YP_370418.1| RNA methyltransferase TrmH, group 2 [Burkholderia sp. 383] >gi|77968394|gb|ABB09774.1| RNA methyltransferase TrmH, group 2 [Burkholderia sp. 383] (156 aa)
Score = 286, Expect = 1.6e-24, Identities = 62/149 (41%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  PEIP NTGN+ R C    A LH+I P GF L+D RM+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D +   L  D        +FVFG ET+GL +E++E++   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVVLVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDARMRRAGLDYHEYAQMRVHRDWDAFVAAETPDP-ARMFAFTTRGSGRFHDHAF--LPGD--------WFVFGSETRGLPAELLERFPNEQRVRLPMRPDNRSLNLSNTVAVVVF 144
>gi|125624162|ref|YP_001032645.1| putative rRNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363] >gi|124492970|emb|CAL97933.1| putative rRNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363] (196 aa)
Score = 286, Expect = 1.6e-24, Identities = 61/149 (40%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           M +I LF+P I  NTGNI+RTC   N  LH+I PFGF ++DK +KRAGLDYWD +    + +  DF   N +    +++L++KFA+   S++   +  KD   +F+FGRE  GL  E M +++   ++I MN  ++RS NLSN   ++ +
  S:    28 MNHIALFEPRIHFNTGNIARTCAATNTVLHLIEPFGFEISDKHLKRAGLDYWDKVNIVYHKNLQDF--MNSIADGGQLYLVSKFAEHVYSDVDYSDDKKDH--YFLFGREDTGLPEEFMHEHRDECIRIPMNDEHVRSLNLSNCACMIVY 173
>gi|94265230|ref|ZP_01288990.1| tRNA/rRNA methyltransferase (SpoU) [delta proteobacterium MLMS-1] >gi|94272199|ref|ZP_01292086.1| tRNA/rRNA methyltransferase (SpoU) [delta proteobacterium MLMS-1] >gi|93450204|gb|EAT01499.1| tRNA/rRNA methyltransferase (SpoU) [delta proteobacterium MLMS-1] >gi|93454264|gb|EAT04577.1| tRNA/rRNA methyltransferase (SpoU) [delta proteobacterium MLMS-1] (153 aa)
Score = 286, Expect = 1.6e-24, Identities = 61/148 (41%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
            N+VL +PEIP NTG+I+R C   +  LH++ P GF  +DK +KRAGLDYW H++      WS+ E        ++++ ++K   K+    T    T  +  F +FGRETKGL +EI+E Y    L I M N +IRS NL+ + AIV +
  S:     6 FNVVLVEPEIPPNTGSIARLCGATDTVLHLVHPLGFDTDDKHLKRAGLDYWQHVRIVH---WSNLEEFLAAQDENRLYFLSK---KTQRPYTAISFTPGD--FLIFGRETKGLPAEILELYADRCLLIPMSNPHIRSLNLAQAAAIVLY 146
>gi|89256878|ref|YP_514240.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica] >gi|115315257|ref|YP_763980.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|156503053|ref|YP_001429118.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|89144709|emb|CAJ80040.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica LVS] >gi|115130156|gb|ABI83343.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|134253963|gb|EBA53057.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica 257] >gi|156253656|gb|ABU62162.1| RNA methyltransferase, TrmH family protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122711|gb|EDO66840.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. holarctica FSC022] (155 aa)
Score = 286, Expect = 1.8e-24, Identities = 62/149 (41%), Positives = 95/149 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M++I L++PEIP NTGNI R C    A LH+I  FGF L DK+++RAGLDY +    K Y ++++F  Q   NK+ +++  T  A +    +   + + D+    +FG ET+GL ++++E  K+ QLKI M+ N RS NLSNSVA++ +
  S:     1 MISIALYEPEIPPNTGNIIRLCANVGAKLHLIELFGFKLEDKQLRRAGLDYHEFADLKIYKNFAEFYQQ---NKDKQIWACTTKAKQYYHQV---DFSCDD--ILLFGPETRGLPADVLELLKQTQLKIPMHKNSRSLNLSNSVAVILY 141
>gi|23098542|ref|NP_692008.1| rRNA methylase [Oceanobacillus iheyensis HTE831] >gi|22776768|dbj|BAC13043.1| rRNA methylase [Oceanobacillus iheyensis HTE831] (157 aa)
Score = 286, Expect = 1.8e-24, Identities = 58/148 (39%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +++VLF+PEIP NTGNI RTC+    TLH+I P GF  + K ++RAGLDYW+H+  +EY    D         ++  + I  F  K  ++    +   D+  FFVFG+E+ G+  E++   +   L+I MN  +RS NLSN+ AI+ +
  S:     3 VHVVLFEPEIPANTGNIGRTCLATGVTLHLIHPLGFSTDSKMVRRAGLDYWEHVDVREYQSIEDLYE---TYPDAGFYYIENFGTKHYTDFDFSDSDMDQ--FFVFGKESTGIPKELLIGKEDQCLRIHMNDKVRSLNLSNTSAIIIY 145
>gi|170734196|ref|YP_001766143.1| RNA methyltransferase [Burkholderia cenocepacia MC0-3] >gi|194558109|ref|YP_002093135.1| RNA methyltransferase, TrmH family [Burkholderia cenocepacia PC184] >gi|124871900|gb|EAY63616.1| RNA methyltransferase, TrmH family [Burkholderia cenocepacia PC184] >gi|169817438|gb|ACA92021.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia cenocepacia MC0-3] (156 aa)
Score = 286, Expect = 1.9e-24, Identities = 62/149 (41%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  PEIP NTGN+ R C    A LH+I P GF L+D RM+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D +   L  D        +FVFG ET+GL +E++E++   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVVLVAPEIPPNTGNVIRLCANTGAHLHLIEPLGFPLDDARMRRAGLDYHEYAQMRVHRDWDAFVAAETPDP-ARMFAFTTRGSGRFHDHAF--LPGD--------WFVFGSETRGLPAELLERFPNEQRVRLPMRPDNRSLNLSNTVAVVVF 144
>gi|116512002|ref|YP_809218.1| rRNA methylase (SpoU class) [Lactococcus lactis subsp. cremoris SK11] >gi|116107656|gb|ABJ72796.1| Predicted rRNA methylase (SpoU class) [Lactococcus lactis subsp. cremoris SK11] (169 aa)
Score = 285, Expect = 2.0e-24, Identities = 60/149 (40%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           M +I LF+P I  NTGNI+RTC   N  LH+I PFGF ++DK +KRAGLDYWD +    + +  DF   + +    +++L++KFA+   S++   +  KD   +F+FGRE  GL  E M +++   ++I MN  ++RS NLSN   ++ +
  S:     1 MNHIALFEPRIHFNTGNIARTCAATNTVLHLIEPFGFEISDKHLKRAGLDYWDKVNIVYHKNLQDF--MDSIADGGQLYLVSKFAEHVYSDVDYSDDEKDH--YFLFGREDTGLPEEFMHEHRDECIRIPMNDEHVRSLNLSNCACMIVY 146
>gi|161523632|ref|YP_001578644.1| RNA methyltransferase [Burkholderia multivorans ATCC 17616] >gi|189351599|ref|YP_001947227.1| TrmH family RNA methyltransferase [Burkholderia multivorans ATCC 17616] >gi|160341061|gb|ABX14147.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia multivorans ATCC 17616] >gi|189335621|dbj|BAG44691.1| TrmH family RNA methyltransferase [Burkholderia multivorans ATCC 17616] (156 aa)
Score = 283, Expect = 3.3e-24, Identities = 61/149 (40%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D++   L  D        +FVFG ET+GL +E++E++   Q +++ M    RS NLSN+VA+V F
  S:     1 MFNVVLVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAESPDP-ARIFAFTTRGSSRFHDRAF--LPGD--------WFVFGSETRGLPAELLERFPAEQRVRLPMRPGNRSMNLSNTVAVVVF 144
>gi|69249442|ref|ZP_00604978.1| RNA methyltransferase TrmH, group 2 [Enterococcus faecium DO] >gi|68194153|gb|EAN08686.1| RNA methyltransferase TrmH, group 2 [Enterococcus faecium DO] (167 aa)
Score = 283, Expect = 3.3e-24, Identities = 66/149 (44%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           M +IVLF+P IP NTGNI+RTC   N  LH+I P GF  +DK +KRAGLDYW+ +    +   S+ E+      N K+ LI+KFA K  S+   +     EE FF+FG+ET GL    M + ++  L+I MN  ++RS NLSN+ A++ +
  S:     1 MNHIVLFEPLIPANTGNIARTCAATNTPLHLIEPLGFSTDDKHLKRAGLDYWNDVNITYH---SNLEAFLTFLGNRKLHLISKFAHKVYSD---ENFADGEEHFFLFGKETTGLPETFMRENEEKCLRIPMNDEHVRSLNLSNTAAMIVY 144
>gi|42521894|ref|NP_967274.1| rRNA methyltransferase [Bdellovibrio bacteriovorus HD100] >gi|39574424|emb|CAE77928.1| rRNA methyltransferase [Bdellovibrio bacteriovorus HD100] (160 aa)
Score = 283, Expect = 3.5e-24, Identities = 64/149 (42%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHL---KRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           +  IVL +PEIP+NTGNI RTCVG N  LH++   GF +ND  +KRAGLDYW HL   + + ++DW        V   S+++L T    +     T  E       +FVFG+ETKGL  E ++K+ +  + I M     RS NL+ SVAI A+
  S:     7 LFRIVLIEPEIPQNTGNIGRTCVGTNCELHIVGKMGFEINDTNLKRAGLDYWPHLTWYRHETFEDWWKH-----VEDPSRIWLFTTKTQR-----TYFEPQYQSGDWFVFGKETKGLDPEFLQKHPQQTVTIPMIGEGARSLNLATSVAIAAY 149
>gi|194562322|ref|YP_002097345.1| RNA methyltransferase TrmH [Burkholderia dolosa AUO158] >gi|124893946|gb|EAY67826.1| RNA methyltransferase TrmH [Burkholderia dolosa AUO158] (156 aa)
Score = 282, Expect = 4.4e-24, Identities = 61/149 (40%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D++   L  D        +FVFG ET+GL +E++E++   Q +++ M    RS NLSN+VA+V F
  S:     1 MFNVVLVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHGDWDAFVAAEAPDP-ARMFAFTTRGSGRFHDRAF--LPGD--------WFVFGSETRGLPAELLERFPGEQRVRLPMRPGNRSLNLSNTVAVVVF 144
>gi|29377148|ref|NP_816302.1| RNA methyltransferase [Enterococcus faecalis V583] >gi|29344614|gb|AAO82372.1| RNA methyltransferase, TrmH family [Enterococcus faecalis V583] (168 aa)
Score = 282, Expect = 4.6e-24, Identities = 62/159 (38%), Positives = 98/159 (61%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +IVLF+P+IP NTGNI+RTC   N  LH+I P GF  +DK +KRAGLDYW+ +    + D + F +         + L+TKFA ++ S +  ++    E+ +F+FG+ET GL    M + ++  ++I MN  ++RS NLSN+ A++ +      NF +L+
  S:     4 HIVLFEPQIPANTGNIARTCAATNTPLHLIEPLGFSTDDKHLKRAGLDYWNDVNITYHKDSAAFLAH---VAGKHLHLVTKFAHQTYSEVNYND---GEDHYFLFGKETTGLPETFMRENEEKCIRIPMNDEHVRSLNLSNTAALIVYEALRQQNFPNLE 157
>gi|149179294|ref|ZP_01857856.1| spoU rRNA Methylase family protein [Planctomyces maris DSM 8797] >gi|148841868|gb|EDL56269.1| spoU rRNA Methylase family protein [Planctomyces maris DSM 8797] (158 aa)
Score = 282, Expect = 4.8e-24, Identities = 56/149 (37%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ++++VL+QP+IP+NTGNI RTCV   A L ++RP GF L+ K ++RAG+DYW HL  +  D  ++ +SQ    ++   + +TKFA + + +    EL   +   F+FG E+ GL   I+E+     LK+ M+  +RS NL+++   V +
  S:     8 LIHVVLYQPDIPQNTGNIGRTCVAVGAKLWLVRPLGFQLDAKHLRRAGMDYWQHLNWEAVDSLAEVQSQ---LQDRTWWKLTKFATRYVWDA---ELEPGQ--VFLFGSESNGLPPRILEEDPDSNLKLPMHQEVRSLNLASTATAVMY 148
>gi|15618570|ref|NP_224856.1| rRNA methylase [Chlamydophila pneumoniae CWL029] >gi|15836192|ref|NP_300716.1| rRNA methylase [Chlamydophila pneumoniae J138] >gi|16752380|ref|NP_444639.1| spoU rRNA methylase family protein [Chlamydophila pneumoniae AR39] >gi|33242017|ref|NP_876958.1| putative rRNA methylase [Chlamydophila pneumoniae TW-183] >gi|4376959|gb|AAD18799.1| rRNA Methylase [Chlamydophila pneumoniae CWL029] >gi|8163363|gb|AAF73627.1| spoU rRNA methylase family protein [Chlamydophila pneumoniae AR39] >gi|8979032|dbj|BAA98867.1| rRNA methylase [Chlamydophila pneumoniae J138] >gi|33236527|gb|AAP98615.1| putative rRNA methylase [Chlamydophila pneumoniae TW-183] (156 aa)
Score = 282, Expect = 4.8e-24, Identities = 64/148 (43%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + +VL  P+IP+NTGNI RTCV   A L ++RP GF L DK +KRAG+DYWD L+    D  S  E+ + V ++    L TK       + +  E +      +VFG E+KGL  EI++KY K  L+I M  +IRS NL+ SV IV +
  S:     1 MRVVLHCPDIPQNTGNIGRTCVALGAELILVRPLGFSLADKFVKRAGMDYWDKLQLTVVD--SIEEALHDVPEDQIFCLSTK------GSASYTEFSLPSSGTYVFGSESKGLPKEILKKYYKNCLRIPMQQDIRSLNLATSVGIVLY 140
>gi|87120919|ref|ZP_01076811.1| putative tRNA/rRNA methyltransferase [Marinomonas sp. MED121] >gi|86163757|gb|EAQ65030.1| putative tRNA/rRNA methyltransferase [Marinomonas sp. MED121] (157 aa)
Score = 282, Expect = 4.8e-24, Identities = 65/149 (43%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL+QPEIP NTGN+ R C      LH+I P GF L++K+++RAGLDY +  + K + DW  F +SQ +     KV+ +T    K  S     E   +     VFG ET+GL  E +E     Q L++ M  N RS NLSN+VAI+ +
  S:     1 MLNIVLYQPEIPPNTGNVIRLCANTGYKLHLIEPLGFDLDEKKVRRAGLDYHELARVKRHKDWQAFVDSQEI----GKVYALTTKGSKVPS-----EAKFEANDVLVFGPETRGLPIEFIEALPAEQRLRLPMQPNSRSLNLSNTVAIMVY 142
>gi|145590122|ref|YP_001156719.1| RNA methyltransferase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048528|gb|ABP35155.1| RNA methyltransferase, TrmH family, group 2 [Polynucleobacter sp. QLW-P1DMWA-1] (156 aa)
Score = 281, Expect = 5.9e-24, Identities = 63/149 (42%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF-QLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVLF+PEIP NTGNI R C    A LH+I P GF + D +++RAGLDY +    K + +W  F      +      L TK + K      + + T ++  +FVFG ETKG+T E+     K  Q+++ M  N RS NLSN+VAIV +
  S:     1 MFNIVLFEPEIPPNTGNIIRLCANTGAKLHLIEPLGFPMEDAKLRRAGLDYHEFASIKVHPNWGHFLETEKPDPQHLFTLTTKGSGK----FHEGKYTPND--YFVFGSETKGITEEVRNSIPKMNQMRLAMQDNSRSLNLSNTVAIVVY 144
>gi|71894579|ref|YP_278687.1| putative tRNA/rRNA methyltransferase [Mycoplasma synoviae 53] >gi|71851367|gb|AAZ43976.1| putative tRNA/rRNA methyltransferase [Mycoplasma synoviae 53] (178 aa)
Score = 281, Expect = 6.1e-24, Identities = 68/160 (42%), Positives = 98/160 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLD-YWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           MLNIVL+QPEI  NT NI R+C    A LH+I+P GF L+ K  KRA        ++ + +D + DF ++    KN+ VF IT++  KS   +  K+E +KD+ IFF+FGRE+ G+  EI++      L+I M S +RS NL+N+V IV F +    N+  L
  S:     1 MLNIVLYQPEISPNTANIIRSCYALGAKLHIIKPLGFDLHPKYFKRAAAGRLLSDIRHEVHDSYLDFYNK---YKNANVFYITRYGLKSYDKVDFKNEYSKDKNIFFMFGRESTGIDKEILKNNIDKCLRIPMVSKMRSINLANTVCIVGFEFMRQMNWEGL 159
>gi|83319378|ref|YP_424348.1| RNA methyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283264|gb|ABC01196.1| RNA methyltransferase, TrmH family [Mycoplasma capricolum subsp. capricolum ATCC 27343] (181 aa)
Score = 278, Expect = 1.6e-23, Identities = 52/148 (35%), Positives = 94/148 (63%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +NIVL+QPEI +N G I RTCV  NA LH+I P GFI +D+ + R+  + + ++    YDDW+DF ++   ++N  +F ++++  K IS+    ++  ++ ++ VFG+E+ G+   I++++     +I M S  RS N++N+V I ++
  S:     6 INIVLYQPEIAQNVGAIMRTCVAINARLHIIEPLGFIFDDRHLSRSSANEYKYVDCIRYDDWNDFITK---HQNITLFCLSRYGQKPISDFDFSKI--NDNVYLVFGKESTGIAKPILKEHYNTTFRIPMISETRSLNIANTVGIASY 148
>gi|116334061|ref|YP_795588.1| rRNA methylase (SpoU class) [Lactobacillus brevis ATCC 367] >gi|116099408|gb|ABJ64557.1| Predicted rRNA methylase (SpoU class) [Lactobacillus brevis ATCC 367] (170 aa)
Score = 277, Expect = 1.6e-23, Identities = 56/147 (38%), Positives = 96/147 (65%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKI-EMNSNIRSFNLSNSVAIVAF 149
           +I LF+P  P NTGNI+RTC G +  L +I+P GF ++D  +KRAGLDYWD +  + +++   F   + ++  S+++L++KFAD+  +    D    + + +F+FG+ET GL    M ++ +  ++I + +++IR+ NLSNS AIV +
  S:     4 HIALFEPLFPANTGNIARTCAGTDTILDLIKPLGFSVDDAHLKRAGLDYWDKVDVRYHENLPAF--LDTISDLSQLYLVSKFADQDYTE--PDYQVNEHDHYFLFGKETTGLPEPFMRQHAEKCIRIPQDDTHIRALNLSNSAAIVIY 147
>gi|37528643|ref|NP_931988.1| hypothetical protein plu4834 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36788082|emb|CAE17206.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] (162 aa)
Score = 277, Expect = 1.8e-23, Identities = 65/149 (43%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNS-KVFLITKF---ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K++ D+  F E++ L   +S ++F +T     A  ++S    D        + +FG ET+GL   +++     Q ++I M +N RS NLSNSVA+V F
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFQLHLIQPLGFTWDDKRLRRAGLDYHEFANIKQHHDYFAFLENEGLTGASSARLFALTTKGTPAHSAVSYQAGD--------YLMFGPETRGLPPYVLDNMPPQQKIRIPMLANSRSMNLSNSVAVVVF 147
>gi|148324023|gb|EDK89273.1| tRNA methylase SpoU [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (150 aa)
Score = 277, Expect = 2.0e-23, Identities = 62/157 (39%), Positives = 91/157 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           +NIVL+QPEIP NTGNI R+CV  N TLH+I+P GF L++K++KRAG+DYW  +  K    W  FE     NK  ++F  T    +  S     ++   E+ + +FG E++G+  +I+ K  +  + I M    RS NLSNS  I+ +  +    FN
  S:     1 MNIVLYQPEIPYNTGNIGRSCVLTNTTLHLIKPLGFSLDEKQVKRAGMDYWHLVDLKV---WESFEEFLEANKGIRIFYATTKTKQKYS-----DVKYKEDDYIMFGPESRGIPEDILNKNSERCITIPMIPMGRSLNLSNSAVIILYEAYRQLGFN 149
>gi|153955993|ref|YP_001396758.1| hypothetical protein CKL_3384 [Clostridium kluyveri DSM 555] >gi|146348851|gb|EDK35387.1| Hypothetical protein CKL_3384 [Clostridium kluyveri DSM 555] (155 aa)
Score = 277, Expect = 2.0e-23, Identities = 65/160 (40%), Positives = 96/160 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           LNIVLF+PEIP+NTGNI+RTCV   + LH+I+P GF L++K ++RAGLDYW +L    YD + +   +    KN   +  T        N  +    KDE+ F VFG+E+ GL  +I +   +  +++ M  +  RS NLSN+VAIV +      +F ++K
  S:     3 LNIVLFEPEIPQNTGNIARTCVLTGSRLHLIKPLGFSLDEKHLRRAGLDYWKYLDLTLYDCYEELRER---YKNGTFYFSTTHG----KNFYQHAKFKDED-FIVFGKESCGLPDKIRDSNPEKNIRLPMIKTTTRSLNLSNAVAIVVYEALRQLDFPNMK 155
>gi|83719588|ref|YP_440980.1| RNA methyltransferase [Burkholderia thailandensis E264] >gi|167617773|ref|ZP_02386404.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia thailandensis Bt4] >gi|83653413|gb|ABC37476.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia thailandensis E264] (156 aa)
Score = 276, Expect = 2.2e-23, Identities = 59/149 (39%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ +   + DW  F +    +  ++ F  T     +F D++           +   +FVFG ET+GLT  ++E++   Q +++ M    RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMHVHRDWDAFVAAEAPDP-ARTFAFTTRGSGRFHDRAF----------EPGDWFVFGSETRGLTPALVERFAPEQRVRLPMRPGNRSLNLSNTVAVVVF 144
>gi|150385370|ref|ZP_01924005.1| tRNA/rRNA methyltransferase (SpoU) [Victivallis vadensis ATCC BAA-548] >gi|150258235|gb|EDM95520.1| tRNA/rRNA methyltransferase (SpoU) [Victivallis vadensis ATCC BAA-548] (157 aa)
Score = 276, Expect = 2.3e-23, Identities = 60/148 (40%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNI-RSFNLSNSVAIVAF 149
            NIVL  PEIP+NTG I R CV     LH++RP GF L DK +KRAG+DYW HL    Y++W +F     + KN +  L+  F          D   +  + + VFGRE+ GL  E  ++Y+    +I MN    RS NL+N+ +IV +
  S:     4 FNIVLVAPEIPQNTGTIGRLCVSTETRLHLVRPLGFSLEDKYVKRAGMDYWPHLDLTIYENWEEF-----LKKNPEANLL--FISTKGETCFWDAQYRPGD-YLVFGRESSGLPPEFYDRYRSRLYRIPMNGRFHRSLNLANAASIVLY 144
>gi|83644213|ref|YP_432648.1| rRNA methylase (SpoU class) [Hahella chejuensis KCTC 2396] >gi|83632256|gb|ABC28223.1| predicted rRNA methylase (SpoU class) [Hahella chejuensis KCTC 2396] (154 aa)
Score = 276, Expect = 2.5e-23, Identities = 62/149 (41%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLFQPEIP NTGNI R C     TLH+I P GF  +DKR++RAGLDY ++   K + D+  F  +   NK   +    K     +S    D L        VFG ET+GL  +++++   +  L++ M  + RS NLSN+VA+V++
  S:     1 MLNIVLFQPEIPPNTGNIIRLCANCGFTLHLIEPLGFTWDDKRLQRAGLDYHEYAPVKRHGDFQQFLDEVRPNKVYALSTRGKSYYHEVSFAAGDAL--------VFGPETRGLPQQMLDELGSESCLRVPMRQDSRSLNLSNTVALVSY 142
>gi|563845|emb|CAA86559.1| unnamed protein product [Bacillus circulans subsp. alkalophilus] (144 aa)
Score = 276, Expect = 2.6e-23, Identities = 61/148 (41%), Positives = 84/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+IVL +PEIP NTGNI+RTC      LH++RP GF  +DK +KRAGLDYW +    EY D   FE         + F  +  A K   ++      +D + F VFG+ETKGL  E++       +++ M   +RS NLSNS AI+ +
  S:     3 LHIVLVEPEIPANTGNIARTCAATGTHLHLVRPLGFNTDDKTLKRAGLDYW-YAVHIEYHD--SFEELQQKYPEGRFFYTSTKATKRYCDIA----FQDGD-FLVFGKETKGLPPELLAANPDSCIRMPMTDKVRSLNLSNSAAIIVY 142
>gi|73540016|ref|YP_294536.1| RNA methyltransferase TrmH, group 2 [Ralstonia eutropha JMP134] >gi|72117429|gb|AAZ59692.1| RNA methyltransferase TrmH, group 2 [Ralstonia eutropha JMP134] (156 aa)
Score = 275, Expect = 3.0e-23, Identities = 57/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL +PEIP NTGN+ R C    A LH+++P GF L D RM+RAGLDY ++   + +D W    +    +  S++F +T             +++     +FVFG ET+GL  E  E +   Q +++ M  N RS NLSN+VA+V F
  S:     1 MFHVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLEDARMRRAGLDYHEYATMRVHDSWDALMASEQPDP-SRMFALTTHGSTPFG-----QVSFQPGDWFVFGSETRGLAPERRESFPPSQRIRLPMRPNNRSLNLSNTVAVVVF 144
>gi|46200254|ref|YP_005921.1| RNA methyltransferase, putative [Thermus thermophilus HB27] >gi|55980023|ref|YP_143320.1| RNA methyltransferase [Thermus thermophilus HB8] >gi|46197882|gb|AAS82294.1| RNA methyltransferase, putative [Thermus thermophilus HB27] >gi|55771436|dbj|BAD69877.1| RNA methyltransferase [Thermus thermophilus HB8] (149 aa)
Score = 275, Expect = 3.3e-23, Identities = 57/155 (36%), Positives = 93/155 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFH-YHFLT 155
           ML++VL+QPEIP+N GN++RT       LH+IRP GF+L+  ++KRAGLDYW H+  + +D ++ F     + + ++VF  +   + S+      E    E  + +FG E++GL  E++ ++    LKI M   +RS NL+ +V + A+  Y  LT
  S:     1 MLHLVLYQPEIPQNAGNVARTAAALGWPLHLIRPLGFLLSSPKLKRAGLDYWPHVDLRLHDSFAAFLEA--LPRGARVFAFSARGEASLY-----EARFREGDYLLFGPESRGLPEEVLARFPT--LKIPMPGPVRSLNLAVAVGVAAYEAYRQLT 147
>gi|48428734|gb|AAT42383.1| putative rRNA methylase [Collimonas fungivorans] (160 aa)
Score = 275, Expect = 3.4e-23, Identities = 60/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKN---SKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL +PEIP NTGNI R C    A LH+I P GF L+D +M+RAGLDY D+   + + DW+DF +      +   S++F +T       ++L      +  +I FVFG ET+GL   + E +   Q +++ M  + RS NLSN+VA+V +
  S:     1 MFHVVLVEPEIPPNTGNIIRLCANTGAQLHLIEPLGFPLDDSKMRRAGLDYHDYATMQVHADWNDFVASMRDAGSYDPSRMFAMTTHGSTPFASLQ----FRPGDI-FVFGSETRGLDPALRESFAPSQRIRLPMRPDNRSLNLSNTVAVVVY 148
>gi|19704144|ref|NP_603706.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714356|gb|AAL95005.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (150 aa)
Score = 275, Expect = 3.4e-23, Identities = 62/157 (39%), Positives = 91/157 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           +NIVL+QPEIP NTGNI R+CV  N TLH+I+P GF L++K++KRAG+DYW  +  K    W  FE     NK  ++F  T    +  S     ++  +E  + +FG E++G+  +I+ K  +  + I M    RS NLSNS  I+ +  +    FN
  S:     1 MNIVLYQPEIPYNTGNIGRSCVLTNTTLHLIKPLGFSLDEKQVKRAGMDYWHLVDLK---IWESFEEFLEANKGIRLFYATTKTKQRYS-----DVKYEENDYIMFGPESRGIPEDILNKNPERCITIPMIPMGRSLNLSNSAVIILYEAYRQLGFN 149
>gi|160932290|ref|ZP_02079681.1| hypothetical protein CLOLEP_01125 [Clostridium leptum DSM 753] >gi|156868892|gb|EDO62264.1| hypothetical protein CLOLEP_01125 [Clostridium leptum DSM 753] (168 aa)
Score = 274, Expect = 3.7e-23, Identities = 57/145 (39%), Positives = 86/145 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           LNIV+ +PEIP+NTGN++RTC    A LH++ P GF ++DK++KRAGLDYW  L    Y++  +F  +   NK    +    F+ K+    T  +L   +  + +FG+ET GL  +++       ++I M    RS NLSNSVA+
  S:     4 LNIVMVEPEIPQNTGNVARTCAATGARLHLVGPMGFTIDDKKLKRAGLDYWHLLDITYYENLEEFFEK---NKGGNFYY---FSTKAPHRHT--DLAYPDNCYLLFGKETAGLPEKLLFDNPDTTVRIPMIDEARSLNLSNSVAV 140
>gi|134096081|ref|YP_001101156.1| putative tRNA/rRNA methyltransferase [Herminiimonas arsenicoxydans] >gi|133739984|emb|CAL63035.1| Putative RNA methyltransferase [Herminiimonas arsenicoxydans] (160 aa)
Score = 274, Expect = 3.7e-23, Identities = 60/149 (40%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWS----DFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL +PEIP NTGNI R C    A LH++ P GF L+D +M+RAGLDY D+ + K + DW      F +   +N  +++F +T       + L      +  +I FVFG ETKGL   + E +   Q +++ M  + RS NLSN+VA+V +
  S:     1 MFHVVLVEPEIPPNTGNIIRLCANTGAQLHLVEPLGFPLDDAKMRRAGLDYHDYAQMKVHHDWQAFLDSFPADQPLNP-ARMFALTTHGSTPFAGLA----FQPGDI-FVFGSETKGLAPALRESFPPVQRIRLPMRPDNRSLNLSNTVAVVVY 148
>gi|134297042|ref|YP_001120777.1| RNA methyltransferase [Burkholderia vietnamiensis G4] >gi|134140199|gb|ABO55942.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia vietnamiensis G4] (156 aa)
Score = 274, Expect = 3.7e-23, Identities = 60/149 (40%), Positives = 91/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D +   +  D        +FVFG ET+GL +E++E++   Q +++ M    RS NLSN+VA+V F
  S:     1 MFNVVLVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAEMRVHRDWDAFVAAESPDP-TRMFAFTTRGSGRFHDHAF--VPGD--------WFVFGSETRGLPAELLERFPGEQRVRLPMRPGNRSLNLSNTVAVVVF 144
>gi|42561144|ref|NP_975595.1| rRNA methylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492642|emb|CAE77237.1| rRNA Methylase (Spou-family) [Mycoplasma mycoides subsp. mycoides SC str. PG1] (181 aa)
Score = 274, Expect = 4.3e-23, Identities = 54/159 (33%), Positives = 96/159 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +NIVL++PEI +N G I RTCV  NA LH+I P GFI +D+ + R   + + ++    YDDW+DF ++   + N  +F ++++  K IS+    ++  ++ ++ VFG+E+ G+   I++++     +I M S  RS N++N+V I ++      N+ DL
  S:     6 INIVLYEPEIAQNVGAIMRTCVAINARLHIIEPLGFIFDDRHLSRPSANEYKYVDCIRYDDWNDFITK---HPNITLFCLSRYGQKPISDFDFSKI--NDNVYLVFGKESTGIAKPILKEHYNTTFRIPMISETRSLNIANTVGIASYEVLRQWNYLDL 159
>gi|53718088|ref|YP_107074.1| SpoU rRNA methylase family protein [Burkholderia pseudomallei K96243] >gi|167814039|ref|ZP_02445719.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 91] >gi|167901142|ref|ZP_02488347.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei NCTC 13177] >gi|194504644|ref|YP_002034216.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 1655] >gi|194515968|ref|YP_002051876.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei S13] >gi|52208502|emb|CAH34437.1| SpoU rRNA methylase family protein [Burkholderia pseudomallei K96243] >gi|169653201|gb|EDS85894.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei S13] >gi|184212481|gb|EDU09524.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 1655] (156 aa)
Score = 274, Expect = 4.3e-23, Identities = 58/149 (38%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D+S           +   +FVFG ET+GL   +++++   Q +++ M    RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAEAPDP-ARMFAFTTRGSGRFHDRSF----------EPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTVAVVVF 144
>gi|77977375|ref|ZP_00832825.1| COG0219: Predicted rRNA methylase (SpoU class) [Yersinia intermedia ATCC 29909] (165 aa)
Score = 274, Expect = 4.4e-23, Identities = 58/149 (38%), Positives = 94/149 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVN-KNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F + +NL + + +++F +T     + S      ++   + + +FG ET+GL + +++     Q ++I M ++ RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFASIKHHHDYQAFLDCENLDSAQPARLFALTTKGTPAHS-----AVSYQADDYLLFGPETRGLPASVLDALPAQQKIRIPMQADSRSMNLSNAVSVVVY 147
>gi|83746863|ref|ZP_00943910.1| 23S rRNA methyltransferase [Ralstonia solanacearum UW551] >gi|83726448|gb|EAP73579.1| 23S rRNA methyltransferase [Ralstonia solanacearum UW551] (156 aa)
Score = 273, Expect = 4.8e-23, Identities = 59/149 (39%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L D RM+RAGLDY ++   + + DW  F  ++     +++F +T       ++L           +FVFG ET+GL+ E  E +   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLIEPLGFPLEDARMRRAGLDYHEYATMRVHADWEAF-LRDAQPDPARMFALTTRGSTPFASLAFQPGD-----WFVFGSETRGLSEERREWFPPSQRIRLPMRPDNRSLNLSNTVAVVVF 144
>gi|152980476|ref|YP_001354860.1| RNA methyltransferase [Janthinobacterium sp. Marseille] >gi|151280553|gb|ABR88963.1| RNA methyltransferase, TrmH family, group 2 [Janthinobacterium sp. Marseille] (165 aa)
Score = 273, Expect = 5.2e-23, Identities = 59/157 (37%), Positives = 92/157 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDW----SDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           + ++VL +PEIP NTGNI R C    A LH++ P GF L+D +M+RAGLDY D+ + K + DW    + F ++  +N + ++F +T       +++            FVFG ETKGL + + E +   Q +++ M  + RS NLSN+VA+V +      NF
  S:     6 LFHVVLVEPEIPPNTGNIIRLCANTGAQLHLVEPLGFPLDDAKMRRAGLDYHDYAQMKVHADWQAFLNSFPAEQPLN-HERMFALTTHGSTPFASMAFQPGD-----VFVFGSETKGLETSLRESFPPSQRIRLPMRPDNRSLNLSNTVAVVVYEAWRQNNF 161
>gi|116491172|ref|YP_810716.1| rRNA methylase (SpoU class) [Oenococcus oeni PSU-1] >gi|118587352|ref|ZP_01544778.1| rRNA methyltransferase, SpoU family [Oenococcus oeni ATCC BAA-1163] >gi|116091897|gb|ABJ57051.1| Predicted rRNA methylase (SpoU class) [Oenococcus oeni PSU-1] >gi|118432176|gb|EAV38916.1| rRNA methyltransferase, SpoU family [Oenococcus oeni ATCC BAA-1163] (168 aa)
Score = 273, Expect = 5.3e-23, Identities = 65/161 (40%), Positives = 96/161 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           M +IVLF+P +P NTGNI+RT    NA LH+I+P GF L+DK++ RAGLDYW ++    +++  +F        N K+FL++K+A  S         + D+  +F+FG E  GL    M K  +  ++I  N  ++RS NLSNSVAIV +      NF+ L+
  S:     1 MNHIVLFEPSMPANTGNIARTATAINARLHLIKPLGFDLDDKKVIRAGLDYWSNVDLVIHENLPEFLK---TIGNGKLFLVSKYAKISYDQADFSNTSVDQ--YFLFGNEAYGLPEVFMRKNPEKAIRIPQNDQHVRSLNLSNSVAIVLYEAMRQQNFHGLE 157
>gi|115352957|ref|YP_774796.1| RNA methyltransferase [Burkholderia ambifaria AMMD] >gi|115282945|gb|ABI88462.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia ambifaria AMMD] (170 aa)
Score = 273, Expect = 5.8e-23, Identities = 58/149 (38%), Positives = 91/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N++L  PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D +   +  D        +FVFG ET+GL ++++E++   Q +++ M    RS NLSN+VA+V F
  S:    15 MFNVILVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAEMRVHRDWDAFVAAEAPDP-ARMFAFTTRGSGRFHDHAF--VPGD--------WFVFGSETRGLPADVLERFPNEQRVRLPMRPGNRSLNLSNTVAVVVF 158
>gi|153884621|ref|ZP_02005779.1| RNA methyltransferase, TrmH family, group 2 [Ralstonia pickettii 12D] >gi|151578506|gb|EDN42904.1| RNA methyltransferase, TrmH family, group 2 [Ralstonia pickettii 12D] (156 aa)
Score = 272, Expect = 7.3e-23, Identities = 58/149 (38%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L D RM+RAGLDY ++   + + DW  F  ++     +++F +T       +++           +FVFG ET+GL+ E  E +   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLIEPLGFPLEDARMRRAGLDYHEYATMRVHADWDAF-LRDAQPDPARMFALTTRGSTPFASMAFQPGD-----WFVFGSETRGLSEERREWFPATQRIRLPMRPDNRSLNLSNTVAVVVF 144
>gi|22123992|ref|NP_667415.1| hypothetical protein y0071 [Yersinia pestis KIM] >gi|21956733|gb|AAM83666.1|AE013608_1 hypothetical protein y0071 [Yersinia pestis KIM] (194 aa)
Score = 272, Expect = 7.5e-23, Identities = 61/149 (40%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNL-VNKNSKVFLITKF---ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+ L   + +++F +T     A  ++S    D        + +FG ET+GL + I++     Q ++I M ++ RS NLSN+V++V +
  S:    33 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFADIKHHHDYQAFLDSEKLDSTQPARLFALTTKGTPAHSAVSYQAND--------YLLFGPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVY 179
>gi|16120422|ref|NP_403735.1| putative methyltransferase [Yersinia pestis CO92] >gi|45439935|ref|NP_991474.1| putative methyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|108809463|ref|YP_653379.1| putative methyltransferase [Yersinia pestis Antiqua] >gi|108813940|ref|YP_649707.1| methyltransferase [Yersinia pestis Nepal516] >gi|145601075|ref|YP_001165151.1| methyltransferase [Yersinia pestis Pestoides F] >gi|150260867|ref|ZP_01917595.1| predicted rRNA methylase [Yersinia pestis CA88-4125] >gi|153949233|ref|YP_001399082.1| RNA methyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|162420361|ref|YP_001604714.1| RNA methyltransferase [Yersinia pestis Angola] >gi|165926204|ref|ZP_02222036.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936183|ref|ZP_02224752.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Orientalis str. IP275] >gi|166011519|ref|ZP_02232417.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213678|ref|ZP_02239713.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398819|ref|ZP_02304343.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419141|ref|ZP_02310894.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426653|ref|ZP_02318406.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468388|ref|ZP_02333092.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis FV-1] >gi|170026342|ref|YP_001722847.1| RNA methyltransferase [Yersinia pseudotuberculosis YPIII] >gi|45434790|gb|AAS60351.1| putative methyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|108777588|gb|ABG20107.1| methyltransferase [Yersinia pestis Nepal516] >gi|108781376|gb|ABG15434.1| putative methyltransferase [Yersinia pestis Antiqua] >gi|115345901|emb|CAL18760.1| putative methyltransferase [Yersinia pestis CO92] >gi|145212771|gb|ABP42178.1| methyltransferase [Yersinia pestis Pestoides F] >gi|149290275|gb|EDM40352.1| predicted rRNA methylase [Yersinia pestis CA88-4125] >gi|152960728|gb|ABS48189.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pseudotuberculosis IP 31758] >gi|162353176|gb|ABX87124.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis Angola] >gi|165915797|gb|EDR34405.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Orientalis str. IP275] >gi|165922064|gb|EDR39241.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989665|gb|EDR41966.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205080|gb|EDR49560.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963135|gb|EDR59156.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051323|gb|EDR62731.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054342|gb|EDR64159.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752876|gb|ACA70394.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pseudotuberculosis YPIII] (162 aa)
Score = 272, Expect = 7.5e-23, Identities = 61/149 (40%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNL-VNKNSKVFLITKF---ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+ L   + +++F +T     A  ++S    D        + +FG ET+GL + I++     Q ++I M ++ RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFADIKHHHDYQAFLDSEKLDSTQPARLFALTTKGTPAHSAVSYQAND--------YLLFGPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVY 147
>gi|189425147|ref|YP_001952324.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter lovleyi SZ] >gi|189421406|gb|ACD95804.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter lovleyi SZ] (154 aa)
Score = 272, Expect = 7.5e-23, Identities = 58/148 (39%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            NIVL +PEIP NTGNI+R C    ATLH++   GF ++D+ +KRAGLDYWD +  K +++    + Q+   +    +L TK A     N  +  + +  + F VFG+ET GL +E++   ++  L I M   +RS NLSN+ A+V +
  S:     4 FNIVLIEPEIPPNTGNIARLCAATAATLHLVGKLGFSIDDRYLKRAGLDYWDKVDLKRWENLEQLQQQH--PEGRFWYLSTKVA----RNCYEQGIYQPGD-FLVFGKETAGLPAELLLANQERCLTIPMPGQVRSLNLSNAAAVVLY 144
>gi|157373044|ref|YP_001481033.1| putative tRNA/rRNA methyltransferase YibK [Serratia proteamaculans 568] >gi|157324808|gb|ABV43905.1| RNA methyltransferase, TrmH family, group 2 [Serratia proteamaculans 568] (157 aa)
Score = 271, Expect = 9.2e-23, Identities = 63/149 (42%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKF--ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +    + + D++ F +    N      L TK   A  ++S    D        + +FG ET+GL +EI+E     Q ++I M +  RS NLSN+VA+V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFQLHLIEPMGFPWDDKRLRRAGLDYHEFASIRRHADYAAFIASE--NPQRLFALTTKGTPAHSAVSYQAGD--------YLLFGPETRGLPAEILEALPAQQKIRIPMQAQSRSMNLSNAVAVVVY 142
>gi|51594425|ref|YP_068616.1| putative methyltransferase [Yersinia pseudotuberculosis IP 32953] >gi|186893412|ref|YP_001870524.1| RNA methyltransferase [Yersinia pseudotuberculosis PB1/+] >gi|51587707|emb|CAH19307.1| putative methyltransferase [Yersinia pseudotuberculosis IP 32953] >gi|186696438|gb|ACC87067.1| RNA methyltransferase, TrmH family, group 2 [Yersinia pseudotuberculosis PB1/+] (162 aa)
Score = 271, Expect = 9.3e-23, Identities = 61/149 (40%), Positives = 93/149 (62%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKN-SKVFLITKF---ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+ L +   +++F +T     A  ++S    D        + +FG ET+GL + I++     Q ++I M ++ RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFADIKHHHDYQAFLDSEKLDSTQLARLFALTTKGTPAHSAVSYQAND--------YLLFGPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVY 147
>gi|126452601|ref|YP_001064786.1| RNA methyltransferase [Burkholderia pseudomallei 1106a] >gi|134279430|ref|ZP_01766142.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 305] >gi|126226243|gb|ABN89783.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 1106a] >gi|134248630|gb|EBA48712.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 305] (179 aa)
Score = 271, Expect = 9.6e-23, Identities = 57/149 (38%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D++           +   +FVFG ET+GL   +++++   Q +++ M    RS NLSN+VA+V F
  S:    24 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAEAPDP-ARMFAFTTRGSGRFHDRAF----------EPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTVAVVVF 167
>gi|126439427|ref|YP_001057538.1| RNA methyltransferase [Burkholderia pseudomallei 668] >gi|126218920|gb|ABN82426.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 668] (179 aa)
Score = 271, Expect = 9.6e-23, Identities = 57/149 (38%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D++           +   +FVFG ET+GL   +++++   Q +++ M    RS NLSN+VA+V F
  S:    24 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAEAPDP-ARMFAFTTRGSGRFHDRAF----------EPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTVAVVVF 167
>gi|53724519|ref|YP_104677.1| RNA methyltransferase [Burkholderia mallei ATCC 23344] >gi|67640730|ref|ZP_00439526.1| COG0219: Predicted rRNA methylase (SpoU class) [Burkholderia mallei GB8 horse 4] >gi|76811046|ref|YP_332082.1| RNA methyltransferase [Burkholderia pseudomallei 1710b] >gi|121598583|ref|YP_991525.1| RNA methyltransferase [Burkholderia mallei SAVP1] >gi|124386186|ref|YP_001027401.1| RNA methyltransferase [Burkholderia mallei NCTC 10229] >gi|126450821|ref|YP_001082366.1| RNA methyltransferase [Burkholderia mallei NCTC 10247] >gi|161360919|ref|ZP_02106779.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 1106b] >gi|161369843|ref|ZP_02109411.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 1710a] >gi|167001964|ref|ZP_02267754.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei PRL-20] >gi|167717915|ref|ZP_02401151.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei DM98] >gi|167736934|ref|ZP_02409708.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 14] >gi|167822559|ref|ZP_02454030.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 9] >gi|167844142|ref|ZP_02469650.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei B7210] >gi|167892647|ref|ZP_02480049.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 7894] >gi|167909362|ref|ZP_02496453.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 112] >gi|167917391|ref|ZP_02504482.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei BCC215] >gi|194316545|ref|YP_002012984.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei ATCC 10399] >gi|194511271|ref|YP_002023800.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei Pasteur 52237] >gi|194523655|ref|YP_002059187.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei FMH] >gi|194528636|ref|YP_002064158.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei JHU] >gi|194572430|ref|YP_002107426.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 406e] >gi|194576331|ref|YP_002111214.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei 2002721280] >gi|52427942|gb|AAU48535.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei ATCC 23344] >gi|76580499|gb|ABA49974.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 1710b] >gi|121227393|gb|ABM49911.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei SAVP1] >gi|124294206|gb|ABN03475.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei NCTC 10229] >gi|126243691|gb|ABO06784.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei NCTC 10247] >gi|147747665|gb|EDK54741.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei FMH] >gi|147752646|gb|EDK59712.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei JHU] >gi|148026652|gb|EDK84737.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei 2002721280] >gi|157805768|gb|EDO82938.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei 406e] >gi|157935556|gb|EDO91226.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia pseudomallei Pasteur 52237] >gi|160695700|gb|EDP85670.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia mallei ATCC 10399] (156 aa)
Score = 271, Expect = 9.6e-23, Identities = 57/149 (38%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D +M+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D++           +   +FVFG ET+GL   +++++   Q +++ M    RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAEAPDP-ARMFAFTTRGSGRFHDRAF----------EPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTVAVVVF 144
>gi|89056101|ref|YP_511552.1| tRNA/rRNA methyltransferase (SpoU) [Jannaschia sp. CCS1] >gi|88865650|gb|ABD56527.1| tRNA/rRNA methyltransferase (SpoU) [Jannaschia sp. CCS1] (166 aa)
Score = 270, Expect = 1.1e-22, Identities = 56/149 (37%), Positives = 82/149 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNS-NIRSFNLSNSVAIVAFH 150
           + +VL  PEIP NTG I RTCV  +  L +I P GF +++K ++RAGLDYW H++  EYD W+ F       +  +VFL     +      +  E     + + +FG+ETKGL SE++         + M S +IRS NLSN+   V + 
  S:    15 MKVVLVHPEIPGNTGTIGRTCVALDLELILIHPLGFDISEKSVRRAGLDYWKHVRLSEYDSWTAFLEAR-APREDQVFLFENGGEGG----SVYEPDYPSDAYLIFGKETKGLPSEVLNGRAHRTFHLPMRSPHIRSLNLSNAATAVIYQ 159
>gi|34762434|ref|ZP_00143434.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887902|gb|EAA24970.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (150 aa)
Score = 270, Expect = 1.2e-22, Identities = 61/157 (38%), Positives = 90/157 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           +NIVL+QPEIP NTGNI R+CV  N TLH+I+P GF L++K++KRAG+DYW  +  K    W  FE     NK  ++F  T    +        ++  +E  + +FG E++G+  +I+ K  +  + I M    RS NLSNS  I+ +  +    FN
  S:     1 MNIVLYQPEIPYNTGNIGRSCVLTNTTLHLIKPLGFSLDEKQVKRAGMDYWHLVDLK---IWESFEEFLETNKGIRLFYATTKTKQKYC-----DVKYEENDYIMFGPESRGIPEDILNKNPERCVTIPMIPMGRSLNLSNSAVIILYEAYRQLGFN 149
>gi|77972957|ref|ZP_00828511.1| COG0219: Predicted rRNA methylase (SpoU class) [Yersinia frederiksenii ATCC 33641] (167 aa)
Score = 270, Expect = 1.3e-22, Identities = 62/149 (41%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNS------KVFLITKF---ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+NL    S      ++F +T     A  ++S    D        + +FG ET+GL   +++     Q ++I M ++ RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFANIKHHHDYQAFLDSENLDGAQSTGPQSARLFALTTKGTPAHSAVSYQAND--------YLLFGPETRGLPPFVLDALPAQQKIRIPMQADSRSMNLSNAVSVVVY 152
>gi|118595209|ref|ZP_01552556.1| tRNA/rRNA methyltransferase [Methylophilales bacterium HTCC2181] >gi|118440987|gb|EAV47614.1| tRNA/rRNA methyltransferase [Methylophilales bacterium HTCC2181] (154 aa)
Score = 270, Expect = 1.3e-22, Identities = 65/159 (40%), Positives = 95/159 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSE-IMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFND 159
           M NIVLF+PEIP NTGNI R CV   ++LH+I+P GF L++K ++RAGLDY D    K YD++ +  +Q    KN + F +T  +D    +   +         F+FG ET+GL  E + +K  +  +++ M ++ RS NLSN+VAIV F      NF +
  S:     1 MFNIVLFEPEIPPNTGNIIRLCVNTKSSLHIIKPMGFTLDEKPVRRAGLDYHDMANVKVYDNYEECYAQ---LKNHRHFAVTTKSDSHYHHFKYEAGD-----VFIFGPETRGLPLERLNDKRNQANIRVPMVASNRSMNLSNTVAIVIFEAWRQINFTE 152
>gi|33151545|ref|NP_872898.1| tRNA/rRNA methyltransferase [Haemophilus ducreyi 35000HP] >gi|33147765|gb|AAP95287.1| probable tRNA/rRNA methyltransferase [Haemophilus ducreyi 35000HP] (159 aa)
Score = 269, Expect = 1.4e-22, Identities = 57/149 (38%), Positives = 94/149 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVLF+PEIP+N+GNI R C      LHMI PFGF  +DK++KR+GLDY + +  ++Y  + DF ++    K  ++F +T   + + S     ++  ++  F +FG E++G+ + I+E     Q +++ M  + RS NLSN+VA+V +
  S:     1 MLDIVLFEPEIPQNSGNIIRLCANCGFRLHMIEPFGFTWDDKKLKRSGLDYHEFVDIQKYTHFDDFLAR---AKPKRLFALTTKGEANHS-----QVQYEQGNFLMFGPESRGIPTAILETLPMSQKIRVPMCKDSRSMNLSNTVAVVVY 142
>gi|187927322|ref|YP_001897809.1| RNA methyltransferase, TrmH family, group 2 [Ralstonia pickettii 12J] >gi|187724212|gb|ACD25377.1| RNA methyltransferase, TrmH family, group 2 [Ralstonia pickettii 12J] (156 aa)
Score = 269, Expect = 1.5e-22, Identities = 57/149 (38%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N++L +PEIP NTGN+ R C    A LH+I P GF L D RM+RAGLDY ++   + + DW  F  ++     +++F +T       +++           +FVFG ET+GL+ E  E +   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVILVEPEIPPNTGNVIRLCANTGAQLHLIEPLGFPLEDARMRRAGLDYHEYATMRVHADWDAF-LRDAQPDPTRMFALTTRGSTPFASVAFQPGD-----WFVFGSETRGLSEERREWFPASQRIRLPMRPDNRSLNLSNTVAVVVF 144
>gi|94309202|ref|YP_582412.1| RNA methyltransferase TrmH, group 2 [Ralstonia metallidurans CH34] >gi|93353054|gb|ABF07143.1| RNA methyltransferase TrmH, group 2 [Ralstonia metallidurans CH34] (156 aa)
Score = 269, Expect = 1.6e-22, Identities = 56/149 (37%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+++P GF L D RM+RAGLDY ++   + ++ W    +    +  +++F +T             +++     +FVFG ET+GL  E  E +   Q +++ M  N RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLEDARMRRAGLDYHEYATMRVHESWDALMAAEQPDP-TRMFALTTHGSTPFG-----QVSFAPGDWFVFGSETRGLAPERREWFPSAQRIRLPMRPNNRSLNLSNTVAVVVF 144
>gi|77960029|ref|ZP_00823929.1| COG0219: Predicted rRNA methylase (SpoU class) [Yersinia mollaretii ATCC 43969] (167 aa)
Score = 269, Expect = 1.7e-22, Identities = 58/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITK-FADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+ L    S      + FA  +        ++     + +FG ET+GL + +++     Q ++I M ++ RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFASIKHHHDYQAFLDSEKLDGAQSAGATPARLFALTTKGTPAHSAVSYQANDYLLFGPETRGLPATVLDALPAQQKIRIPMQADSRSMNLSNAVSVVVY 152
>gi|118580121|ref|YP_901371.1| tRNA/rRNA methyltransferase (SpoU) [Pelobacter propionicus DSM 2379] >gi|118502831|gb|ABK99313.1| tRNA/rRNA methyltransferase (SpoU) [Pelobacter propionicus DSM 2379] (157 aa)
Score = 268, Expect = 1.8e-22, Identities = 61/148 (41%), Positives = 85/148 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDD----WSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSN-IRSFNLSNSVAIVAF 149
            NIVL +PEIP NTGNI+R C      LH++ P GF ++D+++KRAGLDYW  +  K +      W +F          + F ++  A +S   L  D    D   F VFG+ETKGL +EI+E   +  + I M +N +RS NLS S  IV +
  S:     7 FNIVLVEPEIPPNTGNIARLCAATGTVLHLVEPLGFSIDDRQLKRAGLDYWGSVTLKVWQRLEQVWQEF-------PRGRFFYLSTKAGRSY--LAADFRPGD---FIVFGKETKGLPAEILEWNSETAITIPMPANAVRSLNLSTSAGIVLY 147
>gi|89898732|ref|YP_515842.1| tRNA/rRNA methyltransferase [Chlamydophila felis Fe/C-56] >gi|89332104|dbj|BAE81697.1| tRNA/rRNA methyltransferase [Chlamydophila felis Fe/C-56] (156 aa)
Score = 268, Expect = 1.8e-22, Identities = 57/148 (38%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + +VL+ P+IP+NTGNI RTCV   A L ++RP GF L DK +KRAG+DYWD +     D     E+ + +++N KVF ++    +   +++   L  D    +VFG E+KGL  E+++KY      + M   +RS NL+ +V +V F
  S:     1 MKVVLYNPDIPQNTGNIGRTCVALGAELILVRPLGFSLLDKFVKRAGMDYWDKVNPSVVDSLD--EALSGIDEN-KVFCLSTKGSQCYGDVS---LPMDG--VYVFGSESKGLPEEVLKKYYNHCYYLPMKPGVRSLNLATTVGVVLF 140
>gi|187922547|ref|YP_001894189.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia phytofirmans PsJN] >gi|187713741|gb|ACD14965.1| RNA methyltransferase, TrmH family, group 2 [Burkholderia phytofirmans PsJN] (156 aa)
Score = 268, Expect = 1.9e-22, Identities = 57/157 (36%), Positives = 90/157 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D +++RAGLDY ++ +   + DW+ F ++   +  +++F    F  +      +      +  +FVFG ET+GL   +++++   Q +++ M    RS NLSN+VAIV F     T F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKLRRAGLDYHEYAQMNVHADWAAFVAKESPDP-ARMF---AFTTRGSGRFHEHAFQSGD--WFVFGAETRGLPDSVLDQFANQQRVRLPMRPGNRSLNLSNTVAIVVFEAWRQTGF 152
>gi|91781671|ref|YP_556877.1| RNA methyltransferase TrmH, group 2 [Burkholderia xenovorans LB400] >gi|91685625|gb|ABE28825.1| RNA methyltransferase TrmH, group 2 [Burkholderia xenovorans LB400] (156 aa)
Score = 268, Expect = 2.1e-22, Identities = 59/157 (37%), Positives = 92/157 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L+D RM+RAGLDY ++ +   + DW+ F ++   +  +++F  T     +F +++  +            +FVFG ET+GL   ++ ++   Q +++ M    RS NLSN+VA+V F     T F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDARMRRAGLDYHEYAQMNVHADWAAFIAKESPDP-ARMFAFTTRGSGRFHERAFQSGD----------WFVFGAETRGLPDPVLGQFADEQRVRLPMRPGNRSLNLSNTVAVVVFEAWRQTGF 152
>gi|77958480|ref|ZP_00822513.1| COG0219: Predicted rRNA methylase (SpoU class) [Yersinia bercovieri ATCC 43970] (167 aa)
Score = 268, Expect = 2.1e-22, Identities = 58/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITK-FADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+ L    S      + FA  +        ++     + +FG ET+GL + +++     Q ++I M ++ RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFASIKHHHDYQAFLDSEKLDGAQSAGATPARLFALTTKGTPAHSAVSYQANDYLLFGPETRGLPARVLDVLPAQQKIRIPMQADSRSMNLSNAVSVVVY 152
>gi|123440483|ref|YP_001004477.1| putative methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122087444|emb|CAL10225.1| putative methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] (167 aa)
Score = 268, Expect = 2.2e-22, Identities = 62/149 (41%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNS------KVFLITKF---ADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    K + D+  F +S+NL    S      ++F +T     A  +++    D        + +FG ET+GL S +++     Q ++I M +  RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFANIKHHHDYQAFLDSENLDGAQSAGTNPARLFALTTKGTPAHSAVNYQVND--------YLLFGPETRGLPSNVLDALPAQQKIRIPMLAASRSMNLSNAVSVVVY 152
>gi|152990479|ref|YP_001356201.1| tRNA/rRNA methyltransferase [Nitratiruptor sp. SB155-2] >gi|151422340|dbj|BAF69844.1| tRNA/rRNA methyltransferase [Nitratiruptor sp. SB155-2] (156 aa)
Score = 267, Expect = 2.4e-22, Identities = 61/149 (40%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKN-SKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P+IP NTGNI R CV   +TLH+++P GF ++ K +KRAGLDYW+ L  K +D   +     L N N S+ F  T  + K        ++      F  FG ETKGL  E+MEK+ +  + I M    RS NL+ SV ++ +
  S:     1 MFNIVLVHPQIPPNTGNIGRLCVNTGSTLHLVKPLGFDISQKAVKRAGLDYWEKLDLKVWDSLDEL----LHNCNLSRAFFATTKSSKPYF-----QVQYQPGDFLFFGSETKGLPMELMEKHWEHAVTIPMTKEGRSLNLAVSVGVIVY 141
>gi|95930687|ref|ZP_01313421.1| tRNA/rRNA methyltransferase (SpoU) [Desulfuromonas acetoxidans DSM 684] >gi|95133339|gb|EAT15004.1| tRNA/rRNA methyltransferase (SpoU) [Desulfuromonas acetoxidans DSM 684] (158 aa)
Score = 267, Expect = 2.4e-22, Identities = 58/148 (39%), Positives = 84/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSN-IRSFNLSNSVAIVAF 149
            +IVL +PEIP NTGNI+R C G    LH++   GF L+D+ +KRAGLDYW H+    +D     E         + +  +K A     +L   + T     F VFG+ETKGL  E++E++ +  L+I M+ + +RS NLS S  IV +
  S:     6 FHIVLVEPEIPPNTGNIARLCAGTQTHLHLVGKLGFSLDDRYLKRAGLDYWPHVPLHRWDSLEQLEQ---AYPEGRWWYTSKTA-----HLVHSQATFHPGDFIVFGKETKGLPKELLERHPQRCLRIPMSCDAVRSLNLSTSAGIVLY 146
>gi|32265877|ref|NP_859909.1| rRNA methylase (SpoU class) [Helicobacter hepaticus ATCC 51449] >gi|32261926|gb|AAP76975.1| predicted rRNA methylase (SpoU class) [Helicobacter hepaticus ATCC 51449] (156 aa)
Score = 267, Expect = 2.7e-22, Identities = 59/144 (40%), Positives = 78/144 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEI----FFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVA 145
             IVL QP+IP+NTGNI R CV  ++ LH+I P GF    K +KRAGLDYW HL+  E+ D + F      +K    F  TK            +L  D +     F  FGRE  GL  +I+  Y+K   K+ M + +RS NL+ SV 
  S:     4 FQIVLVQPQIPQNTGNIGRLCVATDSVLHLIHPLGFSTTQKELKRAGLDYWQHLQVYEWADLNTFWHSYPPSKR-HFFFSTK----------AQQLYYDADFSQGGFLYFGREDAGLNEDILHTYQKQVYKLPMKAGVRSINLATSVG 140
>gi|149200214|ref|ZP_01877236.1| rRNA methyltransferase [Lentisphaera araneosa HTCC2155] >gi|149136656|gb|EDM25087.1| rRNA methyltransferase [Lentisphaera araneosa HTCC2155] (151 aa)
Score = 267, Expect = 2.8e-22, Identities = 62/148 (41%), Positives = 90/148 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSN-IRSFNLSNSVAIVAF 149
           +NIVLFQP IP+NTG I R  V  +  LH+I+P GF L++K++K+AG+DYW H+K   ++ W DF + N     + VF  TK   K+I      E T  E+ + +FG E+ GL  E  E ++     I M  + +RS NL+NSV+IV +
  S:     1 MNIVLFQPLIPQNTGTIGRLTVCTDNDLHLIKPLGFELDEKKIKKAGMDYWPHVKLHIHESWEDFLN-NTPEDKTMVFCTTK-CKKTIY-----EHTFTEDDYLIFGNESHGLPPEFYENFQDSLCTIPMRGDHLRSHNLANSVSIVTY 142
>gi|88713151|ref|ZP_01107235.1| RNA methyltransferase, TrmH family, group 2 [Flavobacteriales bacterium HTCC2170] >gi|88708532|gb|EAR00768.1| RNA methyltransferase, TrmH family, group 2 [Flavobacteriales bacterium HTCC2170] (150 aa)
Score = 267, Expect = 2.8e-22, Identities = 60/148 (40%), Positives = 90/148 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           LNIVLF+PEIP NTGNI R  +   + LH+++PFGF L+DKR+KRAGLDYW H+    Y++  +F  Q+  N  + V+  +       S   KD++      + +FG+E+ GL  EI++       KI + +S IRS NL+N+V +  +
  S:     3 LNIVLFEPEIPNNTGNIGRLALATGSNLHLVKPFGFELDDKRLKRAGLDYWPHISLFTYENIEEFYKQH--NDKNLVYFSSHGEKNHWSIDYKDDM------YLIFGKESVGLPKEILQNNSDKLYKIPLFSSKIRSLNLANAVGVTIY 143
>gi|107023784|ref|YP_622111.1| RNA methyltransferase TrmH, group 2 [Burkholderia cenocepacia AU 1054] >gi|105893973|gb|ABF77138.1| RNA methyltransferase TrmH, group 2 [Burkholderia cenocepacia AU 1054] (168 aa)
Score = 267, Expect = 3.0e-22, Identities = 58/141 (41%), Positives = 88/141 (62%)
  Q:     9 PEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT-----KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           PEIP NTGN+ R C    A LH+I P GF L+D RM+RAGLDY ++ + + + DW  F +    +  +++F  T     +F D +   L+ D        +FVFG ET+GL +E++E++   Q +++ M  + RS NLSN+VA+V F
  S:    21 PEIPPNTGNVIRLCANTGAHLHLIEPLGFPLDDARMRRAGLDYHEYAQMRVHRDWDAFVAAETPDP-ARMFAFTTRGSGRFHDHAF--LSGD--------WFVFGSETRGLPAELLERFPNEQRVRLPMRPDNRSLNLSNTVAVVVF 156
>gi|148242334|ref|YP_001227491.1| rRNA methylase [Synechococcus sp. RCC307] >gi|147850644|emb|CAK28138.1| Predicted rRNA methylase [Synechococcus sp. RCC307] (152 aa)
Score = 266, Expect = 3.1e-22, Identities = 55/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  IVL +PEIP NTGNI+RTC      LH++ P GF +ND+++KRAGLDYW H+   ++  W +F   +  + + ++   ++ A +S       E+    + + +FG ETKGL  E+        L     S +RS NLS + A+V F
  S:     1 MPQIVLVEPEIPPNTGNIARTCAATETPLHLVEPLGFEINDRQLKRAGLDYWPHVPLVQHSSWGEFLKHHQ-HHSGRLLGFSRHASRSYL-----EIDYRADDWLIFGCETKGLAPEVQANCDDLLLIPMTCSAVRSLNLSVAAAVVLF 143
>gi|149376046|ref|ZP_01893812.1| predicted rRNA methylase [Marinobacter algicola DG893] >gi|149359683|gb|EDM48141.1| predicted rRNA methylase [Marinobacter algicola DG893] (154 aa)
Score = 266, Expect = 3.5e-22, Identities = 60/149 (40%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLN+VLF+PEIP NTGNI R C      LH+I P GF L DK+M+RAGLDY ++     + D+  F ES+    + S++F +T    +   ++   E    +  + +FG ET+GL  +I E   +  +L++ M    RS NLSN+VA+V +
  S:     1 MLNVVLFEPEIPPNTGNIIRLCANTGCQLHLIEPLGFTLEDKQMRRAGLDYSEYATVTVHSDYQAFLESE----QPSRLFGLTTKGSRGYHDV---EYQNGD--YLMFGPETRGLPQDIREAMPEHHRLRVPMRPESRSLNLSNTVALVVY 142
>gi|29839847|ref|NP_828953.1| RNA methyltransferase [Chlamydophila caviae GPIC] >gi|666878|gb|AAB41347.1| spoU [Chlamydophila caviae] >gi|29834194|gb|AAP04831.1| RNA methyltransferase, TrmH family [Chlamydophila caviae GPIC] (156 aa)
Score = 266, Expect = 3.8e-22, Identities = 57/148 (38%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + +VL+ P+IP+NTGNI RTC+   A L ++RP GF L DK +KRAG+DYWD +     D     E+ + V++N KVF ++    +   +++   L  D    +VFG E+KGL  ++++KY      + M   IRS NL+ +V +V F
  S:     1 MKVVLYNPDIPQNTGNIGRTCIALGAELILVRPLGFSLLDKFVKRAGMDYWDKVNLSVVDSLD--EALSGVDQN-KVFCLSTKGSQYYGDVS---LPMDG--VYVFGSESKGLPEDVLKKYYNHCYYLPMRPGIRSLNLATTVGVVLF 140
>gi|91776534|ref|YP_546290.1| RNA methyltransferase TrmH, group 2 [Methylobacillus flagellatus KT] >gi|91710521|gb|ABE50449.1| RNA methyltransferase TrmH, group 2 [Methylobacillus flagellatus KT] (154 aa)
Score = 265, Expect = 4.2e-22, Identities = 62/149 (41%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEI------FFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  IVL+QPEIP NTGNI R C   N  LH+++P GF L DK++KRAGLDY ++     ++DW   + Q L  + +       FA      LT    T+  +I       FVFG ET+GL  EI  ++  ++++++ M    RS NLSNS AI+ +
  S:     1 MFEIVLYQPEIPPNTGNIIRLCANSNTRLHLVKPLGFELEDKQLKRAGLDYHEYASLVVHEDWEACK-QALAGRRT-------FA------LTTKGSTRHSDIRFLPGNVFVFGPETRGLPEEIRAEFSPEYRIRLPMMPQSRSLNLSNSAAILLY 142
>gi|30250229|ref|NP_842299.1| rRNA methyltransferase [Nitrosomonas europaea ATCC 19718] >gi|30181024|emb|CAD86214.1| rRNA_methyl_2: RNA methyltransferase, TrmH family, group 2 [Nitrosomonas europaea ATCC 19718] (154 aa)
Score = 265, Expect = 4.7e-22, Identities = 61/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY--WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML I+L QPEIP NTGNI R C    A LH+IRP GF L+D++++RAGLDY  W  L   E     D  S   +    ++F +T    ++  +  K   T ++   F+FG ET+GL +E++E + + Q ++I M S  RS NLSN+ A++ +
  S:     1 MLQIILHQPEIPPNTGNIIRLCANTGAQLHLIRPLGFDLSDRQLRRAGLDYHEWARLTVHE-----DLASCLKLMDGCRIFAVTT---RATHHHGKVAYTGND--VFLFGSETRGLPAEVLENFPQDQRIRIPMLSASRSLNLSNAAAVIIY 142
>gi|51245784|ref|YP_065668.1| rRNA methylase homolog (CspR) [Desulfotalea psychrophila LSv54] >gi|50876821|emb|CAG36661.1| probable rRNA methylase homolog (CspR) [Desulfotalea psychrophila LSv54] (165 aa)
Score = 265, Expect = 4.7e-22, Identities = 61/148 (41%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           LNIVL +PEIP NTG+I+R C   NA LH++ P GF  +DK ++RAGLDYW  +    ++ +  F SQ   +K++  F  TK  +KS +     E    +  F +FG+ETKGL   I++ +    L + M N NIRS NL+ +  IV +
  S:    15 LNIVLVEPEIPPNTGSIARLCGATNAILHLVHPLGFSTDDKHLRRAGLDYWKFVNIVYWESFEAFLSQ--CDKDNMYFFTTK-TEKSYT-----EAKFKQGDFLIFGKETKGLPKPILDLHPDRCLTLPMPNPNIRSLNLAMTAGIVLY 155
>gi|34557814|ref|NP_907629.1| putative RNA methylase [Wolinella succinogenes DSM 1740] >gi|34483532|emb|CAE10529.1| PUTATIVE RNA METHYLASE [Wolinella succinogenes] (153 aa)
Score = 265, Expect = 4.9e-22, Identities = 55/148 (37%), Positives = 80/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L IVL +P IP+NTGNI R C    + LH+I P GF L+ K +KRAG+DYW+HL+  E+     F   +   ++   FL+T  A ++       E +     +  FGRE  GL   ++E + +  LKI M    RS NL+ +  IV +
  S:     3 LQIVLVEPRIPQNTGNIGRLCAATQSALHLIHPLGFTLSQKEIKRAGMDYWEHLELYEWSSLEAFTEAHPFGESH--FLLTTKAKRAYF-----EASLPPSAYLYFGREDAGLPQVLLEAHPQAMLKIPMKEGNRSLNLATATGIVLY 143
>gi|86607760|ref|YP_476522.1| RNA methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86556302|gb|ABD01259.1| RNA methyltransferase, TrmH family, group 2 [Synechococcus sp. JA-2-3B'a(2-13)] (152 aa)
Score = 264, Expect = 5.4e-22, Identities = 58/148 (39%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKV-FLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            ++VL  PEIP NTGNI+RTC   +  LH++ P GF L+D+ +KRAGLDYW H++   Y  WS      LV  + +  F       K++      E+T     + VFG E++GL    +E Y    ++I +   +RS NLSN+VAI  F
  S:     3 FHVVLVAPEIPANTGNIARTCAATDTPLHLVDPLGFRLSDRYLKRAGLDYWQHVQLYRYPSWS-----ALVQAHPEARFWCFSVRGKALYT----EVTYQPGDWLVFGSESRGLDPLFLETYP--SVRIPLRGPVRSLNLSNAVAIALF 140
>gi|54295332|ref|YP_127747.1| hypothetical protein lpl2417 [Legionella pneumophila str. Lens] >gi|53755164|emb|CAH16657.1| hypothetical protein [Legionella pneumophila str. Lens] (149 aa)
Score = 264, Expect = 6.1e-22, Identities = 61/158 (38%), Positives = 84/158 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M++I L+QPEIP NTGNI R C    A LH+I P GF L DK+M+RAGLDY        Y++W     Q  +  +S+  L    A   +     D    D     +FG E+ GL  +I+ +Y    ++I M  N RS NLSN+VAI+ +      +FN
  S:     1 MIHIALYQPEIPPNTGNIIRLCANTGAQLHLIHPLGFTLEDKQMRRAGLDYHQWASILHYENW-----QTFLQSHSQRRLYCCSAKGKVKYSDVDYKADD---ILLFGPESCGLPQQILNQYS--TIRIPMRENNRSLNLSNAVAIILYEAWRQMDFN 148
>gi|134300171|ref|YP_001113667.1| RNA methyltransferase [Desulfotomaculum reducens MI-1] >gi|134052871|gb|ABO50842.1| RNA methyltransferase, TrmH family, group 2 [Desulfotomaculum reducens MI-1] (152 aa)
Score = 264, Expect = 6.1e-22, Identities = 59/159 (37%), Positives = 86/159 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           ++IVL +PEIP NTGNI+RTC    A+LH++ P GF  +D+ +KRAGLDYW  L    +  ++  + Q       + +  T    +        E + +E  F VFG+ET GL  E++       L+I M   +RS NLSNSVAI  +      NF ++
  S:     1 MHIVLVEPEIPANTGNIARTCSVTGASLHLVEPLGFSTDDRYLKRAGLDYWHLLDLHYHKSFAALQQQ---YPEGRFWYFTTKGGRPYH-----EASFEENDFLVFGKETAGLPKELLAANPDNCLRIPMLGQVRSLNLSNSVAIAVYEALRQHNFPNM 151
>gi|54298499|ref|YP_124868.1| hypothetical protein lpp2563 [Legionella pneumophila str. Paris] >gi|53752284|emb|CAH13716.1| hypothetical protein [Legionella pneumophila str. Paris] (149 aa)
Score = 264, Expect = 6.7e-22, Identities = 61/158 (38%), Positives = 83/158 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M++I L+QPEIP NTGNI R C    A LH+I P GF L DK+M+RAGLDY        Y++W     Q  +  +S+  L    A   +     D    D     +FG E+ GL  +I+ +Y    ++I M  N RS NLSN+VAI+ +       FN
  S:     1 MIHIALYQPEIPPNTGNIIRLCANTGAQLHLIHPLGFTLEDKQMRRAGLDYHQWASILHYENW-----QTFLQSHSQRRLFCCSAKGKVKYSDVDYKADD---ILLFGPESCGLPQQILNQYS--TIRIPMRENNRSLNLSNAVAIILYEAWRQMGFN 148
>gi|56752229|ref|YP_172930.1| tRNA/rRNA methyltransferase [Synechococcus elongatus PCC 6301] >gi|81300683|ref|YP_400891.1| RNA methyltransferase TrmH, group 2 [Synechococcus elongatus PCC 7942] >gi|56687188|dbj|BAD80410.1| probable tRNA/rRNA methyltransferase [Synechococcus elongatus PCC 6301] >gi|81169564|gb|ABB57904.1| RNA methyltransferase TrmH, group 2 [Synechococcus elongatus PCC 7942] (156 aa)
Score = 263, Expect = 7.3e-22, Identities = 62/156 (39%), Positives = 85/156 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF----HYHFLTN 156
           M  +VL+QPEIP NTGNI+RTC   +  LH+I P GF L+D+ +KRAGLDYW +++   + DWS F  Q        +   TK     ++ L  D    D   + +FGRET GL  +++             + +RS NLS SVAI  F      +F TN
  S:     1 MPQVVLYQPEIPPNTGNIARTCAATDTPLHLIEPLGFELSDRYLKRAGLDYWPYVQLTTHPDWSVFRQQQQQQGGRLIAFTTK---GELNYLDCDFQATD---WLLFGRETSGLPEDVLASCDHRVRIPTPQAGVRSLNLSVSVAIGLFEARRQVYFATN 154
>gi|94987568|ref|YP_595501.1| RNA methyltransferase [Lawsonia intracellularis PHE/MN1-00] >gi|94731817|emb|CAJ55180.1| RNA methyltransferase, TrmH family, group 2, putative [Lawsonia intracellularis PHE/MN1-00] (153 aa)
Score = 263, Expect = 7.4e-22, Identities = 55/149 (36%), Positives = 90/149 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFH 150
           ++I+L+QPEIP NTGNI+R C   +  LH+I P GF L D+ +KRAGLDYW H+  K +    D+    L++      L+   A   ++ + +   + D+ +  VFGRET GL  ++M++Y+  +++I + S +RS NLS +  I+ + 
  S:     1 MHILLYQPEIPPNTGNIARLCAATHTPLHLIEPLGFKLEDRYLKRAGLDYWKHVILKVWPQLDDY----LLSDGLGRRLVITSARGGVA-VHQFMFSADDTL--VFGRETAGLPKDLMDQYEH-KVRIPIYSTVRSLNLSTAAGIILYQ 141
>gi|90020777|ref|YP_526604.1| putative tRNA/rRNA methyltransferase [Saccharophagus degradans 2-40] >gi|89950377|gb|ABD80392.1| RNA methyltransferase TrmH, group 2 [Saccharophagus degradans 2-40] (177 aa)
Score = 262, Expect = 9.1e-22, Identities = 61/149 (40%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ--LKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVLF+PEIP NTGNI R C      LH+I P GF L+DKR++RAGLDY +      + +W  F  Q    +         +A  +       E++  E  + VFG ET+GL  EI+E Y  F   L+I M  N RS NLSN+ +++ +
  S:    24 MFNIVLFEPEIPPNTGNIIRVCANTGCRLHLIEPLGFELDDKRLRRAGLDYGEWQSVVTHANWDAFIKQQAPER--------LWALSTKGTKFHHEVSIGEGDYLVFGPETRGLPMEILE-YITFDNVLRIPMLPNSRSMNLSNAASVMVY 165
>gi|157373406|ref|YP_001472006.1| RNA methyltransferase [Shewanella sediminis HAW-EB3] >gi|157315780|gb|ABV34878.1| RNA methyltransferase, TrmH family, group 2 [Shewanella sediminis HAW-EB3] (154 aa)
Score = 262, Expect = 9.7e-22, Identities = 61/149 (40%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I LF+PEI  NTGNI R C      LH+I P GF L +K+++RAGLDY D  +   + D+  F    L   + K  +    A  +  +    EL  ++E   +FG ET+GL  EI+E     Q LKI M +N RS NLSN+VAI+++
  S:     1 MFHIALFEPEIAPNTGNIIRLCANNGCQLHLIEPMGFDLEEKKLRRAGLDYSDLTRVTRHKDFESF----LAAMDGKRIM----ACTTKGSRPHTELAYEKEDVLLFGPETRGLPIEIIESLPTTQRLKIPMTANSRSLNLSNAVAIISY 142
>gi|52842704|ref|YP_096503.1| RNA methyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629815|gb|AAU28556.1| RNA methyltransferase TrmH family, group 2 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (174 aa)
Score = 262, Expect = 1.0e-21, Identities = 61/158 (38%), Positives = 84/158 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M++I L+QPEIP NTGNI R C    A LH+I P GF L DK+M+RAGLDY        Y++W     Q  +  +S+  L    A   +     D    D     +FG E+ GL  +I+ +Y    ++I M  N RS NLSN+VAI+ +      +FN
  S:    26 MIHIALYQPEIPPNTGNIIRLCANTGAQLHLIHPLGFTLEDKQMRRAGLDYHQWASILHYENW-----QTFLQSHSQRRLFCCSAKGKVKYSDVDYKADD---ILLFGPESCGLPQQILNQYS--TIRIPMRENNRSLNLSNAVAIILYEAWRQMDFN 173
>gi|113866368|ref|YP_724857.1| rRNA methylase (SpoU class) [Ralstonia eutropha H16] >gi|113525144|emb|CAJ91489.1| predicted rRNA methylase (SpoU class) [Ralstonia eutropha H16] (156 aa)
Score = 262, Expect = 1.0e-21, Identities = 55/149 (36%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+++P GF L D RM+RAGLDY ++   + ++ W    +    +  +++F +T             E+      +FVFG ET+GL+ E  + +   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLEDARMRRAGLDYHEYATMRVHESWDALMASEQPDP-ARMFALTTRGSTPFG-----EVAFRPGDWFVFGSETRGLSPERRDWFPPAQRIRLPMRPDNRSLNLSNTVAVVVF 144
>gi|54020406|ref|YP_115752.1| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae 232] >gi|53987579|gb|AAV27780.1| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae 232] >gi|144575296|gb|AAZ53517.2| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae 7448] (174 aa)
Score = 262, Expect = 1.1e-21, Identities = 66/160 (41%), Positives = 99/160 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKR--AGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           M+NIVLFQPEI  NTGNI R+C      LH+I P  F L+ K +KR  AG+     ++ + + +W +F S+    KN  +F IT++  K  + +    E+   ++IFFVFGRE+ G+  EI++K K+  L+I M +  RS NL+N+V I+A+ +H   NF  L
  S:     1 MINIVLFQPEIGPNTGNIIRSCFVAGLKLHIIMPIAFDLDPKHLKRPAAGI-LLSEIEHEIHKNWQNF-SEKYGQKN--LFFITRYGQKLYTEVDFYTEIETKKDIFFVFGRESTGIPIEILKKNKEKCLRIPMIAKARSLNLANTVVIIAYEFHRQLNFKKL 159
>gi|56415585|ref|YP_152660.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56129842|gb|AAV79348.1| putative RNA-methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (157 aa)
Score = 262, Expect = 1.1e-21, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +    + + D++ F +        ++F +T     + S      ++  +  + +FG ET+GL + I++   K Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFAAVQRHHDYAAFVA---AENPQRLFALTTKGTAAHS-----AVSYQDGDYLMFGPETRGLPASILDALPKEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|148360047|ref|YP_001251254.1| RNA methyltransferase [Legionella pneumophila str. Corby] >gi|148281820|gb|ABQ55908.1| RNA methyltransferase TrmH family, group 2 [Legionella pneumophila str. Corby] (155 aa)
Score = 262, Expect = 1.1e-21, Identities = 61/158 (38%), Positives = 83/158 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M++I L+QPEIP NTGNI R C    A LH+I P GF L DK+M+RAGLDY        Y+ W     Q  +  +S+  L    A   +     D    D     +FG E+ GL  +I+ +Y    ++I M  N RS NLSN+VAI+ +      +FN
  S:     7 MIHIALYQPEIPPNTGNIIRLCANSGAQLHLIHPLGFTLEDKQMRRAGLDYHQWASILHYESW-----QTFLQSHSQRRLFCCSAKGKVKYSDVDYKADD---ILLFGPESCGLPQQILNQYS--TIRIPMRENNRSLNLSNAVAIILYEAWRQMDFN 154
>gi|149194269|ref|ZP_01871366.1| tRNA/rRNA methyltransferase (SpoU) [Caminibacter mediatlanticus TB-2] >gi|149135444|gb|EDM23923.1| tRNA/rRNA methyltransferase (SpoU) [Caminibacter mediatlanticus TB-2] (153 aa)
Score = 261, Expect = 1.2e-21, Identities = 63/160 (39%), Positives = 87/160 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           M NIVLF P+IP NTGNI R CV   A LH+++P GF ++ K +KRAGLDYWD L  K ++   +F     V+ N   F  TK          K      +  +F+FG ETKG+  +I+ +YK+  + I M +  RS NL+ S  I+ +      NF D 
  S:     1 MFNIVLFNPQIPPNTGNIGRLCVNAGAKLHIVKPIGFDISQKAVKRAGLDYWDKLDLKVWESVEEFLKN--VDTNRCFFATTKTKTPYFEKKYK------KGDYFIFGSETKGIDEKILNQYKENNITIPMTNEGRSLNLAVSCGIILYE-AIRQNFKDF 151
>gi|62182189|ref|YP_218606.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616772|ref|YP_001590737.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167549059|ref|ZP_02342818.1| hypothetical protein Sentente_01020 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167555530|ref|ZP_02348548.1| hypothetical protein Sententeri_01460 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168241872|ref|ZP_02666804.1| hypothetical protein Senterienterica_09582 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194451947|ref|YP_002047725.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|62129822|gb|AAX67525.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161366136|gb|ABX69904.1| hypothetical protein SPAB_04591 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194410251|gb|ACF70470.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (157 aa)
Score = 261, Expect = 1.2e-21, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +    + + D++ F +        ++F +T     + S      ++  +  + +FG ET+GL + I++   K Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFAAVQRHHDYAAFVA---AENPQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPKEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|16766980|ref|NP_462595.1| putative tRNA/rRNA methyltransferase YibK [Salmonella typhimurium LT2] >gi|167541907|ref|ZP_02337483.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167994314|ref|ZP_02575406.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168224833|ref|ZP_02650064.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168232538|ref|ZP_02657596.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168235302|ref|ZP_02660360.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168260552|ref|ZP_02682525.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464999|ref|ZP_02698891.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168473262|ref|ZP_02702285.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818477|ref|ZP_02830477.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442768|ref|YP_002042944.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194471131|ref|ZP_03077115.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734332|ref|YP_002116632.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|16422261|gb|AAL22554.1| putative tRNA/rRNA methyltransferase [Salmonella typhimurium LT2] >gi|194401431|gb|ACF61653.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194457495|gb|EDX46334.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194709834|gb|ACF89055.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632281|gb|EDX50765.1| RNA methyltransferase, TrmH family, group 2 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (157 aa)
Score = 261, Expect = 1.2e-21, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +    + + D++ F +        ++F +T     + S      ++  +  + +FG ET+GL + I++   K Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFAAVQRHHDYAAFVA---AENPQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPKEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|152972456|ref|YP_001337602.1| putative tRNA/rRNA methyltransferase YibK [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957305|gb|ABR79335.1| putative tRNA/rRNA methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (157 aa)
Score = 261, Expect = 1.2e-21, Identities = 57/149 (38%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C     +LH+I P GF  +DKR++RAGLDY +    + + D++ F +     +  ++F +T     + S      ++  +  F +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFSLHIIEPMGFTWDDKRLRRAGLDYHEFTAVQRHADYAAFVAS---AQPQRLFALTTKGTPAHS-----AVSYQDGDFLMFGPETRGLPASILDALPPEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|32472821|ref|NP_865815.1| SpoU rRNA methylase family [Rhodopirellula baltica SH 1] >gi|32444058|emb|CAD73500.1| spoU rRNA Methylase family [Rhodopirellula baltica SH 1] (177 aa)
Score = 261, Expect = 1.3e-21, Identities = 55/150 (36%), Positives = 85/150 (56%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKN---SKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYH 152
           ++VL+QPEIP+NTGNI RTCV   A L ++ P  F  ++KR++RAGLDYW +L      DW    S + + +     + F  +KFA +++    + E    +    VFGRET GL + I++      L++ M   +RS NLS +  I  + + 
  S:    27 HVVLYQPEIPQNTGNIGRTCVAVGAKLWIVEPASFQFDEKRLRRAGLDYWQYL------DWEPVPSWDALCERLNPERFFFFSKFAKRTV---WEAEFALGD--VLVFGRETSGLPASILKPDDPRSLRLPMREQVRSLNLSVTAGIALYEHQ 168
>gi|17545077|ref|NP_518479.1| putative tRNA/rRNA methyltransferase protein [Ralstonia solanacearum GMI1000] >gi|17427367|emb|CAD13886.1| putative trna/rrna methyltransferase protein [Ralstonia solanacearum] (156 aa)
Score = 261, Expect = 1.4e-21, Identities = 57/149 (38%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL +PEIP NTGN+ R C    A LH+I P GF L D RM+RAGLDY ++   + +  W  F  ++     +++F +T       + L           +FVFG ET+GL+ E    +   Q +++ M  + RS NLSN+VA+V F
  S:     1 MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLIEPLGFPLEDARMRRAGLDYHEYATMRVHASWDAF-LRDAQPDPARMFALTTRGSTPFAGLAFQPGD-----WFVFGSETRGLSEERRAGFPPSQRIRLPMRPDNRSLNLSNTVAVVVF 144
>gi|16762614|ref|NP_458231.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144103|ref|NP_807445.1| putative tRNA/rRNA methyltransferase YibK [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25331702|pir||AG0975 probable RNA-methyltransferase STY4101 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504919|emb|CAD03299.1| putative RNA-methyltransferase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139740|gb|AAO71305.1| putative RNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (157 aa)
Score = 261, Expect = 1.4e-21, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +    + + D++ F +        ++F +T     + S      ++  +  + +FG ET+GL + I++   K Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFAAVQRHHDYAAFVA---AENPQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPKEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|56475995|ref|YP_157584.1| RNA methyltransferase CspR (SpoU class) [Azoarcus sp. EbN1] >gi|56312038|emb|CAI06683.1| RNA methyltransferase CspR (SpoU class) [Azoarcus sp. EbN1] (154 aa)
Score = 261, Expect = 1.5e-21, Identities = 60/149 (40%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEI------FFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVLFQPEIP NTGN  R      A LH++RP GF L+D+++ RAGLDY D      +DDW+                ++  A + +  L+    T+ + +        +FGRET GL +E+++     Q L+I M    RS NLSN+VA+V F
  S:     1 MLDIVLFQPEIPPNTGNTIRLAANTGARLHLVRPLGFDLSDRQLARAGLDYHDLTTLTVHDDWNA--------------CLSALAGRRLLALSTKGRTRYDLVDYRADDVLLFGRETSGLPAEVLDSVPDMQTLRIPMCPANRSVNLSNAVAVVVF 142
>gi|152993289|ref|YP_001359010.1| tRNA/rRNA methyltransferase [Sulfurovum sp. NBC37-1] >gi|151425150|dbj|BAF72653.1| tRNA/rRNA methyltransferase [Sulfurovum sp. NBC37-1] (164 aa)
Score = 261, Expect = 1.5e-21, Identities = 57/149 (38%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL +P+IP+NTG I R CV   ATLH+I+P GF ++DK +KRAGLDYW HL    ++ +  F  ++ ++++S  ++ T   D    NL  +   K  + + +FG ETKG+  +++  + +  + I M    RS NL  SV +V +
  S:     1 MFNIVLVEPQIPQNTGTIGRLCVNLGATLHLIKPLGFDIDDKAVKRAGLDYWKHLDLVVWESFEAFLKEHPIDEHS--YMSTTKTD----NLYFNAPFKKGD-YILFGSETKGIDEKVLLAHPEQCITIPMGGKGRSLNLGVSVGVVIY 142
>gi|149192621|ref|ZP_01870771.1| rRNA methylase, SpoU family protein [Vibrio shilonii AK1] >gi|148833544|gb|EDL50631.1| rRNA methylase, SpoU family protein [Vibrio shilonii AK1] (158 aa)
Score = 260, Expect = 1.6e-21, Identities = 60/149 (40%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFES---QNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  + K + D++ F +   +N  N N ++F  T    K+  + T  +  + +    +FG ET+GL +E++E     Q ++I M  + RS NLSN+VAI+A+
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVKRHKDYAAFIAYLEEN--NPNYRLFACTT---KTTGHHTDAKYQQGD--VLLFGPETRGLPAEVIESLPMEQRIRIPMMPDARSLNLSNAVAIIAY 146
>gi|144227485|gb|AAZ44230.2| putative tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae J] (174 aa)
Score = 260, Expect = 1.6e-21, Identities = 66/160 (41%), Positives = 98/160 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKR--AGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           M+NIVLFQPEI  NTGNI R+C      LH+I P  F L  K +KR  AG+     ++ + + +W +F S+    KN  +F IT++  K  + +    E+   ++IFFVFGRE+ G+  EI++K K+  L+I M +  RS NL+N+V I+A+ +H   NF  L
  S:     1 MINIVLFQPEIGPNTGNIIRSCFVAGLKLHIIMPIAFDLEPKHLKRPAAGI-LLSEIEHEIHKNWQNF-SEKYGQKN--LFFITRYGQKLYTEVDFYTEIETKKDIFFVFGRESTGIPIEILKKNKEKCLRIPMIAKARSLNLANTVVIIAYEFHRQLNFKKL 159
>gi|86605765|ref|YP_474528.1| RNA methyltransferase [Synechococcus sp. JA-3-3Ab] >gi|86554307|gb|ABC99265.1| RNA methyltransferase, TrmH family, group 2 [Synechococcus sp. JA-3-3Ab] (151 aa)
Score = 260, Expect = 1.7e-21, Identities = 56/148 (37%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKV-FLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            ++VL  PEIP NTGNI+RTC      LH++ P GF L+D+ ++RAGLDYW+H++   Y  WS      LV  + +  F       K++      E+      + VFG E++GL    +E Y    ++I ++  +RS NLSN+VAI  F
  S:     3 FHVVLVAPEIPANTGNIARTCAATRTPLHLVDPLGFRLSDRYLRRAGLDYWEHVQLHRYPSWS-----ALVQAHPEARFWCFSVRGKALYT----EVAYQPGDWLVFGSESRGLDPMFLETYP--SVRIPLSGPVRSLNLSNAVAIALF 140
>gi|146329702|ref|YP_001209617.1| rRNA methyltransferase [Dichelobacter nodosus VCS1703A] >gi|146233172|gb|ABQ14150.1| rRNA methyltransferase [Dichelobacter nodosus VCS1703A] (159 aa)
Score = 260, Expect = 1.7e-21, Identities = 57/148 (38%), Positives = 86/148 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEI-MEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +++ LF P+IP NTGNI R C      LH+I P GF+ +DKR++RAGLDY +  +   +++WSDF       K S ++ +T    + +     D      ++  +FG ET GLT E+  E   + +L++ M +  RS NLSNSVAIV +
  S:     1 MHVALFHPQIPPNTGNIIRLCANTGVKLHIIHPTGFVWDDKRLRRAGLDYAEFAEITHHENWSDF--ARYFPKESCIWALTTRGKRCVY----DAAFSPNDV-LLFGSETSGLTEEVHAEIAPEHKLRLPMQACSRSLNLSNSVAIVLY 142
>gi|15605269|ref|NP_220055.1| rRNA methylase [Chlamydia trachomatis D/UW-3/CX] >gi|76789277|ref|YP_328363.1| rRNA methylase [Chlamydia trachomatis A/HAR-13] >gi|3328978|gb|AAC68142.1| rRNA Methylase (SpoU family) [Chlamydia trachomatis D/UW-3/CX] >gi|76167807|gb|AAX50815.1| rRNA methylase, SpoU family [Chlamydia trachomatis A/HAR-13] (151 aa)
Score = 259, Expect = 2.0e-21, Identities = 60/148 (40%), Positives = 80/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + IVL  P+IP+NTGNI RTCV   A L ++RP GF L DK +KRAG+DYW+ L     D     E   L     ++F +T    K  S   + EL  D    ++FG E+KGL   +++ Y    L I M    RS NL+ SV IV +
  S:     1 MRIVLHNPDIPQNTGNIGRTCVALGAELILVRPLGFSLADKFVKRAGMDYWERLSLSVVD---SLEEALLGVPKERIFCLTT---KGSSYYGERELPLDGT--YIFGAESKGLPQTVLDAYSSQCLYIPMIEGTRSLNLATSVGIVMY 140
>gi|58583829|ref|YP_202845.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84625632|ref|YP_453004.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188574839|ref|YP_001911768.1| hypothetical tRNA/rRNA methyltransferase YibK [Xanthomonas oryzae pv. oryzae PXO99A] >gi|58428423|gb|AAW77460.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84369572|dbj|BAE70730.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519291|gb|ACD57236.1| hypothetical tRNA/rRNA methyltransferase YibK [Xanthomonas oryzae pv. oryzae PXO99A] (158 aa)
Score = 259, Expect = 2.5e-21, Identities = 61/157 (38%), Positives = 91/157 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           +L+++LFQPEIP NTGN+ R C    A LH+I P GF L+DK++KRAGLDY ++   K +    D  S        +VF ++          T+  +  D   F     F+FG ET+GL +E++E    + +L++ M  + RS NLSN+VA++ F      NF
  S:     5 VLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYAPLKVH---VDLPSALAAIAPKRVFALS----------TRSTVRYDTPQFADGDAFLFGPETRGLPTEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNF 154
>gi|88858423|ref|ZP_01133065.1| putative tRNA/rRNA methyltransferase [Pseudoalteromonas tunicata D2] >gi|88820040|gb|EAR29853.1| putative tRNA/rRNA methyltransferase [Pseudoalteromonas tunicata D2] (154 aa)
Score = 258, Expect = 2.7e-21, Identities = 66/149 (44%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY--WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C     +LH+I P GF  +DKR++RAGLDY  + H+KR         ES     K  KV+  T          TK      +  F      +FG ET+GL  EI+E     Q L+I M  N RS NLSN+VA+  +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANTGYSLHLIEPLGFEWDDKRVRRAGLDYHEFSHVKRH-----PSLESYLATEKPKKVYACT----------TKGSGPYHQAQFAAGDCLLFGPETRGLPMEIIESLPNEQRLRIPMQPNSRSMNLSNAVAVFIY 142
>gi|153094194|gb|EDN75079.1| SpoU family rRNA methyltransferase [Mannheimia haemolytica PHL213] (159 aa)
Score = 258, Expect = 2.8e-21, Identities = 58/149 (38%), Positives = 95/149 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+N+GNI R C      LHMI PFGF  +DK+++R+GLDY + +  ++Y ++ DF  +    K  ++F +T   +++ S++ K EL      F +FG E++G+   ++ +    Q ++I M  + RS NLSNSVA+V +
  S:     1 MLDIVLYEPEIPQNSGNIIRLCANCGFRLHMIEPFGFGWDDKKLRRSGLDYHEFVDIQKYKNFEDFLER---AKPKRLFALTTRGEQNHSDV-KYELGD----FLMFGPESRGIPKPLLAEMPMSQKIRIPMCKDSRSMNLSNSVAVVVY 142
>gi|78045792|ref|YP_361967.1| TrmH family tRNA methyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78034222|emb|CAJ21867.1| tRNA/rRNA methyltransferase, SpoU class; TrmH family [Xanthomonas campestris pv. vesicatoria str. 85-10] (158 aa)
Score = 258, Expect = 2.9e-21, Identities = 60/157 (38%), Positives = 92/157 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           +L+++LFQPEIP NTGN+ R C    A LH+I P GF L+DK++KRAGLDY ++   + +   +D  S        +VF ++          T+  +  D   F     F+FG ET+GL +E++E    + +L++ M  + RS NLSN+VA++ F      NF
  S:     5 VLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYAPLQVH---TDLPSALAAIAPKRVFALS----------TRSTVRYDTPQFADGDAFLFGPETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNF 154
>gi|82702256|ref|YP_411822.1| tRNA/rRNA methyltransferase (SpoU) [Nitrosospira multiformis ATCC 25196] >gi|82410321|gb|ABB74430.1| tRNA/rRNA methyltransferase (SpoU) [Nitrosospira multiformis ATCC 25196] (153 aa)
Score = 258, Expect = 3.1e-21, Identities = 54/157 (34%), Positives = 91/157 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           M +++L+QPEIP NTGNI R C      LH+++P GF L DK + RAGLDY +      + DW +   + L +++ + F I+    +       D +T      F+FG E++GL ++++E + ++ +L++ M +  RS NLSN+VA++ +     T F
  S:     1 MFDVILYQPEIPPNTGNIIRLCANTGIRLHLVKPLGFTLEDKLLLRAGLDYHEFASITVHADWVECMDE-LGDRDRRFFAISTKGKQRY-----DLVTYSPGDAFLFGPESRGLPTDLLENFPEQHRLRVPMAAGSRSLNLSNAVAVIVYEAWRQTGF 152
>gi|120602052|ref|YP_966452.1| tRNA/rRNA methyltransferase (SpoU) [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120562281|gb|ABM28025.1| tRNA/rRNA methyltransferase (SpoU) [Desulfovibrio vulgaris subsp. vulgaris DP4] (188 aa)
Score = 258, Expect = 3.1e-21, Identities = 54/150 (36%), Positives = 81/150 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFH 150
           M++IVL+ PEIP NTGN++R C      LH+I P GF L+D+ +KRAGLDYW H+    +  W DF S+ +  +     L+T  A    +       T   +   VFG ET GL  E+++     ++ I +   +RS NLS +  +V + 
  S:    30 MMHIVLYHPEIPPNTGNVARLCAATRTRLHLIEPLGFSLDDRYLKRAGLDYWPHVPLTVWSSWEDFLSRGVEGRR----LVTTSARGGTA---VHRFTYAPDDMLVFGPETTGLPQEVLD-LTPHRVCIPIWGEVRSINLSTATGVVLYQ 171
>gi|21241004|ref|NP_640586.1| tRNA/rRNA methyltransferase [Xanthomonas axonopodis pv. citri str. 306] >gi|21106293|gb|AAM35122.1| tRNA/rRNA methyltransferase [Xanthomonas axonopodis pv. citri str. 306] (158 aa)
Score = 258, Expect = 3.1e-21, Identities = 60/157 (38%), Positives = 92/157 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           +L+++LFQPEIP NTGN+ R C    A LH+I P GF L+DK++KRAGLDY ++   + +   +D  S        +VF ++          T+  +  D   F     F+FG ET+GL +E++E    + +L++ M  + RS NLSN+VA++ F      NF
  S:     5 VLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYAPLQVH---ADLPSALAAIAPKRVFALS----------TRSTVRYDTPQFADGDAFLFGPETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNF 154
>gi|139438050|ref|ZP_01771603.1| Hypothetical protein COLAER_00591 [Collinsella aerofaciens ATCC 25986] >gi|133776247|gb|EBA40067.1| Hypothetical protein COLAER_00591 [Collinsella aerofaciens ATCC 25986] (199 aa)
Score = 258, Expect = 3.3e-21, Identities = 52/119 (43%), Positives = 75/119 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQN-LVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM 119
           M NIVL+ PEIP NTGNI RTCV   A LH++ P GF L+DK ++RAGL YW +L    Y  W DF ++N L   + ++ L+TK A ++ +  T     +D + + VFG E+ G+  E++
  S:     1 MFNIVLYAPEIPANTGNIGRTCVVTGAHLHLVEPLGFSLDDKTVRRAGLGYWQNLDVTTYAGWEDFLARNGLSPADERLHLLTKKARRTYAQST----YRDGD-YLVFGSESSGIPEELL 115
>gi|114776575|ref|ZP_01451620.1| RNA methyltransferase, TrmH family, group 2, putative [Mariprofundus ferrooxydans PV-1] >gi|114553405|gb|EAU55803.1| RNA methyltransferase, TrmH family, group 2, putative [Mariprofundus ferrooxydans PV-1] (155 aa)
Score = 257, Expect = 3.6e-21, Identities = 52/148 (35%), Positives = 82/148 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+IVL +PEIP NTGNI+R C    A LH++ P GF ++D+ +KRAGLDYW +L    +D W    S    N+N        +   S ++ +  ++T       VFG ET+GL++ I+ + +   + +  ++ +RS NL+    I  F
  S:     5 LHIVLVEPEIPPNTGNIARLCGCTGAALHLVHPLGFSVDDRSLKRAGLDYWQYLDVTHHDSWQQLRSSLDGNRNW-------YGMSSKASTSFWDVTYSHGDVLVFGPETRGLSAAILAEIQPLTVPMRADAPVRSLNLATVCGITLF 145
>gi|15835441|ref|NP_297200.1| spoU rRNA methylase family protein [Chlamydia muridarum Nigg] >gi|8163329|gb|AAF73607.1| spoU rRNA methylase family protein [Chlamydia muridarum Nigg] (151 aa)
Score = 257, Expect = 4.0e-21, Identities = 60/148 (40%), Positives = 79/148 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + IVL  P+IP+NTGNI RTCV   A L ++RP GF L DK +KRAG+DYWD L     D     E         K+F +T    K  S   + EL  D    ++FG E++GL   +++ Y    L I M    RS NL+ SV IV +
  S:     1 MRIVLHNPDIPQNTGNIGRTCVALGAELILVRPLGFSLADKFVKRAGMDYWDRLSLSVVD---SLEEALRGIPREKIFCLTT---KGSSYYGERELPLDGT--YIFGAESRGLPQTVLDAYSSQCLYIPMIEGTRSLNLATSVGIVMY 140
>gi|145621202|ref|ZP_01777190.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter bemidjiensis Bem] >gi|144942483|gb|EDJ77620.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter bemidjiensis Bem] >gi|197089047|gb|ACH40318.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter bemidjiensis Bem] (158 aa)
Score = 257, Expect = 4.0e-21, Identities = 58/148 (39%), Positives = 80/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            +IVL +PEIP NTGNI+R C      LH++   GF  +D+ +KRAGLDYW  +   E   W D  +       S+    +K A+KS    T   L  D   F VFG+ETKGL  E++E   +  ++I +   +RS NLS S  IV +
  S:     7 FHIVLVEPEIPPNTGNIARLCGATGTVLHLVGKLGFSTDDRYLKRAGLDYWSEV---EIHYWPDLPALKQAYPGSRFVYTSKKAEKSYLAFTF--LYGD---FIVFGKETKGLPEELIEANAQTSVRIPIPGKVRSLNLSTSAGIVLY 146
>gi|21229687|ref|NP_635604.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66766564|ref|YP_241326.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|188989626|ref|YP_001901636.1| RNA methyltransferase [Xanthomonas campestris pv. campestris] >gi|21111170|gb|AAM39528.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66571896|gb|AAY47306.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|167731386|emb|CAP49561.1| RNA methyltransferase [Xanthomonas campestris pv. campestris] (158 aa)
Score = 257, Expect = 4.1e-21, Identities = 59/157 (37%), Positives = 91/157 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           +L+++LFQPEIP NTGN+ R C    A LH+I P GF L+DK++KRAGLDY ++ + + + D        L    + +     FA  + S +  D     +   F+FG ET+GL +E++E    + +L++ M  + RS NLSN+VA++ F      NF
  S:     5 VLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYARLQVHPD--------LPTALATLAPKRVFALSTRSTVRYDTPQFADGDAFLFGPETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNF 154
>gi|156936222|ref|YP_001440138.1| putative tRNA/rRNA methyltransferase YibK [Enterobacter sakazakii ATCC BAA-894] >gi|156534476|gb|ABU79302.1| hypothetical protein ESA_04121 [Enterobacter sakazakii ATCC BAA-894] (157 aa)
Score = 256, Expect = 4.7e-21, Identities = 57/149 (38%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D++ F       K  ++F +T     + S      ++  +  + +FG ET+GL + I++   + Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFTAVMRHADYAAFLE---AEKPQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDVLPQEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|46580643|ref|YP_011451.1| RNA methyltransferase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46450062|gb|AAS96711.1| RNA methyltransferase, TrmH family [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (159 aa)
Score = 256, Expect = 4.8e-21, Identities = 54/150 (36%), Positives = 81/150 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFH 150
           M++IVL+ PEIP NTGN++R C      LH+I P GF L+D+ +KRAGLDYW H+    +  W DF S+ +  +     L+T  A    +       T   +   VFG ET GL  E+++     ++ I +   +RS NLS +  +V + 
  S:     1 MMHIVLYHPEIPPNTGNVARLCAATRTRLHLIEPLGFSLDDRYLKRAGLDYWPHVPLTVWASWEDFLSRGVEGRR----LVTTSARGGTA---VHRFTYAPDDMLVFGPETTGLPQEVLD-LTPHRVCIPIWGEVRSINLSTATGVVLYQ 142
>gi|82779099|ref|YP_405448.1| putative tRNA/rRNA methyltransferase YibK [Shigella dysenteriae Sd197] >gi|81243247|gb|ABB63957.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (157 aa)
Score = 256, Expect = 5.0e-21, Identities = 58/149 (38%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D+S F E++N      ++F +T     + S      ++  +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYSAFLEAEN----PQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVY 142
>gi|62184725|ref|YP_219510.1| putative rRNA methylase [Chlamydophila abortus S26/3] >gi|62147792|emb|CAH63538.1| putative rRNA methylase [Chlamydophila abortus S26/3] (156 aa)
Score = 256, Expect = 5.0e-21, Identities = 56/148 (37%), Positives = 82/148 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + +VL+ P+IP+NTGNI RTC+   A L ++RP GF L DK +KRAG+DYWD +     D     E    V+++    L TK A          ++    +  +VFG E+KGL  E+++KY      + M   IRS NL+ +V +V F
  S:     1 MKVVLYHPDIPQNTGNIGRTCIALGAELILVRPLGFSLLDKFVKRAGMDYWDKVNLSVVDSLD--EVLFGVDEDKIFCLSTKGAQ------YYGDVALPMDGVYVFGSESKGLPEEVLKKYYNHTYYLPMQPGIRSLNLATTVGVVLF 140
>gi|194431210|ref|ZP_03063503.1| RNA methyltransferase, TrmH family, group 2 [Shigella dysenteriae 1012] >gi|194420665|gb|EDX36741.1| RNA methyltransferase, TrmH family, group 2 [Shigella dysenteriae 1012] (160 aa)
Score = 256, Expect = 5.0e-21, Identities = 58/149 (38%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D+S F E++N      ++F +T     + S      ++  +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYSAFLEAEN----PQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVY 142
>gi|92115317|ref|YP_575245.1| RNA methyltransferase TrmH, group 2 [Chromohalobacter salexigens DSM 3043] >gi|91798407|gb|ABE60546.1| RNA methyltransferase TrmH, group 2 [Chromohalobacter salexigens DSM 3043] (164 aa)
Score = 255, Expect = 6.4e-21, Identities = 61/149 (40%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVLF+PEIP NTGN+ R C      LH+I P GF L+DKR++RAGLDY +  + K + DW  F ES     + ++V  ++             E+   E    VFG ET+GL   +++     Q L+I M  + RS NLSN+ AI+ F
  S:     1 MLDIVLFEPEIPPNTGNLIRLCANTGFRLHLIEPLGFALDDKRLRRAGLDYHEWARVKVHADWRAFLESV----QPARVLAVSTRGRTGYH-----EVAYREGDALVFGPETRGLPQAMLDALPPAQRLRIPMLPDSRSLNLSNACAILVF 142
>gi|157149223|ref|YP_001456542.1| putative tRNA/rRNA methyltransferase YibK [Citrobacter koseri ATCC BAA-895] >gi|157086428|gb|ABV16106.1| hypothetical protein CKO_05063 [Citrobacter koseri ATCC BAA-895] (157 aa)
Score = 255, Expect = 6.7e-21, Identities = 56/149 (37%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +    + + D++ F +        ++F +T     + S      ++  +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFAAVQRHHDYAAFVA---AENPQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPATILDALPAEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|15795087|ref|NP_284909.1| tRNA/rRNA methyltransferase [Neisseria meningitidis Z2491] >gi|121634138|ref|YP_974383.1| putative tRNA/rRNA methyltransferase [Neisseria meningitidis FAM18] >gi|120865844|emb|CAM09576.1| putative tRNA/rRNA methyltransferase [Neisseria meningitidis FAM18] >gi|121052957|emb|CAM09311.1| putative tRNA/rRNA methyltransferase [Neisseria meningitidis Z2491] (154 aa)
Score = 255, Expect = 7.0e-21, Identities = 57/149 (38%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFF------VFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M  IVL+QPEIP NTGNI R C    A LH+++P GF L+  +MKRAGLDY +      Y+++ D               +   A + I  LT     + +E  F      +FG ET+GL ++I++     Q +++ M    RS NLSN+VA++ F
  S:     1 MFTIVLYQPEIPPNTGNIIRLCANTGADLHLVKPLGFPLDSAKMKRAGLDYHEFASLTVYENFDD--------------CLKALAGRRIFALTTKGTARPDETAFQKGDVLLFGPETRGLPADILDSLPAAQKIRLPMQPGSRSMNLSNTVAVILF 142
>gi|118602767|ref|YP_903982.1| tRNA/rRNA methyltransferase (SpoU) [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567706|gb|ABL02511.1| tRNA/rRNA methyltransferase (SpoU) [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (153 aa)
Score = 255, Expect = 7.0e-21, Identities = 58/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLN+VLF+PEIP NTG I R C    A L +I+P+GF + DK+++RAGLDY + +   EYD++ D+    L  +  K   +     K+I    K +         + G ET+GL  +I+ +YK   L ++  S  RS NLSN  +IVA+
  S:     1 MLNLVLFEPEIPNNTGAIIRLCANMGANLRLIKPYGFEMEDKKLRRAGLDYKELMCVSEYDNFDDY----LEKEKPKNLFVVSSKVKTIYTDVKYQAGDS----LLLGPETRGLPQDILNQYKGITLPMQDKS--RSLNLSNCASIVAY 139
>gi|77359337|ref|YP_338912.1| tRNA/rRNA methyltransferase [Pseudoalteromonas haloplanktis TAC125] >gi|76874248|emb|CAI85469.1| putative tRNA/rRNA methyltransferase [Pseudoalteromonas haloplanktis TAC125] (154 aa)
Score = 254, Expect = 7.7e-21, Identities = 59/149 (39%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY--WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C     +LH+I P GF  +DKR+KRAGLDY  + H++R      + FE+     K  K++  T    +        +   +     VFG ET+GL  E+++     Q ++I M +N RS NLSN+V++  +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANTGYSLHLIEPLGFAWDDKRIKRAGLDYHEFSHVQRH-----ASFEAYLEACKPKKIYACTTKGSQ-----FHHQAQYEAGDCLVFGPETRGLPDELIQSLPNEQRVRIPMQANSRSMNLSNAVSVFVY 142
>gi|126665731|ref|ZP_01736712.1| predicted rRNA methylase [Marinobacter sp. ELB17] >gi|126629665|gb|EBA00282.1| predicted rRNA methylase [Marinobacter sp. ELB17] (154 aa)
Score = 254, Expect = 8.0e-21, Identities = 58/149 (38%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK-----DELTKDEEIFFVFGRETKGLTSEIMEKYKK-FQLKIEMNSNIRSFNLSNSVAIVAF 149
           MLN+VL++PEIP NTGNI R C      LH+I P GF L DKRM+RAGLDY ++   K             V+K+   FL ++   +     TK      E++  E  + +FG ET+GL + + +      +L++ M ++ RS NLSN+ A+V +
  S:     1 MLNVVLYEPEIPPNTGNIIRLCANTGCKLHLIEPLGFTLEDKRMRRAGLDYSEYASVK-------------VHKSYPAFLHSEQPQRLFGLTTKGSHYYHEVSYQEGDYLMFGPETRGLPAPVRDALPDGHRLRVPMCAHSRSLNLSNTAALVVY 142
>gi|121535177|ref|ZP_01666993.1| RNA methyltransferase, TrmH family, group 2 [Thermosinus carboxydivorans Nor1] >gi|121306286|gb|EAX47212.1| RNA methyltransferase, TrmH family, group 2 [Thermosinus carboxydivorans Nor1] (153 aa)
Score = 254, Expect = 8.1e-21, Identities = 58/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL +PEIP NTGNI+R C      LH+++P GF  +D+ +KRAGLDYW HL +  Y +  +F+           +  T  A K  +++     T  +    VFG+ET GL  E++       ++I M  + RS NLSN+VA+VA+
  S:     1 MLHIVLVEPEIPGNTGNIARLCAATCCELHLVKPLGFSTDDRHLKRAGLDYW-HLVKVHYHE--NFQEVADRYAGHNFYFNTTKAQKRYTDI---RYTAGD--VLVFGKETAGLPEELLRANWPNCIRIPMLEDARSLNLSNAVAVVAY 141
>gi|113474137|ref|YP_720198.1| tRNA/rRNA methyltransferase (SpoU) [Trichodesmium erythraeum IMS101] >gi|110165185|gb|ABG49725.1| tRNA/rRNA methyltransferase (SpoU) [Trichodesmium erythraeum IMS101] (153 aa)
Score = 254, Expect = 8.1e-21, Identities = 57/149 (38%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNS-NIRSFNLSNSVAIVAF 149
           M NIVL  P+IP+NTGN++RTC      LH++ P GF ++D+ +KRAGLDYW ++K   ++DW++F+    V  +     +  F+     N TK +   ++  + +FG ET GL  +++  Y    L I M   N+RS NLS S A+  F
  S:     1 MPNIVLVYPQIPQNTGNVARTCAATKTELHLVGPLGFEISDRYLKRAGLDYWPYVKLNYHNDWAEFK----VYHHKLGGRLIGFSKMGKLNYTKFQYQTND--WLLFGSETNGLPKDVL-NYCSATLYIPMTQPNVRSLNLSVSAALGLF 143
>gi|152985329|ref|YP_001351180.1| putative rRNA methylase [Pseudomonas aeruginosa PA7] >gi|150960487|gb|ABR82512.1| probable rRNA methylase [Pseudomonas aeruginosa PA7] (153 aa)
Score = 254, Expect = 9.4e-21, Identities = 55/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C     +LH+I P GF L+DKR++RAGLDY ++   + Y D  D  E+        ++F  T    ++       E+       F+FG E++GL  E+      + +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRYPDLQDCLEALG----QPRLFAFTTKGSRAFH-----EVAYQRGDAFLFGPESRGLPEEVRNALPAERRLRLPMREGCRSLNLSNTVAVTVY 142
>gi|154520210|gb|ABS82777.1| RNA methyltransferase [uncultured Methylophaga sp.] (154 aa)
Score = 254, Expect = 9.6e-21, Identities = 56/149 (37%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+I L++PEIP NTGNI R C    A LH+I P  F+L+DKR++RAGLDY +    K + D++ F+      +N  +F  T  A +        + T  +E   +FG E++GL + +++     Q ++I M    RS NLSN+ AI+ +
  S:     1 MLHIALYEPEIPPNTGNIIRLCANTGAQLHLIEPLAFVLDDKRLRRAGLDYHEFAPVKVHADFAAFQQW---QQNRPLFACTTKAKQ-----FHHQATFIDESILLFGPESRGLPATLLDNLPDRQKIRIPMYPESRSLNLSNATAIILY 142
>gi|66048105|ref|YP_237946.1| RNA methyltransferase TrmH, group 2 [Pseudomonas syringae pv. syringae B728a] >gi|63258812|gb|AAY39908.1| RNA methyltransferase TrmH, group 2 [Pseudomonas syringae pv. syringae B728a] (151 aa)
Score = 254, Expect = 9.6e-21, Identities = 53/149 (35%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGN+ R C     TLH+I P GF L+DKR++RAGLDY ++   + + D +    +     N +VF  T    +   + + +         F+FG E++GL ++I++    + +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNVIRLCANSGCTLHLIEPLGFELDDKRLRRAGLDYHEYATLQTHADLASCLEK---IGNPRVFAFTTKGSRPFHDASFEPGDA-----FLFGPESRGLPADILDSLSSEHRLRLPMREGCRSLNLSNTVAVAVY 142
>gi|119473213|ref|ZP_01614899.1| putative tRNA/rRNA methyltransferase [Alteromonadales bacterium TW-7] >gi|119444544|gb|EAW25860.1| putative tRNA/rRNA methyltransferase [Alteromonadales bacterium TW-7] (154 aa)
Score = 253, Expect = 1.0e-20, Identities = 62/149 (41%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY--WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C     +LH+I P GF  +DKR+KRAGLDY  + H++R      + FE+     K  KV+  T    +        E   +     VFG ET+GL  E+++     Q ++I M  N RS NLSN+VA+  +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANTGFSLHLIEPLGFEWDDKRVKRAGLDYHEFSHVQRH-----ASFEAYLEKCKPKKVYACTTKGSQ-----FHHEARYEAGDCLVFGPETRGLPDEMIQALPNEQRVRIPMQPNSRSMNLSNAVAVFVY 142
>gi|146309796|ref|YP_001174870.1| putative tRNA/rRNA methyltransferase YibK [Enterobacter sp. 638] >gi|145316672|gb|ABP58819.1| RNA methyltransferase, TrmH family, group 2 [Enterobacter sp. 638] (157 aa)
Score = 253, Expect = 1.0e-20, Identities = 57/149 (38%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVLF+PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D++ F +        ++F +T     + S      ++  E  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFTAVVRHHDYAAFVA---AENPQRMFALTTKGTPAHS-----AVSYQEGDYLMFGPETRGLPATILDVLPAEQKIRIPMMPDSRSMNLSNAVSVVVY 142
>gi|148377353|ref|YP_001256229.1| tRNA/rRNA methyltransferase [Mycoplasma agalactiae PG2] >gi|148291399|emb|CAL58783.1| tRNA/rRNA methyltransferase [Mycoplasma agalactiae PG2] (177 aa)
Score = 253, Expect = 1.1e-20, Identities = 60/160 (37%), Positives = 97/160 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKR-AGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           M++IVLF+PEIP NT NI RTC    A LH+I+P  F L+ K + R A       ++ + +D +SDF ++    K+  ++ IT++  K+ S++  K E   ++EI+ +FG+E+ G+  ++++      L+I M S +RS NL+N VAIV F      +F DL
  S:     1 MVHIVLFKPEIPPNTANIIRTCFAIGAKLHIIKPISFSLDPKYLSRPAAGRLLSDIEHEVHDSYSDFYNK---YKDKNIYYITRYGLKTYSDVDFKKEYENNDEIWLMFGKESTGIDKQVLKDNIDNCLRIPMISKMRSINLANCVAIVGFEVMRQIDFKDL 159
>gi|46143316|ref|ZP_00135490.2| COG0219: Predicted rRNA methylase (SpoU class) [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207549|ref|YP_001052774.1| putative tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|165975518|ref|YP_001651111.1| tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149330|ref|YP_001967855.1| putative tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126096341|gb|ABN73169.1| putative tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|165875619|gb|ABY68667.1| probable tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189914461|gb|ACE60713.1| putative tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (159 aa)
Score = 252, Expect = 1.4e-20, Identities = 54/149 (36%), Positives = 92/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+N+GNI R C      LHMI P GF  +DK+++R+GLDY + +  ++Y ++ DF  +    K  ++F +T   + + S     E++ +   F +FG E++G+   I++     Q +++ M  + RS NLSN+VA+V +
  S:     1 MLDIVLYEPEIPQNSGNIIRLCANCGFRLHMIEPLGFAWDDKKLRRSGLDYHEFVDIQKYKNFEDFLER---AKPKRLFALTTKGEPNHS-----EVSYELGDFLMFGPESRGIPMTILDNLPMSQKIRVPMCKDSRSMNLSNTVAVVVY 142
>gi|15828774|ref|NP_326134.1| tRNA/rRNA methyltransferase [Mycoplasma pulmonis UAB CTIP] >gi|14089717|emb|CAC13476.1| TRNA/RRNA METHYLTRANSFERASE [Mycoplasma pulmonis] (174 aa)
Score = 252, Expect = 1.4e-20, Identities = 58/149 (38%), Positives = 95/149 (63%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY-WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKD--EEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M+NIVL+QPEIP NTGNI RTC   ++ LH+I+P  F LN + +KR+   +    ++ + +D ++DF ++    +N  +F IT+++ KS S++     T D  ++IFFVFG E+ G+  +I+ +     L+I M    RS NL+NSV ++ +
  S:     1 MINIVLYQPEIPPNTGNIIRTCFATSSKLHIIKPIAFDLNPRFLKRSAAGHLLSEIQHEVHDSYNDFLAK---YQNENIFYITRYSQKSYSDIDFKLETFDGKKDIFFVFGTESTGIPKKILSQNIDKTLRIPMAPENRSLNLANSVVVIIY 149
>gi|72382186|ref|YP_291541.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. NATL2A] >gi|72002036|gb|AAZ57838.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. NATL2A] (166 aa)
Score = 252, Expect = 1.5e-20, Identities = 60/146 (41%), Positives = 89/146 (60%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK----------KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + LF+P IP+NTG I RTC+ FN +L +I+P GF   DK +KRAGLDYW H+    Y+ +  +++     KNS++  +TK ++  ISN+    + KD +I  +FGRE  GL   I+ K +          + QLK      +RS NLS +  IV +
  S:    11 VALFEPRIPQNTGTIGRTCLAFNMSLDIIKPTGFSFEDKYLKRAGLDYWPHVDVHLYESFEQYKNS---FKNSRIIALTKKSNNLISNI----IYKDTDI-LLFGREDTGLPESIINKCEIVAGIPMPGGENQLK---TGGVRSLNLSVASGIVCY 155
>gi|53803355|ref|YP_114950.1| RNA methyltransferase [Methylococcus capsulatus str. Bath] >gi|53757116|gb|AAU91407.1| RNA methyltransferase, TrmH family, group 2 [Methylococcus capsulatus str. Bath] (159 aa)
Score = 252, Expect = 1.5e-20, Identities = 52/149 (34%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKK-FQLKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL++PEIP NTGN+ R C    A LH+I P GF ++D R++RAGLDY +  +   + DW  F          ++F +T   + S +++T           F+FG E++GL + ++ +++   ++++ M    RS NLSN+VA+V F
  S:     1 MFHVVLYEPEIPPNTGNVIRLCANTGACLHLIEPLGFEMDDARLRRAGLDYREWAEVARHRDWEGFVG---AVAPERIFALTTRGEVSHADVTYRPGDA-----FLFGPESRGLPAALLARFETGRRIRLPMRPGSRSLNLSNAVAVVCF 142
>gi|16131477|ref|NP_418063.1| predicted rRNA methylase [Escherichia coli str. K-12 substr. MG1655] >gi|26250250|ref|NP_756290.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli CFT073] >gi|89110405|ref|AP_004185.1| predicted rRNA methylase [Escherichia coli W3110] >gi|91213120|ref|YP_543106.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli UTI89] >gi|110643850|ref|YP_671580.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli 536] >gi|117625884|ref|YP_859207.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli APEC O1] >gi|170083114|ref|YP_001732434.1| rRNA methylase [Escherichia coli str. K12 substr. DH10B] >gi|170680159|ref|YP_001745908.1| RNA methyltransferase [Escherichia coli SMS-3-5] >gi|191170469|ref|ZP_03032022.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli F11] >gi|84028008|sp|P0AGJ7|YIBK_ECOLI Uncharacterized tRNA/rRNA methyltransferase yibK >gi|84028007|sp|P0AGJ8|YIBK_ECOL6 Uncharacterized tRNA/rRNA methyltransferase yibK >gi|26110679|gb|AAN82864.1|AE016768_282 Hypothetical tRNA/rRNA methyltransferase yibK [Escherichia coli CFT073] >gi|466744|gb|AAB18583.1| alternate gene name yibK [Escherichia coli] >gi|1790034|gb|AAC76630.1| predicted rRNA methylase [Escherichia coli str. K-12 substr. MG1655] >gi|85676436|dbj|BAE77686.1| predicted rRNA methylase [Escherichia coli W3110] >gi|91074694|gb|ABE09575.1| hypothetical protein UTI89_C4147 [Escherichia coli UTI89] >gi|110345442|gb|ABG71679.1| hypothetical tRNA/rRNA methyltransferase YibK [Escherichia coli 536] >gi|115515008|gb|ABJ03083.1| predicted rRNA methylase [Escherichia coli APEC O1] >gi|169890949|gb|ACB04656.1| predicted rRNA methylase [Escherichia coli str. K12 substr. DH10B] >gi|170517877|gb|ACB16055.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli SMS-3-5] >gi|190909277|gb|EDV68863.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli F11] (157 aa)
Score = 251, Expect = 2.0e-20, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D+  F E++N      ++F +T     + S      ++  +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAEN----PQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVY 142
>gi|24114875|ref|NP_709385.1| putative tRNA/rRNA methyltransferase YibK [Shigella flexneri 2a str. 301] >gi|30065118|ref|NP_839289.1| putative tRNA/rRNA methyltransferase YibK [Shigella flexneri 2a str. 2457T] >gi|74314157|ref|YP_312576.1| putative tRNA/rRNA methyltransferase YibK [Shigella sonnei Ss046] >gi|82545974|ref|YP_409921.1| putative tRNA/rRNA methyltransferase YibK [Shigella boydii Sb227] >gi|110807718|ref|YP_691238.1| putative tRNA/rRNA methyltransferase YibK [Shigella flexneri 5 str. 8401] >gi|187730115|ref|YP_001882306.1| RNA methyltransferase, TrmH family, group 2 [Shigella boydii CDC 3083-94] >gi|24054114|gb|AAN45092.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30043379|gb|AAP19100.1| hypothetical protein S4123 [Shigella flexneri 2a str. 2457T] >gi|73857634|gb|AAZ90341.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|81247385|gb|ABB68093.1| conserved hypothetical protein [Shigella boydii Sb227] >gi|110617266|gb|ABF05933.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] >gi|187427107|gb|ACD06381.1| RNA methyltransferase, TrmH family, group 2 [Shigella boydii CDC 3083-94] (157 aa)
Score = 251, Expect = 2.0e-20, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D+  F E++N      ++F +T     + S      ++  +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAEN----PQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVY 142
>gi|71737140|ref|YP_277002.1| RNA methyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557693|gb|AAZ36904.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas syringae pv. phaseolicola 1448A] (151 aa)
Score = 251, Expect = 2.1e-20, Identities = 52/149 (34%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGN+ R C     TLH+I P GF L+DKR++RAGLDY ++   + + D +    +     N ++F  T    +   + + +         F+FG E++GL ++I++    + +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNVIRLCANSGCTLHLIEPLGFELDDKRLRRAGLDYHEYATLQTHPDLASCLEK---IGNPRLFAFTTKGSRPFHDASFEPGDA-----FLFGPESRGLPADILDSLSSEHRLRLPMREGCRSLNLSNTVAVAVY 142
>gi|50085960|ref|YP_047470.1| putative tRNA/rRNA methyltransferase [Acinetobacter sp. ADP1] >gi|49531936|emb|CAG69648.1| putative tRNA/rRNA methyltransferase [Acinetobacter sp. ADP1] (159 aa)
Score = 250, Expect = 2.3e-20, Identities = 54/149 (36%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDD----WSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M+++VLF+PEIP NTGNI R C    A LH+++P GF L+DK++KRAGLDY ++ + K +D+        +SQ +    S +F +T     +  + T   +  +  +  + G ET+GL   +   + +K  +++ M  N RS NLSN+ A++ +
  S:     1 MIHVVLFEPEIPANTGNIIRLCANTGAQLHLVKPLGFELDDKKLKRAGLDYHEYARMKIWDNIEQCLESLKSQGI--SESDIFPLT-----TKGSATPHTVDLNRPVALLMGPETRGLPESVRFMFPQKNWIRLPMAENSRSLNLSNATAVIVY 147
>gi|59802048|ref|YP_208760.1| hypothetical protein NGO1727 [Neisseria gonorrhoeae FA 1090] >gi|194099620|ref|YP_002002751.1| SpoU [Neisseria gonorrhoeae NCCP11945] >gi|59718943|gb|AAW90348.1| putative tRNA/rRNA methyltransferase [Neisseria gonorrhoeae FA 1090] >gi|193934910|gb|ACF30734.1| SpoU [Neisseria gonorrhoeae NCCP11945] (154 aa)
Score = 250, Expect = 2.3e-20, Identities = 56/149 (37%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFF------VFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML IVL+QPEIP NTGNI R C    A LH+++P GF L+  +MKRAGLDY +      ++++ D               +   A + I  LT     + +E  F      +FG ET+GL ++I++     Q +++ M    RS NLSN+V+++ F
  S:     1 MLTIVLYQPEIPPNTGNIIRLCANTGADLHLVKPLGFPLDSAKMKRAGLDYHEFASLTVHENFDD--------------CLKSLAGRRIFALTTKGTARPDETAFQKGDVLLFGPETRGLPADILDSLPAAQKIRLPMRPGSRSMNLSNTVSVILF 142
>gi|194363941|ref|YP_002026551.1| tRNA/rRNA methyltransferase (SpoU) [Stenotrophomonas maltophilia R551-3] >gi|194346745|gb|ACF49868.1| tRNA/rRNA methyltransferase (SpoU) [Stenotrophomonas maltophilia R551-3] (159 aa)
Score = 250, Expect = 2.4e-20, Identities = 52/148 (35%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKK-FQLKIEMNSNIRSFNLSNSVAIVAF 149
            +++LFQPEIP NTGN+ R C    A LH++ P GF L DK++KRAGLDY ++ + + + D        L    +++     FA  + +++  D +  D+   F+FG E++GL  ++++      +L++ M  + RS NLSN+VA+V +
  S:     7 FHVILFQPEIPPNTGNVIRLCANTGAQLHLVEPLGFALEDKQLKRAGLDYHEYSRLQVHPD--------LDTALARIAPKRLFALSTRASVRYDSVAFDDGDAFLFGPESRGLPQDVLDALPDGHRLRLPMRPDNRSLNLSNTVAVVMY 147
>gi|116053273|ref|YP_793597.1| putative rRNA methylase [Pseudomonas aeruginosa UCBPP-PA14] >gi|115588494|gb|ABJ14509.1| putative RNA methylase [Pseudomonas aeruginosa UCBPP-PA14] (153 aa)
Score = 250, Expect = 2.5e-20, Identities = 54/149 (36%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C     +LH+I P GF L+DKR++RAGLDY ++   + Y    D +S       S++F  T    ++       E+       F+FG E++GL  ++        +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRY---PDLQSCLEALGQSRLFAFTTKGSRAFH-----EVAYQRGDAFLFGPESRGLPEDVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVY 142
>gi|50365192|ref|YP_053617.1| rRNA methyltransferase [Mesoplasma florum L1] >gi|50363748|gb|AAT75733.1| rRNA methyltransferase [Mesoplasma florum L1] (179 aa)
Score = 250, Expect = 2.7e-20, Identities = 52/148 (35%), Positives = 87/148 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +NIVL++PEI +N   I RTCV  NA LH+I P GFI   + M RA    +D ++ + YDDW DF  +   N +  +F I+++ +K  S+   +   K   +F +FG+E+ G+  +I++   +   ++ M+   RS N++N+V IV +
  S:     5 VNIVLYEPEIAQNVAAIIRTCVATNAKLHIIEPLGFIFKKEEMNRASAGTFDLVEYQLYDDWEDFCEK---NPSIDLFCISRYGEKPHSDFDFNSYQK--PVFVMFGKESTGIPKQIIKDNYENTFRLPMSPQTRSINVANTVGIVTY 147
>gi|29654808|ref|NP_820500.1| RNA methyltransferase [Coxiella burnetii RSA 493] >gi|153208685|ref|ZP_01946932.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii 'MSU Goat Q177'] >gi|161830683|ref|YP_001597358.1| RNA methyltransferase [Coxiella burnetii RSA 331] >gi|165919332|ref|ZP_02219418.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii RSA 334] >gi|29542076|gb|AAO91014.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii RSA 493] >gi|120575796|gb|EAX32420.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii 'MSU Goat Q177'] >gi|161762550|gb|ABX78192.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii RSA 331] >gi|165916992|gb|EDR35596.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii RSA 334] (152 aa)
Score = 250, Expect = 2.8e-20, Identities = 61/149 (40%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF----------FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +I LF+PEIP NTGNI R C    A+LH+I P GF L++KR++RAGLDY +      YD +  F+S               FA+  I   T    TK + I+          F+FG ET+GL +EI  ++    Q++I M +  RS NL+N+V+I+ +
  S:     1 MFHIALFEPEIPPNTGNIIRLCANAGASLHLIHPLGFSLDEKRLQRAGLDYREWATIIHYDHFEAFKS--------------AFAEHRIFACT----TKGKTIYADVHYRSSDVFLFGPETRGLPAEIRTQFPDSQQIRIPMVTEKRSINLANTVSIILY 142
>gi|157163090|ref|YP_001460408.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli HS] >gi|170018161|ref|YP_001723115.1| RNA methyltransferase [Escherichia coli ATCC 8739] >gi|188491907|ref|ZP_02999177.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli 53638] >gi|194435762|ref|ZP_03067865.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli 101-1] >gi|157068770|gb|ABV08025.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli HS] >gi|169753089|gb|ACA75788.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli ATCC 8739] >gi|188487106|gb|EDU62209.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli 53638] >gi|194425305|gb|EDX41289.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli 101-1] (157 aa)
Score = 250, Expect = 2.8e-20, Identities = 57/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D+  F E++N      ++F +T     + S      ++  +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDFRAFLEAEN----PQRLFALTTKGTPAHS-----AVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVY 142
>gi|15676192|ref|NP_273324.1| RNA methyltransferase [Neisseria meningitidis MC58] >gi|7225492|gb|AAF40722.1| RNA methyltransferase, TrmH family [Neisseria meningitidis MC58] (154 aa)
Score = 249, Expect = 2.9e-20, Identities = 56/149 (37%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFF------VFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M  IVL+QPEIP NTGNI R C    A LH+++P GF L+  +MKRAGLDY +      ++++ D               +   A + I  LT     + +E  F      +FG ET+GL ++I++     Q +++ M    RS NLSN+VA++ F
  S:     1 MFTIVLYQPEIPPNTGNIIRLCANTGADLHLVKPLGFPLDSAKMKRAGLDYHEFASLTVHENFDD--------------CLKALAGRRIFALTTKGTARPDETAFQKGDVLLFGPETRGLPADILDSLPAAQKIRLPMQPGSRSMNLSNTVAVILF 142
>gi|42630400|ref|ZP_00155944.1| COG0219: Predicted rRNA methylase (SpoU class) [Haemophilus influenzae R2846] >gi|46133126|ref|ZP_00203087.1| COG0219: Predicted rRNA methylase (SpoU class) [Haemophilus influenzae R2866] >gi|68249362|ref|YP_248474.1| putative RNA methyltransferase [Haemophilus influenzae 86-028NP] >gi|145638435|ref|ZP_01794045.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae PittII] >gi|68057561|gb|AAX87814.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae 86-028NP] >gi|145272764|gb|EDK12671.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae PittII] (160 aa)
Score = 249, Expect = 3.1e-20, Identities = 60/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K EL      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGSPAHSQV-KFELGD----YLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|152977823|ref|YP_001343452.1| RNA methyltransferase [Actinobacillus succinogenes 130Z] >gi|150839546|gb|ABR73517.1| RNA methyltransferase, TrmH family, group 2 [Actinobacillus succinogenes 130Z] (158 aa)
Score = 249, Expect = 3.1e-20, Identities = 58/149 (38%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S     E+  +   F +FG ET+G+   I++    + +++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFERFIESE----KPKRLFALTTKGGPAHS-----EVRFESGDFLMFGPETRGIPMSILDNMPMERKIRIPMTANSRSMNLSNSVAVAVY 142
>gi|124025726|ref|YP_001014842.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. NATL1A] >gi|123960794|gb|ABM75577.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. NATL1A] (166 aa)
Score = 249, Expect = 3.2e-20, Identities = 60/147 (40%), Positives = 89/147 (60%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK----------KFQLKIEMNSNIRSFNLSNSVAIVAFH 150
           + LF+P IP+NTG I RTC+ FN +L +I+P GF   DK +KRAGLDYW H+    Y+ +  +++     KNS++   TK ++  ISN+    + KD +I  +FGRE  GL   I+ K +          + QLK      +RS NLS +  IV ++
  S:    11 VSLFEPRIPQNTGTIGRTCLAFNMSLDIIKPTGFSFEDKYLKRAGLDYWPHVDVHLYESFDQYKNS---FKNSRIIAFTKKSNNLISNI----IYKDTDI-LLFGREDTGLPESIINKCEIVAGIPMPGGENQLK---TGGVRSLNLSVASGIVCYY 156
>gi|107104223|ref|ZP_01368141.1| hypothetical protein PaerPA_01005296 [Pseudomonas aeruginosa PACS2] >gi|194554978|ref|YP_002090004.1| hypothetical protein PA2G_04825 [Pseudomonas aeruginosa 2192] >gi|126197371|gb|EAZ61434.1| hypothetical protein PA2G_04825 [Pseudomonas aeruginosa 2192] (153 aa)
Score = 249, Expect = 3.4e-20, Identities = 53/149 (35%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C     +LH+I P GF L+DKR++RAGLDY ++   + Y    D +S        ++F  T    ++       E+    +  F+FG E++GL  ++        +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRY---PDLQSCLEALGQPRLFAFTTKGSRAFH-----EVAYQRDDAFLFGPESRGLPEDVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVY 142
>gi|89900467|ref|YP_522938.1| tRNA/rRNA methyltransferase (SpoU) [Rhodoferax ferrireducens T118] >gi|89345204|gb|ABD69407.1| tRNA/rRNA methyltransferase (SpoU) [Rhodoferax ferrireducens T118] (161 aa)
Score = 249, Expect = 3.5e-20, Identities = 58/149 (38%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +PEIP NTGNI R        LH+I P GF ++DK M+RAGLDY ++   K +  W  F +        ++F +T  A +S+      E       + VFG ETKGL+  + + +   Q LK+ M    RS NLSN+VA+  F
  S:     1 MFHIVLVEPEIPPNTGNIIRLSANTGCALHLIEPLGFSMDDKHMRRAGLDYHEYATVKRHASWQAFLAGEQ-PAPERMFALTTRAGRSVY-----EAQFAPGDWLVFGSETKGLSDAVRQSFTLAQSLKLPMIEGQRSLNLSNAVAVTVF 144
>gi|117618548|ref|YP_854721.1| RNA methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559955|gb|ABK36903.1| RNA methyltransferase, TrmH family, group 2 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (168 aa)
Score = 248, Expect = 3.7e-20, Identities = 62/149 (41%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT---KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C      LH+I P GF  +DKR+KRAGLDY +  + K    W +FE+       ++VF  T   + A  ++     D L        +FG E++GL  EI+E     Q L+I M    RS NL+N+VA+  +
  S:    13 MLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIEPLGFEWDDKRVKRAGLDYHEFAEVKR---WPNFEAFLEAVAPTRVFACTTKGRTAHSAVQFAAGDAL--------LFGPESRGLPIEIIESLPFEQRLRIPMLPQSRSMNLANAVAVFVY 154
>gi|120556073|ref|YP_960424.1| RNA methyltransferase [Marinobacter aquaeolei VT8] >gi|120325922|gb|ABM20237.1| RNA methyltransferase, TrmH family, group 2 [Marinobacter aquaeolei VT8] (154 aa)
Score = 248, Expect = 3.8e-20, Identities = 54/149 (36%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML++VL++PEIP NTGNI R C      LH+I P GF L DK+M+RAGLDY ++   K + D+  F +     + S++F +T    +        E+   +  + +FG ET+GL  ++      + +L++ M    RS NLSN+ A+V +
  S:     1 MLHVVLYEPEIPPNTGNIIRLCANTGCQLHLIEPLGFSLEDKQMRRAGLDYSEYATVKIHPDYDSFLA---TEQPSRLFGLTTKGSRHYH-----EVAFRDGDYLMFGPETRGLPEDVRNGLPAEHRLRVPMRPESRSLNLSNTAALVVY 142
>gi|145634823|ref|ZP_01790531.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae PittAA] >gi|145267989|gb|EDK07985.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae PittAA] (160 aa)
Score = 248, Expect = 3.8e-20, Identities = 60/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K EL      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGSPAHSQV-KFELGD----YLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|116327528|ref|YP_797248.1| rRNA methylase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331859|ref|YP_801577.1| rRNA methylase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116120272|gb|ABJ78315.1| rRNA methylase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125548|gb|ABJ76819.1| rRNA methylase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (153 aa)
Score = 248, Expect = 3.8e-20, Identities = 53/148 (35%), Positives = 90/148 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           L+I L++PEIP NTGNI+R CV   A LH+I    F L++K  +RAGLDYWD +K   +    ++++  ++   +  +LI+ +  +S +++   E        F+FG ET G+ +++   + + + LKI M  + R  NLSNSVA++++
  S:     3 LHIGLYRPEIPPNTGNIARLCVALGAELHIIGQASFDLSEKAARRAGLDYWDKVKISFHSSLEEYKA--ILPSGTDPYLISVYGKRSYTDVQYKEGDA-----FLFGNETSGVPTKMKNSWSEERILKIPMEDSSRCLNLSNSVAVISY 144
>gi|118474338|ref|YP_891998.1| tRNA/rRNA methyltransferase [Campylobacter fetus subsp. fetus 82-40] >gi|118413564|gb|ABK81984.1| tRNA/rRNA methyltransferase [Campylobacter fetus subsp. fetus 82-40] (162 aa)
Score = 248, Expect = 4.1e-20, Identities = 59/149 (39%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +PEI  NTG+I R CV     LH+I+P GF+L+DK +KRAGLDYWD L    ++   DF +QN+  K+   F  TK      +N         +  F  FG E  GL  ++M+  K+  + I M+ + RS NL+ SV I+ +
  S:     1 MFDIVLVRPEIHTNTGSIGRMCVNSGCRLHLIKPLGFMLDDKHLKRAGLDYWDKLDLVIWESLDDFLTQNIKFKDRFFFATTK------TNRLYFNTKFQKGDFLFFGAEGSGLPLDLMKIKKENCITIPMSGDGRSLNLATSVGIITY 143
>gi|15804150|ref|NP_290189.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli O157:H7 EDL933] >gi|15833738|ref|NP_312511.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli O157:H7 str. Sakai] >gi|157158942|ref|YP_001465089.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli E24377A] >gi|168709281|ref|ZP_02741558.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4045] >gi|168716790|ref|ZP_02749067.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4206] >gi|168735112|ref|ZP_02767389.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4115] >gi|168746844|ref|ZP_02771866.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4113] >gi|168753429|ref|ZP_02778436.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4401] >gi|168759703|ref|ZP_02784710.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4501] >gi|168766025|ref|ZP_02791032.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4486] >gi|168772428|ref|ZP_02797435.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4196] >gi|168779761|ref|ZP_02804768.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4076] >gi|168785483|ref|ZP_02810490.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC869] >gi|168791174|ref|ZP_02816181.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4042] >gi|168797449|ref|ZP_02822456.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC508] >gi|191168138|ref|ZP_03029935.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli B7A] >gi|193066094|ref|ZP_03047150.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli E22] >gi|193068534|ref|ZP_03049496.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli E110019] >gi|194427425|ref|ZP_03059974.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli B171] >gi|195935135|ref|ZP_03080517.1| putative tRNA/rRNA methyltransferase YibK [Escherichia coli O157:H7 str. EC4024] >gi|12518356|gb|AAG58753.1|AE005588_4 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|13363959|dbj|BAB37907.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|157080972|gb|ABV20680.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli E24377A] >gi|187771711|gb|EDU35555.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4196] >gi|188018363|gb|EDU56485.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4113] >gi|189002486|gb|EDU71472.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4076] >gi|189358940|gb|EDU77359.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4401] >gi|189364523|gb|EDU82942.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4486] >gi|189369515|gb|EDU87931.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC4501] >gi|189374384|gb|EDU92800.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC869] >gi|189380038|gb|EDU98454.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli O157:H7 str. EC508] >gi|190901807|gb|EDV61559.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli B7A] >gi|192926256|gb|EDV80894.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli E22] >gi|192958185|gb|EDV88626.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli E110019] >gi|194414465|gb|EDX30738.1| RNA methyltransferase, TrmH family, group 2 [Escherichia coli B171] (157 aa)
Score = 248, Expect = 4.3e-20, Identities = 57/149 (38%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      + D+  F E++N      ++F +T     + S      +   +  + +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDFRAFLEAEN----PQRLFALTTKGTPAHS-----AVNYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVY 142
>gi|148826591|ref|YP_001291344.1| putative RNA methyltransferase [Haemophilus influenzae PittEE] >gi|148716751|gb|ABQ98961.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae PittEE] (160 aa)
Score = 248, Expect = 4.7e-20, Identities = 60/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K EL      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGSPAHSQV-KFELGD----YLMFGPETRGIPMSILNEMPLEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|145632119|ref|ZP_01787854.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae 3655] >gi|148827956|ref|YP_001292709.1| putative RNA methyltransferase [Haemophilus influenzae PittGG] >gi|144987026|gb|EDJ93556.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae 3655] >gi|148719198|gb|ABR00326.1| conserved hypothetical tRNA/rRNA methyltransferase [Haemophilus influenzae PittGG] (160 aa)
Score = 248, Expect = 4.7e-20, Identities = 60/149 (40%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K EL      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGSPAHSQV-KFELGD----YLMFGPETRGIPMSILNEMPLEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|28872435|ref|NP_795054.1| RNA methyltransferase [Pseudomonas syringae pv. tomato str. DC3000] >gi|28855690|gb|AAO58749.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas syringae pv. tomato str. DC3000] (151 aa)
Score = 248, Expect = 4.8e-20, Identities = 54/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQ-------NLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGN+ R C     TLH+I P GF L+DKR++RAGLDY ++   + + D +    +           K S+ F    FA                   F+FG E++GL ++I++    + +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNVIRLCANSGCTLHLIEPLGFELDDKRLRRAGLDYHEYATLQTHADLASCLEKIGNPRLFAFTTKGSRPFHDASFAPGDA---------------FLFGPESRGLPADILDSLSSEHRLRLPMREGCRSLNLSNTVAVAVY 142
>gi|153834908|ref|ZP_01987575.1| RNA methyltransferase, TrmH family, group 2 [Vibrio harveyi HY01] >gi|148868634|gb|EDL67718.1| RNA methyltransferase, TrmH family, group 2 [Vibrio harveyi HY01] (159 aa)
Score = 247, Expect = 5.0e-20, Identities = 58/149 (38%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D+  F       K     L   FA  + +     +    E    +FG ET+GL +E++E     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYQAFLEYLEKEKQGNYRL---FACTTKTTGHHVDAKYQEGDVLMFGPETRGLPAEVIESLPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|71065779|ref|YP_264506.1| tRNA/rRNA methyltransferase [Psychrobacter arcticus 273-4] >gi|71038764|gb|AAZ19072.1| probable tRNA/rRNA methyltransferase [Psychrobacter arcticus 273-4] (186 aa)
Score = 247, Expect = 5.6e-20, Identities = 60/148 (40%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWS-------DFESQN---LVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ++IVL  P++P NTGNI R C    A LH+++P GF L+DK+++RAGLDY ++   + +DDWS       D +      L  K SK F    F  +  +  +  E + +  +  VFG ET GL  +I E       L++ M ++ RS NLSNSVAI  +
  S:     3 IHIVLVAPKMPSNTGNIIRLCANSGAQLHLVKPLGFELDDKKLRRAGLDYHEYAHLQVHDDWSVAKQALQDADCHTITALTTKLSKPFYDYDFGGQETAE-SGSEFSGN-NVAMVFGSETAGLADDIREDIGADNWLRLPMLADSRSLNLSNSVAICLY 159
>gi|157737324|ref|YP_001490007.1| RNA methylase [Arcobacter butzleri RM4018] >gi|157699178|gb|ABV67338.1| RNA methylase, SpoU family [Arcobacter butzleri RM4018] (154 aa)
Score = 247, Expect = 5.8e-20, Identities = 63/161 (39%), Positives = 89/161 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGF-ILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           M NIVL +P IP N G I R C   N  LH+I+P+GF  + +K ++RAGLDYW  L+  EY++  DF S+N    N + FL T        N+  D      + +F FGRE  GL  +++ K     + I M ++ RS N++NSV+IVA+      NF   K
  S:     1 MFNIVLLEPRIPGNVGTIGRLCFALNCKLHLIKPYGFGEITEKEVRRAGLDYWYDLEVFEYENIEDFWSKNPF--NDRHFLAT----TKTKNVYFDAKFNVGD-YFYFGREDAGLPEDLLSKSSHTCITIPMTNDARSLNIANSVSIVAYE-ALRQNFTSFK 154
>gi|78223582|ref|YP_385329.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter metallireducens GS-15] >gi|78194837|gb|ABB32604.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter metallireducens GS-15] (158 aa)
Score = 247, Expect = 6.2e-20, Identities = 55/148 (37%), Positives = 77/148 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            +IVL +PEIP NTGNI+R C      LH++   GF  +D+ +KRAGLDYW  +   E   W D  +        +    +K A K     T  E    E  F VFG+ET GL  E++E  ++  ++I +   +RS NLS S  IV +
  S:     7 FHIVLIEPEIPPNTGNIARLCGATGTVLHLVGKLGFSTDDRYLKRAGLDYWSEV---EIHYWDDLAALQHAYPEGRFIYTSKKAAK-----THIEAAFKEGDFIVFGKETVGLPEELIEANRENTVRIPIFGKVRSLNLSTSAGIVLY 146
>gi|145640854|ref|ZP_01796436.1| rRNA methylase [Haemophilus influenzae R3021] >gi|145274368|gb|EDK14232.1| rRNA methylase [Haemophilus influenzae 22.4-21] (160 aa)
Score = 246, Expect = 7.1e-20, Identities = 60/149 (40%), Positives = 91/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM-EKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K +L      + +FG ET+G+   I+ E   K +++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGSPAHSQV-KFKLGD----YLMFGPETRGIPMSILNEMPMKQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|88799598|ref|ZP_01115174.1| putative tRNA/rRNA methyltransferase [Reinekea sp. MED297] >gi|88777683|gb|EAR08882.1| putative tRNA/rRNA methyltransferase [Reinekea sp. MED297] (154 aa)
Score = 246, Expect = 7.4e-20, Identities = 54/149 (36%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVLF+PEIP NTGNI R C      LH+I P GF +++K ++RAGLDY +  + + + D+  F  Q    +  ++F ++    +  S     E+      + +FG ET+GL ++I E     Q L++ M ++ RS NLSN+VA++ +
  S:     1 MFHIVLFEPEIPPNTGNIIRLCANTGCQLHLIEPLGFSMDEKALRRAGLDYHEFAQIRIWPDYPTFLQQ---AQPPRLFALSTKGSQGYS-----EVAFQPGDYLMFGPETRGLPADIRESLPPEQVLRLPMLADSRSLNLSNTVAVMVY 142
>gi|67923250|ref|ZP_00516736.1| tRNA/rRNA methyltransferase (SpoU) [Crocosphaera watsonii WH 8501] >gi|67854927|gb|EAM50200.1| tRNA/rRNA methyltransferase (SpoU) [Crocosphaera watsonii WH 8501] (155 aa)
Score = 246, Expect = 7.7e-20, Identities = 62/149 (41%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           M  +VL  P+IP NTGNI+RTC   N  LH++ P GF L+D+ +KRAGLDYW H+K   Y++   F S     K  +  L+  F+ +  S     E    E  + VFG ET+GL  +  E+  +  L I M +  +RS NLS SVAI  F
  S:     3 MPRVVLVNPQIPPNTGNIARTCAATNTELHLVGPLGFELSDRYLKRAGLDYWPHVKLHYYENLEQFVS---FQKQQEGRLL-GFSVRGKS--CYGECNFQENDWLVFGSETEGLPDKFREQCDQM-LYIPMPHPQVRSLNLSVSVAIGLF 145
>gi|158334676|ref|YP_001515848.1| RNA methyltransferase [Acaryochloris marina MBIC11017] >gi|158304917|gb|ABW26534.1| RNA methyltransferase, TrmH family [Acaryochloris marina MBIC11017] (153 aa)
Score = 245, Expect = 8.5e-20, Identities = 53/149 (35%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           ML +VL  PEIP NTGNI+RTC      LH++ P GF ++++ +KRAGLDYW  +K + +  W+ FE          V     F+     +  + +  +D+  + +FG E+ GL  +I++      L+I M +  +RS NLS S A+  F
  S:     1 MLRVVLVYPEIPPNTGNIARTCAATQTELHLVEPLGFEISNRYLKRAGLDYWPFVKLQTHASWAAFEQVRQQQGGRSV----SFSKSGTHSYLQFQFCEDD--WLIFGSESSGLPPDILQDSSAV-LRIPMAHEQVRSLNLSVSAAVGLF 143
>gi|149925625|ref|ZP_01913889.1| predicted rRNA methylase (SpoU class) [Limnobacter sp. MED105] >gi|149825742|gb|EDM84950.1| predicted rRNA methylase (SpoU class) [Limnobacter sp. MED105] (156 aa)
Score = 245, Expect = 9.4e-20, Identities = 52/149 (34%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M+N+VL +PEIP NTGN+ R C      LH++ P GF L D RM+RAGLDY ++     +  W  F  +   N      + TK            ++      + +FG ET+GL+ E+   + +   L++ M    RS NLSNSVA++ +
  S:     1 MINVVLVEPEIPPNTGNVIRLCANTGVQLHLVEPLGFPLEDARMRRAGLDYHEYANMLVHPGWEAFLDRQQPNPQRCFAMTTKGKHSPF------DVKFQAGDYLMFGSETRGLSEEVRNWFARENWLRLPMRPESRSLNLSNSVAVMVY 144
>gi|56461530|ref|YP_156811.1| rRNA/tRNA methylase [Idiomarina loihiensis L2TR] >gi|56180540|gb|AAV83262.1| Predicted rRNA/tRNA methylase, SpoU family [Idiomarina loihiensis L2TR] (154 aa)
Score = 245, Expect = 9.4e-20, Identities = 57/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML++VLF+PEIP NTGN+ R       +LH+I P GF L++K+++RAGLDY D      + DW  F +    N   ++F  T     + S      +  +     +FG ET+GL  E++E + ++  L++ M    RS NLSNSVAI A+
  S:     1 MLHLVLFEPEIPPNTGNVIRLAANTGMSLHLIEPLGFELDEKKVRRAGLDYHDLASVNIHKDWQSFLNSTSFN---RIFACTTKGKTNYS-----AVAYEAGDVLLFGPETRGLPMEVLETFPQENWLRLPMADTSRSLNLSNSVAIFAY 142
>gi|85711495|ref|ZP_01042553.1| Predicted rRNA/tRNA methylase, SpoU family protein [Idiomarina baltica OS145] >gi|85694647|gb|EAQ32587.1| Predicted rRNA/tRNA methylase, SpoU family protein [Idiomarina baltica OS145] (154 aa)
Score = 245, Expect = 1.0e-19, Identities = 56/149 (37%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML++VLF+PEIP NTGN+ R        LH+I P GF L++K+++RAGLDY    + K + +WSDF      N+         FA  +  +    E+  +E    +FG ET+GL  ++++ + ++  L++ M  + RS NLSNSVAI  +
  S:     1 MLHLVLFEPEIPPNTGNVIRLAANTGMQLHLIEPLGFDLDEKKVRRAGLDYHALTQVKIHKNWSDFLENVDYNR--------IFACTTKGSTRYTEVAYEENDVLLFGPETRGLPMDVLQTFPQENWLRLPMVPDSRSLNLSNSVAIFTY 142
>gi|28899635|ref|NP_799240.1| rRNA methylase [Vibrio parahaemolyticus RIMD 2210633] >gi|28807887|dbj|BAC61124.1| rRNA methylase, SpoU family [Vibrio parahaemolyticus RIMD 2210633] (159 aa)
Score = 245, Expect = 1.0e-19, Identities = 61/149 (40%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD------HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D      H   + + ++ D E Q     N ++F  T       +    D   K  ++  +FG ET+GL +EI+E     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKNYQAFLEYLDKEKQG----NYRLFACT----TKTTGHHVDAQYKAGDV-LMFGPETRGLPAEIIEGLPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|104779663|ref|YP_606161.1| RNA methyltransferase [Pseudomonas entomophila L48] >gi|95108650|emb|CAK13344.1| putative RNA methyltransferase, TrmH family, group 2 [Pseudomonas entomophila L48] (153 aa)
Score = 244, Expect = 1.1e-19, Identities = 55/149 (36%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C      LH+I P  F L+DKR++RAGLDY ++   K ++  +   ES      N ++F  T             E+       F+FG E++GL +E+++     Q L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANSGCALHLIEPISFELDDKRLRRAGLDYHEYATLKRHESLAGCLESLG----NPRLFAFTTKGSHPFH-----EVAYQPGDAFLFGPESRGLPAEVLDSLPAEQRLRLPMRPGCRSLNLSNTVAVTVY 142
>gi|153840063|ref|ZP_01992730.1| RNA methyltransferase, TrmH family, group 2 [Vibrio parahaemolyticus AQ3810] >gi|149746359|gb|EDM57408.1| RNA methyltransferase, TrmH family, group 2 [Vibrio parahaemolyticus AQ3810] (159 aa)
Score = 244, Expect = 1.1e-19, Identities = 60/149 (40%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD------HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D      H   + + ++ D E Q     N ++F  T    K+  +    +    +    +FG ET+GL +EI+E     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKNYQAFLEYLDKEKQG----NYRLFACTT---KTTGHHVDAQYQAGD--VLMFGPETRGLPAEIIEGLPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|91787138|ref|YP_548090.1| RNA methyltransferase TrmH, group 2 [Polaromonas sp. JS666] >gi|91696363|gb|ABE43192.1| RNA methyltransferase TrmH, group 2 [Polaromonas sp. JS666] (183 aa)
Score = 244, Expect = 1.2e-19, Identities = 56/149 (37%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL +PEIP NTGN+ R        LH++ P GF ++DK M+RAGLDY ++ +   +  W    +SQ       ++F +T     S+ ++    L  D   + VFG ET+GL  ++ E +   Q L++ M    RS NLSN+VA+  F
  S:    20 MFNIVLVEPEIPPNTGNVIRLAANTGCRLHLVEPLGFSMDDKHMRRAGLDYHEYAQVLRHASWQALLDSQR--PPAGRLFAMTTHGAGSVYDMRF--LPGD---WLVFGAETRGLAPDVRESFPMAQRLRVPMQPGQRSLNLSNTVAVTVF 163
>gi|93005998|ref|YP_580435.1| tRNA/rRNA methyltransferase (SpoU) [Psychrobacter cryohalolentis K5] >gi|92393676|gb|ABE74951.1| tRNA/rRNA methyltransferase (SpoU) [Psychrobacter cryohalolentis K5] (186 aa)
Score = 244, Expect = 1.3e-19, Identities = 59/148 (39%), Positives = 85/148 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWS-------DFESQN---LVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ++IVL  P++P NTGNI R C    A LH+++P GF L+DK+++RAGLDY ++   + +D+WS       D +      L  K SK F    F  +  +    D       +  VFG ET GL  +I E       L++ M ++ RS NLSNSVAI  +
  S:     3 IHIVLVAPKMPSNTGNIIRLCANSGAQLHLVKPLGFELDDKKLRRAGLDYHEYAHLQVHDNWSIAKQALQDADCHTITALTTKLSKPFYDYDFGGQETAESGSD--FSGNNVAMVFGSETAGLADDIREDIGADNWLRLPMLADSRSLNLSNSVAICLY 159
>gi|87303673|ref|ZP_01086448.1| probable tRNA/rRNA methyltransferase [Synechococcus sp. WH 5701] >gi|87281778|gb|EAQ73743.1| probable tRNA/rRNA methyltransferase [Synechococcus sp. WH 5701] (161 aa)
Score = 244, Expect = 1.3e-19, Identities = 54/146 (36%), Positives = 86/146 (58%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM------NSNIRSFNLSNSVAIVAF 149
           +VLFQP+IP NTGN++RTC    A LH+I P GF L+++++KRAGLDYW  +    +  +    ++    +  ++  ++  AD+   +        D+  + +FGRE+ GL  E++E+    +L I M         +RS NLS SVA+V F
  S:     7 VVLFQPQIPPNTGNVARTCAATGAELHLIEPLGFSLDERQLKRAGLDYWPWVPLHVHPGFEALSAEQR-RRGGRLLALSSQADQPYQHC---RFCSDD--WLLFGRESDGLPPELLEQ-ADMRLTIPMPGSVRHGGGVRSLNLSVSVAVVLF 151
>gi|67157556|ref|ZP_00418805.1| RNA methyltransferase TrmH, group 2 [Azotobacter vinelandii AvOP] >gi|67085464|gb|EAM04938.1| RNA methyltransferase TrmH, group 2 [Azotobacter vinelandii AvOP] (162 aa)
Score = 244, Expect = 1.3e-19, Identities = 59/148 (39%), Positives = 84/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDW-SDFESQNLVNKNSKVFLITKFADK---SISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
            +++LFQPEIP NTGNI R C     +LH+I P GF L+DKR++RAGLDY ++   K + D  S  ES        ++F  T    +   S++    D         F+FG E++GL  E+ E     Q L++ M S  RS NLSN+VA+  +
  S:    11 FHVILFQPEIPPNTGNIIRLCANTGCSLHLIDPLGFELDDKRLRRAGLDYHEYATLKRHADLPSCLESLG----RPRLFAFTTKGSQPYHSVAYRRGDA--------FLFGPESRGLPQEVRESLPPEQRLRLPMRSACRSLNLSNTVAVAVY 151
>gi|34499838|ref|NP_904053.1| RNA methyltransferase [Chromobacterium violaceum ATCC 12472] >gi|34105688|gb|AAQ62042.1| probable RNA methyltransferase [Chromobacterium violaceum ATCC 12472] (154 aa)
Score = 244, Expect = 1.4e-19, Identities = 52/149 (34%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M  +VLFQPEIP NTGN+ R C      LH+++P GF L D +++RAGLDY ++ +   ++DW D   + L  +         FA  +      D ++      F+FG E++GL  +++      Q +++ M    RS NLSN+VA+  F
  S:     1 MFTVVLFQPEIPPNTGNVIRLCANTGCELHLVKPMGFPLEDAKLRRAGLDYHEYARVVVHEDW-DACLRTLQGRRI-------FAATTKGATRHDRISYQPGDVFLFGPESRGLPQDVLAALPAQQRIRLPMRPESRSLNLSNAVAVTVF 142
>gi|47458956|ref|YP_015818.1| spoU class tRNA/rRNA methylase [Mycoplasma mobile 163K] >gi|47458284|gb|AAT27607.1| spoU class tRNA/rRNA methylase [Mycoplasma mobile 163K] (173 aa)
Score = 244, Expect = 1.4e-19, Identities = 53/160 (33%), Positives = 97/160 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY-WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           M+NIVLFQPEIP NTGNI RTC    A LH+I+P  F L+ K +KR+   +  + ++ + Y+ + DF  +   +    ++ +T++   + S++   +   ++++F +FG E+ G+  +I++   +  L+I M+ ++RS NL+N+V ++A+      NF  L
  S:     1 MINIVLFQPEIPPNTGNIIRTCKATQAKLHIIKPIAFDLDPKYLKRSAAGWILEDIEHEVYETYDDFLKK---HSEKSIYYLTRYGKINYSDVNFKKYQNNDDLFVMFGTESTGIPKKILKNNLENCLRIPMDKDMRSLNLANTVFLIAYEIQRQWNFEKL 158
>gi|153212559|ref|ZP_01948306.1| rRNA methylase, SpoU family [Vibrio cholerae 1587] >gi|153825535|ref|ZP_01978202.1| rRNA methylase, SpoU family [Vibrio cholerae MZO-2] >gi|124116430|gb|EAY35250.1| rRNA methylase, SpoU family [Vibrio cholerae 1587] >gi|149740820|gb|EDM54911.1| rRNA methylase, SpoU family [Vibrio cholerae MZO-2] >gi|150424067|gb|EDN16006.1| rRNA methylase, SpoU family [Vibrio cholerae AM-19226] (158 aa)
Score = 243, Expect = 1.4e-19, Identities = 54/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D++ F     + +    F +     K+  +    +  + +    +FG ET+GL +E++      Q ++I M    RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYAAF--IEYLQRERGSFRVFACTTKTTQHHVDAQFQQGD--VLLFGPETRGLPAELIASLPAEQRIRIPMMPEARSLNLSNAVAIIAF 146
>gi|145636678|ref|ZP_01792345.1| rRNA methylase [Haemophilus influenzae PittHH] >gi|145270204|gb|EDK10140.1| rRNA methylase [Haemophilus influenzae PittHH] (160 aa)
Score = 243, Expect = 1.4e-19, Identities = 59/149 (39%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K +L      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGSPAHSQV-KFKLGD----YLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|121603783|ref|YP_981112.1| RNA methyltransferase [Polaromonas naphthalenivorans CJ2] >gi|120592752|gb|ABM36191.1| RNA methyltransferase, TrmH family, group 2 [Polaromonas naphthalenivorans CJ2] (159 aa)
Score = 243, Expect = 1.4e-19, Identities = 59/149 (39%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISN---LTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL +PEIP NTGN+ R        LH++ P GF ++DK M+RAGLDY ++ +   +  W  F ESQ       ++F +T     S+     L  D        + VFG ETKGL  E+ + +    +LK+ M    RS NLSN+VA+  F
  S:     1 MFNIVLVEPEIPPNTGNVIRLAANTGCRLHLVEPLGFSMDDKHMRRAGLDYHEYAQVLRHASWPAFLESQQ--PPADRLFALTTQGAGSMYEARFLPGD--------WLVFGSETKGLAPEVRQSFALARRLKVPMLPGQRSLNLSNTVAVTVF 144
>gi|24213347|ref|NP_710828.1| rRNA methylase [Leptospira interrogans serovar Lai str. 56601] >gi|45658771|ref|YP_002857.1| tRNA/rRNA methyltransferase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24194095|gb|AAN47846.1|AE011251_8 rRNA methylase [Leptospira interrogans serovar Lai str. 56601] >gi|45602015|gb|AAS71494.1| tRNA/rRNA methyltransferase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (153 aa)
Score = 243, Expect = 1.5e-19, Identities = 58/148 (39%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           L I L++PEIP NTGNI+R CV   A LH++    F L++K  +RAGLDYWD  K K Y   S  E +  +   + ++LI+ +  +S +N++  +        F+FG ET G+  EI   + + + LKI M  + R  NLSNSVA++++
  S:     3 LYIGLYRPEIPPNTGNIARLCVALGAELHIVGQASFDLSEKAARRAGLDYWD--KVKIYFHSSLEEYKVALPSGTNLYLISIYGKRSYTNVSYRKGDA-----FLFGNETSGVPLEIKNSWDQERILKIPMEDSSRCLNLSNSVAVISY 144
>gi|116749122|ref|YP_845809.1| tRNA/rRNA methyltransferase (SpoU) [Syntrophobacter fumaroxidans MPOB] >gi|116698186|gb|ABK17374.1| tRNA/rRNA methyltransferase (SpoU) [Syntrophobacter fumaroxidans MPOB] (164 aa)
Score = 243, Expect = 1.5e-19, Identities = 56/161 (34%), Positives = 90/161 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAFH-YHFLTNFNDLK 161
           +  +VL+QPEIP+NTGNI+RTC   +  LH++ P GF + D+ +KRAGLDYW H++ K +    D ES      + +    +  AD+   +         + +F  FG E+ GL ++++     F + I +N + +RS NL+ SV I  F     LT+ +D +
  S:     9 VFQVVLYQPEIPQNTGNIARTCAATHTPLHLVEPLGFRITDRGLKRAGLDYWPHVRLKVH---PDLESLCREIGDRRWVYFSAHADRRYCDF---RFQPGDCLF--FGSESFGLPNDLLVSRPGFVINIPINRARVRSLNLATSVGIALFEALRQLTSHDDCR 163
>gi|154707421|ref|YP_001423885.1| RNA methyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|154356707|gb|ABS78169.1| RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii Dugway 5J108-111] (152 aa)
Score = 243, Expect = 1.5e-19, Identities = 60/149 (40%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF----------FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +I LF+PEIP NTGNI R C    A+L++I P GF L++KR++RAGLDY +      YD +  F+S               FA+  I   T    TK + I+          F+FG ET+GL +EI  ++    Q++I M +  RS NL+N+V+I+ +
  S:     1 MFHIALFEPEIPPNTGNIIRLCANAGASLYLIHPLGFSLDEKRLQRAGLDYREWATIIHYDHFEAFKS--------------AFAEHRIFACT----TKGKTIYADVHYRSSDVFLFGPETRGLPAEIRTQFPDSQQIRIPMVTEKRSINLANTVSIILY 142
>gi|145301039|ref|YP_001143880.1| RNA methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853811|gb|ABO92132.1| RNA methyltransferase, TrmH family, group 2 [Aeromonas salmonicida subsp. salmonicida A449] (154 aa)
Score = 243, Expect = 1.5e-19, Identities = 61/149 (40%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C      LH+I P GF  +DKR+KRAGLDY +  + K    W  +E+          FL     ++  +  TK         F      +FG E++GL  EI+E     Q L+I M    RS NLSN+VA+  +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIEPLGFEWDDKRVKRAGLDYHEFAEVKR---WPSYEA----------FLAAVAPERVFACTTKGSTAHSAAQFAPGDALLFGPESRGLPLEIIESLPFEQRLRIPMLPQSRSMNLSNAVAVFVY 142
>gi|159903443|ref|YP_001550787.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9211] >gi|159888619|gb|ABX08833.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9211] (162 aa)
Score = 243, Expect = 1.6e-19, Identities = 56/148 (37%), Positives = 85/148 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK------DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L + LF+P IP+NTGNI RTC  F   LH+I+P GF L+ K +KRAGLDYWD +    ++++S F+                 +DK +   +K      +++T   E   +FGRE  GL  +I E      + I M        ++ +RS NLS++ AI ++
  S:     8 LKVALFEPRIPQNTGNIGRTCAAFQIPLHLIKPLGFSLDSKLLKRAGLDYWDFIDLTTHENFSAFK--------------IHISDKRLIGFSKKDGIPLNKITFKPEDVLLFGREDTGLPEDIREAC-DLMVSIPMPGKADSDGSNGVRSLNLSSACAIASY 154
>gi|121607435|ref|YP_995242.1| tRNA/rRNA methyltransferase (SpoU) [Verminephrobacter eiseniae EF01-2] >gi|121552075|gb|ABM56224.1| tRNA/rRNA methyltransferase (SpoU) [Verminephrobacter eiseniae EF01-2] (168 aa)
Score = 243, Expect = 1.7e-19, Identities = 56/149 (37%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +PEIP NTGN+ R       TLH+I P GF + D+RM+RAGLDY ++ +   + DW+ F  +      S++F +T    +S+  +        +  +FVFG ET+GL + +   +   Q L++ M    RS NLSN+VA+  F
  S:     1 MFHIVLVEPEIPPNTGNVIRLAANTGCTLHLIEPLGFSMEDRRMRRAGLDYHEYARVLCHADWAAF-LRTARPDASRMFALTT---QSLQWVHATCFRPGD--WFVFGAETRGLAAALRASFAPAQCLRLPMIEGQRSLNLSNAVAVTVF 144
>gi|26991728|ref|NP_747153.1| RNA methyltransferase [Pseudomonas putida KT2440] >gi|24986832|gb|AAN70617.1|AE016704_8 RNA methyltransferase, TrmH family, group 2 [Pseudomonas putida KT2440] (157 aa)
Score = 243, Expect = 1.8e-19, Identities = 57/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C      LH+I P  F L+DKR++RAGLDY ++   K ++  +   ES      N ++F  T          TK      E  F     F+FG E++GL +E+++    + +L++ M    RS NLSN+VA+  +
  S:     5 MFHVILFQPEIPPNTGNIIRLCANSGCALHLIEPISFELDDKRLRRAGLDYHEYATLKRHESLAGCLESLG----NPRLFAFT----------TKGSHPFHEVAFQPGDAFLFGPESRGLPAEVLDSLPAEHRLRLPMRPGCRSLNLSNTVAVTVY 146
>gi|148550127|ref|YP_001270229.1| RNA methyltransferase [Pseudomonas putida F1] >gi|148514185|gb|ABQ81045.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas putida F1] (153 aa)
Score = 243, Expect = 1.8e-19, Identities = 57/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C      LH+I P  F L+DKR++RAGLDY ++   K ++  +   ES      N ++F  T          TK      E  F     F+FG E++GL +E+++    + +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANSGCALHLIEPISFELDDKRLRRAGLDYHEYATLKRHESLAGCLESLG----NPRLFAFT----------TKGSHPFHEVAFQPGDAFLFGPESRGLPAEVLDSLPAEHRLRLPMRPGCRSLNLSNTVAVTVY 142
>gi|170719600|ref|YP_001747288.1| RNA methyltransferase [Pseudomonas putida W619] >gi|169757603|gb|ACA70919.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas putida W619] (153 aa)
Score = 242, Expect = 1.8e-19, Identities = 55/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C      LH+I P  F L+DKR++RAGLDY ++   K ++  +    +NL   N ++F  T             E+       F+FG E++GL +E+++     Q L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANSGCALHLIEPISFELDDKRLRRAGLDYHEYATLKRHESLARC-LENL--GNPRLFAFTTKGSHPFH-----EVAYQPGDAFLFGPESRGLPAEVLDSLPAEQRLRLPMMPGCRSLNLSNTVAVTVY 142
>gi|86147915|ref|ZP_01066220.1| rRNA methylase, SpoU family protein [Vibrio sp. MED222] >gi|85834342|gb|EAQ52495.1| rRNA methylase, SpoU family protein [Vibrio sp. MED222] (159 aa)
Score = 242, Expect = 1.8e-19, Identities = 57/149 (38%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF   +K+++RAGLDY D  + K + +   F  + L N+    F I     K+  +    +  + +    +FG ET+GL +E +E     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDFEEKKVRRAGLDYHDLARVKRHKNLEAF-LEYLENEREGDFRIFACTTKTTGHHVDAKFQQGD--VLMFGPETRGLPAEFIESMPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|15642690|ref|NP_232323.1| rRNA methylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586619|ref|ZP_01676404.1| rRNA methylase, SpoU family [Vibrio cholerae 2740-80] >gi|121726684|ref|ZP_01679909.1| rRNA methylase, SpoU family [Vibrio cholerae V52] >gi|147674422|ref|YP_001218183.1| rRNA methylase [Vibrio cholerae O395] >gi|153221019|ref|ZP_01952074.1| rRNA methylase, SpoU family [Vibrio cholerae MAK 757] >gi|153820202|ref|ZP_01972869.1| rRNA methylase, SpoU family [Vibrio cholerae NCTC 8457] >gi|153821286|ref|ZP_01973953.1| rRNA methylase, SpoU family [Vibrio cholerae B33] >gi|194533172|ref|YP_002068591.1| rRNA methylase, SpoU family [Vibrio cholerae MO10] >gi|9657291|gb|AAF95836.1| rRNA methylase, SpoU family [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121549178|gb|EAX59211.1| rRNA methylase, SpoU family [Vibrio cholerae 2740-80] >gi|121630845|gb|EAX63227.1| rRNA methylase, SpoU family [Vibrio cholerae V52] >gi|124119930|gb|EAY38673.1| rRNA methylase, SpoU family [Vibrio cholerae MAK 757] >gi|125619224|gb|EAZ47754.1| rRNA methylase, SpoU family [Vibrio cholerae MO10] >gi|126509257|gb|EAZ71851.1| rRNA methylase, SpoU family [Vibrio cholerae NCTC 8457] >gi|126521218|gb|EAZ78441.1| rRNA methylase, SpoU family [Vibrio cholerae B33] >gi|146316305|gb|ABQ20844.1| rRNA methylase, SpoU family [Vibrio cholerae O395] (158 aa)
Score = 242, Expect = 1.9e-19, Identities = 54/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D++ F     + +    F +     K+  +    +  + +    +FG ET+GL +E++      Q ++I M    RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYAAF--IEYLQRERGSFRLFACTTKTTQHHVDAQFQQGD--VLLFGPETRGLPAELIASLPAEQRIRIPMMPEARSLNLSNAVAIIAF 146
>gi|145628348|ref|ZP_01784149.1| rRNA methylase [Haemophilus influenzae 22.1-21] >gi|144980123|gb|EDJ89782.1| rRNA methylase [Haemophilus influenzae 22.1-21] (160 aa)
Score = 242, Expect = 2.0e-19, Identities = 59/149 (39%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K +L      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGCPAHSQV-KFKLGD----YLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|70733879|ref|YP_257519.1| RNA methyltransferase [Pseudomonas fluorescens Pf-5] >gi|68348178|gb|AAY95784.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas fluorescens Pf-5] (151 aa)
Score = 242, Expect = 2.0e-19, Identities = 52/149 (34%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGN+ R C      LH+I P GF ++DKR++RAGLDY ++   + + D +   ES      + ++F  T    +   + +  E        F+FG E++GL +++++     Q L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLG----HPRLFAFTTKGSRPFHDASFQEGDA-----FLFGPESRGLPADVLDALPGEQRLRLPMREGCRSLNLSNTVAVAVY 142
>gi|16272707|ref|NP_438925.1| putative RNA methyltransferase [Haemophilus influenzae Rd KW20] >gi|145630511|ref|ZP_01786291.1| rRNA methylase [Haemophilus influenzae 22.4-21] >gi|1176303|sp|P44868|Y766_HAEIN Probable tRNA/rRNA methyltransferase HI0766 >gi|28948421|pdb|1J85|A Chain A, Structure Of Yibk From Haemophilus Influenzae (Hi0766), A Truncated Sequence Homolog Of Trna (Guanosine-2'-O-) Methyltransferase (Spou) >gi|28948677|pdb|1MXI|A Chain A, Structure Of Yibk From Haemophilus Influenzae (Hi0766): A Methyltransferase With A Cofactor Bound At A Site Formed By A Knot >gi|1573774|gb|AAC22424.1| rRNA methylase, putative [Haemophilus influenzae Rd KW20] >gi|144983901|gb|EDJ91343.1| rRNA methylase [Haemophilus influenzae R3021] (160 aa)
Score = 242, Expect = 2.0e-19, Identities = 59/149 (39%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +  + K +  +  F ES+    K  ++F +T     + S + K +L      + +FG ET+G+   I+ +    Q ++I M +N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESE----KPKRLFALTTKGCPAHSQV-KFKLGD----YLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVY 142
>gi|121595834|ref|YP_987730.1| tRNA/rRNA methyltransferase (SpoU) [Acidovorax sp. JS42] >gi|120607914|gb|ABM43654.1| tRNA/rRNA methyltransferase (SpoU) [Acidovorax sp. JS42] (189 aa)
Score = 242, Expect = 2.2e-19, Identities = 54/149 (36%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +PEIP NTGN+ R        LH++ P GF + D  M+RAGLDY ++ + + +  W+    +++    S++F +T    +S+ +     L  D   +FVFG E++GL  E+ E +   Q L++ M  N RS NLSN+VA+  +
  S:    28 MFHIVLVEPEIPPNTGNVIRLAANTGCMLHLVEPLGFSMEDPLMRRAGLDYHEYAEVRRHPGWTAL-LRDMQPDLSRMFALTTHGTQSVYD--TGFLPGD---WFVFGAESRGLPPELRETFPPAQRLRLPMLPNQRSLNLSNAVAVTVY 171
>gi|15603378|ref|NP_246452.1| hypothetical protein PM1513 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721900|gb|AAK03597.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] (158 aa)
Score = 242, Expect = 2.3e-19, Identities = 55/149 (36%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DK+++R+GLDY +  + K +     FE+     +  ++F +T     + S + + EL      + +FG E++G+   I++     Q ++I M  N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKKLRRSGLDYHEFAEIKRH---KTFETFLATEQPKRLFALTTKGSPAHSQV-QFELGD----YLMFGPESRGIPMSILDSLPMAQKIRIPMTENSRSMNLSNSVAVAVY 142
>gi|114561495|ref|YP_749008.1| RNA methyltransferase [Shewanella frigidimarina NCIMB 400] >gi|114332788|gb|ABI70170.1| RNA methyltransferase, TrmH family, group 2 [Shewanella frigidimarina NCIMB 400] (154 aa)
Score = 241, Expect = 2.4e-19, Identities = 60/149 (40%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK-----DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF L +K+++RAGLDY            SD  S    +KN   FL      + I+  TK      ++   E    +FG ET+GL  +I++     Q L+I M +N RS NLSNSVAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDLEEKKLRRAGLDY------------SDLTSVTR-HKNYTAFLEAMAGKRIIACTTKGSRPHTQIAFQENDVLLFGPETRGLPMDIIDATPLAQRLRIPMTANSRSLNLSNSVAIISY 142
>gi|52424221|ref|YP_087358.1| CspR protein [Mannheimia succiniciproducens MBEL55E] >gi|52306273|gb|AAU36773.1| CspR protein [Mannheimia succiniciproducens MBEL55E] (159 aa)
Score = 241, Expect = 2.4e-19, Identities = 60/149 (40%), Positives = 89/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DKR++R+GLDY +    K++  +  F ES+    K  ++F +T     + S + K EL      + +FG ET+G+   I++     Q ++I M  N RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAHIKKHKTFEVFLESE----KPKRLFALTTKGGPAHSEV-KFELGD----YLMFGPETRGIPMAILDSMPMEQKIRIPMTENSRSMNLSNSVAVTVY 142
>gi|90414908|ref|ZP_01222872.1| putative rRNA methylase, SpoU family protein [Photobacterium profundum 3TCK] >gi|90323964|gb|EAS40560.1| putative rRNA methylase, SpoU family protein [Photobacterium profundum 3TCK] (154 aa)
Score = 241, Expect = 2.5e-19, Identities = 56/149 (37%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D      + D++ F+ + +V +  ++F  T    K+ +  T  +  + +    +FG ET+GL +E +E     Q L+I M+ + RS NLSN+ AI+ +
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKLRRAGLDYHDLAHVHRHKDFAAFK-EAMVGR--RLFACTT---KTTNYHTNAQFAEGD--VLIFGPETRGLPAEFIESLPLEQRLRIPMHPDSRSLNLSNAAAIIGY 142
>gi|148265317|ref|YP_001232023.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter uraniireducens Rf4] >gi|146398817|gb|ABQ27450.1| tRNA/rRNA methyltransferase (SpoU) [Geobacter uraniireducens Rf4] (160 aa)
Score = 241, Expect = 2.5e-19, Identities = 52/148 (35%), Positives = 79/148 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            +IVL +PEIP NTGNI+R C   +  LH++   GF  +D+ +KRAGLDYW  +   +   W D ++        +    +K   +S   +   E T  +  F VFG+ETKGL  E++E      ++I +   +RS NLS +  IV +
  S:     7 FHIVLVEPEIPPNTGNIARLCGATSTVLHLVGKLGFSTDDRALKRAGLDYWSEV---DIHYWEDLDALKSAYPGGRFIYTSKKVPRSYVEM---EFTAGD--FIVFGKETKGLPDELIEANPDTAVRIPIFGRVRSLNLSTAAGIVLY 146
>gi|146309256|ref|YP_001189721.1| RNA methyltransferase [Pseudomonas mendocina ymp] >gi|145577457|gb|ABP86989.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas mendocina ymp] (154 aa)
Score = 241, Expect = 2.6e-19, Identities = 54/149 (36%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C      LH+I P GF L+DKR++RAGLDY ++   K +   +D +S        ++F  T    +        E+       F+FG E++GL  E+       Q +++ M +  RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANSGCQLHLIEPLGFELDDKRLRRAGLDYHEYATLKRH---ADLQSCLDSLGQPRLFAFTTKGSQPFH-----EIAYQPGDAFLFGPESRGLPEEVRNALPPEQRVRLPMRAGCRSLNLSNTVAVTVY 142
>gi|33599281|ref|NP_886841.1| rRNA methylase [Bordetella bronchiseptica RB50] >gi|33575327|emb|CAE30790.1| rRNA methylase [Bordetella bronchiseptica RB50] (172 aa)
Score = 241, Expect = 2.6e-19, Identities = 57/149 (38%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF-QLKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL  PEIP NTGN  R C    A LH++RP GF L+D R++RAGLDY +    + +D              ++VF +T  A  S++++            FVFGRET GL+   M  +    QL++ M    RS NLSN+VA+  F
  S:    17 MFHVVLVSPEIPPNTGNAIRLCANTGAQLHLVRPLGFELDDARLRRAGLDYHEWQPVQVHDTLPQ-ALAATGAAAARVFALTTRAPASLADMAFQAGD-----VFVFGRETAGLSEAHMALFGPAQQLRLPMRPGQRSLNLSNAVAVTVF 160
>gi|27364652|ref|NP_760180.1| rRNA methylase [Vibrio vulnificus CMCP6] >gi|37681300|ref|NP_935909.1| rRNA methylase [Vibrio vulnificus YJ016] >gi|27360797|gb|AAO09707.1|AE016801_26 Predicted rRNA methylase [Vibrio vulnificus CMCP6] >gi|37200051|dbj|BAC95880.1| predicted rRNA methylase [Vibrio vulnificus YJ016] (157 aa)
Score = 241, Expect = 2.7e-19, Identities = 58/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDH---LKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D     + K Y  + D+  Q       ++F  T    K+  +    +  + +    +FG ET+GL  E++E     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKNYQAFLDYLEQ---RGEYRIFACTT---KTTGHHVDAQYRQGD--VLLFGPETRGLPMEVIESLPMSQRIRIPMMPDARSLNLSNAVAIIAF 145
>gi|33595003|ref|NP_882646.1| rRNA methylase [Bordetella parapertussis 12822] >gi|33565079|emb|CAE40030.1| rRNA methylase [Bordetella parapertussis] (172 aa)
Score = 241, Expect = 2.7e-19, Identities = 57/149 (38%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF-QLKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL  PEIP NTGN  R C    A LH++RP GF L+D R++RAGLDY +    + +D              ++VF +T  A  S++++            FVFGRET GL+   M  +    QL++ M    RS NLSN+VA+  F
  S:    17 MFHVVLVSPEIPPNTGNAIRLCANTGAQLHLVRPLGFELDDARLRRAGLDYHEWQPVQVHDTLPQ-ALAATGAAAARVFALTTRAPASLADMAFQAGD-----VFVFGRETAGLSEAHMALFGPAQQLRLPMRPGQRSLNLSNAVAVTVF 160
>gi|153828346|ref|ZP_01981013.1| rRNA methylase, SpoU family [Vibrio cholerae 623-39] >gi|148876176|gb|EDL74311.1| rRNA methylase, SpoU family [Vibrio cholerae 623-39] (158 aa)
Score = 241, Expect = 2.7e-19, Identities = 54/149 (36%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D++ F     + +    F +     K+  +    +    +    +FG ET+GL +E++      Q ++I M    RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYAAF--IEYLQRERGSFRVFACTTKTTQHHVDAQFQPGD--VLLFGPETRGLPAELIASLPAEQRIRIPMMPEARSLNLSNAVAIIAF 146
>gi|78356571|ref|YP_388020.1| RNA methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218976|gb|ABB38325.1| RNA methyltransferase, TrmH family [Desulfovibrio desulfuricans G20] (152 aa)
Score = 241, Expect = 2.8e-19, Identities = 48/149 (32%), Positives = 84/149 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFH 150
           ++IVLFQPEIP NTGN++R C     +LH+I P GF ++DK ++RAGLDYW H+    +  W  F  +  V    ++ + +     ++ +       K++ +  VFG E++GL + +++      ++I +   +RS N+S +  IV + 
  S:     1 MHIVLFQPEIPPNTGNVARLCAATRTSLHLIEPLGFSVDDKHVRRAGLDYWPHVDLTVWPGWYAFMRE--VGSRVRLVMTSARGGTAVQDF---RFNKNDAL--VFGPESRGLPAHMLDGSGHV-VRIPIWGEVRSLNMSTAAGIVLYQ 141
>gi|194536422|ref|YP_002071581.1| rRNA methylase, SpoU family [Vibrio cholerae RC385] >gi|150421216|gb|EDN13499.1| rRNA methylase, SpoU family [Vibrio cholerae RC385] (158 aa)
Score = 241, Expect = 3.0e-19, Identities = 54/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D++ F     + +    F +     K+  +    +  + +    +FG ET+GL +E++      Q ++I M    RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYAAF--IEYLQRERGSFRLFACTTKTTQHHVDAQFQQGD--VLLFGPETRGLPAELIASLPVEQRIRIPMMPEARSLNLSNAVAIIAF 146
>gi|148977226|ref|ZP_01813853.1| rRNA methylase, SpoU family protein [Vibrionales bacterium SWAT-3] >gi|145963508|gb|EDK28771.1| rRNA methylase, SpoU family protein [Vibrionales bacterium SWAT-3] (159 aa)
Score = 241, Expect = 3.0e-19, Identities = 56/149 (37%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF   +K+++RAGLDY D  + K + +   F  + L N+    + I     K+  +    +  + +    +FG ET+GL +E +E     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDFEEKKVRRAGLDYHDLARVKRHKNLEAF-IEYLENEREGDYRIFACTTKTTGHHVDAKFQQGD--VLMFGPETRGLPAEFIESMPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|85060160|ref|YP_455862.1| putative RNA methyltransferase [Sodalis glossinidius str. 'morsitans'] >gi|84780680|dbj|BAE75457.1| putative RNA methyltransferase [Sodalis glossinidius str. 'morsitans'] (155 aa)
Score = 240, Expect = 3.4e-19, Identities = 55/149 (36%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLIT---KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           MLNIVL++PEIP NTGNI R C      LH+I+P GF  +DKR++RAGLDY +    + +    D+ +     + +++F +T   + A  ++     D        + +FG ET+GL   I++     Q ++I M  + RS NLSN+V++V +
  S:     1 MLNIVLYEPEIPPNTGNIIRLCANTGFHLHIIQPLGFTWDDKRLRRAGLDYHEFAAIRHH---RDYAAFLAQAQQARLFALTTKGQPAHSAVRYQAGD--------YLLFGPETRGLPPSILDALPMTQKIRIPMQPDSRSMNLSNAVSVVVY 142
>gi|71906256|ref|YP_283843.1| RNA methyltransferase TrmH, group 2 [Dechloromonas aromatica RCB] >gi|71845877|gb|AAZ45373.1| RNA methyltransferase TrmH, group 2 [Dechloromonas aromatica RCB] (154 aa)
Score = 240, Expect = 3.5e-19, Identities = 57/157 (36%), Positives = 86/157 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAFHYHFLTNF 157
           M  +VL++PEIP NTGNI R C    A LH++ P GF L+DK ++RAGLDY ++ +   + DW+  ++        ++F +T    K  ++     L  ++   FVFG ET GL  EI  ++   + L++ M    RS NLSN+ A+  F     T F
  S:     1 MFAVVLYRPEIPPNTGNIIRMCANTGAELHLVEPLGFDLSDKHLRRAGLDYHEYARIVRHADWAACKA---ALAGRRLFAMTT---KGTASPFSTALEAND--VFVFGCETSGLPPEIRAEFSPERCLRLPMLPGQRSLNLSNAAAVTVFEAWRQTGF 150
>gi|156972520|ref|YP_001443427.1| RNA methyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|156524114|gb|ABU69200.1| hypothetical protein VIBHAR_00152 [Vibrio harveyi ATCC BAA-1116] (159 aa)
Score = 240, Expect = 3.6e-19, Identities = 56/149 (37%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D+  F       K     L   FA  + +     +    E    +FG ET+GL +++++     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYQAFLEYLEKEKQGNYRL---FACTTKTTGHHVDAKYQEGDVLMFGPETRGLPADVIDSLPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|119504920|ref|ZP_01626997.1| putative RNA-methyltransferase [marine gamma proteobacterium HTCC2080] >gi|119459206|gb|EAW40304.1| putative RNA-methyltransferase [marine gamma proteobacterium HTCC2080] (158 aa)
Score = 240, Expect = 3.6e-19, Identities = 56/148 (37%), Positives = 87/148 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFL--ITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQL-KIEMNSNIRSFNLSNSVAIVAF 149
           L+IVL++PEIP NTG+I R C    A LH+I+P GF ++DKR++RAGLDY +     +++  + +  QN   +   V    + + ++ S SN   D L        +FG ETKGL   I+    +  + K+ M  N RS NL+N+V++V +
  S:     6 LHIVLYEPEIPGNTGSIIRLCANTGAALHVIKPLGFEMDDKRLRRAGLDYHEFASVMQWESLAHYREQNSDRRLVAVETCGVARHSNFSFSN--SDAL--------LFGSETKGLPEAILVTLSRDHIVKLPMLPNSRSLNLANAVSVVVY 146
>gi|126658117|ref|ZP_01729269.1| RNA methyltransferase TrmH, group 2 [Cyanothece sp. CCY0110] >gi|126620755|gb|EAZ91472.1| RNA methyltransferase TrmH, group 2 [Cyanothece sp. CCY0110] (153 aa)
Score = 240, Expect = 3.8e-19, Identities = 58/149 (38%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           M  +VL  P+IP NTGNI+RTC   N  LH++ P GF L+D+ +KRAGLDYW H+K   + D   F++ +   K      +  F+ +  S     +  +D+  + VFG E++GL     E+  +  L I M +  IRS NLS SVA+  F
  S:     1 MPRVVLVNPQIPPNTGNIARTCAATNTELHLVGPLGFELSDRYLKRAGLDYWPHVKLHYHLDLVQFQAYHQQQKGR----LLGFSVRGKSCYGDCKFQEDD--WLVFGSESEGLPLTFQEQCDQM-LYIPMPHPKIRSLNLSVSVAVGLF 143
>gi|120612549|ref|YP_972227.1| tRNA/rRNA methyltransferase (SpoU) [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120591013|gb|ABM34453.1| tRNA/rRNA methyltransferase (SpoU) [Acidovorax avenae subsp. citrulli AAC00-1] (158 aa)
Score = 240, Expect = 4.0e-19, Identities = 55/149 (36%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +PEIP NTGN+ R        LH++ P GF + DK MKRAGLDY ++ + +++  W+ F      N   +VF +T     ++           E +F     FVFG E++GL  E+ + +   Q L++ M    RS NLSN+VA+  +
  S:     1 MFHIVLVEPEIPPNTGNVIRLAANTGCILHLVEPLGFSMEDKLMKRAGLDYHEYAEVRQHAGWTAFLRDAQPNP-ERVFAMTTHGVHTVY----------ESLFLPGDWFVFGAESRGLPPELRDAFPPAQRLRLPMLPGQRSLNLSNAVAVTVY 144
>gi|33591801|ref|NP_879445.1| rRNA methylase [Bordetella pertussis Tohama I] >gi|33571444|emb|CAE44927.1| rRNA methylase [Bordetella pertussis Tohama I] (156 aa)
Score = 240, Expect = 4.0e-19, Identities = 56/149 (37%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF-QLKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL  PEIP NTGN  R C    A LH++RP GF L+D R++RAGLDY +    + +D               ++F +T  A  S++++            FVFGRET GL+   M  +    QL++ M    RS NLSN+VA+  F
  S:     1 MFHVVLVSPEIPPNTGNAIRLCANTGAQLHLVRPLGFELDDARLRRAGLDYHEWQPVQVHDTLPQ-ALAATGAAAPRIFALTTRARTSLADMAFQAGD-----VFVFGRETAGLSEAHMALFGPAQQLRLPMRPGQRSLNLSNAVAVTVF 144
>gi|194537442|ref|YP_002072584.1| rRNA methylase, SpoU family [Vibrio cholerae V51] >gi|125622055|gb|EAZ50378.1| rRNA methylase, SpoU family [Vibrio cholerae V51] (158 aa)
Score = 239, Expect = 4.3e-19, Identities = 54/149 (36%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D+  F     + +    F +     K+  +    +  + +    +FG ET+GL +E++      Q ++I M    RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYVAF--IEYLQRERGSFRLFACTTKTTQHHVDAQFQQGD--VLLFGPETRGLPAELIASLPAEQRIRIPMMPEARSLNLSNAVAIIAF 146
>gi|90408298|ref|ZP_01216463.1| putative rRNA methylase, SpoU family protein [Psychromonas sp. CNPT3] >gi|90310599|gb|EAS38719.1| putative rRNA methylase, SpoU family protein [Psychromonas sp. CNPT3] (154 aa)
Score = 239, Expect = 4.4e-19, Identities = 58/158 (36%), Positives = 88/158 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M+ I LF+PEIP+NTG I R C      LH+I P GF  N+KR++RAGLDY +    K + ++ DF ES     K  ++   T    K+ +  ++      +    +FG ET+GL SE+++     Q L+I M  N RS NL+N+V++  +      +FN
  S:     1 MIEIALFEPEIPQNTGAIIRVCANTGCILHLIEPLGFDFNEKRVRRAGLDYHEIANIKHHKNYQDFLESV----KGKRILACTT---KTTTYHSQANFQSGD--VLLFGPETRGLPSELLDALPLEQKLRIPMQPNSRSMNLANAVSVFVYEAWRQLDFN 151
>gi|110835132|ref|YP_693991.1| RNA methyltransferase [Alcanivorax borkumensis SK2] >gi|110648243|emb|CAL17719.1| RNA methyltransferase, TrmH family [Alcanivorax borkumensis SK2] (156 aa)
Score = 239, Expect = 4.5e-19, Identities = 56/149 (37%), Positives = 90/149 (60%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+I LF+PEIP NTGNI R      A LH+I P GF L +K+++RAGLDY +    + + D+S F+ +++V +  ++F +T    +  S        +D ++  +FG ET+GL  +I++     Q L++ M +  RS NLSN+VA+  +
  S:     1 MLHIALFEPEIPPNTGNIIRLAANTGAQLHLIEPLGFSLEEKKLRRAGLDYSEFAALQVHRDFSAFQ-ESVVGQ--RLFAMTTKGSRPHSQ----ACFQDGDV-LLFGPETRGLPEQILDSLPATQRLRLPMVAESRSLNLSNAVAVTLY 142
>gi|44662935|gb|AAS47553.1| putative RNA methylase [symbiont bacterium of Paederus fuscipes] (158 aa)
Score = 239, Expect = 4.9e-19, Identities = 57/149 (38%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDW-SDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M  I+LFQPEIP NTGNI R C      LH+I P GF L++KR++RAGLDY ++   + Y D  S  ES        ++F  T    ++       E+       F+FG E++GL   +       Q L++ M    RS NLSN+VAI  +
  S:     1 MFQIILFQPEIPPNTGNIIRLCANAGCGLHLIEPLGFELDNKRLRRAGLDYHEYTNVRRYPDLRSCLESL----AQPRLFAFTTKGSRAFH-----EVDYQRGDAFLFGPESRGLPGRVRNALLPEQRLRLPMRGGCRSLNLSNTVAIAVY 142
>gi|15838566|ref|NP_299254.1| tRNA/rRNA methylase [Xylella fastidiosa 9a5c] >gi|9107078|gb|AAF84774.1|AE004016_8 tRNA/rRNA methylase [Xylella fastidiosa 9a5c] (148 aa)
Score = 238, Expect = 5.6e-19, Identities = 54/146 (36%), Positives = 81/146 (55%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ++L+QPEIP NTGN+ R C    A LH+I P GF L+D+R+KRAGLDY ++ + + +         NL +  + +     FA  +   +  D  T      F+FG ET+GL   ++    + Q L + M    RS NLSN+VA++ F
  S:     1 MLLYQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLDDRRLKRAGLDYHEYARMQVH--------PNLSSALAAIAPRRLFALSTRGQMRYDTPTFSTGDAFIFGPETRGLPDTVLHTIPESQRLYLPMQPQSRSLNLSNAVAVMVF 139
>gi|187476751|ref|YP_784775.1| RNA methyltransferase [Bordetella avium 197N] >gi|115421337|emb|CAJ47842.1| putative RNA methyltransferase [Bordetella avium 197N] (156 aa)
Score = 238, Expect = 5.8e-19, Identities = 56/149 (37%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++L  PEIP NTGN  R C    A LH++RP GF L+D R++RAGLDY +    K +DD     +        ++F +T    +S + +            FVFGRET GL+ E +  +   Q L++ M    RS NLSN+VA+  F
  S:     1 MFHVILVCPEIPPNTGNAIRLCANTGAQLHLVRPLGFELDDTRLRRAGLDYHEWQPMKVHDDLPAALAATGA-PPERIFALTTQGARSAAGMQYQRGD-----VFVFGRETAGLSPEHVALFAPGQRLRLPMRPGQRSLNLSNAVAVTVF 144
>gi|91228462|ref|ZP_01262386.1| rRNA methylase, SpoU family protein [Vibrio alginolyticus 12G01] >gi|91187997|gb|EAS74305.1| rRNA methylase, SpoU family protein [Vibrio alginolyticus 12G01] (159 aa)
Score = 238, Expect = 6.1e-19, Identities = 58/149 (38%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF------ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + ++  F      E Q     N ++F  T    K+  +    +    +    +FG ET+GL +EI++     Q ++I M  + RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKNYQAFLEYLEKEKQG----NYRLFACTT---KTTGHHVDAQYQAGD--VLMFGPETRGLPAEIIDSLPMEQRIRIPMMPDARSLNLSNAVAIIAF 147
>gi|94501460|ref|ZP_01307979.1| putative RNA-methyltransferase [Oceanobacter sp. RED65] >gi|94426425|gb|EAT11414.1| putative RNA-methyltransferase [Oceanobacter sp. RED65] (154 aa)
Score = 238, Expect = 6.3e-19, Identities = 57/149 (38%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +I LF+P+I  NTGNI R C      LH+I P GF L +K+++RAGLDY +      Y D+  F+      K+ ++F  T    K   +  K +   D+    +FG ET GL+ E+ME      +++I M  + RS NLSNSVAI++ 
  S:     1 MFHIALFEPQIAPNTGNIIRLCANNGCQLHLIEPMGFNLEEKKLRRAGLDYHEFANVSVYPDYWAFKE---AMKDKRIFACTT---KGSGHYHKVKYQPDD--VLLFGAETHGLSDEVMESIDPSMRIRIPMLPDSRSLNLSNSVAIISL 142
>gi|119899105|ref|YP_934318.1| tRNA/rRNA methylase [Azoarcus sp. BH72] >gi|119671518|emb|CAL95431.1| tRNA/rRNA methylase [Azoarcus sp. BH72] (177 aa)
Score = 238, Expect = 6.6e-19, Identities = 58/149 (38%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I+LF+PEIP NTGNI R        LH++ P GF+L DK + RAGLDY D  +   + DW    +        +VF +T  A +   + T D    D    F+FG E++GL  E+ E     Q L++ M  + RS NLSN+VA++ F
  S:    14 MFHIILFEPEIPPNTGNIIRLAANTGCHLHLVEPLGFVLTDKALARAGLDYHDLARVTVHTDWPACRA---FLGERRVFALTTRAQR--RHDTVDFRPGDA---FLFGPESRGLPPELRESLPPEQRLRLPMVPSNRSMNLSNAVAVMVF 155
>gi|77456565|ref|YP_346070.1| RNA methyltransferase TrmH, group 2 [Pseudomonas fluorescens PfO-1] >gi|77380568|gb|ABA72081.1| RNA methyltransferase TrmH, group 2 [Pseudomonas fluorescens PfO-1] (151 aa)
Score = 238, Expect = 6.6e-19, Identities = 55/149 (36%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGN+ R C      LH+I P GF ++DKR++RAGLDY ++   + + D +   ES      + ++F  T          TK      +  F     F+FG E++GL  E+++     Q L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLG----HPRLFAFT----------TKGSRPFHDAAFVPGDAFIFGPESRGLPPEVLDALPGEQRLRLPMREGCRSLNLSNTVAVAVY 142
>gi|77166275|ref|YP_344800.1| RNA methyltransferase TrmH, group 2 [Nitrosococcus oceani ATCC 19707] >gi|76884589|gb|ABA59270.1| RNA methyltransferase TrmH, group 2 [Nitrosococcus oceani ATCC 19707] (161 aa)
Score = 238, Expect = 6.9e-19, Identities = 58/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M ++VL +PEIP NTGNI R C    A LH+++P GF L+D+R++RAGLDY +  K K             V+ + + FL      +  +  T+ +   D+  F      +FG ET+GL  E++E     Q L+I M    RS NLSN+VA+V +
  S:     1 MFHVVLLEPEIPPNTGNIIRLCANTGAILHLVQPLGFELDDRRLRRAGLDYHEWAKVK-------------VHPSLEHFLDKTQPRQLWACSTRGQQPYDKANFHPGDALLFGPETRGLPRELLETLLSRQVLRIPMEPTSRSLNLSNAVAVVLY 142
>gi|46446016|ref|YP_007381.1| hypothetical protein pc0382 [Candidatus Protochlamydia amoebophila UWE25] >gi|46399657|emb|CAF23106.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (148 aa)
Score = 237, Expect = 7.0e-19, Identities = 52/148 (35%), Positives = 81/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           + I+LFQP+IP+N GNI RTC      L M+ P GF  +D+ +KRAGLDYW+ +     ++  ++    L N+ +  +    F+ K+ +  T  E++   + F +FG ET GL S   EK+    +KI M   +R  NL+ S  I  +
  S:     1 MKIILFQPQIPQNAGNIVRTCAVTGTDLMMVHPLGFSTHDRWLKRAGLDYWEGVSVSFIENLENY----LENQQASFYF---FSSKATTLYT--EVSYAADSFLIFGSETSGLPSIFQEKWGNRFVKIPMKPKVRCLNLATSAGIALY 139
>gi|154148507|ref|YP_001406799.1| RNA methyltransferase [Campylobacter hominis ATCC BAA-381] >gi|153804516|gb|ABS51523.1| RNA methyltransferase, TrmH family [Campylobacter hominis ATCC BAA-381] (161 aa)
Score = 237, Expect = 7.0e-19, Identities = 60/149 (40%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P+IP+NTG I R C+  N  LH+++P  F L++K ++RAGLDYW  L    +D   DF + N  +K S+ +  T    KS       +  KD+ IF  FG E+ GL    M+K  +  + I M +  RS NL+ SV IVA+
  S:     1 MFNIVLVHPQIPQNTGAIGRLCINANLKLHIVKPTIFSLDEKSVRRAGLDYWKKLNPTIWDSLDDFMAAN-GDKISRFWFSTT---KSKRLYFTADFKKDDFIF--FGGESTGLPMNFMQKNWQNAITIPMGNEGRSLNLAMSVGIVAY 143
>gi|153952499|ref|YP_001398024.1| RNA methyltransferase [Campylobacter jejuni subsp. doylei 269.97] >gi|152939945|gb|ABS44686.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. doylei 269.97] (155 aa)
Score = 236, Expect = 1.0e-18, Identities = 58/149 (38%), Positives = 88/149 (59%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+++P  F ++ K ++RAGLDYWD L+   +++  +F ++N++ KN   F  TK + K+  N    E  K++  F  FG E+ GL  E+M+   K  + I M S  RS NL+ SV I+++
  S:     1 MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIVKPTVFDISQKAVRRAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATTK-SRKAYFN---TEFQKND--FLFFGSESYGLPMELMQLNWKNAITIPMKSYGRSLNLATSVGIISY 143
>gi|90416184|ref|ZP_01224116.1| tRNA/rRNA methyltransferase [marine gamma proteobacterium HTCC2207] >gi|90331909|gb|EAS47123.1| tRNA/rRNA methyltransferase [marine gamma proteobacterium HTCC2207] (154 aa)
Score = 236, Expect = 1.0e-18, Identities = 54/149 (36%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C      LH+I P GF L+DK+++RAGLDY +    K +   +  E+     +  K++ ++       S+   +E         +FG ET+GL +++ +     Q L++ M    RS NLSN+V+I+ +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANTGFRLHLIEPLGFDLDDKKLRRAGLDYREFQSLKVH---ASLEAYRQSQQPKKIYALSTKGTVCYSSARFEEGDA-----LLFGPETRGLPADVRDGLGTEQVLRLPMQKESRSLNLSNTVSIIVY 142
>gi|15792234|ref|NP_282057.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86150167|ref|ZP_01068394.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597538|ref|ZP_01100772.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni 84-25] >gi|85839283|gb|EAQ56545.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88190130|gb|EAQ94105.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360230|emb|CAL35025.1| putative RNA methylase [Campylobacter jejuni subsp. jejuni NCTC 11168] (155 aa)
Score = 236, Expect = 1.1e-18, Identities = 56/149 (37%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+++P  F ++ K ++RAGLDYWD L+   +++  +F ++N++ KN   F  T    KS       E  K++  F  FG E+ GL  E+M+   +  + I M S  RS NL+ SV I+++
  S:     1 MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIVKPIVFDISQKAVRRAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATT----KSQKAYFDAEFQKND--FLFFGSESYGLPMELMQLNWENAITIPMKSYGRSLNLATSVGIISY 143
>gi|119475548|ref|ZP_01615901.1| putative RNA-methyltransferase [marine gamma proteobacterium HTCC2143] >gi|119451751|gb|EAW32984.1| putative RNA-methyltransferase [marine gamma proteobacterium HTCC2143] (154 aa)
Score = 236, Expect = 1.1e-18, Identities = 56/149 (37%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++P I  NTGNI R C      LH+I P GF   DK+++RAGLDY D      Y D++ F  Q  +N    +   TK       +   D++   +    +FG ET GL +E+ + +     LKI M+   RS NLSNSVAI+ +
  S:     1 MFHIALYEPRIAPNTGNIIRLCANNGCHLHIIEPMGFDFEDKKLRRAGLDYSDLAHVTRYPDYAVFAEQ--MNGRRILACTTK------GSRHYDQMDYQKGDVLLFGSETAGLPAELRDSFPADNLLKIPMHPTSRSLNLSNSVAIITY 142
>gi|49080686|gb|AAT50047.1| PA5127 [synthetic construct] (154 aa)
Score = 235, Expect = 1.3e-18, Identities = 52/149 (34%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C     +LH+I P GF L+DKR++RAGLDY ++   + Y      +S        ++F  T    ++       E+       F+FG E++GL  ++        +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRY---PYLQSCLEALGQPRLFAFTTKGSRAFH-----EVAYQRGDAFLFGPESRGLPEDVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVY 142
>gi|15600320|ref|NP_253814.1| putative rRNA methylase [Pseudomonas aeruginosa PAO1] >gi|9951426|gb|AAG08512.1|AE004926_2 probable rRNA methylase [Pseudomonas aeruginosa PAO1] (153 aa)
Score = 235, Expect = 1.3e-18, Identities = 52/149 (34%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C     +LH+I P GF L+DKR++RAGLDY ++   + Y      +S        ++F  T    ++       E+       F+FG E++GL  ++        +L++ M    RS NLSN+VA+  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRY---PYLQSCLEALGQPRLFAFTTKGSRAFH-----EVAYQRGDAFLFGPESRGLPEDVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVY 142
>gi|15805267|ref|NP_293955.1| RNA methyltransferase, putative [Deinococcus radiodurans R1] >gi|6457905|gb|AAF09819.1|AE001885_3 RNA methyltransferase, putative [Deinococcus radiodurans R1] (158 aa)
Score = 235, Expect = 1.5e-18, Identities = 54/149 (36%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +L++VLF+PE   N GN++RTC    A LH+IRPFGF L+D+  +RA +DY   +   EY  WSDF++Q  +   ++VF    F+  +    T+    + +  + +FG E++GL   + +   K  LK+      RS NLS +V   AF
  S:    10 LLHVVLFEPEKAGNVGNVARTCSVLGAELHLIRPFGFHLHDREFRRAVMDYLQGVTLHEYAGWSDFQAQ--LPDAARVF---AFSTHATEYHTRAGFKRGD--YLLFGPESRGLPVWLRDALPK--LKLPQPGRGRSLNLSVAVGAAAF 149
>gi|28198735|ref|NP_779049.1| tRNA/rRNA methylase [Xylella fastidiosa Temecula1] >gi|28056826|gb|AAO28698.1| tRNA/rRNA methylase [Xylella fastidiosa Temecula1] (153 aa)
Score = 235, Expect = 1.5e-18, Identities = 53/149 (35%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           + +++L+QPEIP NTGN+ R C    A LH+I P GF L+D+++KRAGLDY ++ + + +         NL +  + +     FA  +   +  D  T      F+FG ET+GL   ++    + Q L + M    RS NLSN+VA++ F
  S:     3 LYDVLLYQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLDDRQLKRAGLDYHEYARMQVH--------PNLSSALAAIAPRRLFALSTRGQVRYDTPTFRTGDAFIFGPETRGLPDTVLHTIPESQRLYLPMQPQSRSLNLSNAVAVMVF 144
>gi|71275853|ref|ZP_00652137.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa Dixon] >gi|71897938|ref|ZP_00680143.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa Ann-1] >gi|71899349|ref|ZP_00681509.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa Ann-1] >gi|170730164|ref|YP_001775597.1| tRNA/rRNA methylase [Xylella fastidiosa M12] >gi|182681428|ref|YP_001829588.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa M23] >gi|71163431|gb|EAO13149.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa Dixon] >gi|71730863|gb|EAO32934.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa Ann-1] >gi|71732182|gb|EAO34237.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa Ann-1] >gi|167964957|gb|ACA11967.1| tRNA/rRNA methylase [Xylella fastidiosa M12] >gi|182631538|gb|ACB92314.1| tRNA/rRNA methyltransferase (SpoU) [Xylella fastidiosa M23] (155 aa)
Score = 235, Expect = 1.5e-18, Identities = 53/149 (35%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           + +++L+QPEIP NTGN+ R C    A LH+I P GF L+D+++KRAGLDY ++ + + +         NL +  + +     FA  +   +  D  T      F+FG ET+GL   ++    + Q L + M    RS NLSN+VA++ F
  S:     5 LYDVLLYQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLDDRQLKRAGLDYHEYARMQVH--------PNLSSALAAIAPRRLFALSTRGQVRYDTPTFRTGDAFIFGPETRGLPDTVLHTIPESQRLYLPMQPQSRSLNLSNAVAVMVF 146
>gi|78486290|ref|YP_392215.1| tRNA/rRNA methyltransferase (SpoU) [Thiomicrospira crunogena XCL-2] >gi|78364576|gb|ABB42541.1| rRNA methylase family protein [Thiomicrospira crunogena XCL-2] (154 aa)
Score = 234, Expect = 1.7e-18, Identities = 56/149 (37%), Positives = 91/149 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M++I+L++PEIP+NTG + R      A LH+I+P+ F L++K+++RAGLDY +    KE+   +  E+     K ++VF +T          TK E    E +F     F+FG ET+GL  +++E   + Q L I M    RS NL+N+V+++A+
  S:     1 MIHIILYEPEIPQNTGALIRLSANMGAHLHLIQPYAFDLSEKKVRRAGLDYAELANLKEH---ASLEACLETIKPNRVFALT----------TKTERYYTEPVFENGDAFLFGPETRGLPKDVIESVPEDQRLTIPMIPGGRSLNLANAVSVMAY 142
>gi|157415161|ref|YP_001482417.1| RNA methyltransferase [Campylobacter jejuni subsp. jejuni 81116] >gi|157386125|gb|ABV52440.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni 81116] (155 aa)
Score = 234, Expect = 1.8e-18, Identities = 57/149 (38%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+I+P  F ++ K ++RAGLDYWD L+   +++  +F ++N++ KN   F  T    KS       E  K++  F  FG E+ GL  E+M+   +  + I M S  RS NL+ SV I+++
  S:     1 MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIIKPTVFDISQKAVRRAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATT----KSQKAYFDAEFQKND--FLFFGSESYGLPMELMQLNWENAITIPMKSYGRSLNLATSVGIISY 143
>gi|116074887|ref|ZP_01472148.1| putative tRNA/rRNA methyltransferase (SpoU family) protein [Synechococcus sp. RS9916] >gi|116068109|gb|EAU73862.1| putative tRNA/rRNA methyltransferase (SpoU family) protein [Synechococcus sp. RS9916] (158 aa)
Score = 234, Expect = 1.8e-18, Identities = 52/149 (34%), Positives = 83/149 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF-QLKIEMNSNIRSFNLSNSVAIVAFH 150
           L I LF+P IP NTGNI+R+C  F   L +I P GF ++D+ +KRAGLDYW H+    + D+  F ++  V    ++   ++   +S+S     +    +    +FGRE  GL + + E+      + +  + N+RS NLS S A+V+F 
  S:     8 LRIALFEPRIPPNTGNIARSCAAFQLPLSLIEPLGFSIDDRAVKRAGLDYWPHVDLATHPDFEHFLAELPVPH--RLIGCSRHQGQSLSTF---QFQPGD--VLLFGREDTGLPNPVRERCDAICTIPMRGHENVRSLNLSVSCALVSFQ 150
>gi|124268369|ref|YP_001022373.1| putative tRNA/rRNA methyltransferase protein [Methylibium petroleiphilum PM1] >gi|124261144|gb|ABM96138.1| putative tRNA/rRNA methyltransferase protein [Methylibium petroleiphilum PM1] (161 aa)
Score = 234, Expect = 1.8e-18, Identities = 53/149 (35%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +PEIP NTGN+ R       TLH++ P GF + DK ++RAGLDY +H   + +  W       LV +      +  F  +    LT  E+      + VFG ET+GL   + +++   Q +++ M +  RS NLSN+VA+  F
  S:     1 MFHIVLVEPEIPPNTGNVIRLAANTGCTLHLVEPLGFSMEDKLLQRAGLDYHEHAAVRRHASWEAL----LVAEQPDPQRLFAFTTRGSRPLT--EVPWQAGDWLVFGCETRGLDPTLRDRFPAAQRVRLPMRAGQRSLNLSNAVAVAVF 144
>gi|54307450|ref|YP_128470.1| rRNA methylase [Photobacterium profundum SS9] >gi|46911870|emb|CAG18668.1| putative rRNA methylase, SpoU family [Photobacterium profundum SS9] (159 aa)
Score = 233, Expect = 2.0e-18, Identities = 54/149 (36%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D      + D++ F+         ++F  T    K+ +  T  +  + +    +FG ET+GL ++ +E     Q L+I M+ + RS NLSN+ AI+ +
  S:     6 MFDIALYEPEIAPNTGNIIRLCANCGADLHLIEPLGFDLEEKKLRRAGLDYHDLAHVHRHKDFAAFKE---AMAGRRLFACTT---KTTNYHTNAQFAEGD--VLIFGPETRGLPADFIESLPLEQRLRIPMHPDSRSLNLSNAAAIIGY 147
>gi|57237733|ref|YP_178981.1| RNA methyltransferase [Campylobacter jejuni RM1221] >gi|148926586|ref|ZP_01810268.1| putative RNA methylase [Campylobacter jejuni subsp. jejuni CG8486] >gi|57166537|gb|AAW35316.1| RNA methyltransferase, TrmH family [Campylobacter jejuni RM1221] >gi|145845280|gb|EDK22374.1| putative RNA methylase [Campylobacter jejuni subsp. jejuni CG8486] (155 aa)
Score = 233, Expect = 2.1e-18, Identities = 56/149 (37%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+++P  F ++ K ++RAGLDYWD L+   +++  +F ++N++ KN   F  T    KS       E  K++  F  FG E+ GL  E+M+   +  + I M S  RS NL+ SV I+++
  S:     1 MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIVKPTVFDISQKAVRRAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATT----KSQKAYFDAEFQKND--FLFFGSESYGLPMELMQLNWENAITIPMKSYGRSLNLATSVGIISY 143
>gi|126172465|ref|YP_001048614.1| RNA methyltransferase [Shewanella baltica OS155] >gi|125995670|gb|ABN59745.1| RNA methyltransferase, TrmH family, group 2 [Shewanella baltica OS155] (154 aa)
Score = 233, Expect = 2.4e-18, Identities = 56/149 (37%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF L +K+++RAGLDY D      + D+  F  + +  K  ++   T    +  + L+     KD+    +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDLEEKKLRRAGLDYADLTNVTRHKDFDAF-LEAMAGK--RIMACTTKGSRPHTELS---FAKDD--VLLFGPETRGLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|89094922|ref|ZP_01167853.1| Predicted rRNA/tRNA methylase, SpoU family protein [Oceanospirillum sp. MED92] >gi|89080788|gb|EAR60029.1| Predicted rRNA/tRNA methylase, SpoU family protein [Oceanospirillum sp. MED92] (156 aa)
Score = 233, Expect = 2.5e-18, Identities = 58/149 (38%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML++VLF+PEIP NTGNI R C      LH++ P GF L+DKR++RAGLDY +    K + D     SQ    +  KV+ +T       S++  D    D     + G ET+GL  E+     + + L++ M ++ RS NLSN+ AIV +
  S:     1 MLHVVLFEPEIPPNTGNIIRLCANTGFHLHLVEPLGFELDDKRLRRAGLDYHEFAAVKIHPDLETCLSQ---IEPRKVWALT--TKGRTSHVEADFQAGD---VLLLGPETRGLPEEVRMTIPQGEWLRMPMKADSRSLNLSNACAIVVY 142
>gi|113461765|ref|YP_719834.1| tRNA/rRNA methyltransferase [Haemophilus somnus 129PT] >gi|112823808|gb|ABI25897.1| possible tRNA/rRNA methyltransferase [Haemophilus somnus 129PT] (161 aa)
Score = 233, Expect = 2.6e-18, Identities = 52/149 (34%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DK+++R+GLDY +  + K++  +++F +    N+         FA  +       ++  +   + +FG ET+G+   I++     Q ++I M  N RS NLSN+VA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKKLRRSGLDYHEFAQIKKHKTFNEFLNTEQPNR--------LFALTTKGTPAHSQVNFELGDYLMFGPETRGIPMSILDNLPTTQKIRIPMIENSRSMNLSNAVAVTVY 142
>gi|118049291|ref|ZP_01517842.1| RNA methyltransferase, TrmH family, group 2 [Comamonas testosteroni KF-1] >gi|118003158|gb|EAV17311.1| RNA methyltransferase, TrmH family, group 2 [Comamonas testosteroni KF-1] (164 aa)
Score = 232, Expect = 2.7e-18, Identities = 52/149 (34%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL  PEIP NTGN+ R       +LH+I P GF + D+ M+RAGLDY ++     +  W  F   +   +  ++F +T  +      +   E    +  + VFG E+KGL  E+  ++   Q L++ M ++ RS NLSN+VA+  F
  S:     1 MFHIVLVAPEIPPNTGNVIRLAANTGCSLHLIEPLGFSMEDRHMRRAGLDYHEYANVARHASWDAF-IDSCQPRRERMFAMTTHSSSPAHAM---EFKAGD--WLVFGSESKGLPPEVRAQFPNEQRLRLPMLASQRSLNLSNAVAVTVF 144
>gi|120597274|ref|YP_961848.1| RNA methyltransferase [Shewanella sp. W3-18-1] >gi|146294582|ref|YP_001185006.1| RNA methyltransferase [Shewanella putrefaciens CN-32] >gi|120557367|gb|ABM23294.1| RNA methyltransferase, TrmH family, group 2 [Shewanella sp. W3-18-1] >gi|145566272|gb|ABP77207.1| RNA methyltransferase, TrmH family, group 2 [Shewanella putrefaciens CN-32] (154 aa)
Score = 232, Expect = 3.2e-18, Identities = 56/149 (37%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C      LH+I P GF L +K+++RAGLDY D      + D+  F  + +  K  ++   T    +  + L+     KD+    +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLRRAGLDYADLTNVTRHKDFDAF-LEAMTGK--RIMACTTKGSRPHTELS---FAKDD--VLLFGPETRGLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|157164727|ref|YP_001467080.1| RNA methyltransferase [Campylobacter concisus 13826] >gi|112800448|gb|EAT97792.1| hypothetical tRNA/rRNA methyltransferase Slr0992 [Campylobacter concisus 13826] (159 aa)
Score = 232, Expect = 3.3e-18, Identities = 57/149 (38%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P+IP+NTG I R CV  N  LH+++P  F L++K ++RAGLDYW  L  K ++   +F   NL +K    F  TK      +N    +   +   F  FG E+ GL  E M+   K  + I M    RS NL+ S  I+A+
  S:     1 MFNIVLVHPQIPQNTGAIGRMCVNANLKLHIVKPTVFDLSEKAVRRAGLDYWKILDPKIWESLDEFLEANLSHKERFFFATTK------TNRLYYDAKFEPGDFIFFGGESTGLPREFMDINFKNAITIPMGKEGRSLNLAMSAGIIAY 143
>gi|119946907|ref|YP_944587.1| RNA methyltransferase [Psychromonas ingrahamii 37] >gi|119865511|gb|ABM04988.1| RNA methyltransferase, TrmH family, group 2 [Psychromonas ingrahamii 37] (154 aa)
Score = 232, Expect = 3.3e-18, Identities = 55/149 (36%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M+ I LF+PEIP+NTG I R C      LH+I P GF L++K+++RAGLDY +      + +++DF  Q +  K  ++F  T    K+ +  ++     D+    +FG ET+GL  EI++     Q L+I M +  RS NLSN+V++  +
  S:     1 MIEIALFEPEIPQNTGAIIRLCANTGCVLHLIEPLGFDLDEKKVRRAGLDYHELTHVYRHKNYNDF-LQAVSGK--RIFACTT---KTTTFHSQANFQADD--VLLFGPETRGLPGEILDALPLEQKLRIPMRAESRSMNLSNAVSVFVY 142
>gi|170718519|ref|YP_001783729.1| RNA methyltransferase [Haemophilus somnus 2336] >gi|168826648|gb|ACA32019.1| RNA methyltransferase, TrmH family, group 2 [Haemophilus somnus 2336] (161 aa)
Score = 232, Expect = 3.4e-18, Identities = 52/149 (34%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP+NTGNI R C      LH+I P GF  +DK+++R+GLDY +  + K++  +++F +    N+         FA  +       ++  +   + +FG ET+G+   I++     Q ++I M  N RS NLSN+VA+  +
  S:     1 MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKKLRRSGLDYHEFAQIKKHKTFNEFLNTEQPNR--------LFALTTKGTPAHSQVNFELGDYLMFGPETRGIPMPILDNLPTTQKIRIPMIENSRSMNLSNAVAVTVY 142
>gi|126726856|ref|ZP_01742695.1| tRNA/rRNA methyltransferase (SpoU) [Rhodobacterales bacterium HTCC2150] >gi|126703814|gb|EBA02908.1| tRNA/rRNA methyltransferase (SpoU) [Rhodobacterales bacterium HTCC2150] (157 aa)
Score = 231, Expect = 3.5e-18, Identities = 53/149 (35%), Positives = 75/149 (50%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSN-IRSFNLSNSVAIVAFH 150
           + IVL  PEIP NTG I RTCV     L +I+P GF L++K ++RAG DYW H+    YDDW  F   +     S  F    F +     + + E   D   + +FG E+ GL   +++       K+ M S  +RS NL+N    V + 
  S:     6 MKIVLVTPEIPWNTGAIGRTCVALGLELILIKPLGFSLDEKAVRRAGTDYWKHVDLTLYDDWQSFLDAHNPAPESMYF----FEEHGAQTIYEPEY--DPNGYLIFGCESAGLPRAVLDGRDDQVFKLPMLSPLVRSLNLANVATAVVYQ 149
>gi|88705266|ref|ZP_01102977.1| tRNA/rRNA methyltransferase (SpoU) [gamma proteobacterium KT 71] >gi|88700356|gb|EAQ97464.1| tRNA/rRNA methyltransferase (SpoU) [Congregibacter litoralis KT71] (154 aa)
Score = 231, Expect = 3.5e-18, Identities = 51/149 (34%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML++ L++PEIP NTGNI R C   +  LH+I+P GF L DK+++RAGLDY      +E+      +S + + +      I   + +   N T  +  K +    +FG ET+GL + ++++    + L++ M  + RS NLSN+ A+V +
  S:     1 MLHVALYEPEIPPNTGNIMRLCANTSCPLHLIKPLGFSLEDKQLRRAGLDY------REFAHVQTHDSLDALIQTLHRPRIWTLSTRGTRNYTDADFQKGD--VLLFGPETRGLPATVLDELGVHRCLRVPMYPDSRSLNLSNAAALVLY 142
>gi|153002625|ref|YP_001368306.1| RNA methyltransferase [Shewanella baltica OS185] >gi|151367243|gb|ABS10243.1| RNA methyltransferase, TrmH family, group 2 [Shewanella baltica OS185] (154 aa)
Score = 231, Expect = 3.9e-18, Identities = 57/149 (38%), Positives = 80/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKD------ELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF   +K+++RAGLDY D      + D+  F              +   A K I   T        ELT  ++   +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDFEEKKLRRAGLDYADLTNVTRHKDFDAF--------------LEAMAGKRIMACTTKGSRPHTELTFAKDDVLLFGPETRGLPMSIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|74318425|ref|YP_316165.1| RNA methyltransferase CspR [Thiobacillus denitrificans ATCC 25259] >gi|74057920|gb|AAZ98360.1| RNA methyltransferase CspR [Thiobacillus denitrificans ATCC 25259] (154 aa)
Score = 231, Expect = 3.9e-18, Identities = 53/149 (35%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL+QPEIP NTGN+ R      A LH++ P GF L+DK++ RAGLDY D      + DW+  + + L  +  + F +T    +S +++  +          +FG E++GL ++++  +   Q L++ M    RS NLSN+V++V F
  S:     1 MFDIVLYQPEIPPNTGNLIRLAANTGARLHLVEPLGFDLSDKQLVRAGLDYHDMASVHVHADWTAVQ-EALAGR--RWFALTTRGSRSYASVAFEAGD-----VLLFGPESRGLPADLLAHFDVDQRLRLPMLPGSRSLNLSNAVSVVVF 142
>gi|149113884|ref|ZP_01840640.1| RNA methyltransferase, TrmH family, group 2 [Shewanella baltica OS223] >gi|146866242|gb|EDK51482.1| RNA methyltransferase, TrmH family, group 2 [Shewanella baltica OS223] (208 aa)
Score = 231, Expect = 4.1e-18, Identities = 56/149 (37%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C      LH+I P GF L +K+++RAGLDY D      + D+  F  + +  K  ++   T    +  + L+     KD+    +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:    55 MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLRRAGLDYADLTNVTRHKDFDAF-LEAMAGK--RIMACTTKGSRPHTELS---FAKDD--VLLFGPETRGLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 196
>gi|22299336|ref|NP_682583.1| SpoU rRNA methylase family [Thermosynechococcus elongatus BP-1] >gi|22295519|dbj|BAC09345.1| SpoU rRNA Methylase family [Thermosynechococcus elongatus BP-1] (153 aa)
Score = 230, Expect = 4.5e-18, Identities = 55/146 (37%), Positives = 79/146 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAI 146
           M  +VL  P+IP NTGNI+RTC      LH+I P GF L+D+ +KRAGLDYW ++    + DW  F      +++ ++      A +        + T  E  + VFG E  G+ ++++     F LKI M    +RS NLS SVAI
  S:     1 MPAVVLVHPQIPPNTGNIARTCAATQTPLHLIEPLGFELSDRYLKRAGLDYWPYVTLYCHPDWPTF--LKTAHRHGRLIAFEPAAQQIYW-----DFTFAESDWLVFGSEPAGIPADVLATCDVF-LKIPMWQPAVRSLNLSVSVAI 139
>gi|78777295|ref|YP_393610.1| tRNA/rRNA methyltransferase (SpoU) [Sulfurimonas denitrificans DSM 1251] >gi|78497835|gb|ABB44375.1| tRNA/rRNA methyltransferase (SpoU) [Sulfurimonas denitrificans DSM 1251] (156 aa)
Score = 230, Expect = 5.0e-18, Identities = 54/149 (36%), Positives = 76/149 (51%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF--------ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M N+VL  P+IP NTG I R CV   A+LH+I+P  F +++K ++RAGLDYW  L    ++   DF         +     K  K +    F+D                 +  FG ET G+  EI+ KYK+  + I M    RS NL+ S  IV +
  S:     1 MFNLVLVNPQIPNNTGAIGRLCVNAGASLHIIKPIAFDIDEKAVRRAGLDYWHKLDLHVWESLEDFFKNNNIINNAHFATTKTDKPYFEANFSDGD---------------YIFFGSETAGIPEEILTKYKEQNITIPMTKEGRSLNLAISTGIVLY 142
>gi|157327283|emb|CAO15076.1| unnamed protein product [Vitis vinifera] (250 aa)
Score = 230, Expect = 5.0e-18, Identities = 57/161 (35%), Positives = 86/161 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQL-----KIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +L +VL  P+IP NTG I+RTC      LH+I P GF ++D ++KRAGLDYW ++  K +D W++F       +  K  L   F  +  +N+  D  +  +  + +FG ET GL  E +   K   L     +I M  + +R  NLS SV I  +      N+  L+
  S:    68 LLQVVLVSPQIPGNTGTIARTCAASAVGLHLIEPLGFQVDDAKLKRAGLDYWPYVVVKVHDSWAEFREYFRQQEGEKRLL--AFTKRG-TNIHSD-FSYRKGDWLIFGSETCGLPPEALLDCKSEALGGGTIRIPMVETYVRCLNLSVSVGIALYEASRQLNYEQLQ 230
>gi|157413366|ref|YP_001484232.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9215] >gi|157387941|gb|ABV50646.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9215] (160 aa)
Score = 230, Expect = 5.0e-18, Identities = 61/158 (38%), Positives = 89/158 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM---------NSNIRSFNLSNSVAIVAFHYHFLTNFND 159
           + + LF+P IP+NTGNI+R+C  FN  L++I PFGF L DK +KRAGLDYW  +   +YD++  F    L +K +K   I  F+ ++   L   +   D+    +FGRE  GL   I++K   F + I M            +RS NLS +  I  +  H   NF +
  S:     1 MEVSLFEPRIPQNTGNIARSCAAFNIPLNLIEPFGFKLEDKYLKRAGLDYWPLVTVNKYDNFEKF----LASKATK--RIISFSKRNGIYLKDFKFKHDD--ILLFGREDLGLPDYIIDK-SDFLISIFMPNLQTGNNAQKGVRSLNLSVACGIAIYEAHKQINFQN 158
>gi|33240425|ref|NP_875367.1| rRNA methylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33237952|gb|AAQ00020.1| Predicted rRNA methylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (166 aa)
Score = 230, Expect = 5.4e-18, Identities = 56/148 (37%), Positives = 89/148 (60%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L+I L++P IP+NTGNI RTC+ F+  LH+I P GF +N+KR+KRAGLDYW ++  + ++ ++ +     +N +     I  F+ +    L+K E   ++ +  +FGRE  GL S +  K   F   I M        ++ +RS NLS +  I +F
  S:     9 LSIALYEPRIPQNTGNIGRTCLAFDFDLHLILPLGFEINNKRLKRAGLDYWKYINLELHESFAHY--SKFINPSR----IIGFSKEGGIPLSKIEFQSNDSL--LFGREDLGLPSHVKNKC-DFMATIPMPGKSNSKNDNGVRSLNLSVACGIASF 155
>gi|50123235|ref|YP_052402.1| putative RNA-methyltransferase [Pectobacterium atrosepticum SCRI1043] >gi|49613761|emb|CAG77212.1| putative RNA-methyltransferase [Erwinia carotovora subsp. atroseptica SCRI1043] (154 aa)
Score = 230, Expect = 5.4e-18, Identities = 54/159 (33%), Positives = 82/159 (51%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKK-FQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFND 159
           M +I L++P+I  NTGNI R        LH+I P GF   +K+++RAGLDY D      + ++ DF +        ++F  T    +       D+ T       +FG ET GL  EI   ++  F+++I M S+ RS NLSN+VAI+++       F D
  S:     1 MFHIALYEPQIAPNTGNIIRLVANNGCMLHLIEPLGFDFEEKKLRRAGLDYHDLANVSRHKNYQDFLA---AVPGKRIFACTTKGSRPY-----DQPTYQPGDVLLFGSETSGLPDEIRNGFESDFRIRIPMQSDSRSLNLSNAVAIISYEAWRQNGFGD 152
>gi|88808705|ref|ZP_01124215.1| putative tRNA/rRNA methyltransferase (SpoU family) protein [Synechococcus sp. WH 7805] >gi|88787693|gb|EAR18850.1| putative tRNA/rRNA methyltransferase (SpoU family) protein [Synechococcus sp. WH 7805] (165 aa)
Score = 229, Expect = 6.0e-18, Identities = 52/149 (34%), Positives = 84/149 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAFH 150
           L++ LF+P IP NTGNI+RTC  F+  L +I P GF ++D+++KRAGLDYW H+    + D+  F++   + K S+V   ++    ++ + + ++         +FGRE  GL   + ++     L I M           +RS NLS + AI  F 
  S:     9 LSVALFEPRIPPNTGNIARTCAAFDLPLSLIEPLGFSIDDRQLKRAGLDYWPHVNLSVHTDFKAFKTS--LAKPSRVIGCSRRDGVALQDFSFEQGD-----VLLFGREDTGLPEPVRDQCDDI-LTIPMPCSAGVDGQGGVRSLNLSVACAIACFQ 157
>gi|123968533|ref|YP_001009391.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. AS9601] >gi|123198643|gb|ABM70284.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. AS9601] (160 aa)
Score = 229, Expect = 6.4e-18, Identities = 59/158 (37%), Positives = 91/158 (57%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEK----YKKFQLKIEMNSN----IRSFNLSNSVAIVAFHYHFLTNFND 159
           + + LF+P IP+NTGNI+R+C  FN  L++I P GF L DK +KRAGLDYW  +   +Y+++  F    L +K++K   I  F+ K+   L   +  +D+    +FGRE  GL   I++K       F   I+  +N    +RS NLS +  I  +  +   NF +
  S:     1 MEVALFEPRIPQNTGNIARSCAAFNIPLNLIEPLGFKLEDKYLKRAGLDYWPLVTVNQYENFEKF----LASKSTK--RIISFSKKNGLYLKDFKFKQDD--ILLFGREDSGLPDSIIDKSDFLISIFMPNIQTGNNDQKGVRSLNLSVACGIAIYEAYKQINFQN 158
>gi|86152124|ref|ZP_01070336.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni 260.94] >gi|85840909|gb|EAQ58159.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni 260.94] (155 aa)
Score = 229, Expect = 6.8e-18, Identities = 55/149 (36%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+++P  F ++ K ++RAGLDYWD L+   +++  +F ++N++ KN   F  T    KS       +  K++  F  FG E+ GL  E+M+   +  + I M S  RS NL+ SV I+++
  S:     1 MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIVKPTVFDISQKAVRRAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATT----KSQKAYFDAKFQKND--FLFFGSESYGLPVELMQLNWENAITIPMKSYGRSLNLATSVGIISY 143
>gi|157963757|ref|YP_001503791.1| RNA methyltransferase [Shewanella pealeana ATCC 700345] >gi|157848757|gb|ABV89256.1| RNA methyltransferase, TrmH family, group 2 [Shewanella pealeana ATCC 700345] (153 aa)
Score = 229, Expect = 7.0e-18, Identities = 57/149 (38%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK-----DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R        LH+I P GF L DK+++RAGLDY D      +             KN + FL      + ++  TK      ELT  ++   +FG E++GL ++I++     Q L+I M S  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLIANNGCKLHLIEPLGFDLEDKKLRRAGLDYADLANVTHH-------------KNFEAFLEAMAGKRIMACTTKGSRPHSELTFKQDDVLLFGPESRGLPADIIDSIPTEQRLRIPMMSTSRSLNLSNAVAIISY 142
>gi|89076382|ref|ZP_01162715.1| putative rRNA methylase, SpoU family protein [Photobacterium sp. SKA34] >gi|89047953|gb|EAR53544.1| putative rRNA methylase, SpoU family protein [Photobacterium sp. SKA34] (154 aa)
Score = 229, Expect = 7.3e-18, Identities = 60/158 (37%), Positives = 91/158 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD--HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSE-IMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M +I L++PEI  NTGNI R      A LH+I P GF L++K+++RAGLDY D  H+ R +     DF +     +  ++F  T    K+ +  T  +  + +    +FG ET+GL +E I  +  + +L+I M  + RS NLSN+VAI+AF      +FN
  S:     1 MFDIALYEPEIAPNTGNIIRLSANCGANLHLIEPLGFDLDEKKVRRAGLDYHDLAHVHRHK-----DFTAFMQAMEGRRIFACTT---KTTNFHTNAKFEQGD--VLLFGPETRGLPAEFIASQPLEQRLRIPMQPDSRSLNLSNAVAIIAFEAWRQMDFN 151
>gi|86153504|ref|ZP_01071708.1| rRNA methylase, SpoU family [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121612429|ref|YP_001000579.1| RNA methyltransferase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005510|ref|ZP_02271268.1| RNA methyltransferase, TrmH family protein [Campylobacter jejuni subsp. jejuni 81-176] >gi|85843230|gb|EAQ60441.1| rRNA methylase, SpoU family [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249452|gb|EAQ72412.1| RNA methyltransferase, TrmH family [Campylobacter jejuni subsp. jejuni 81-176] (155 aa)
Score = 228, Expect = 7.7e-18, Identities = 55/149 (36%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+++P  F ++ K ++RAGLDYWD L+   +++  +F ++N++ KN   F  T    KS       +  K++  F  FG E+ GL  E+M+   +  + I M S  RS NL+ SV I+++
  S:     1 MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIVKPTVFDISQKAVRRAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATT----KSQKAYFDAKFQKND--FLFFGSESYGLPMELMQLNWENAITIPMKSYGRSLNLATSVGIISY 143
>gi|149908629|ref|ZP_01897291.1| putative tRNA/rRNA methyltransferase [Moritella sp. PE36] >gi|149808463|gb|EDM68400.1| putative tRNA/rRNA methyltransferase [Moritella sp. PE36] (154 aa)
Score = 228, Expect = 8.8e-18, Identities = 55/149 (36%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML I LF+PEIP NTGNI R C      LH+I P GF  +DKR+KRAGLDY +    K + ++  F        ++++F  T    K        E         +FG ET+GL  E+++   + Q ++I M    RS NLSN+V++  +
  S:     1 MLQIALFEPEIPPNTGNIIRLCANSGFKLHLIEPLGFEWDDKRVKRAGLDYHEFADVKRHANYQAFLD---CVGDARIFACTTKGTK-----YHHEAQYQAGDVLLFGPETRGLPPEVLDTLPQEQKVRIPMLPESRSMNLSNAVSVFIY 142
>gi|76800290|ref|ZP_00782002.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae 18RS21] >gi|76584510|gb|EAO61403.1| RNA methyltransferase, TrmH family, group 2 [Streptococcus agalactiae 18RS21] (93 aa)
Score = 228, Expect = 8.8e-18, Identities = 40/64 (62%), Positives = 49/64 (76%)
  Q:     3 NIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF 66
           +IVLF+P+IP NTGNI+RTC   NA LH+IRP GF ++DK+MKRAGLDYWD L    YD   +F
  S:    19 HIVLFEPQIPANTGNIARTCAATNAPLHIIRPMGFPIDDKKMKRAGLDYWDKLDVSFYDGLEEF 82
>gi|146339026|ref|YP_001204074.1| putative tRNA/rRNA methyltransferase [Bradyrhizobium sp. ORS278] >gi|146191832|emb|CAL75837.1| putative tRNA/rRNA methyltransferase [Bradyrhizobium sp. ORS278] (161 aa)
Score = 228, Expect = 8.9e-18, Identities = 46/147 (31%), Positives = 80/147 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVA 148
           + I L+QP+IP+NTG I R C       H+I P GF ++D++ +RAG+DY DHL  + +D WS FE+         + L TK A   +      +++   +   + GRE+ G+ + + +     +L+I +   +RS N++ + A+ A
  S:     1 MQIALYQPDIPQNTGTILRLCACLGLAAHIIEPAGFAVSDRQFRRAGMDYLDHLDWRRHDSWSAFEAWRATQGYRLLLLTTKGATSYL------DISYRPDDILLLGRESVGVPATVADAADA-RLRIPLKPGMRSLNVAIASAMAA 140
>gi|30690444|ref|NP_198040.2| tRNA/rRNA methyltransferase (SpoU) family protein [Arabidopsis thaliana] >gi|38603878|gb|AAR24684.1| At5g26880 [Arabidopsis thaliana] >gi|110740973|dbj|BAE98581.1| hypothetical protein [Arabidopsis thaliana] >gi|110743259|dbj|BAE99520.1| hypothetical protein [Arabidopsis thaliana] (263 aa)
Score = 228, Expect = 9.0e-18, Identities = 56/161 (34%), Positives = 87/161 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQ-NLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM-----EKYKKFQLKIEM-NSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +L++VL  P+IP NTG I+RTC      LH++ P GF ++D R+KRAGLDYW  +  K +  W++F+    L     ++   TK   +  S+ +    + D   + +FG ET GL  E +     E Y    L+I M  + +R  NLS SV I  +      N+  ++
  S:    81 LLHVVLVSPQIPGNTGCIARTCAASAVGLHLVGPLGFQVDDARVKRAGLDYWPFVVVKAHSSWAEFQEYFRLQEGEKRMIAFTKRGTRIHSDFSYR--SGD---YLLFGSETSGLPPEALSDCNHEPYGGGTLRIPMVETYVRCLNLSVSVGIALYEASRQLNYEQIE 243
>gi|124548097|ref|ZP_01706863.1| RNA methyltransferase, TrmH family, group 2 [Shewanella putrefaciens 200] >gi|124508673|gb|EAY52764.1| RNA methyltransferase, TrmH family, group 2 [Shewanella putrefaciens 200] (154 aa)
Score = 227, Expect = 1.1e-17, Identities = 55/149 (36%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C      LH+I P GF L +K+++RAGLDY D      + D+  F  + +  K  ++   T    +        EL+  +    +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLRRAGLDYADLTNVTRHKDFDAF-LEAMTGK--RIMACTTKGSRP-----HTELSFAKNDVLLFGPETRGLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|57242225|ref|ZP_00370164.1| RNA methyltransferase, TrmH family, group 2 [Campylobacter upsaliensis RM3195] >gi|57016905|gb|EAL53687.1| RNA methyltransferase, TrmH family, group 2 [Campylobacter upsaliensis RM3195] (154 aa)
Score = 227, Expect = 1.1e-17, Identities = 60/160 (37%), Positives = 81/160 (50%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           M +IVL  P IP+NTG+I R C      LH+I+P  F L++K +KRAGLDYWD L+   ++   +F   NL  K    F  TK      S      +      F  FG E+ GL +E+M   +  Q+ I M    RS NL+ SV IV++      NFN  
  S:     1 MFHIVLVHPRIPQNTGSIGRMCFNVGFKLHIIKPCVFDLSEKAVKRAGLDYWDKLEPIIWESLEEFLRSNLQCKERFFFATTKSKKPYFS------VKFRAGDFLFFGSESFGLPNELMNLNEAHQITIPMKPYGRSLNLATSVGIVSYE-ALRQNFNSF 153
>gi|196155361|ref|YP_002124850.1| putative tRNA/rRNA methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|88775090|gb|EAR06341.1| putative tRNA/rRNA methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|196111140|gb|ACG64856.1| putative tRNA/rRNA methyltransferase [Alteromonas macleodii 'Deep ecotype'] (154 aa)
Score = 227, Expect = 1.2e-17, Identities = 61/149 (40%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY--WDHLKRKEYDDWSDFESQNLVNKNSKVFLIT---KFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY  + H+KR    D +  E      K ++VF  T   K     +S    D L        +FG ET+GL  + ++     Q ++I M  + RS NLSN+V++  +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANSGFMLHLIEPLGFDWDDKRVRRAGLDYHEFAHVKRHASLD-AYLEDA----KPNRVFACTTKGKAFHSDVSYQKGDAL--------IFGPETRGLPDDYIQSLPPEQRVRIPMLPDSRSMNLSNAVSVFVY 142
>gi|88813043|ref|ZP_01128285.1| RNA methyltransferase, TrmH family, group 2 [Nitrococcus mobilis Nb-231] >gi|88789676|gb|EAR20801.1| RNA methyltransferase, TrmH family, group 2 [Nitrococcus mobilis Nb-231] (169 aa)
Score = 227, Expect = 1.2e-17, Identities = 51/149 (34%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADK---SISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +L++VL +PEIP NTGN+ R C      LH+I P GF ++D+R++RAGLDY ++ + +E+  ++ F       +  ++F  +  A +   ++     D L        +FG E++GL   ++E +  K  L++ M    RS NLSN+VA+  F
  S:    13 LLHVVLLEPEIPANTGNVIRLCANTGMRLHLIHPLGFYMDDRRLRRAGLDYREYARVEEHAGYAAFCR---TVQPMRIFAFSASARRIFHAVRFQPGDAL--------LFGSESRGLPPNLLEAFDPKAVLRLPMVPGNRSLNLSNAVAVAVF 154
>gi|24376005|ref|NP_720048.1| RNA methyltransferase [Shewanella oneidensis MR-1] >gi|24351008|gb|AAN57492.1|AE015885_5 RNA methyltransferase, TrmH family, group 2 [Shewanella oneidensis MR-1] (154 aa)
Score = 227, Expect = 1.3e-17, Identities = 56/149 (37%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK-----DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF   +K+++RAGLDY D      +             KN   FL      + ++  TK      EL+  ++   +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDFEEKKLRRAGLDYADLTNVTRH-------------KNFDAFLKAMAGKRIMACTTKGSRPHSELSFAKDDVLLFGPETRGLPMSIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|145350134|ref|XP_001419472.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144579704|gb|ABO97765.1| predicted protein [Ostreococcus lucimarinus CCE9901] (183 aa)
Score = 226, Expect = 1.5e-17, Identities = 55/145 (37%), Positives = 85/145 (58%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFES--QNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF----QLKIEMNSNIRSFNLSNSVAI 146
           L++VL  P+IP NTG I+RTC      LH++ P GF L+D ++KRAGLDYW  +  K +DDW  F +  + L ++  ++   +KF  +  +   +D   +  + + +FG ET GL    ME  K      ++ I+  S++RS NLS S  I
  S:    21 LHVVLVTPKIPGNTGCIARTCAASRVPLHLVAPLGFSLDDAQLKRAGLDYWKSVCVKVHDDWDAFYAYWRELGDERGRLVAFSKFGARPHA---EDGAYRPGD-WLLFGAETTGLPDAAMEACKATGGVRRIPID-ESHVRSLNLSVSCGI 166
>gi|90580897|ref|ZP_01236699.1| putative rRNA methylase, SpoU family protein [Vibrio angustum S14] >gi|90437968|gb|EAS63157.1| putative rRNA methylase, SpoU family protein [Vibrio angustum S14] (154 aa)
Score = 226, Expect = 1.6e-17, Identities = 59/158 (37%), Positives = 89/158 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD--HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           M +I L++PEI  NTGNI R      A LH+I P GF L++K+++RAGLDY D  H+ R +     DF +     +  ++F  T    K+ +  T  +  + +    +FG ET+GL +E +      Q L+I M  + RS NLSN+VAI++F      +FN
  S:     1 MFDIALYEPEIAPNTGNIIRLSANCGANLHLIEPLGFDLDEKKVRRAGLDYHDLAHVHRHK-----DFAAFMQAMEGRRIFACTT---KTTNFHTNAKFEQGD--VLLFGPETRGLPAEFIASLPLEQRLRIPMQPDSRSLNLSNAVAIISFEAWRQMDFN 151
>gi|126696336|ref|YP_001091222.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9301] >gi|126543379|gb|ABO17621.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9301] (160 aa)
Score = 226, Expect = 1.6e-17, Identities = 56/158 (35%), Positives = 86/158 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEK----YKKFQLKIEMNSN----IRSFNLSNSVAIVAFHYHFLTNFND 159
           + + LF+P IP+NTGNI+R+C  F+  L++I P GF L DK +KRAGLDYW  +    Y+++  F +     +      I  F+ K+   L   +  +D+    +FGRE  GL   I++K       F   I+  +N    +RS NLS +  I  +  H   NF +
  S:     1 MEVALFEPRIPQNTGNIARSCAAFDIPLNLIEPLGFKLEDKYLKRAGLDYWPLVTVNRYENFEKFMTAKTTKR------IISFSKKNGLYLKDFKFKQDD--ILLFGREDSGLPDSIIDKSDFLISIFMPNIQTGNNDQKGVRSLNLSVACGIAIYEAHKQINFQN 158
>gi|71277929|ref|YP_271035.1| RNA methyltransferase [Colwellia psychrerythraea 34H] >gi|71143669|gb|AAZ24142.1| RNA methyltransferase, TrmH family, group 2 [Colwellia psychrerythraea 34H] (154 aa)
Score = 226, Expect = 1.7e-17, Identities = 53/149 (35%), Positives = 86/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKY-KKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML++VLFQP+IP NTGNI R C      LH+I P GF L+DK+++RAGLDY +    + + +++ F  +    +  +V  IT     + +N    +++     + +FG ET GL  E+  +   + +L+I M    RS NLSN+ A++ +
  S:     1 MLDVVLFQPQIPPNTGNIIRLCANSGFRLHLIEPLGFDLDDKKLRRAGLDYHEFAAIQRHANFNAFLEK---EQPKRVLAIT-----TKTNNFYGDISFAAGDYLLFGSETAGLPEEVRAQIPDENKLRIPMLKESRSMNLSNATAVIVY 142
>gi|113972063|ref|YP_735856.1| RNA methyltransferase [Shewanella sp. MR-4] >gi|117922366|ref|YP_871558.1| RNA methyltransferase [Shewanella sp. ANA-3] >gi|113886747|gb|ABI40799.1| RNA methyltransferase, TrmH family, group 2 [Shewanella sp. MR-4] >gi|117614698|gb|ABK50152.1| RNA methyltransferase, TrmH family, group 2 [Shewanella sp. ANA-3] (154 aa)
Score = 225, Expect = 1.8e-17, Identities = 56/149 (37%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK-----DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF   +K+++RAGLDY D      +             KN   FL      + ++  TK      EL+  ++   +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDFEEKKLRRAGLDYADLTNVTRH-------------KNFDAFLEAMAGKRIMACTTKGSRPHTELSFAKDDVLLFGPETRGLPMPIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|33863022|ref|NP_894582.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9313] >gi|33634939|emb|CAE20925.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9313] (166 aa)
Score = 225, Expect = 1.9e-17, Identities = 55/148 (37%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFAD---KSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L + L++P IP NTGNI+RTC  F   L +I P GF L+D+ ++RAGLDYW H+    + D   F  +  +  N ++   ++F     +S+   T D L        +FGRE  GL S++ ++  +    I M           +RS NLS + AIV+F
  S:    10 LRVALYEPRIPPNTGNIARTCAAFRIPLALIEPLGFSLDDRYLRRAGLDYWPHVDLSVHSDLDTF--RKCLPLNHRLIGCSRFGGIPLRSMRFQTGDVL--------LFGREDTGLPSKVRQQCDQIT-TIPMPGAASEQGQGGVRSLNLSVACAIVSF 157
>gi|146280742|ref|YP_001170895.1| RNA methyltransferase [Pseudomonas stutzeri A1501] >gi|21425310|emb|CAC79245.1| putative RNA methylase [Pseudomonas stutzeri] >gi|145568947|gb|ABP78053.1| RNA methyltransferase, TrmH family, group 2 [Pseudomonas stutzeri A1501] (160 aa)
Score = 225, Expect = 2.0e-17, Identities = 53/149 (35%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDW-SDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +++LFQPEIP NTGNI R C      LH+I P G+ L+DKR++RAGLDY ++   + + D  S      +   N     +  F  K      +    + + +  +FG E++GL  +I +     Q L++ M  + RS NLSN+VAI  +
  S:     1 MFHVILFQPEIPPNTGNIIRLCANTGCHLHLIEPLGYELDDKRLRRAGLDYHEYATLERHADLPSCLARIGIDAANPDGPRLFAFTTKGSQPFHEVRYRRGDAL--LFGPESRGLPPDIRDALPNEQRLRLPMRPDSRSLNLSNTVAIAVY 149
>gi|37520268|ref|NP_923645.1| tRNA/rRNA methyltransferase [Gloeobacter violaceus PCC 7421] >gi|35211261|dbj|BAC88640.1| gll0699 [Gloeobacter violaceus PCC 7421] (162 aa)
Score = 225, Expect = 2.1e-17, Identities = 51/148 (34%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
            ++VL  PEIP NTGN++RTC     +LH++   GF L+DK +KRAGLDYW+H+    + D      Q    ++++ F++T  A + +      +       + VFG E++GL   ++   +   + I +    +RS NLSN+VA+V F
  S:    11 FHVVLVDPEIPPNTGNVARTCAATGTSLHLVGTLGFQLSDKYLKRAGLDYWEHVDLHYHPDLGALLEQ----QSAQRFVLTS-ARRGVCLW---DFAFQPGDWLVFGSESRGLPEGLLSDERHPVVTIPLAEPAVRSLNLSNAVAVVLF 151
>gi|114049292|ref|YP_739842.1| RNA methyltransferase [Shewanella sp. MR-7] >gi|113890734|gb|ABI44785.1| RNA methyltransferase, TrmH family, group 2 [Shewanella sp. MR-7] (154 aa)
Score = 225, Expect = 2.1e-17, Identities = 56/149 (37%), Positives = 81/149 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTK-----DELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF   +K+++RAGLDY D      +             KN   FL      + ++  TK      EL+  ++   +FG ET+GL   I+E     Q L+I M +  RS NLSN+VAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDFEEKKLRRAGLDYADLTNVTRH-------------KNFDAFLEAMTGKRIMACTTKGSRPHTELSFAKDDVLLFGPETRGLPMPIIESIPTEQRLRIPMAATSRSLNLSNAVAIISY 142
>gi|57504963|ref|ZP_00370915.1| rRNA methylase [Campylobacter coli RM2228] >gi|57019235|gb|EAL55941.1| rRNA methylase [Campylobacter coli RM2228] (155 aa)
Score = 224, Expect = 2.5e-17, Identities = 55/149 (36%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M NIVL  P IP+NTG+I R C      LH+++P  F ++ K ++RAGLDYW+ L+   ++    F   NL+ K+   F  TK      SN    +    E  F  FG E+ GL  E+M+      + I M +  RS NL+ SV IV++
  S:     1 MFNIVLIHPRIPQNTGSIGRMCFNAGFKLHIVKPIVFDISQKAVRRAGLDYWEKLEPVIWESLDIFLEHNLIYKDRFFFATTK------SNKFYFQAKFQENDFLFFGSESYGLPMELMQLNWDNAITIPMKACGRSLNLATSVGIVSY 143
>gi|124023171|ref|YP_001017478.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9303] >gi|123963457|gb|ABM78213.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9303] (166 aa)
Score = 224, Expect = 2.6e-17, Identities = 55/148 (37%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFAD---KSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L + L++P IP NTGNI+RTC  F   L +I P GF L+D+ ++RAGLDYW H+    + D   F  +  +  N ++   ++F     +S+   T D L        +FGRE  GL ++I ++  +    I M           +RS NLS + AIV+F
  S:    10 LRVALYEPRIPPNTGNIARTCAAFRIPLALIEPLGFSLDDRYLRRAGLDYWPHVALSVHSDLDTF--RECLPLNHRLIGCSRFGGIPLRSMRFQTGDVL--------LFGREDTGLPTKIRQQCDQIT-TIPMPGAASEQGQGGVRSLNLSVACAIVSF 157
>gi|84393040|ref|ZP_00991806.1| rRNA methylase, SpoU family [Vibrio splendidus 12B01] >gi|84376292|gb|EAP93174.1| rRNA methylase, SpoU family [Vibrio splendidus 12B01] (159 aa)
Score = 224, Expect = 2.6e-17, Identities = 54/149 (36%), Positives = 82/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R      A LH+I P GF   +K+++RAGLDY D  + K + +   F  + L N+    + I     K+  +    +  + +    +FG E++GL +E +E     Q ++I M    RS NLSN+VAI+AF
  S:     1 MFDIALYEPEIAPNTGNIIRLSANCGANLHLIEPLGFDFEEKKVRRAGLDYHDLARVKRHKNLEAF-LEYLENEREGDYRIFACTTKTTGHHVDAKFQQGD--VLMFGPESRGLPAEFIESMPMEQRIRIPMMPEARSLNLSNAVAIIAF 147
>gi|159489640|ref|XP_001702805.1| predicted protein [Chlamydomonas reinhardtii] >gi|158280827|gb|EDP06584.1| predicted protein [Chlamydomonas reinhardtii] (153 aa)
Score = 224, Expect = 2.7e-17, Identities = 50/146 (34%), Positives = 80/146 (54%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQ--NLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIME---KYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           IVL  P+IP+NTGN++R+C      LH++ P GF L++K++KRAGLDYWD++    +  W  F +   NL      V       D ++      E T     + VFG ET GL  ++     +Y +  ++   ++++RS NL+ +  I  F
  S:     1 IVLVHPQIPQNTGNVARSCAATGTPLHLVGPLGFELDNKKLKRAGLDYWDNVAVALHSTWDHFFAAFINLPGPKRLVAFTVAGWDDTV------EFTYQSGDWLVFGAETSGLPPQVRPVTVRYARIPIR---DTHVRSINLAVAAGIGLF 142
>gi|49474493|ref|YP_032535.1| RNA methyltransferase [Bartonella quintana str. Toulouse] >gi|49239997|emb|CAF26411.1| RNA methyltransferase [Bartonella quintana str. Toulouse] (157 aa)
Score = 224, Expect = 2.8e-17, Identities = 53/146 (36%), Positives = 80/146 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           ML+I LFQP+I  NTG I R    F   +H+I P GF L+D+ +KRAG+DY ++     + DW  F S  + + N ++ L++  A+   +     ++   E    +FGRE+ G+   + E      LKI M  + RS NL+ SVAI
  S:     2 MLHIALFQPDIAGNTGTILRLSACFGLHVHIIEPAGFSLSDRNLKRAGMDYLEYASLNRHIDWQSFMS-TMKHFNRRLLLLSTKAETCYT-----QIYYRENDVLLFGRESAGVPDYVHEAVDH-SLKIPMQPHARSLNLAMSVAI 140
>gi|109897315|ref|YP_660570.1| RNA methyltransferase [Pseudoalteromonas atlantica T6c] >gi|109699596|gb|ABG39516.1| RNA methyltransferase, TrmH family, group 2 [Pseudoalteromonas atlantica T6c] (154 aa)
Score = 223, Expect = 3.2e-17, Identities = 53/149 (35%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL+QPEIP NTGNI R C      LH+I P GF  +DKR++RAGLDY +      +   +  ++     +  ++F  T    K  +   K E    + +  +FG ET+GL  ++++     Q ++I M  + RS NLSN+V++  +
  S:     1 MLDIVLYQPEIPPNTGNIIRLCANTGFALHLIEPLGFEWDDKRVRRAGLDYHEFANVVRH---ASLQAYMESRQPKRIFACTT---KGTTFFAKAEYQLGDAL--LFGPETRGLPDDVIQSLPPEQRVRIPMLPDSRSMNLSNAVSVFVY 142
>gi|33861419|ref|NP_892980.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33633996|emb|CAE19321.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (160 aa)
Score = 223, Expect = 3.3e-17, Identities = 58/148 (39%), Positives = 88/148 (59%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKK----FQLKIEMNSN----IRSFNLSNSVAIVAF 149
           + I LF+P IP+NTG+I+RTC  F+ TL++I P GF L DK +KRAGLDYW  +K K Y ++++F+      KN +   I  F+ K+   L      +D+    +FGRE  GL + I+         F  K+ +++N    +RS NLS +  I  +
  S:     1 MEISLFEPRIPQNTGSIARTCAAFDITLNLIEPLGFKLEDKYLKRAGLDYWPLVKLKNYSNFNNFKDS---KKNKR---IIAFSKKNGVYLKDFRFHEDD--ILLFGREDTGLPNNIINASNSLISIFMPKVALSNNDPKGVRSLNLSVACGIAIY 148
>gi|148253796|ref|YP_001238381.1| putative tRNA/rRNA methyltransferase [Bradyrhizobium sp. BTAi1] >gi|146405969|gb|ABQ34475.1| putative tRNA/rRNA methyltransferase [Bradyrhizobium sp. BTAi1] (158 aa)
Score = 223, Expect = 3.4e-17, Identities = 47/139 (33%), Positives = 74/139 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNL 140
           + I L+QP+IP+NTG I R C       H+I P GF ++D++ +RAG+DY DHL  + +D WS FE       +  +   TK A   +     D   K ++I  + GRE+ G+   + E     +L+I +   +RS N+
  S:     1 MQIALYQPDIPQNTGTILRLCACLGLAAHIIEPAGFAVSDRQFRRAGMDYLDHLAWRRHDSWSAFEDWRAAQGHRLLLFTTKAATSYL-----DFSYKADDI-LLLGRESAGVPDTVAE-VADARLRIPLRPGLRSLNV 132
>gi|77919053|ref|YP_356868.1| putative rRNA methylase [Pelobacter carbinolicus DSM 2380] >gi|77545136|gb|ABA88698.1| putative rRNA methylase [Pelobacter carbinolicus DSM 2380] (156 aa)
Score = 223, Expect = 3.6e-17, Identities = 51/148 (34%), Positives = 83/148 (56%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNS-NIRSFNLSNSVAIVAF 149
            +IVL +PEIP NTGNI+R C      LH++   GF L+D+ +KRAGLDYW+ +  +    W   +       + + +  +K A++  S++  D    D   F VFG+ET GL ++++ +     ++I + S  +RS NLS +  IV +
  S:     6 FHIVLVEPEIPPNTGNIARLCGATGTILHLVGKLGFSLDDRYLKRAGLDYWEVIDVRR---WESLQQLEEAFPDGRWWYTSKKAER--SHVGADFQPGD---FIVFGKETAGLPADLLARNPAHCIRIPIFSPRVRSLNLSTAAGIVLY 146
>gi|114332105|ref|YP_748327.1| RNA methyltransferase [Nitrosomonas eutropha C91] >gi|114309119|gb|ABI60362.1| RNA methyltransferase, TrmH family, group 2 [Nitrosomonas eutropha C91] (154 aa)
Score = 221, Expect = 5.0e-17, Identities = 50/124 (40%), Positives = 72/124 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDY--WDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKK 124
           ML ++L QPEIP NTGNI R C   +  LH+I+P GF L+D+++KRAGLDY  W  L   E     D  S   +    ++F +T    K+  +  K + T D+   F+FG ET GL  E++E + +
  S:     1 MLQVILHQPEIPPNTGNIIRLCANTSTQLHLIKPLGFNLSDRQLKRAGLDYHEWARLTVHE-----DLASCLSLMDGCRIFAVTT---KATKHYDKVDYTTDD--VFLFGSETCGLPVEVLEDFSQ 116
>gi|117923674|ref|YP_864291.1| tRNA/rRNA methyltransferase (SpoU) [Magnetococcus sp. MC-1] >gi|117607430|gb|ABK42885.1| tRNA/rRNA methyltransferase (SpoU) [Magnetococcus sp. MC-1] (174 aa)
Score = 220, Expect = 7.6e-17, Identities = 50/149 (33%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +L++VL++PEIP NTGNI R C    A LH++ P  F L++  +KRAG+DY   +  + YDDW+     Q L  +   +         ++     D L        +FG E  GL +EI +      +++ M    RS NL+N+VA+V +
  S:    21 LLHVVLYRPEIPPNTGNIQRICAATGAMLHLVGPIAFRLDNAALKRAGMDYRQWVDVQRYDDWAHCLRMQPLGVRWIPISTKATQGYHTMRYQAGDRL--------LFGSEGSGLPAEIHQALGHNAVRVPMLPRARSLNLANTVAVVLY 162
>gi|119510692|ref|ZP_01629820.1| hypothetical protein N9414_22008 [Nodularia spumigena CCY9414] >gi|119464646|gb|EAW45555.1| hypothetical protein N9414_22008 [Nodularia spumigena CCY9414] (153 aa)
Score = 219, Expect = 8.9e-17, Identities = 53/149 (35%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           M  +VL  P+IP NTGNI+RTC      LH++ P GF ++D+ +KRAGLDYW ++K   ++    F++ +      +      F  +   N    +   D+  + +FG ET GL S I+       L I M   ++RS NLS SVA+  F
  S:     1 MPQVVLVYPQIPPNTGNIARTCAATGTELHLVAPLGFEISDRYLKRAGLDYWPYVKLHYHESLEAFQATH----QERGGRCLGFTVRGNFNYASFQFQADD--WLLFGSETTGLPSTILSDCDA-TLYIPMAEPHVRSLNLSVSVAVSLF 143
>gi|114770916|ref|ZP_01448384.1| putative tRNA/rRNA methyltransferase [alpha proteobacterium HTCC2255] (154 aa)
Score = 219, Expect = 9.2e-17, Identities = 54/149 (36%), Positives = 85/149 (57%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSE-IMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML+IVL++PEIP NTGNI R C      LH+I P GF  +DK+++RAGLDY +    + +   ++ ++     K  ++F  T          TK  +   +  +      +FG ET+GL  + I+    + +++I M S+ RS NLSNSVA+  +
  S:     1 MLDIVLYEPEIPPNTGNIIRLCANSGFALHLIEPLGFEWDDKKVRRAGLDYHEFANVQRH---ANLDAYLASAKPQRIFACT----------TKGSMFHSKASYAPGDCLIFGPETRGLPHDFILSLPPEQRVRIPMLSDSRSMNLSNSVAVFIY 142
>gi|59712952|ref|YP_205728.1| rRNA methylase [Vibrio fischeri ES114] >gi|59481053|gb|AAW86840.1| predicted rRNA methylase [Vibrio fischeri ES114] (159 aa)
Score = 219, Expect = 9.5e-17, Identities = 56/149 (37%), Positives = 84/149 (56%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R      A LH+I P GF L +K+++RAGLDY D    K + +++ F  + L N +     I  FA  + +       T  +    +FG ET+GL +++++     Q ++I M  + RS NLSNSVAI+ F
  S:     1 MFDIALYEPEIAPNTGNIIRLSANCGANLHLIEPLGFDLEEKKLRRAGLDYHDLAHVKRHKNYAAF-LEYLANDSDVEHRI--FACTTKTTGHHTTPTYQKGDVLLFGPETRGLPADLIDGLPMEQRVRIPMMPDSRSLNLSNSVAIIVF 147
>gi|39996299|ref|NP_952250.1| RNA methyltransferase [Geobacter sulfurreducens PCA] >gi|39983179|gb|AAR34573.1| RNA methyltransferase, TrmH family, group 2, putative [Geobacter sulfurreducens PCA] (164 aa)
Score = 219, Expect = 9.6e-17, Identities = 48/148 (32%), Positives = 77/148 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
            +IVL +PEIP NTGNI+R C      LH++   GF  +D+ +KRAGLDYW  +  +    W   +       +++ F  +K A +   +    E       F VFG+ET GL  +++   ++  ++I +   +RS NLS +  IV +
  S:     7 FHIVLVEPEIPPNTGNIARLCGATGTVLHLVGKLGFSTDDRYLKRAGLDYWSEVDIRY---WESLDQLRQAWPDARFFYTSKKAARCYVDAGFREGD-----FIVFGKETVGLPEDLLRANEEHCVRIPIFGKVRSLNLSTAAGIVLY 146
>gi|119776572|ref|YP_929312.1| RNA methyltransferase TrmH, group 2 [Shewanella amazonensis SB2B] >gi|119769072|gb|ABM01643.1| RNA methyltransferase TrmH, group 2 [Shewanella amazonensis SB2B] (158 aa)
Score = 219, Expect = 9.7e-17, Identities = 52/149 (34%), Positives = 77/149 (51%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C      LH+I P GF L +K+++RAGLDY D  +   + D+  F          ++   T    +        EL        +FG E++GL  +I+      Q L+I M  + RS NLSN+VAI+++
  S:     5 MFHIALYEPEIAPNTGNIIRLCANNGCELHLIEPLGFDLEEKKLRRAGLDYSDMTRVTRHKDFPSFLE---AMAGRRILACTTKGSRP-----HTELEYQAGDVLLFGPESRGLPMDIINSVPTEQRLRIPMVESSRSLNLSNAVAIISY 146
>gi|148652780|ref|YP_001279873.1| tRNA/rRNA methyltransferase (SpoU) [Psychrobacter sp. PRwf-1] >gi|148571864|gb|ABQ93923.1| tRNA/rRNA methyltransferase (SpoU) [Psychrobacter sp. PRwf-1] (180 aa)
Score = 218, Expect = 1.1e-16, Identities = 51/148 (34%), Positives = 80/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWS-DFESQNLVNKNSKVFLITKFADKSIS-NLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           ++IVL  P+IP NTG+  R C    A LH++ P GF L+DK+++RAGLDY ++   + + +W    E+      +  V L TK +      +       + E I  VFG ET GL  +I     +   L++ M  + RS NL+NS++I  +
  S:     3 IHIVLVHPKIPNNTGSAIRLCANTGAQLHLVEPLGFDLDDKKLRRAGLDYHEYAAMQVHKNWQVAKEALQAAGCHKMVALTTKLSHPFYEYDFGDSNAAEHESIALVFGSETAGLADDIRADIGESNWLRLPMLPDSRSLNLANSISICLY 153
>gi|148239457|ref|YP_001224844.1| rRNA methylase [Synechococcus sp. WH 7803] >gi|147847996|emb|CAK23547.1| Predicted rRNA methylase [Synechococcus sp. WH 7803] (165 aa)
Score = 216, Expect = 2.1e-16, Identities = 51/149 (34%), Positives = 79/149 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAFH 150
           L + LF+P IP NTGNI+RTC  F+  L +I P GF ++D+++KRAGLDYW H+    + ++  F+     N  +K F +   + +    +       +     +FGRE  GL   + ++  +  L I M           +RS NLS + AI  F 
  S:     9 LRVALFEPRIPPNTGNIARTCAAFDLPLSLIEPLGFSIDDRQLKRAGLDYWPHVNLSVHTNFQAFK-----NSLAKPFRVIGCSRR--DGVALQGFCFEPGDVLLFGREDTGLPQPVRDQCDQI-LTIPMPCSADSDGQGGVRSLNLSVACAIACFQ 157
>gi|49475913|ref|YP_033954.1| RNA methyltransferase [Bartonella henselae str. Houston-1] >gi|49238721|emb|CAF27975.1| RNA methyltransferase [Bartonella henselae str. Houston-1] (158 aa)
Score = 215, Expect = 3.1e-16, Identities = 51/145 (35%), Positives = 79/145 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           L+I LFQP+I  NTG I R    F   +H+I P GF L+D+ +KRAG+DY ++   + + DW  F    +   N ++ L++  A+   +     ++   E    +FGRE+ G+ + + E   +  LKI M    RS NL+ SVAI
  S:     3 LHIALFQPDIAGNTGTILRLSACFGLHVHIIEPAGFNLSDRNLKRAGMDYLEYASLERHIDWPHF-IHTMKQFNRRLLLLSTKAETCYT-----QICYQENDVLLFGRESAGVPNYVYEAVNE-TLKIPMQPYARSLNLAMSVAI 140
>gi|134098676|ref|YP_001104337.1| tRNA/rRNA methyltransferase (SpoU) [Saccharopolyspora erythraea NRRL 2338] >gi|133911299|emb|CAM01412.1| tRNA/rRNA methyltransferase (SpoU) [Saccharopolyspora erythraea NRRL 2338] (152 aa)
Score = 214, Expect = 3.5e-16, Identities = 51/149 (34%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M ++V + PEIP NTGN  R   G  A LH+I P GF ++D +++RAGLDY D   R       D ++     +  +VF  +  A +S   ++     +  ++  +FG E+ GL  E++E      L+I M    RS NL+NS AI  +
  S:     1 MFHVVFYHPEIPGNTGNAIRMAAGSGAALHLIEPLGFSVDDAKLRRAGLDYHD---RAALHVHPDLDAAWTALRPDRVFAFSSSATRSYETVS----YRPGDV-LMFGPESVGLPPELLEADYVTPLRIPMLPGNRSLNLANSAAIAVY 141
>gi|78779323|ref|YP_397435.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9312] >gi|78712822|gb|ABB49999.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9312] (160 aa)
Score = 214, Expect = 3.8e-16, Identities = 57/151 (37%), Positives = 84/151 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF------QLKIEMNSN--IRSFNLSNSVAIVAFHYH 152
           + + LF+P IP+NTGNI+R+C  FN  L++I P GF L DK +KRAGLDYW  +   +Y ++  F    L +K +K   I  F+ K+   L   +  +D+    +FGRE  GL   I++            L+ E N    +RS NLS +  I  +  H
  S:     1 MEVTLFEPRIPQNTGNIARSCAAFNIPLNLIEPLGFKLEDKYLKRAGLDYWPLVTVNKYANFKKF----LASKQTK--RIISFSKKNGIYLKDFKFQEDD--VLLFGREDSGLPDLIIDNSDYLISIFMPNLQTENNDQKGVRSLNLSVACGIAIYEAH 151
>gi|113954223|ref|YP_730533.1| rRNA methylase [Synechococcus sp. CC9311] >gi|113881574|gb|ABI46532.1| Predicted rRNA methylase [Synechococcus sp. CC9311] (176 aa)
Score = 214, Expect = 4.1e-16, Identities = 57/147 (38%), Positives = 79/147 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVA 148
           L + LF+P IP NTGNI+RTC  F   L +I P GF L D+ +KRAGLDYW H+    + D    FES   + + S+V   ++     + N+   E  K +    +FGRE  GL   I  +  +    I M           +RS NLS + AIV+
  S:    20 LRVALFEPRIPPNTGNIARTCAAFGLPLDLIEPLGFSLEDRYLKRAGLDYWPHVDLTIHKDVDAFFES---LAQPSRVIGCSRRGGILLRNM---EFQKGD--VLLFGREDTGLPETIRSRCHQIT-TISMPCSAGEDGQGGVRSLNLSVACAIVS 166
>gi|123966176|ref|YP_001011257.1| SpoU family tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9515] >gi|123200542|gb|ABM72150.1| putative tRNA/rRNA methyltransferase (SpoU family) [Prochlorococcus marinus str. MIT 9515] (160 aa)
Score = 213, Expect = 5.5e-16, Identities = 57/156 (36%), Positives = 86/156 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKK----FQLKIEMNSN----IRSFNLSNSVAIVAFHYHFLTNF 157
           + I LF+P IP+NTG+I+RTC  F+ TL++I P GF L DK +KRAGLDYW  +K   Y ++  F+      +      I  F+ K+   L +    KD+    +FGRE  GL   ++         F   +E+++N    +RS NLS +  I  +  +   NF
  S:     1 MEISLFEPRIPQNTGSIARTCAAFDITLNLIEPLGFKLEDKYLKRAGLDYWPLVKLNNYPNFKKFKESKKNKR------IIAFSKKNGIYLNRFRFLKDD--ILLFGREDTGLPESVINGSNSLISIFMPNVELSNNDKKGVRSLNLSVACGIAIYEANKQINF 156
>gi|119487746|ref|ZP_01621255.1| RNA methyltransferase TrmH, group 2 [Lyngbya sp. PCC 8106] >gi|119455579|gb|EAW36716.1| RNA methyltransferase TrmH, group 2 [Lyngbya sp. PCC 8106] (154 aa)
Score = 212, Expect = 5.8e-16, Identities = 50/146 (34%), Positives = 78/146 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNS-NIRSFNLSNSVAI 146
           M  +VL QP+IP NTGN++RTC      LH++ P GF ++D+ ++RAGLDYW ++  K +     F+  +       +     F+ +   N  + +   D+  + +FG ET GL+ E++         I M    +RS NLS SVAI
  S:     1 MPRVVLIQPQIPPNTGNVARTCAATRTELHLVGPLGFEISDRDLRRAGLDYWPYVPLKIHSSIEAFKHYHQYWGGRWI----GFSKRGKQNYAQFQYQADD--WLLFGPETTGLSPELLSAC-DVTTSIPMREPGVRSLNLSVSVAI 140
>gi|71082809|ref|YP_265528.1| rRNA methylase [Candidatus Pelagibacter ubique HTCC1062] >gi|91762768|ref|ZP_01264733.1| rRNA Methylase [Candidatus Pelagibacter ubique HTCC1002] >gi|71061922|gb|AAZ20925.1| rRNA Methylase [Candidatus Pelagibacter ubique HTCC1062] >gi|91718570|gb|EAS85220.1| rRNA Methylase [Candidatus Pelagibacter ubique HTCC1002] (153 aa)
Score = 211, Expect = 7.9e-16, Identities = 57/155 (36%), Positives = 84/155 (54%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFN 158
           I L++P+IP+NT  I RTC    A L +I P GF+ +DKR KR  +DY D    + Y    +F       KN +V L+T    KS  + T  +   ++ +  +FGRE+ G+   +     K++LKI M  N RS N+++SVAI+       TNFN
  S:     7 IALYEPDIPQNTAAIIRTCACLGADLEIIEPCGFLFSDKRFKRVVMDYMDEKMIRFYQSSDEFFKS---KKNERVILLTT---KSADSYTDFKFESNDTL--LFGRESAGVPDHV-HNLIKYRLKIPMMDNKRSLNIASSVAIILSENLRQTNFN 152
>gi|116070592|ref|ZP_01467861.1| putative tRNA/rRNA methyltransferase (SpoU family) protein [Synechococcus sp. BL107] >gi|116065997|gb|EAU71754.1| putative tRNA/rRNA methyltransferase (SpoU family) protein [Synechococcus sp. BL107] (166 aa)
Score = 209, Expect = 1.3e-15, Identities = 52/148 (35%), Positives = 80/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L + LF+P IP NTGNI+RTC  F   L +I P GF ++D+ ++RAGLDYW H++   +  + D     L+  N     I   + +  S L++ E    +    +FGRE  GL  +I ++     + I M           +RS NLS + A+V +
  S:    10 LRVALFEPRIPPNTGNIARTCAAFQLPLSLIEPLGFQIDDRSLRRAGLDYWPHVQVSTHGSF-DALKDGLLPHNR----IIGCSRRGGSCLSEFEFQHGD--VLLFGREDTGLPEDIRDQCHSI-VTIPMPGAAAPSGQGGVRSLNLSVACALVTY 157
>gi|17230844|ref|NP_487392.1| hypothetical protein alr3352 [Nostoc sp. PCC 7120] >gi|17132447|dbj|BAB75051.1| alr3352 [Nostoc sp. PCC 7120] (153 aa)
Score = 208, Expect = 1.7e-15, Identities = 52/149 (34%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           M  +VL  P+IP NTGNI+RTC      LH++ P GF ++D+ +KRAGLDYW ++K   +     FE+ +      +   +  F+    S+  +     D+  + +FG ET GL   ++       L I M    +RS NLS SVA+  F
  S:     1 MPQVVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFEISDRYLKRAGLDYWPYVKLHYHKTLEAFENAH----QERGGRLLGFSVGGSSSYIQFPYQADD--WLLFGSETTGLPPTVLSACDA-TLYIPMAEPGVRSLNLSVSVAVGLF 143
>gi|75909401|ref|YP_323697.1| RNA methyltransferase TrmH, group 2 [Anabaena variabilis ATCC 29413] >gi|75703126|gb|ABA22802.1| RNA methyltransferase TrmH, group 2 [Anabaena variabilis ATCC 29413] (153 aa)
Score = 208, Expect = 1.8e-15, Identities = 54/149 (36%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           M  +VL  P+IP NTGNI+RTC      LH++ P GF ++D+ +KRAGLDYW ++K   +     FE  N+  +     L   F+    S+  +     D+  + +FG ET GL   ++       L I M    +RS NLS SVA+  F
  S:     1 MPQVVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFEISDRYLKRAGLDYWPYVKLHYHKTIEAFE--NVHQERGGRLL--GFSVSGSSSYIQFPYQADD--WLLFGSETTGLPPTVLSACDA-TLYIPMAEPGVRSLNLSVSVAVGLF 143
>gi|115372778|ref|ZP_01460084.1| CspR protein [Stigmatella aurantiaca DW4/3-1] >gi|115370259|gb|EAU69188.1| CspR protein [Stigmatella aurantiaca DW4/3-1] (167 aa)
Score = 208, Expect = 1.9e-15, Identities = 52/148 (35%), Positives = 79/148 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDW----SDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++VL  P+IP NTGN++R C    + L +I P GF + D+ +KRAGLDYWD +  K Y  +     DF +       ++ +L   F+ ++ ++L        + +  VFG E  GL +E+M       + I M    RS NLS SV I  +
  S:     9 LHLVLVSPQIPPNTGNVARLCAVTGSRLILIEPLGFSIADRDLKRAGLDYWDKVFLKLYPTYPAYLEDFPA-------ARRWL---FSARAPTSLYAARFEAGDHL--VFGSEVTGLPAEVMAGGSGQSVTIPMLEERRSLNLSTSVGIATY 148
>gi|153008950|ref|YP_001370165.1| tRNA/rRNA methyltransferase (SpoU) [Ochrobactrum anthropi ATCC 49188] >gi|151560838|gb|ABS14336.1| tRNA/rRNA methyltransferase (SpoU) [Ochrobactrum anthropi ATCC 49188] (180 aa)
Score = 207, Expect = 2.3e-15, Identities = 53/147 (36%), Positives = 75/147 (51%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVA 148
           L + L+QP+IP NTG I R   C+GF   + +I P GF ++D+ +KRAG+DY +      + DW  FE   L  K   V L TK A      +   +    E    +FGRE+ G+   +       +L I M    RS NL+ SVA+ A
  S:    24 LRVALYQPDIPGNTGTILRMAACLGF--AVDLIEPAGFDISDRSLKRAGMDYLEQATLTRHADWHHFEDWRLQAKRRIVLLSTKAA------IPYTDYRFQENDILLFGRESSGVPDNVHNSADA-RLLIPMMPGARSLNLAVSVAMTA 163
>gi|57241070|ref|ZP_00369017.1| rRNA methylase [Campylobacter lari RM2100] >gi|57017991|gb|EAL54766.1| rRNA methylase [Campylobacter lari RM2100] (155 aa)
Score = 207, Expect = 2.5e-15, Identities = 54/149 (36%), Positives = 79/149 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M +IVL +P IP+NTG+I R C     TLH+I P  F +++K +KRAGLDYW  L    +++  DF  +    ++   F  TK            ++   E  F  FG E+ GL  ++M+K  K  + I M    RS NL+ SV IV++
  S:     1 MFHIVLVEPRIPQNTGSIGRMCFNAGFTLHIINPL-FSIDEKAVKRAGLDYWKKLNPMLWNNLEDFLKKYEKFQDRFFFATTKTTQAYF------DVKFQEGDFLFFGSESFGLPEQLMQKNWKNAITIPMKDCGRSLNLATSVGIVSY 142
>gi|86748324|ref|YP_484820.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris HaA2] >gi|86571352|gb|ABD05909.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris HaA2] (150 aa)
Score = 207, Expect = 2.5e-15, Identities = 46/146 (31%), Positives = 76/146 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           + I L+QP+IP+NTG + R C   N   H+I P GF  +D+  +RAG+DY D +    +D WS FE Q   + + +V L+T    K ++   +      +    + GRE+ G+  E+       ++ I M    RS N++ + A+V
  S:     1 MRIALYQPDIPQNTGTLLRFCACLNVEAHIIEPAGFPTSDRHFRRAGMDYLDQITIVRHDSWSKFE-QWRKDADCRVILLTT---KGVTPYLEQRYQSTD--VLLLGRESAGVPDEVAAAADA-RIVIPMQPGFRSLNVAMAAALV 139
>gi|27377595|ref|NP_769124.1| tRNA/rRNA methyltransferase [Bradyrhizobium japonicum USDA 110] >gi|27350740|dbj|BAC47749.1| tRNA/rRNA methyltransferase [Bradyrhizobium japonicum USDA 110] (152 aa)
Score = 207, Expect = 2.6e-15, Identities = 47/147 (31%), Positives = 74/147 (50%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVA 148
           + I LFQP+IP+NTG I R C       H+I P GF ++D+  +RAG+DY D +    +  W  FE          +   TK A        +D   +  +I  +FGRE+ G+T  ++E     +L I +   +RS N++ + A+ A
  S:     1 MQIALFQPDIPQNTGTILRLCACLGLAAHIIEPAGFPVSDRHFRRAGMDYLDQVSITRHVSWPQFEEWRAAQGCRLLLFTTKAATD-----YRDFRYQTSDI-LLFGRESAGVTDAVVEAADA-RLVIPIAPGLRSLNVAMTAAMAA 140
>gi|118591955|ref|ZP_01549350.1| RNA methyltransferase [Stappia aggregata IAM 12614] >gi|118435598|gb|EAV42244.1| RNA methyltransferase [Stappia aggregata IAM 12614] (157 aa)
Score = 207, Expect = 2.7e-15, Identities = 50/147 (34%), Positives = 78/147 (53%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD------HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           M +I L+QP+IP+NTG I R       T+H+I P GF ++D  +KRAG+DY +      H+    +DDW   E + L      V L TK      S+L   + T + +   + GRE+ G+  ++       +L I M   +RS N++ S  +V
  S:     1 MPDIALYQPDIPQNTGTILRLAACMGVTVHLIEPAGFPISDSALKRAGMDYLERAAMVRHISFAAFDDWRRSERRRL------VLLTTK------SDLPYADFTFETDDILMMGRESSGVPEDV-HALADARLTIPMADGMRSLNVAVSTGMV 140
>gi|78184720|ref|YP_377155.1| SpoU family tRNA/rRNA methyltransferase [Synechococcus sp. CC9902] >gi|78169014|gb|ABB26111.1| putative tRNA/rRNA methyltransferase (SpoU family) [Synechococcus sp. CC9902] (166 aa)
Score = 207, Expect = 2.7e-15, Identities = 49/148 (33%), Positives = 82/148 (55%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFES-QNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L + LF+P IP NTGNI+RTC  F   L +I P GF ++D+ ++RAGLDYW H++   +     FE+ + ++   S++   ++     +S+    E    +    +FGRE  GL  ++ ++     + I M           +RS NLS + A+V +
  S:    10 LRVALFEPRIPPNTGNIARTCAAFQLPLSLIEPLGFQIDDRSVRRAGLDYWPHVQLSTH---GSFEAMKQVLLPQSRIIGCSRRGGSCLSDF---EFQHGD--VLLFGREDTGLPDDVRDQCHTI-VTIPMPGAADSSGQGGVRSLNLSVACALVTY 157
>gi|33865749|ref|NP_897308.1| SpoU family tRNA/rRNA methyltransferase [Synechococcus sp. WH 8102] >gi|33632919|emb|CAE07730.1| putative tRNA/rRNA methyltransferase (SpoU family) [Synechococcus sp. WH 8102] (166 aa)
Score = 206, Expect = 2.8e-15, Identities = 48/148 (32%), Positives = 79/148 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L +VL++P+IP NTGNI+RTC  F   L +I P GF ++D+ ++RAGLDYW H++   + +      Q  +    ++   ++    S+      E         +FGRE  GL   + ++  +  L I M           +RS NLS + A+V++
  S:    10 LRVVLYEPQIPPNTGNIARTCAAFRLPLALIEPLGFCIDDRAVRRAGLDYWPHVQLSIHSNLDHLLGQ--LPHPHRLIGCSRHGGDSLG-----EFQFQHGDVLLFGREDNGLPGHVRDQCDRI-LTIPMPGGVDADGQGGVRSLNLSVACALVSY 157
>gi|114321720|ref|YP_743403.1| tRNA/rRNA methyltransferase (SpoU) [Alkalilimnicola ehrlichei MLHE-1] >gi|114228114|gb|ABI57913.1| tRNA/rRNA methyltransferase (SpoU) [Alkalilimnicola ehrlichei MLHE-1] (153 aa)
Score = 205, Expect = 3.7e-15, Identities = 54/161 (33%), Positives = 83/161 (51%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDF-ESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           M +IVL +PEIP NTGN+ R      A LH++ P GF L+D R++RAGLD         Y +W+   E  +LV+   +V     +A  +  ++   ++        VFG ET GL  E+       +L++ M    RS NL NSV++V +      +F +L+
  S:     1 MFHIVLVEPEIPPNTGNVIRLAANTGAHLHLVHPLGFRLDDTRLRRAGLD---------YHEWARVAEHPSLVDCLRQVRPRRAWALSTHGSVGYHQVRYAPGDALVFGCETGGLRRELTRFSPGRRLRLPMRPESRSMNLGNSVSVVLYEALRQQDFPELE 153
>gi|186686113|ref|YP_001869309.1| tRNA/rRNA methyltransferase (SpoU) [Nostoc punctiforme PCC 73102] >gi|186468565|gb|ACC84366.1| tRNA/rRNA methyltransferase (SpoU) [Nostoc punctiforme PCC 73102] (153 aa)
Score = 205, Expect = 3.8e-15, Identities = 52/149 (34%), Positives = 77/149 (51%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNS-NIRSFNLSNSVAIVAF 149
           M  +VL  P+IP NTGNI+RTC      LH++ P GF ++D+ +KRAGLDYW ++K   ++    F++ +   +    +L          N +        + + +FG ET GL   I+       L I M+   +RS NLS SVAI  F
  S:     1 MPQVVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFEISDRYLKRAGLDYWPYVKLHYHESLEAFKTVH--QERGGRWLGYTVG----GNFSYVSFRYQADDWLLFGSETTGLPPTILSDCDA-TLYIPMSQPGVRSLNLSVSVAIGLF 143
>gi|16331214|ref|NP_441942.1| hypothetical protein slr0992 [Synechocystis sp. PCC 6803] >gi|3915412|sp|P74516|Y992_SYNY3 Uncharacterized tRNA/rRNA methyltransferase slr0992 >gi|1653708|dbj|BAA18620.1| slr0992 [Synechocystis sp. PCC 6803] (153 aa)
Score = 205, Expect = 4.4e-15, Identities = 51/149 (34%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM-NSNIRSFNLSNSVAIVAF 149
           M+ +VL  P+IP NTGNI+RTC      LH++ P GF L D+ +KRAGLDYW ++    ++   +F    + +   +   +  F+     N    + T     + + G ET GL  ++M       L I M +S +RS NL++S AI  F
  S:     1 MVKLVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFELGDRYLKRAGLDYWPYVDLHYHNSCEEF----ITHWRGQGGNLLGFSVTGTVNFW--DYTYQSTDWLMMGSETDGL-PQMMRDLSTQLLCIPMPHSEVRSLNLASSAAIALF 143
>gi|121602085|ref|YP_989283.1| RNA methyltransferase [Bartonella bacilliformis KC583] >gi|120614262|gb|ABM44863.1| RNA methyltransferase, TrmH family [Bartonella bacilliformis KC583] (155 aa)
Score = 204, Expect = 4.7e-15, Identities = 51/145 (35%), Positives = 77/145 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           L+I LFQP+I  NTG I R        +H+I P GF L+D+ +KRAG+DY +    + + DW  F    +   N ++FL++  A    +N+      K++    +FGRE+ G+   + +      LKI M    RS NL+ SVAI
  S:     3 LHIALFQPDIAGNTGTILRLGACLGVHVHIIEPAGFDLSDRNLKRAGMDYLERASLERHIDWQHFLDA-MQKFNRRLFLLSTKATTCYTNI---RYQKND--VLLFGRESAGVPDYVHQAV-DCTLKIPMQQQARSLNLAMSVAI 140
>gi|87124502|ref|ZP_01080351.1| putative tRNA/rRNA methyltransferase (SpoU family protein) [Synechococcus sp. RS9917] >gi|86168074|gb|EAQ69332.1| putative tRNA/rRNA methyltransferase (SpoU family protein) [Synechococcus sp. RS9917] (161 aa)
Score = 204, Expect = 5.1e-15, Identities = 48/149 (32%), Positives = 75/149 (50%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF-QLKIEMNSNIRSFNLSNSVAIVAFH 150
           L I L++P+IP NTGNI+RT   F   L +I P GF L D+ +KRAGLDYW H++   + D   F     +      F +   +    + L +      +    +FGRE  GL   +  +  +   + +   + +RS NLS + A+V+F 
  S:    11 LRIALYEPQIPPNTGNIARTSAAFQLPLALIEPLGFSLEDRYLKRAGLDYWPHVQLSSHSDVDAF-----LEALPTPFRLIGCSRHGGTALPQMRFEPGD--VLLFGREDLGLPESVRRRCDQLCTIPMPGGAAVRSLNLSVAAALVSFQ 153
>gi|90422442|ref|YP_530812.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris BisB18] >gi|90104456|gb|ABD86493.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris BisB18] (162 aa)
Score = 204, Expect = 5.2e-15, Identities = 50/146 (34%), Positives = 75/146 (51%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITK----FADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           + I LFQP+IP+NTG I R C   N   H+I P GF ++D+  +RAG+DY D +    +D WS FE          V L TK    + D   S   +D L        + GRE+ G+  ++       +L I +   +RS N++ + A+V
  S:     7 MRIALFQPDIPQNTGTILRLCACLNVEAHIIEPAGFPVSDRHFRRAGMDYLDQVTIMRHDCWSKFEQWRAAAGCRLVLLTTKGLTPYLDYRYS--ARDVL--------LLGRESAGVPDDV-AAVADARLVIPVQPGLRSLNVAMAAAMV 145
>gi|108758130|ref|YP_630275.1| RNA methyltransferase [Myxococcus xanthus DK 1622] >gi|108462010|gb|ABF87195.1| RNA methyltransferase, TrmH family [Myxococcus xanthus DK 1622] (167 aa)
Score = 204, Expect = 5.3e-15, Identities = 51/145 (35%), Positives = 78/145 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           L++VL  P+IP NTGN++R C      L ++ P GF ++D+++KRAGLDYWD +  + Y     + +      +++ +L +  A+ S+      E   +E    VFG E  GL  E+ME      + I M  + RS NLS SV I
  S:     9 LHLVLVSPQIPPNTGNVARLCAVTGCRLILVEPLGFSIDDRQLKRAGLDYWDKVFLRLY---PTYAAYAADYPDARRWLFSARAETSLY-----EARFEEGDHLVFGSEVSGLAPEVMEGGTGTAVTIPMLEDRRSLNLSTSVGI 145
>gi|115522972|ref|YP_779883.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris BisA53] >gi|115516919|gb|ABJ04903.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris BisA53] (153 aa)
Score = 203, Expect = 7.4e-15, Identities = 47/146 (32%), Positives = 76/146 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           + I LFQP+IP+NTG I R C   +   H+I P GF ++D+  +RAG+DY D +    +D W+ FE Q   ++  ++ L+T      IS         D     + GRE+ G+  E+       +L I +   +RS N++ + A+V
  S:     1 MRIALFQPDIPQNTGTILRLCACLDVEAHIIEPAGFPVSDRNFRRAGMDYLDQVSLTRHDSWTKFE-QWRRDQGCRLILLT--TKGLISYFEYRYAPSD---VLMLGRESAGVPDEV-AAVADARLAIPVKPGLRSLNIAVAAAMV 139
>gi|66880060|ref|ZP_00405046.1| COG0219: Predicted rRNA methylase (SpoU class) [Mycoplasma genitalium G-37] (56 aa)
Score = 202, Expect = 9.8e-15, Identities = 35/52 (67%), Positives = 42/52 (80%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYW 52
           ++NIVLF PEIP NTGNI R+C  F A LH+I+P+GF LNDKRM RAGL+ W
  S:     5 VINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCW 56
>gi|78212857|ref|YP_381636.1| SpoU family tRNA/rRNA methyltransferase [Synechococcus sp. CC9605] >gi|78197316|gb|ABB35081.1| putative tRNA/rRNA methyltransferase (SpoU family) [Synechococcus sp. CC9605] (163 aa)
Score = 202, Expect = 1.0e-14, Identities = 48/148 (32%), Positives = 81/148 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEM--------NSNIRSFNLSNSVAIVAF 149
           L I LF+P+IP NTGNI+RT   F   L +I P GF ++D+ ++RAGLDYW H++     ++ +F++   +    ++   ++    S+++ T     + +    +FGRE  GL   + +      L I M           +RS NLS + A+V +
  S:     7 LRIALFEPQIPPNTGNIARTSAAFRIPLTLIEPLGFKVDDRSVRRAGLDYWPHVQLSIASNFPEFQAG--LRPGQRLIGCSRRGGSSLTSFT---FQRGD--VLLFGREDTGLPESVRDACDSI-LTIPMPGAADDAGQGGVRSLNLSVACALVTY 154
>gi|83591705|ref|YP_425457.1| tRNA/rRNA methyltransferase (SpoU) [Rhodospirillum rubrum ATCC 11170] >gi|83574619|gb|ABC21170.1| tRNA/rRNA methyltransferase (SpoU) [Rhodospirillum rubrum ATCC 11170] (160 aa)
Score = 200, Expect = 1.6e-14, Identities = 42/147 (28%), Positives = 81/147 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           M+ + L+QP+IP+N G I R        + +I P GF+L+D+R++RAG+DY +      +  WS+F S  L ++   + L T+      S    + + +  ++  + GRE+ G+  E+ E+    ++++ M   +RS N++ + A+V
  S:     1 MVRLALYQPDIPQNAGTILRLGACLGVEVDLIEPCGFVLDDRRLRRAGMDYLERAALVRHSSWSNFVS-GLADEARLILLTTQ-----ASAFHAETIFQPNDV-LLLGRESAGVPPEVHER-ADLRIRVPMVPGVRSLNIAVTAALV 139
>gi|154508741|ref|ZP_02044383.1| hypothetical protein ACTODO_01249 [Actinomyces odontolyticus ATCC 17982] >gi|153798375|gb|EDN80795.1| hypothetical protein ACTODO_01249 [Actinomyces odontolyticus ATCC 17982] (153 aa)
Score = 200, Expect = 1.7e-14, Identities = 47/149 (31%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ML+I+ ++PEIP NTG   R      + LH+++P GF ++D +++RAGLDY D      +D       + L     +V+ +T  A    S+++  +         +FGRE+ GL+ + M   + + +++I+M   +RS NL+NS +IV +
  S:     1 MLHIIFWEPEIPGNTGAAIRLSACTGSMLHLVKPLGFDMDDAKLRRAGLDYHDLAHVMVHDSL----DEALAEVPGRVWALTGHATTMYSDVSYADGDG-----LLFGRESVGLSEDAMHHPRVEDRVRIQMVDGVRSLNLANSASIVLY 141
>gi|127514505|ref|YP_001095702.1| RNA methyltransferase [Shewanella loihica PV-4] >gi|126639800|gb|ABO25443.1| RNA methyltransferase, TrmH family, group 2 [Shewanella loihica PV-4] (154 aa)
Score = 199, Expect = 2.0e-14, Identities = 56/149 (37%), Positives = 83/149 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C      LH+I P GF L +K+++RAGLDY D  +   + D+  F S        ++   T    +  S     E+  +++   +FG ET+GL   I+E     Q L+I M ++ RS NLSNSVAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLRRAGLDYSDLTRVTRHKDFESFLS---AMAGKRIMACTTKGSRPHS-----EIAFEKDDVLLFGPETRGLPMPIIESIPTSQRLRIPMAASSRSLNLSNSVAIISY 142
>gi|91794831|ref|YP_564482.1| RNA methyltransferase TrmH, group 2 [Shewanella denitrificans OS217] >gi|91716833|gb|ABE56759.1| RNA methyltransferase TrmH, group 2 [Shewanella denitrificans OS217] (153 aa)
Score = 197, Expect = 3.2e-14, Identities = 59/149 (39%), Positives = 87/149 (58%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           M +I L++PEI  NTGNI R C    + LH+I P GF L +K+++RAGLDY D      + ++ DF  Q +  K  ++ + T    +  + L   E  KD+    +FG ET+GL  +I+      Q L+I M S+ RS NLSNSVAI+++
  S:     1 MFHIALYEPEIAPNTGNIIRLCANNGSHLHLIEPLGFDLEEKKLRRAGLDYADLANVTRHKNYDDF-LQAMAGK--RIMVCTTKGSRPHTEL---EFAKDD--VLLFGPETRGLPMDIINAAPLEQRLRIPMMSSSRSLNLSNSVAIISY 142
>gi|91975781|ref|YP_568440.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris BisB5] >gi|91682237|gb|ABE38539.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris BisB5] (150 aa)
Score = 196, Expect = 4.0e-14, Identities = 45/146 (30%), Positives = 75/146 (51%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           + I L+QP+IP+NTG + R C   N   H+I P GF  +D+  +RAG+DY D +    +D WS F  Q     + +V L+T    K ++   +      +    + GRE+ G+  E+       ++ I M   +RS N++ + A+V
  S:     1 MRIALYQPDIPQNTGTLLRFCACLNLEAHIIEPAGFPTSDRHFRRAGMDYLDQVTILRHDSWSKF-VQWRKEADCRVILLTT---KGVTPYLEQRYQSTD--VLLLGRESAGVPDEVAAAADA-RVLIPMQPKMRSLNVAMAAALV 139
>gi|114704756|ref|ZP_01437664.1| RNA methyltransferase [Fulvimarina pelagi HTCC2506] >gi|114539541|gb|EAU42661.1| RNA methyltransferase [Fulvimarina pelagi HTCC2506] (150 aa)
Score = 196, Expect = 4.1e-14, Identities = 50/146 (34%), Positives = 80/146 (54%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           ++I L+QP+I  NTG + RT    +  + +I P GF L+D+ +KRAG+DY       ++ D+  FE+        ++ L+T  AD  + +       +D++I  +FGRET G+  E+       +L I M +  RS NLS SVA+V
  S:     3 ISIALYQPDIAGNTGAVMRTAACLDLRIEIIEPTGFELSDRSLKRAGMDYLSLANLTKHLDFEAFEAWR-KRAGRRLILLTTKADTVVWDFE----FRDDDI-VMFGRETAGVPVEV-HAAADARLTIPMQTGARSMNLSASVALV 141
>gi|85714273|ref|ZP_01045261.1| tRNA/rRNA methyltransferase (SpoU) [Nitrobacter sp. Nb-311A] >gi|85698720|gb|EAQ36589.1| tRNA/rRNA methyltransferase (SpoU) [Nitrobacter sp. Nb-311A] (156 aa)
Score = 193, Expect = 1.0e-13, Identities = 39/113 (34%), Positives = 59/113 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGL 114
           + + LFQP+IP+NTG I R C   +   H+I P GF ++D+  +RAG+DY D +    +D W  F+     +    V   TK A   +     D    D +I  +FGRE+ G+
  S:     1 MRVALFQPDIPQNTGTILRLCACLDVEAHIIEPAGFPVSDRHFRRAGMDYLDEVAIVRHDSWQKFQQWRAADGGRLVLFTTKGARPYL-----DHRFADTDI-LLFGRESAGV 107
>gi|13472427|ref|NP_103994.1| RNA methyltransferase [Mesorhizobium loti MAFF303099] >gi|14023173|dbj|BAB49780.1| RNA methyltransferase [Mesorhizobium loti MAFF303099] (152 aa)
Score = 191, Expect = 1.5e-13, Identities = 52/147 (35%), Positives = 77/147 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVA 148
           L I L+QP+I  NTG I R        + +I P GF L+DK +KRAG+DY +      + DW+ FE +   +    V L TK A    +N +      D +I  +FGRE+ G+   + +     +L I M  + RS N++ SVA+VA
  S:     5 LRIALYQPDIAGNTGTILRFAACLGLGVDIIEPAGFPLSDKALKRAGMDYLEMAALTRHVDWNAFEDRRKKDGRRLVLLSTK-AATPYTNFS----FADGDI-LLFGRESAGVPDPVHQAADA-RLTIPMQGSARSINVALSVAMVA 144
>gi|153803685|ref|ZP_01958271.1| rRNA methylase, SpoU family [Vibrio cholerae MZO-3] >gi|124120781|gb|EAY39524.1| rRNA methylase, SpoU family [Vibrio cholerae MZO-3] (127 aa)
Score = 190, Expect = 2.1e-13, Identities = 40/119 (33%), Positives = 65/119 (54%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM 119
           M +I L++PEI  NTGNI R C    A LH+I P GF L +K+++RAGLDY D  +   + D++ F     + +    F +     K+  +    +  + +    +FG ET+GL +E++
  S:     1 MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKDYAAF--IEYLQRERGSFRVFACTTKTTQHHVDAQFQQGD--VLLFGPETRGLPAELI 115
>gi|94984180|ref|YP_603544.1| tRNA/rRNA methyltransferase (SpoU) [Deinococcus geothermalis DSM 11300] >gi|94554461|gb|ABF44375.1| tRNA/rRNA methyltransferase (SpoU) [Deinococcus geothermalis DSM 11300] (153 aa)
Score = 190, Expect = 2.5e-13, Identities = 46/140 (32%), Positives = 77/140 (55%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNL 140
           +L++VLF+PE   N GN++RTC    A LH+IRPFGF L+D+  +RA +DY   +   E+ +W+ +  Q  +   ++V+  +  A+   +  T+    + + +  VFG E++GL   + E      LK+      RS NL
  S:     5 LLHVVLFEPEKAGNVGNVARTCAVLGADLHLIRPFGFHLHDREFRRAVMDYLQGVTLHEHANWTAY--QAALPPEARVWAFSTHAE---TFHTRAGFRRGDHL--VFGPESRGLPVWLREALPA--LKLPQPGGGRSLNL 135
>gi|92118708|ref|YP_578437.1| tRNA/rRNA methyltransferase (SpoU) [Nitrobacter hamburgensis X14] >gi|91801602|gb|ABE63977.1| tRNA/rRNA methyltransferase (SpoU) [Nitrobacter hamburgensis X14] (156 aa)
Score = 189, Expect = 3.0e-13, Identities = 44/138 (31%), Positives = 68/138 (49%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFN 139
           + I LFQP+IP+NTG I R C   +   H+I P GF ++D+  +RAG+DY D +    +D W  F+     N    V   T+ A   +     D    D +I  +FGRE+     + +      +L I + + +RS N
  S:     1 MRIALFQPDIPQNTGTILRLCACLDVEAHIIEPAGFPVSDRHFRRAGMDYLDQVAIVRHDSWPKFQQWRAANGGRLVLFTTRGALPYL-----DHRYADTDI-LLFGRESA-GVPDAVAAAADARLVIPVKAGLRSLN 131
>gi|4104449|gb|AAD02043.1| tRNA/rRNA methyltransferase [Brucella melitensis biovar Abortus] (159 aa)
Score = 189, Expect = 3.0e-13, Identities = 50/145 (34%), Positives = 76/145 (52%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           L + L+QP+IP NTG I R   C+GF   + +I P GF ++D+ +KRAG+DY +      + DW+ F++         V L TK A      +        E    +FGRE+ G+   I +   + +L I M  + RS NL+ SVA+
  S:     3 LRVALYQPDIPGNTGTILRMAACLGF--AVDLIEPAGFDISDRALKRAGMDYLEQAALTRHPDWNRFDAWRKNAGRGLVLLSTKAA------IPYTGYQFQENDILLFGRESAGVPEAIHDNADE-RLLIPMVRSARSLNLAVSVAM 140
>gi|17986753|ref|NP_539387.1| ribosomal RNA methyltransferase [Brucella melitensis 16M] >gi|17982380|gb|AAL51651.1| ribosomal RNA methyltransferase [Brucella melitensis 16M] (171 aa)
Score = 188, Expect = 3.5e-13, Identities = 50/145 (34%), Positives = 76/145 (52%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           L + L+QP+IP NTG I R   C+GF   + +I P GF ++D+ +KRAG+DY +      + DW+ F++         V L TK A      +        E    +FGRE+ G+   I +   + +L I M  + RS NL+ SVA+
  S:    15 LRVALYQPDIPGNTGTILRMAACLGF--AVDLIEPAGFDISDRALKRAGMDYLEQAALTRHPDWNRFDAWRKNAGRRLVLLSTKAA------IPYTGYQFQENDILLFGRESAGVPEAIHDNADE-RLLIPMVRSARSLNLAVSVAM 152
>gi|23502412|ref|NP_698539.1| RNA methyltransferase [Brucella suis 1330] >gi|62290431|ref|YP_222224.1| RNA methyltransferase [Brucella abortus bv. 1 str. 9-941] >gi|82700354|ref|YP_414928.1| tRNA/rRNA methyltransferase (SpoU) [Brucella melitensis biovar Abortus 2308] >gi|148559238|ref|YP_001259422.1| RNA methyltransferase [Brucella ovis ATCC 25840] >gi|161619491|ref|YP_001593378.1| tRNA/rRNA methyltransferase (SpoU) [Brucella canis ATCC 23365] >gi|163843802|ref|YP_001628206.1| tRNA/rRNA methyltransferase (SpoU) [Brucella suis ATCC 23445] >gi|189024660|ref|YP_001935428.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus S19] >gi|23348399|gb|AAN30454.1| RNA methyltransferase, TrmH family [Brucella suis 1330] >gi|62196563|gb|AAX74863.1| RNA methyltransferase, TrmH family [Brucella abortus biovar 1 str. 9-941] >gi|82616455|emb|CAJ11518.1| tRNA/rRNA methyltransferase (SpoU) [Brucella melitensis biovar Abortus 2308] >gi|148370495|gb|ABQ60474.1| RNA methyltransferase, TrmH family [Brucella ovis ATCC 25840] >gi|161336302|gb|ABX62607.1| tRNA/rRNA methyltransferase (SpoU) [Brucella canis ATCC 23365] >gi|163674525|gb|ABY38636.1| tRNA/rRNA methyltransferase (SpoU) [Brucella suis ATCC 23445] >gi|189020232|gb|ACD72954.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus S19] (159 aa)
Score = 188, Expect = 3.5e-13, Identities = 50/145 (34%), Positives = 76/145 (52%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           L + L+QP+IP NTG I R   C+GF   + +I P GF ++D+ +KRAG+DY +      + DW+ F++         V L TK A      +        E    +FGRE+ G+   I +   + +L I M  + RS NL+ SVA+
  S:     3 LRVALYQPDIPGNTGTILRMAACLGF--AVDLIEPAGFDISDRALKRAGMDYLEQAALTRHPDWNRFDAWRKNAGRRLVLLSTKAA------IPYTGYQFQENDILLFGRESAGVPEAIHDNADE-RLLIPMVRSARSLNLAVSVAM 140
>gi|146321556|ref|YP_001201267.1| rRNA methyltransferase [Streptococcus suis 98HAH33] >gi|145692362|gb|ABP92867.1| rRNA methyltransferase, TrmH family [Streptococcus suis 98HAH33] (125 aa)
Score = 188, Expect = 3.8e-13, Identities = 44/106 (41%), Positives = 69/106 (65%)
  Q:    44 MKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEI-FFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           MKRAGLDYWD L  + YD+ S+F   +  +K  +V L++K+ADK+ S    DE   D  I +F+FGRE KGL  + M ++ +  ++I MN  ++RS N+SN+  ++ +
  S:     1 MKRAGLDYWDKLDVRFYDNLSEF--MDYASKQGRVHLVSKYADKTYS----DEDYNDGNIHYFLFGREDKGLPEDFMREHPEKAIRIPMNDEHVRSLNVSNTACMIVY 102
>gi|146319351|ref|YP_001199063.1| rRNA methyltransferase [Streptococcus suis 05ZYH33] >gi|145690157|gb|ABP90663.1| rRNA methyltransferase, TrmH family [Streptococcus suis 05ZYH33] (125 aa)
Score = 188, Expect = 3.8e-13, Identities = 44/106 (41%), Positives = 69/106 (65%)
  Q:    44 MKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEI-FFVFGRETKGLTSEIMEKYKKFQLKIEMN-SNIRSFNLSNSVAIVAF 149
           MKRAGLDYWD L  + YD+ ++F   +  +K  +V L++KFADK+ S    DE   D  I +F+FGRE KGL  + M ++ +  ++I MN  ++RS N+SN+  ++ +
  S:     1 MKRAGLDYWDKLDVRFYDNLAEF--MDYASKQGRVHLVSKFADKTYS----DEDYNDGNIHYFLFGREDKGLPEDFMREHPEKAIRIPMNDEHVRSLNVSNTACMIVY 102
>gi|19551878|ref|NP_599880.1| SpoU class rRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|62389537|ref|YP_224939.1| putative tRNA/rRNA methyltransferase protein [Corynebacterium glutamicum ATCC 13032] >gi|145294815|ref|YP_001137636.1| hypothetical protein cgR_0762 [Corynebacterium glutamicum R] >gi|21323412|dbj|BAB98040.1| Predicted rRNA methylase (SpoU class) [Corynebacterium glutamicum ATCC 13032] >gi|41324871|emb|CAF19353.1| PUTATIVE TRNA/RRNA METHYLTRANSFERASE PROTEIN [Corynebacterium glutamicum ATCC 13032] >gi|140844735|dbj|BAF53734.1| hypothetical protein [Corynebacterium glutamicum R] (157 aa)
Score = 188, Expect = 3.9e-13, Identities = 48/148 (32%), Positives = 71/148 (47%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+++   P IP NTGN  R C G  A LH++ P GF L +K ++RAGLD         Y D +D       ++         FA  + +N    ++  +     +FG E  GL  E +E  +   +L+I M    RS NLSNS A+  +
  S:     6 LHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLD---------YHDLADVTVHATFDEAMAAVPGRVFAFTTTANTRFTDIAFEPGDALLFGTEPTGLPQEHVEHSRITSELRIPMLPGRRSMNLSNSAAVATY 145
>gi|39934266|ref|NP_946542.1| putative RNA methyltransferase [Rhodopseudomonas palustris CGA009] >gi|167368051|ref|ZP_02302191.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris TIE-1] >gi|192289793|ref|YP_001990398.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris TIE-1] >gi|39648114|emb|CAE26634.1| putative RNA methyltransferase [Rhodopseudomonas palustris CGA009] >gi|192283542|gb|ACE99922.1| tRNA/rRNA methyltransferase (SpoU) [Rhodopseudomonas palustris TIE-1] (151 aa)
Score = 188, Expect = 4.3e-13, Identities = 47/146 (32%), Positives = 75/146 (51%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIF-----FVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           + I LFQP+IP+NTG I R C   N   H+I P GF  +D+  +R+G+DY D +    +D W  FE Q       ++ L+T          TK E    E+ +      + GRE+ G+  ++       ++ I M   +RS N++ + A+V
  S:     1 MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSDRHFRRSGMDYLDQVSIVRHDSWLKFE-QWRKTAGCRLILLT----------TKGERPYFEQRYQPTDVLMLGRESAGVPDDVAAAADA-RVVIPMQPGLRSLNIAMAAAVV 139
>gi|38233828|ref|NP_939595.1| putative tRNA/rRNA methyltransferase [Corynebacterium diphtheriae NCTC 13129] >gi|38200089|emb|CAE49769.1| Putative tRNA/rRNA methyltransferase [Corynebacterium diphtheriae] (156 aa)
Score = 187, Expect = 4.8e-13, Identities = 54/148 (36%), Positives = 78/148 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L+IV   P IP NTGN  RT     A+LH+I P GF   DK +KRAGLDY D     +    S+F++      +S+VF  +  A    +++      KD ++  +FG E  GL +E +E  +   Q++I M    RS NLSN  +I  +
  S:     4 LHIVFDNPVIPNNTGNAIRTSAVTGASLHLIEPLGFNFEDKNLKRAGLDYHD---LADVHIHSNFDACMNALPHSRVFAFSSHATTWYTDIE----YKDGDV-LLFGTEPTGLPTEHLEHPRITQQVRIPMLPARRSMNLSNCASIAIY 144
>gi|108798157|ref|YP_638354.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium sp. MCS] >gi|119867253|ref|YP_937205.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium sp. KMS] >gi|126433816|ref|YP_001069507.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium sp. JLS] >gi|108768576|gb|ABG07298.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium sp. MCS] >gi|119693342|gb|ABL90415.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium sp. KMS] >gi|126233616|gb|ABN97016.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium sp. JLS] (179 aa)
Score = 182, Expect = 1.8e-12, Identities = 48/149 (32%), Positives = 75/149 (50%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM-EKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  ++ + P I  NTGN  R   G    LH++RP GF L++ +++RAGLDY D      +DD        L    + V+  T  A  S +++  D    D     +FG E  GL +E + + +   Q++I M +  RS NLSN+ A+  +
  S:     1 MFKVMFYSPRIAPNTGNAIRMVAGTGCELHLVRPLGFDLSEPKLRRAGLDYHDLASVTVHDDLPAAWDAVL---PASVYAFTAHATVSFADV--DYRPGD---VLMFGPEPTGLDAETLADPHITAQVRIPMLAGRRSLNLSNAAAVAVY 142
>gi|116253233|ref|YP_769071.1| putative aminotransferase/methyltransferase [Rhizobium leguminosarum bv. viciae 3841] >gi|115257881|emb|CAK08979.1| putative aminotransferase/methyltransferase [Rhizobium leguminosarum bv. viciae 3841] (153 aa)
Score = 181, Expect = 2.6e-12, Identities = 46/146 (31%), Positives = 76/146 (52%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           L + L+QP+IP NTG I R   C+GF   + +I P GF ++D+ +KRAG+DY        +  W  FE+  L      +   TK A++        +L+   +   +FGRE+ G+  ++ E     ++ I M    RS N++ S A++
  S:     4 LRLALYQPDIPGNTGTILRLAACLGF--AVDLIEPAGFDISDRNLKRAGMDYIAAAALTRHVSWDRFEAWRLTTGRRLILASTKAAERYT------DLSFRPDDVLLFGRESAGVPDQVHETADA-RVLIPMVEGQRSINVAVSAAMI 142
>gi|119962280|ref|YP_948432.1| TrmH family RNA methyltransferase [Arthrobacter aurescens TC1] >gi|119949139|gb|ABM08050.1| putative RNA methyltransferase, TrmH family [Arthrobacter aurescens TC1] (155 aa)
Score = 179, Expect = 4.1e-12, Identities = 46/149 (30%), Positives = 75/149 (50%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEI-MEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  I+   PEIP NTGN  R      A LH++ P GF  +D +++RAGLDY D      +    D E+     K  +VF  T   + S ++++  E         +FG E+ GL   +  + +   ++++ M  ++RS NL+N+ +I  F
  S:     1 MFRILFHTPEIPGNTGNAIRLAAITGAELHLVEPLGFDFSDAKLRRAGLDYHDLAVVTVH---KDIEAAWAALKPERVFAYTSDGETSYTDISYREGD-----VLMFGPESVGLPDWLKQDPHVTARVRLPMKPSLRSLNLANAASIAVF 142
>gi|145225467|ref|YP_001136145.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium gilvum PYR-GCK] >gi|145217953|gb|ABP47357.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium gilvum PYR-GCK] (154 aa)
Score = 179, Expect = 4.5e-12, Identities = 48/149 (32%), Positives = 74/149 (49%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDD----WSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGL-TSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M N++ + P I  NTGN  R   G    LH++ P GF L++ +++RAGLDY D      + D    WS       V   ++VF  T  A  S + +  +          +FG E  GL  + + + +   Q++I M S  RS NLSN+ A+  +
  S:     1 MFNVLFYSPRIAPNTGNAIRMVAGTGCALHLVEPLGFDLSEPKLRRAGLDYHDLASVTVHADLGAAWS-------VLMPARVFAFTAHAATSFAGVGYEPGD-----VLMFGPEPTGLDEATLADPHITGQVRIPMLSGRRSLNLSNAAAVAVY 142
>gi|56551848|ref|YP_162687.1| RNA methyltransferase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543422|gb|AAV89576.1| RNA methyltransferase [Zymomonas mobilis subsp. mobilis ZM4] (152 aa)
Score = 178, Expect = 6.0e-12, Identities = 43/145 (29%), Positives = 72/145 (49%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           + I LFQP+I  N G I RT   F   + +I P GF  +D+ +KRAG+DY        ++DW+ F    L  +  +  L+T   D  +      E+T   +   +FG E+ G   + + +    Q++I + ++ RS N++ S  I
  S:     1 MRIALFQPDIAGNVGTILRTAACFGVGVDIIEPCGFAFSDRALKRAGMDYAKIAPPVRHNDWNSF----LSTRPERRVLLTTAGDIPLP-----EMTFQPDDILLFGSESAG-APDFVHQAASHQVRIPLLADFRSLNIAVSAGI 135
>gi|1903046|emb|CAB07516.1| hypothetical 13.6 kd protein [Bacillus subtilis] (114 aa)
Score = 177, Expect = 6.4e-12, Identities = 45/118 (38%), Positives = 68/118 (57%)
  Q:    44 MKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDLK 161
           +KRAGLDYW+ +    +D   + FE+     K  K F ITKF  +  ++    +L  DE+ FFVFGRET GL  ++++      L++ M  ++RS NLSN+ AI+ +      N+ DLK
  S:     2 LKRAGLDYWEFVNVVYHDSLEELFEAY----KKGKFFFITKFGQQPHTSFDYTDL--DEDYFFVFGRETSGLPKDLIQNNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDLK 114
>gi|15965575|ref|NP_385928.1| putative tRNA/rRNA methyltransferase protein [Sinorhizobium meliloti 1021] >gi|15074756|emb|CAC46401.1| Putative tRNA/rRNA methyltransferase [Sinorhizobium meliloti 1021] (153 aa)
Score = 177, Expect = 6.6e-12, Identities = 45/138 (32%), Positives = 67/138 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFN 139
           L I L+QP+IP NTG I R       ++ +I P GF L+D+ +KRAG+DY   +    +D W  FE+         V   TK A    +  T+     D+    +FGRE+ G+   + E+    ++ I M    RS N
  S:     4 LRIALYQPDIPGNTGTILRLAACLGLSVDIIEPAGFDLSDRNLKRAGMDYIAAVTMTRHDSWERFETWRSSTGRRLVLASTKAA----APYTRFSFRPDD--VLLFGRESAGVPDHVHERADA-RILIPMAPGQRSLN 134
>gi|144899702|emb|CAM76566.1| rRNA methylase (SpoU class) [Magnetospirillum gryphiswaldense MSR-1] (156 aa)
Score = 177, Expect = 6.8e-12, Identities = 40/141 (28%), Positives = 70/141 (49%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLS 141
           +L + LFQP+IP+N G + R        L +I P GF+ ++KRM+RAG+DY DH +   +  W+ F  +       ++ L+T      +     D  +       + GRE+ G+  E+  +     ++I M   +RS N++
  S:     3 LLRLALFQPDIPQNAGALLRLSACLGIPLEIIEPCGFLWDEKRMRRAGMDYVDHARVTRHASWNAFRQK----PGGRLVLLTTAGGTRL-----DGFSFRPGDVIMMGRESAGVPPEVAAE-ADVTVRIPMAPGLRSLNVA 133
>gi|25027214|ref|NP_737268.1| putative rRNA methylase [Corynebacterium efficiens YS-314] >gi|23492495|dbj|BAC17468.1| putative rRNA methylase [Corynebacterium efficiens YS-314] (173 aa)
Score = 177, Expect = 7.1e-12, Identities = 50/148 (33%), Positives = 72/148 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSD-FESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSE-IMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           L++V   P IP NTGN  R C G  A LH++ P GF L +K ++RAGLDY D      + +  D F +        ++F  T  A    +++T            +FG E  GL  E I+      +++I M    RS NLSNS A+  +
  S:    22 LHVVFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFDLTEKHLRRAGLDYHDLADVTVHANIEDCFGAL-----PGRIFAFTTQATGWFTDITYQPGDA-----LLFGTEPTGLPHEHIIHPRVTAEVRIPMLEGRRSMNLSNSAAVATY 161
>gi|111023195|ref|YP_706167.1| tRNA/rRNA methyltransferase [Rhodococcus sp. RHA1] >gi|110822725|gb|ABG98009.1| tRNA/rRNA methyltransferase [Rhodococcus sp. RHA1] (151 aa)
Score = 177, Expect = 7.4e-12, Identities = 46/142 (32%), Positives = 74/142 (52%)
  Q:     8 QPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDD----WSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM-EKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           +P IP NTGN  R   G    LH++ P GF L++ ++KRAGLDY D      +++    W+  E        ++V+  T  A  S +++             +FG E  GL+ E++ + +   +L+I M    RS NLSN+ A+V +
  S:     4 EPRIPPNTGNAIRMVAGTGCELHLVGPLGFDLSEPKLKRAGLDYHDLASVTVHENLEAAWAALEP-------ARVYAFTAHATVSYADIAYQPGD-----VLLFGPEPTGLSEEVLADPHVTERLRIPMLPGRRSLNLSNAAALVTY 138
>gi|72080482|ref|YP_287540.1| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae 7448] (146 aa)
Score = 177, Expect = 7.6e-12, Identities = 48/132 (36%), Positives = 80/132 (60%)
  Q:    29 LHMIRPFGFILNDKRMKR--AGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +H+I P  F L+ K +KR  AG+     ++ + + +W +F S+    KN  +F IT++  K  + +    E+   ++IFFVFGRE+ G+  EI++K K+  L+I M +  RS NL+N+V I+A+ +H   NF  L
  S:     1 MHIIMPIAFDLDPKHLKRPAAGI-LLSEIEHEIHKNWQNF-SEKYGQKN--LFFITRYGQKLYTEVDFYTEIETKKDIFFVFGRESTGIPIEILKKNKEKCLRIPMIAKARSLNLANTVVIIAYEFHRQLNFKKL 131
>gi|2222703|emb|CAB09926.1| rRNA methylase [Mycobacterium leprae] (169 aa)
Score = 176, Expect = 8.3e-12, Identities = 46/149 (30%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGL-TSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  ++ + P IP NTGN  RT       LH++ P GF L++ +++RAGLDY D      +   S  E+ N ++  ++V     FA  +++N    +++       +FG E  GL  + + + +   Q++I M S  RS NLSN+ A+  +
  S:    16 MFRLLFYTPRIPPNTGNAIRTAAVTGCALHLVEPIGFDLSNPKLRRAGLDYHDLASVTVHTSLS--EAWNALSP-ARV-----FAFSTLANTLFTDVSYQAGDVLMFGPEPTGLDAATLADDHITQQVRIPMLSGRRSLNLSNAAAVAVY 157
>gi|15827131|ref|NP_301394.1| putative tRNA/rRNA methyltransferase [Mycobacterium leprae TN] >gi|13092679|emb|CAC29927.1| putative tRNA/rRNA methyltransferase [Mycobacterium leprae] (158 aa)
Score = 176, Expect = 8.3e-12, Identities = 46/149 (30%), Positives = 78/149 (52%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGL-TSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  ++ + P IP NTGN  RT       LH++ P GF L++ +++RAGLDY D      +   S  E+ N ++  ++V     FA  +++N    +++       +FG E  GL  + + + +   Q++I M S  RS NLSN+ A+  +
  S:     5 MFRLLFYTPRIPPNTGNAIRTAAVTGCALHLVEPIGFDLSNPKLRRAGLDYHDLASVTVHTSLS--EAWNALSP-ARV-----FAFSTLANTLFTDVSYQAGDVLMFGPEPTGLDAATLADDHITQQVRIPMLSGRRSLNLSNAAAVAVY 146
>gi|71893495|ref|YP_278941.1| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae J] (146 aa)
Score = 175, Expect = 1.1e-11, Identities = 48/132 (36%), Positives = 79/132 (59%)
  Q:    29 LHMIRPFGFILNDKRMKR--AGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLT-KDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAFHYHFLTNFNDL 160
           +H+I P  F L  K +KR  AG+     ++ + + +W +F S+    KN  +F IT++  K  + +    E+   ++IFFVFGRE+ G+  EI++K K+  L+I M +  RS NL+N+V I+A+ +H   NF  L
  S:     1 MHIIMPIAFDLEPKHLKRPAAGI-LLSEIEHEIHKNWQNF-SEKYGQKN--LFFITRYGQKLYTEVDFYTEIETKKDIFFVFGRESTGIPIEILKKNKEKCLRIPMIAKARSLNLANTVVIIAYEFHRQLNFKKL 131
>gi|75676802|ref|YP_319223.1| tRNA/rRNA methyltransferase (SpoU) [Nitrobacter winogradskyi Nb-255] >gi|74421672|gb|ABA05871.1| tRNA/rRNA methyltransferase (SpoU) [Nitrobacter winogradskyi Nb-255] (156 aa)
Score = 174, Expect = 1.4e-11, Identities = 32/84 (38%), Positives = 45/84 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFA 85
           + I LFQP+IP+NTG I R C       H+I P GF ++D+  +RAG+DY D +    +D W  FE     +    V   T+ A
  S:     1 MRIALFQPDIPQNTGTILRLCACLGVEAHIIEPAGFPVSDRHFRRAGMDYLDQVTIVRHDSWLKFEQWRAGDGGRLVLFTTRGA 84
>gi|116059478|emb|CAL55185.1| tRNA/rRNA methyltransferase (ISS) [Ostreococcus tauri] (170 aa)
Score = 174, Expect = 1.6e-11, Identities = 47/145 (32%), Positives = 78/145 (53%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFES--QNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKF----QLKIEMNSNIRSFNLSNSVAI 146
           L +VL +P IP NTG ++R+C      LH++ P  F L+D R+KRAGLDYW  +  + +  W  F +  + +     ++   +K   +  +  T      D   + +FG E KGL  + ME  ++     ++ I+  +++RS NLS S  I
  S:    12 LAVVLVEPRIPGNTGCVARSCAAARVPLHLVDPL-FELDDARLKRAGLDYWKSVCVRVHPSWEAFYAYWRGVETTEKRLVGFSKLGARPHAE-TGAYRRGD---WLLFGSEDKGLREDAMEACRQSGGIRRIPID-ETHVRSLNLSVSAGI 156
>gi|110634520|ref|YP_674728.1| tRNA/rRNA methyltransferase (SpoU) [Mesorhizobium sp. BNC1] >gi|110285504|gb|ABG63563.1| tRNA/rRNA methyltransferase (SpoU) [Mesorhizobium sp. BNC1] (153 aa)
Score = 173, Expect = 1.9e-11, Identities = 44/143 (30%), Positives = 70/143 (48%)
  Q:     4 IVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           I LFQP+IP NTG I R        + +I P GF L+D+ +KRAG+DY +    + +  W DF S     +  ++ L T          +     +D +I  +FGRE+ G+   +      ++L I M    RS N++ + A+
  S:     8 IALFQPDIPGNTGAILRLSACLGLAVDLIEPAGFDLSDRALKRAGMDYLELAALRRHASWEDFNSWRH-QEARRIILFTTAGTVPYQCFS----FRDGDI-LMFGRESSGVPDHVHNAV-NYRLVIPMKEGTRSLNVAMAAAM 143
>gi|116671282|ref|YP_832215.1| tRNA/rRNA methyltransferase (SpoU) [Arthrobacter sp. FB24] >gi|116611391|gb|ABK04115.1| tRNA/rRNA methyltransferase (SpoU) [Arthrobacter sp. FB24] (155 aa)
Score = 173, Expect = 2.2e-11, Identities = 49/149 (32%), Positives = 77/149 (51%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD----HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIM-EKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  I+   PEIP NTGN  R      A LH++ P GF  +D +++RAGLDY D     + +     W   + + +    S     T +AD  IS L  D L        +FG E+ GL +E+  + +   ++++ M  ++RS NL+N+ +I  F
  S:     1 MFRILFHTPEIPGNTGNAIRLAAITGAELHLVEPLGFDFSDAKLRRAGLDYHDLAVVTVHKSIEAAWEALQPERVYAFTSDGE--TSYAD--ISYLPGDVL--------LFGPESVGLPAELKNDPHVTSRVRLPMLPSLRSLNLANAASIAVF 142
>gi|15889520|ref|NP_355201.1| tRNA/rRNA methyltransferase [Agrobacterium tumefaciens str. C58] >gi|15157398|gb|AAK87986.1| tRNA/rRNA methyltransferase [Agrobacterium tumefaciens str. C58] (161 aa)
Score = 172, Expect = 2.4e-11, Identities = 44/146 (30%), Positives = 71/146 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           + I L+QP+IP NTG I R        + +I P GF ++D+ +KRAG+DY        +  W  FE          V   T+ A      L   ++T   +   +FGRE+ G+   + +K  + ++ I M +  RS N++ S A+V
  S:    12 IRIALYQPDIPGNTGTILRLAACLGLGVDIIEPAGFDISDRNLKRAGMDYIAAAALTRHVSWDRFEEWRASTGRRLVLASTRAA------LPYTDITYRADDILLFGRESAGVPDHVHDKADE-RIIIPMVAGQRSINVAMSAAMV 150
>gi|149186958|ref|ZP_01865266.1| tRNA/rRNA methyltransferase [Erythrobacter sp. SD-21] >gi|148829347|gb|EDL47790.1| tRNA/rRNA methyltransferase [Erythrobacter sp. SD-21] (150 aa)
Score = 171, Expect = 3.2e-11, Identities = 42/145 (28%), Positives = 74/145 (51%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           + I LF+PEI  N GN+ R      A + +I P GF  +D+R++RA +DY DH++   +     FE+        ++ L T  A +S    + D   + ++I  +FG+E+ G+T  +        +++ M   +RS NL+ S  +
  S:     1 MRIALFEPEIAGNVGNVMRLGACMGAGVDLIEPLGFPWDDRRVRRAAMDYIDHVEVVRH---VSFEAFRAARAGQRLVLFTTRATQS----SYDFAYRPDDI-LLFGKESAGVTDAVRACVDA-SVRLPMKPEVRSLNLATSAGL 136
>gi|54022887|ref|YP_117129.1| putative ribosomal RNA methyltransferase [Nocardia farcinica IFM 10152] >gi|54014395|dbj|BAD55765.1| putative ribosomal RNA methyltransferase [Nocardia farcinica IFM 10152] (154 aa)
Score = 171, Expect = 3.4e-11, Identities = 46/149 (30%), Positives = 73/149 (48%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFF------VFGRETKGLTSEIM-EKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M ++V  +P IP NTGN  R   G    LH+I P GF L++ +++RAGLDY D                ++    S        A + +   T    T+  +I +      +FG E  GL +E++ + +   +L+I M    RS NLSN+ A+  +
  S:     1 MFHLVFHEPRIPPNTGNAIRLVAGTGCALHLIEPLGFDLSEAKLRRAGLDYHD--------------LASVTVHESLAAAWEALAPERVYAFTTQGSTRYTDIAYRPGDVLLFGTEPTGLPAEVLADPHITDRLRIPMLPGRRSMNLSNAAAVTVY 142
>gi|120402541|ref|YP_952370.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium vanbaalenii PYR-1] >gi|119955359|gb|ABM12364.1| tRNA/rRNA methyltransferase (SpoU) [Mycobacterium vanbaalenii PYR-1] (154 aa)
Score = 170, Expect = 5.2e-11, Identities = 43/149 (28%), Positives = 75/149 (50%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGL-TSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           M  ++ + P I  NTGN  R   G    LH++ P GF L++ +++RAGLDY D      +    D +S       ++VF  T  A  S +++      +  ++  +FG E  GL  + + + +   Q++I + +  RS NLSN+ A+  +
  S:     1 MFKVMFYSPRIAPNTGNAIRMVAGTGCELHLVEPLGFDLSEPKLRRAGLDYHDLASVTVH---PDLDSAWAAVTPARVFAFTAHATASFADVA----YRPGDV-LMFGPEPTGLDAATLADPHITAQVRIPLLAGRRSLNLSNAAAVAVY 142
>gi|114569286|ref|YP_755966.1| tRNA/rRNA methyltransferase (SpoU) [Maricaulis maris MCS10] >gi|114339748|gb|ABI65028.1| tRNA/rRNA methyltransferase (SpoU) [Maricaulis maris MCS10] (148 aa)
Score = 169, Expect = 6.1e-11, Identities = 42/145 (28%), Positives = 70/145 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           + IV FQP+IP+N G   R    F A L +I P  F L DK ++RA +DY   +    +  W  +++    +    V   T+ A K    L       D+ +  +FGRE+ G+  ++ +     ++KI +   +RS N++ S  I
  S:     1 MRIVFFQPDIPQNLGAAMRVAACFGAELDIIEPCAFPLTDKGIRRAAMDYQAAISPLRHASWKAYQASAEASAGRLVLFTTRGAGK----LWDFSFRPDDRL--LFGRESAGVPDDVHDA-ATCRVKIPIREGMRSLNVTVSAGI 138
>gi|86358645|ref|YP_470537.1| tRNA/rRNA methyltransferase protein [Rhizobium etli CFN 42] >gi|86282747|gb|ABC91810.1| probable tRNA/rRNA methyltransferase protein [Rhizobium etli CFN 42] (153 aa)
Score = 168, Expect = 7.1e-11, Identities = 44/146 (30%), Positives = 77/146 (52%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           L + L+QP+IP NTG + R   C+GF   + +I P GF ++D+ +KR+G+DY        +  W  FE+ +       +   TK A++       D + + +++  +FGRE+ G+   + E+     L I M    RS N++ S A++
  S:     4 LRLALYQPDIPGNTGTLLRLAACLGF--AVDLIEPAGFNVSDRDLKRSGMDYIAAAALTRHASWDRFEAWHAATGRRLILASTKAAER-----YTDFVFRPDDV-LLFGRESAGVPDHVHERADACIL-IPMVEGQRSINVAISAAMI 142
>gi|110180258|gb|ABG54368.1| YibK [Klebsiella pneumoniae] (147 aa)
Score = 168, Expect = 9.1e-11, Identities = 45/138 (32%), Positives = 77/138 (55%)
  Q:    12 PENTGNISRTC--VGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQ-LKIEMNSNIRSFNLSNSVAIVAF 149
           P NTGNI R C   GF+   H+ R +    +DKR++RAGLDY +    + + D++ F +     +  ++F +T     + S      ++  +  F +FG ET+GL + I++     Q ++I M  + RS NLSN+V++V +
  S:     1 PPNTGNIIRLCANTGFSLAYHLSR-WASPWDDKRLRRAGLDYHEFTAVQRHADYAAFVAS---AQPQRLFALTTKGTPAHS-----AVSYQDGDFLMFGPETRGLPASILDALPPEQKIRIPMMPDSRSMNLSNAVSVVVY 132
>gi|62426254|ref|ZP_00381382.1| COG0219: Predicted rRNA methylase (SpoU class) [Brevibacterium linens BL2] (154 aa)
Score = 167, Expect = 1.1e-10, Identities = 47/148 (31%), Positives = 77/148 (52%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGL-TSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIVAF 149
           ++IV   PEIP NTGN  R      A LH++ P GF L+D +++RAGLDY D      +   +D  +        +V   T   D+S + +      +D ++  +FG+E+ GL  S + + +    ++I M  + RS NL+NS +I  +
  S:     3 IDIVFHTPEIPGNTGNAIRLAAVTGAHLHLVEPLGFDLSDAKLRRAGLDYHDLAHVTVHASLTDLWNH---LGERRVIAFTTHTDQSFAEVD----YRDGDV-LLFGQESTGLPDSVVDDDHVDLSVRIPMLPSRRSLNLANSASIAIY 143
>gi|150396754|ref|YP_001327221.1| tRNA/rRNA methyltransferase (SpoU) [Sinorhizobium medicae WSM419] >gi|150028269|gb|ABR60386.1| tRNA/rRNA methyltransferase (SpoU) [Sinorhizobium medicae WSM419] (153 aa)
Score = 166, Expect = 1.2e-10, Identities = 44/146 (30%), Positives = 71/146 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           L I L+QP+IP NTG I R        + +I P GF L+D+ +KRAG+DY   +    + +W  FE+         V   TK A       T+     D+    + GRE+ G+  ++ E+    ++ I M    RS N++ + A++
  S:     4 LRIALYQPDIPGNTGTILRLAACLGLAVDIIEPAGFDLSDRNLKRAGMDYIAAVTMTRHVNWERFETWRSSTGRRLVLASTKAA----VPYTRFMFKPDD--ILLLGRESAGVPDQVHERADA-RILIPMAPGQRSLNIAMAGAMI 142
>gi|87199225|ref|YP_496482.1| tRNA/rRNA methyltransferase [Novosphingobium aromaticivorans DSM 12444] >gi|87134906|gb|ABD25648.1| tRNA/rRNA methyltransferase [Novosphingobium aromaticivorans DSM 12444] (151 aa)
Score = 165, Expect = 2.0e-10, Identities = 41/145 (28%), Positives = 77/145 (53%)
  Q:     2 LNIVLFQPEIPENTGNISR--TCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           + I L++PEI  N G + R   C+G N  L  + P GF   D+R++RA +DY DH+K   +  +  F +        ++ L T  A++S+ +        D+    +FG+E+ G+  E+ +   + +++I +   +RS NL+ + A+
  S:     1 MRIALYEPEIAGNVGAVMRLGACLGVNVDL--VEPMGFAWEDRRVRRAAMDYIDHVKVTRHAGFGPFRAS---VAPGRLVLFTTKAEQSLHDF---RFRADD--VLLFGKESAGVPDEVAQACDE-RVRIPIRPEVRSLNLAIATAL 136
>gi|8895693|gb|AAF81066.1|AF223364_1 tRNA/rRNA methyltransferase-like protein [Myxococcus xanthus] (88 aa)
Score = 164, Expect = 2.3e-10, Identities = 26/54 (48%), Positives = 39/54 (72%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHL 55
           L++VL  P+IP NTGN++R C      L ++ P GF ++D+++KRAGLDYWD +
  S:     9 LHLVLVSPQIPPNTGNVARLCAVTGCRLILVEPLGFSIDDRQLKRAGLDYWDKV 62
>gi|23011594|ref|ZP_00051908.1| COG0219: Predicted rRNA methylase (SpoU class) [Magnetospirillum magnetotacticum MS-1] (175 aa)
Score = 163, Expect = 3.1e-10, Identities = 26/68 (38%), Positives = 42/68 (61%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFES 68
           ML + L+QP+IP+NTG + R        + +I P GF ++D+ ++R+GLDY DH+    +  W  FE+
  S:     1 MLRLALYQPDIPQNTGTMLRMAACLGVAVEIIEPAGFDVSDRHLRRSGLDYLDHVAITRHRSWDAFEA 68
>gi|68536793|ref|YP_251498.1| putative rRNA methylase, SpoU class [Corynebacterium jeikeium K411] >gi|68264392|emb|CAI37880.1| putative rRNA methylase, SpoU class [Corynebacterium jeikeium K411] (171 aa)
Score = 162, Expect = 3.8e-10, Identities = 46/141 (32%), Positives = 69/141 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWD--HLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYK-KFQLKIEMNSNIRSFNLSN 142
           L++V  +PEIP NTGN  R C G  A+LH+  P  F  +DK ++RAGLDY +   +   E  D +     +    + +VF  T       +     E+        +FG E  GL  E++   +   +++I M    RS NLSN
  S:    14 LHVVFDRPEIPPNTGNAIRMCAGTGASLHLAGPLAFKFDDKHVRRAGLDYHELADVHVHEGIDEALAHVTDPARGSGRVFAFTAQTGTWFT-----EVDYQPGDVLLFGPEPTGLADEVLADPRVTAKVRIPMLPGRRSMNLSN 152
>gi|154246890|ref|YP_001417848.1| tRNA/rRNA methyltransferase (SpoU) [Xanthobacter autotrophicus Py2] >gi|154160975|gb|ABS68191.1| tRNA/rRNA methyltransferase (SpoU) [Xanthobacter autotrophicus Py2] (154 aa)
Score = 162, Expect = 3.9e-10, Identities = 41/145 (28%), Positives = 71/145 (48%)
  Q:     2 LNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAI 146
           + I L+ P+I +N G I R    F   +H+I P GF + D   +RAG+DY D +  + +  ++ F+++        V   T+ A+     L       D+    +FGRE+ G+  E +      +L+I M + +RS N++ S  I
  S:     3 VRIALYCPDIAQNAGTILRIGACFGIEVHIIEPAGFPVGDAGFRRAGMDYIDQVTWRRHASFAAFDAERRAEGRRVVLFTTQGAEP----LFGFRFQPDD--VLLFGRESAGV-PESVHAVADARLRIPMRAGVRSLNVAVSAGI 140
>gi|156452766|ref|ZP_02059135.1| tRNA/rRNA methyltransferase (SpoU) [Methylobacterium chloromethanicum CM4] >gi|156188373|gb|EDO20573.1| tRNA/rRNA methyltransferase (SpoU) [Methylobacterium chloromethanicum CM4] (149 aa)
Score = 162, Expect = 4.2e-10, Identities = 38/147 (25%), Positives = 74/147 (50%)
  Q:     1 MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILNDKRMKRAGLDYWDHLKRKEYDDWSDFESQNLVNKNSKVFLITKFADKSISNLTKDELTKDEEIFFVFGRETKGLTSEIMEKYKKFQLKIEMNSNIRSFNLSNSVAIV 147
           ML + L+QP+IP+NTG + R        + +I P GF ++D+ ++R+GLDY DH+    +  W  FE+     + + + L+      S+         +D +   + GRE+ G+  E +      ++ + +   +RS N++   A++
  S:     1 MLRLALYQPDIPQNTGTMLRMSACLGIAVEIIEPAGFDVSDRHLRRSGLDYLDHVAITRHRSWDAFEAW---RRETDIRLVLATTTGSVP--YTQHAFRDGDCLLM-GRESAGV-PEAVHAAADARVVVPIRPGLRSLNVAICAAMM 140