>gi|26553553|ref|NP_757487.1| deoxyuridine 5'triphosphate nucleotidohydrolase dUTPase [Mycoplasma penetrans HF-2] >gi|26453559|dbj|BAC43891.1| deoxyuridine 5'triphosphate nucleotidohydrolase dUTPase [Mycoplasma penetrans HF-2] (163 aa)
Score = 788, Expect = 9.6e-83, Identities = 163/163 (100%), Positives = 163/163 (100%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK
  S:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
>gi|153814468|ref|ZP_01967136.1| hypothetical protein RUMTOR_00681 [Ruminococcus torques ATCC 27756] >gi|145848864|gb|EDK25782.1| hypothetical protein RUMTOR_00681 [Ruminococcus torques ATCC 27756] (178 aa)
Score = 508, Expect = 3.2e-50, Identities = 103/162 (63%), Positives = 129/162 (79%)
  Q:     1 MKIMGKFEKISLNEFNKSF----------ENKD------IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           MK + +FEK+S  +F+  +          ENKD       E+Y+ I+LP+RAT  SAGYDFFAP D+++ P +T+KIPTGIRV M  + VL   PRS LGFK+RLQL+NTVG+IDSDYY SDNEGHIF KLTND+NE K + IK G+GF Q IF+ YGIT DD A+++RNGGFGST K
  S:     1 MKRIARFEKVSFRQFSDGWDDTFQAIEKGENKDQSKETLKEIYDRIKLPRRATAGSAGYDFFAPVDIILNPGETIKIPTGIRVWMEPEWVLKCYPRSGLGFKFRLQLNNTVGIIDSDYYNSDNEGHIFAKLTNDSNEEKTVQIKAGEGFMQGIFVEYGITVDDAATDVRNGGFGSTTK 178
>gi|154502807|ref|ZP_02039867.1| hypothetical protein RUMGNA_00621 [Ruminococcus gnavus ATCC 29149] >gi|153796690|gb|EDN79110.1| hypothetical protein RUMGNA_00621 [Ruminococcus gnavus ATCC 29149] (170 aa)
Score = 508, Expect = 3.4e-50, Identities = 101/162 (62%), Positives = 129/162 (79%)
  Q:     1 MKIMGKFEKISLNEFNKSF-------ENKDIE-LYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           MK + KF K+SL +F K +       E  +IE +Y +I+LP+RAT  SAGYDFFAP  L+++P +T+KIPTGIRV M+ + VL   PRS LGFKYRLQL+NTVG+IDSDY+YSDNEGH+F K+TNDTNE K + I +G+GF Q IF+ YGIT DD  +++RNGGFGST K
  S:     1 MKRIAKFHKVSLEQFKKDWIDTFGLDEEANIEEIYENIKLPRRATAGSAGYDFFAPVRLILEPGETLKIPTGIRVEMDPEWVLKCYPRSGLGFKYRLQLNNTVGIIDSDYFYSDNEGHMFSKITNDTNEEKTIDIAQGEGFMQGIFVEYGITVDDDVTDVRNGGFGSTTK 170
>gi|167766903|ref|ZP_02438956.1| hypothetical protein CLOSS21_01420 [Clostridium sp. SS2/1] >gi|167711451|gb|EDS22030.1| hypothetical protein CLOSS21_01420 [Clostridium sp. SS2/1] (170 aa)
Score = 505, Expect = 6.3e-50, Identities = 98/162 (60%), Positives = 127/162 (78%)
  Q:     1 MKIMGKFEKISLNEFNKSF--------ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           M  + +F K+S  +F +S+        E +  E+Y+ I+LPKRAT+ SAGYDFF+P D  +KP +T+KIPTGIRV +  D VL I PRS LGFK+RLQ++NTVG+IDSDY+YSDNEGHIF+KLTNDTNE K + + +G G  Q IF+ YG+T DD A+E+RNGGFGST K
  S:     1 MNKIAQFHKVSFEQFKESWDDSFPGASEEEIKEIYDQIKLPKRATRGSAGYDFFSPVDFELKPGETIKIPTGIRVFIESDWVLNIFPRSGLGFKFRLQMNNTVGIIDSDYFYSDNEGHIFVKLTNDTNEGKTVSVAQGTGMVQGIFMQYGVTIDDDATEVRNGGFGSTTK 170
>gi|153855820|ref|ZP_01996806.1| hypothetical protein DORLON_02827 [Dorea longicatena DSM 13814] >gi|149751861|gb|EDM61792.1| hypothetical protein DORLON_02827 [Dorea longicatena DSM 13814] (171 aa)
Score = 505, Expect = 6.7e-50, Identities = 100/161 (62%), Positives = 124/161 (77%)
  Q:     2 KIMGKFEKISLNEFNKSF--------ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           K + KFEK+S  +F   +        + +  E+Y+S++LPKRATK SAGYDF+AP  + +KP +T KIPTGIR +M ++ VL   PRS LGFK+RLQL+NTVG+IDSDYYYSDNEGHIF K+TNDTNE K + I  G GF Q IF+ YGIT DD+  EIRNGGFGST K
  S:     3 KRIAKFEKVSFEQFKGGYTDAIGEASDEQIREVYDSLKLPKRATKGSAGYDFYAPAAITLKPGETAKIPTGIRAKMEDNWVLQCYPRSGLGFKFRLQLNNTVGIIDSDYYYSDNEGHIFAKITNDTNEGKTVEIPAGTGFMQGIFMEYGITVDDEVEEIRNGGFGSTTK 171
>gi|167758922|ref|ZP_02431049.1| hypothetical protein CLOSCI_01268 [Clostridium scindens ATCC 35704] >gi|167663329|gb|EDS07459.1| hypothetical protein CLOSCI_01268 [Clostridium scindens ATCC 35704] (172 aa)
Score = 505, Expect = 7.3e-50, Identities = 98/160 (61%), Positives = 121/160 (75%)
  Q:     4 MGKFEKISLNEFNKSF--------ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           + KF K+S  +F + F        E K  E Y+ +QLPKRAT  SAGYDF+ P  +V+ P +TVKIPTGIRV M +D VL   PRS LGFKYRLQL+NTVG+IDSDY+YSDNEGHIF K+TNDTNE K + ++ G GF Q IF+ YGIT DD+ + +RNGGFGST  +
  S:     5 IAKFHKVSFEQFREGFMDSFGPIEEEKIKEAYDGVQLPKRATAGSAGYDFYTPVSIVLHPGKTVKIPTGIRVEMEDDWVLKCYPRSGLGFKYRLQLNNTVGIIDSDYFYSDNEGHIFAKITNDTNEGKVVELQAGTGFMQGIFVEYGITLDDEVTAVRNGGFGSTTNQ 172
>gi|153812984|ref|ZP_01965652.1| hypothetical protein RUMOBE_03391 [Ruminococcus obeum ATCC 29174] >gi|149830931|gb|EDM86021.1| hypothetical protein RUMOBE_03391 [Ruminococcus obeum ATCC 29174] (172 aa)
Score = 500, Expect = 2.8e-49, Identities = 101/163 (61%), Positives = 126/163 (77%)
  Q:     1 MKIMGKFEKISLNEFNKSF-------ENKDIE-LYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           MK + KF K+S  +F K +       ++K+I+  Y  I LP RAT  SAGYDFFAP D+V+ P +T KIPTG+RV M +D VL   PRS LGFK+RLQL+NTVG+IDSDY+YSDNEGHIF K+TND+NE K + I+ G GF Q IF+ YGIT DD+A+ IRNGGFGST +K
  S:     1 MKRIAKFHKVSPEQFAKDWKDTFPAADDKEIQDTYEKISLPVRATAGSAGYDFFAPADIVLNPGETAKIPTGVRVEMEQDWVLKCYPRSGLGFKFRLQLNNTVGIIDSDYFYSDNEGHIFAKITNDSNEGKTVNIQAGTGFMQGIFVEYGITVDDEATGIRNGGFGSTTEK 171
>gi|166032013|ref|ZP_02234842.1| hypothetical protein DORFOR_01715 [Dorea formicigenerans ATCC 27755] >gi|166028466|gb|EDR47223.1| hypothetical protein DORFOR_01715 [Dorea formicigenerans ATCC 27755] (173 aa)
Score = 499, Expect = 3.1e-49, Identities = 98/162 (60%), Positives = 124/162 (76%)
  Q:     2 KIMGKFEKISLNEFNKSF--------ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           K + +F K+S  +F + F        E +  E+Y SI+LPKRAT  SAGYDF+ P  +V+ P +TVKIPTGIRV M E+ VL   PRS LGFKYRLQL+NTVG+IDSDY+YSDNEGHIF KLTND+NE K + ++ G GF Q IF+ YGIT DD  + +RNGGFGST+++
  S:     4 KRIAQFHKVSFEQFAEGFQDTFGEMKEGELKEIYQSIKLPKRATAGSAGYDFYTPIPIVLAPGKTVKIPTGIRVEMQENWVLKCYPRSGLGFKYRLQLNNTVGIIDSDYFYSDNEGHIFAKLTNDSNEGKTVELEAGSGFMQGIFVEYGITMDDDVTTVRNGGFGSTSQR 173
>gi|167748104|ref|ZP_02420231.1| hypothetical protein ANACAC_02848 [Anaerostipes caccae DSM 14662] >gi|167652096|gb|EDR96225.1| hypothetical protein ANACAC_02848 [Anaerostipes caccae DSM 14662] (170 aa)
Score = 499, Expect = 3.6e-49, Identities = 96/162 (59%), Positives = 129/162 (79%)
  Q:     1 MKIMGKFEKISLNEFNKSF--------ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           MK + +F K+S  +F +S+        E++  ++++SI+LPKRAT+ SAGYDF++P D  +KP +T+KIPTGIRV M E  VL + PRS LGFK+RLQ++NTVG+IDSDY+YSDNEGHIF+KLTND+NE K + ++ G G  Q IF+ YG+T DD A E+RNGGFGST K
  S:     1 MKKIAQFHKVSFGQFLESWQDTFEGTSEDEVRQIFDSIELPKRATRGSAGYDFYSPVDFELKPGETIKIPTGIRVYMEESWVLNLFPRSGLGFKFRLQMNNTVGIIDSDYFYSDNEGHIFVKLTNDSNEGKIVRVEAGTGIVQGIFMEYGVTIDDDAKEVRNGGFGSTTK 170
>gi|160941962|ref|ZP_02089285.1| hypothetical protein CLOBOL_06854 [Clostridium bolteae ATCC BAA-613] >gi|158435126|gb|EDP12893.1| hypothetical protein CLOBOL_06854 [Clostridium bolteae ATCC BAA-613] (171 aa)
Score = 493, Expect = 1.9e-48, Identities = 91/163 (55%), Positives = 123/163 (75%)
  Q:     1 MKIMGKFEKISLNEFNKSF--------ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           M+ + KF K+S  +F   +        E + I +Y  I+LP RAT  SAGYDFF P  L + P +++K+PTG+R  ++   VL I PRSSLGFK+RLQL+NTVG+IDSDY+YSDNEGH+FIK+TND+ E K + + +G GFAQ IF+ YGIT DD+ S++RNGGFGST+ +
  S:     1 MQRIAKFHKVSFEQFKADWADAFPDTSEEEIIHIYEGIRLPARATSGSAGYDFFTPVPLTLAPGESMKVPTGVRAEIDTGWVLQIFPRSSLGFKFRLQLNNTVGIIDSDYFYSDNEGHMFIKVTNDSREGKTVELGQGAGFAQGIFIPYGITADDECSDVRNGGFGSTDAR 171
>gi|167754917|ref|ZP_02427044.1| hypothetical protein CLORAM_00421 [Clostridium ramosum DSM 1402] >gi|167704967|gb|EDS19546.1| hypothetical protein CLORAM_00421 [Clostridium ramosum DSM 1402] (170 aa)
Score = 490, Expect = 3.7e-48, Identities = 101/162 (62%), Positives = 126/162 (77%)
  Q:     1 MKIMGKFEKIS----LNEFNKSFENKDI----ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           M+ + KF K+S    + +F  SF   D     ++Y SI+LPKRAT  SAGYDF+ P D ++KP +T+KIPTGIRV +N+  VL I PRS LGFKYRLQL+NTVG+IDSDY+ SDNEGHIFIK+TND+NE+K + +K G GF Q IFL YGI EDD  ++ RNGGFGST K
  S:     1 MQAIAKFHKVSKEQFIIDFKDSFPKYDEAAINDIYASIKLPKRATIGSAGYDFYTPIDFILKPHETIKIPTGIRVSINDGWVLAIFPRSGLGFKYRLQLNNTVGIIDSDYFNSDNEGHIFIKITNDSNEDKTVELKAGQGFGQGIFLQYGIVEDDNTTDERNGGFGSTTK 170
>gi|160914249|ref|ZP_02076470.1| hypothetical protein EUBDOL_00259 [Eubacterium dolichum DSM 3991] >gi|158433876|gb|EDP12165.1| hypothetical protein EUBDOL_00259 [Eubacterium dolichum DSM 3991] (178 aa)
Score = 483, Expect = 2.7e-47, Identities = 94/158 (59%), Positives = 119/158 (75%)
  Q:     4 MGKFEKISLNEFNKS----FENKDI----ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTN 161
           + KF K+S ++F K     F N        +Y+ I+LPKRATK SAGYDF+ P   V+ P+ T+K+PTGIRV + E  VL + PRSSLGFKYRLQLDN+VG+IDSDY+ S+NEGH+F+KLTNDTNE K + ++ GD   Q IFL +GI EDD    +RNGGFGSTN
  S:    13 VAKFYKVSFHQFLKDWKACFPNSTSVQIQNIYDEIKLPKRATKGSAGYDFYTPITFVLPPQHTIKLPTGIRVEIQEGWVLTLYPRSSLGFKYRLQLDNSVGIIDSDYFSSNNEGHLFVKLTNDTNEGKTVNLRAGDAMLQGIFLPFGICEDDACQGVRNGGFGSTN 178
>gi|169351484|ref|ZP_02868422.1| hypothetical protein CLOSPI_02264 [Clostridium spiroforme DSM 1552] >gi|169291706|gb|EDS73839.1| hypothetical protein CLOSPI_02264 [Clostridium spiroforme DSM 1552] (170 aa)
Score = 480, Expect = 5.1e-47, Identities = 100/162 (61%), Positives = 129/162 (79%)
  Q:     1 MKIMGKFEKIS----LNEFNKSFENKD---IE-LYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           M+ + KF KIS    +N+F  + +N D   IE +Y +I+LPKRAT  SAGYDF+ P +  +KP++T+ IPTGIRV++NE   L I PRS LGFKYRLQL+NTVG+IDSDY+ SDNEGHIFIK+TND+NENK + +  G GFAQ IF+ +G+ EDD  ++ RNGGFGSTNK
  S:     1 MQTIAKFLKISKEQFINDFKNTLDNYDESQIENIYETIKLPKRATIGSAGYDFYTPINFTLKPQETINIPTGIRVKINEGWFLAIFPRSGLGFKYRLQLNNTVGIIDSDYFNSDNEGHIFIKITNDSNENKTVELNAGQGFAQGIFMPFGLVEDDDTTDQRNGGFGSTNK 170
>gi|154502197|ref|ZP_02039257.1| hypothetical protein RUMGNA_00007 [Ruminococcus gnavus ATCC 29149] >gi|153797076|gb|EDN79496.1| hypothetical protein RUMGNA_00007 [Ruminococcus gnavus ATCC 29149] (172 aa)
Score = 343, Expect = 4.5e-31, Identities = 72/162 (44%), Positives = 109/162 (67%)
  Q:     1 MKIMGKFEKISLNEFNKS---------FENKD---IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           M+ + KF K+S  +F +           ENK     E Y +I +PKR+T  SAG+D   P+++ + P Q++ IPTG+R  M+ D V+LI PRSSLG K  + + NTV V+D+DY Y+DNEGHIFI + N+  +  EL  ++GD   QA+F+ +G+ ++++ +  R GG GST K
  S:     1 MRKVAKFSKVSFEQFVEDCKGILGDVYIENKMEYLSEKYKNINIPKRSTACSAGHDISTPFNIKMTPHQSITIPTGLRCEMDRDYVMLIFPRSSLGIKKGMTIANTVPVVDADYTYADNEGHIFICIKNNGEDMLEL--EEGDKIVQAVFVPFGVADEEEITTERTGGIGSTGK 172
>gi|162448001|ref|YP_001621133.1| dUTP pyrophosphatase [Acholeplasma laidlawii PG-8A] >gi|161986108|gb|ABX81757.1| dUTP pyrophosphatase [Acholeplasma laidlawii PG-8A] (146 aa)
Score = 288, Expect = 1.1e-24, Identities = 68/134 (50%), Positives = 88/134 (65%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           SI LPKRATK+SAGYD  +    VIKP     I TG++V M E+  L+I PRSSLG K  L + N VG+ID DYY + +NEGHI I L N   ++   +I+KG+  AQ +F  Y IT DD++S  R GGFGS+ +
  S:    14 SINLPKRATKYSAGYDIESADAYVIKPGTIQLIDTGLKVDMLENEALMIYPRSSLGIKKGLIMSNAVGIIDKDYYNNPNNEGHIMIPLFNFGQQDA--IIQKGERVAQGVFQKYLITSDDESSNERTGGFGSSGQ 146
>gi|78043524|ref|YP_359171.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Carboxydothermus hydrogenoformans Z-2901] >gi|77995639|gb|ABB14538.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Carboxydothermus hydrogenoformans Z-2901] (146 aa)
Score = 286, Expect = 1.9e-24, Identities = 66/133 (49%), Positives = 84/133 (63%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           I +P+R TK SAGYD  A  D+V+ P +   +PTG++  M ED VLLI  RSSL  K  L L N VGV+D+DYY + +NEGHI I L N   E   + I+KG+  AQ IF  Y   +DD+A   R GGFGST +
  S:    15 INIPQRKTKASAGYDLEAAIDVVLNPGEVKLVPTGVKAYMPEDEVLLIYIRSSLAVKKGLLLANGVGVVDADYYDNPENEGHIMIPLFNPGKE--PVTIRKGERIAQGIFTRYLKADDDEALGQRTGGFGSTGQ 146
>gi|51892671|ref|YP_075362.1| putative dUTPase [Symbiobacterium thermophilum IAM 14863] >gi|51856360|dbj|BAD40518.1| putative dUTPase [Symbiobacterium thermophilum IAM 14863] (140 aa)
Score = 279, Expect = 9.9e-24, Identities = 61/131 (46%), Positives = 78/131 (59%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           ++LP+R T+ SAGYD  A  ++ I P Q   +PTG++  M ED VLL+  RSSL  K RL L N +GVID+DY  + DNEGHI + L N   E     I  G+  AQ IF+ Y     DQ   +R GG GST
  S:     8 VRLPQRKTRLSAGYDLEAAEEVTIPPGQVALVPTGLKAYMGEDEVLLLAVRSSLAVKRRLALANGIGVIDADYADNPDNEGHILVALVNLGTE--PATIACGERVAQGIFVRYLTVAGDQPGGLRTGGIGST 137
>gi|25010183|ref|NP_734578.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus agalactiae NEM316] >gi|77414817|ref|ZP_00790936.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae 515] >gi|23094534|emb|CAD45753.1| Unknown [Streptococcus agalactiae NEM316] >gi|77159133|gb|EAO70325.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae 515] (148 aa)
Score = 271, Expect = 8.8e-23, Identities = 62/149 (41%), Positives = 89/149 (59%)
  Q:    14 EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           E    F NK++       LPKR T H+AGYD       VI+P +   +PTGI+  M    VL +  RSS   K  + L N+VGVID DYY +  NEGHIF ++ N T++   +++++G+   QA+F  + + +DDQA+ +R GGFGST K
  S:     8 ELVSQFSNKEL-------LPKRETAHAAGYDLKVAKKTVIEPGEITLVPTGIKAHMQPGEVLYLYDRSSNPRKKGIVLINSVGVIDGDYYNNQVNEGHIFAQMQNITDQ--AVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK 148
>gi|76800395|ref|ZP_00782025.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae 18RS21] >gi|76584405|gb|EAO61380.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae 18RS21] (196 aa)
Score = 269, Expect = 1.8e-22, Identities = 63/162 (38%), Positives = 93/162 (57%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +K+     K+   E    F NK++       LPKR T H+AGYD        I+P +   +PTGI+  M    VL +  RSS   K  + L N+VGVID DYY +  NEGHIF ++ N T++   +++++G+   QA+F  + + +DDQA+ +R GGFGST K
  S:    43 IKMEYHMSKVRGFELVSQFSNKEL-------LPKRETAHAAGYDLKVAKKTXIEPGEITLVPTGIKAYMQPGEVLYLYDRSSNPRKKGIVLINSVGVIDGDYYNNQVNEGHIFAQMQNITDQ--AVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK 196
>gi|118587586|ref|ZP_01545010.1| dUTPase, phage associated [Oenococcus oeni ATCC BAA-1163] >gi|118432037|gb|EAV38779.1| dUTPase, phage associated [Oenococcus oeni ATCC BAA-1163] (154 aa)
Score = 268, Expect = 1.9e-22, Identities = 61/133 (45%), Positives = 90/133 (67%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVK-IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           + I+LP R T H+AGYD  A  D  I    T+K +PTGI+  M  D+VL ++ RSS  +K  L L N++GVID+DYY ++ NEG IF++L + +   K + +KKGD   QAIF+ + + ++D+A  +R+GGFGST
  S:    19 SGIKLPSRGTAHAAGYDIRAAEDTEIPGDGTIKLVPTGIKAYMPHDNVLFLVNRSSGPYKRGLVLPNSIGVIDADYYNNEKNEGEIFVQLQSIS--GKTVDVKKGDRIVQAIFVPFLLADNDRAGGLRHGGFGST 151
>gi|22536294|ref|NP_687145.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus agalactiae 2603V/R] >gi|76788466|ref|YP_328833.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus agalactiae A909] >gi|22533116|gb|AAM99017.1|AE014196_13 deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae 2603V/R] >gi|76563523|gb|ABA46107.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae A909] (148 aa)
Score = 268, Expect = 2.0e-22, Identities = 62/149 (41%), Positives = 89/149 (59%)
  Q:    14 EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           E    F NK++       LPKR T H+AGYD       VI+P +   +PTGI+  M    VL +  RSS   K  + L N+VGVID DYY +  NEGHIF ++ N T++   +++++G+   QA+F  + + +DDQA+ +R GGFGST K
  S:     8 ELVSQFSNKEL-------LPKRETAHAAGYDLKVAKKTVIEPGEITLVPTGIKAYMQPGEVLYLYDRSSNPRKKGIVLINSVGVIDGDYYNNQVNEGHIFAQMQNITDQ--AVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK 148
>gi|116490413|ref|YP_809957.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Oenococcus oeni PSU-1] >gi|116091138|gb|ABJ56292.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Oenococcus oeni PSU-1] (151 aa)
Score = 268, Expect = 2.2e-22, Identities = 62/131 (47%), Positives = 89/131 (67%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVK-IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           I+LP R T H+AGYD  A  D  I    T+K +PTGI+  M  D+VL ++ RSS  +K  L L N+VGVID+DYY ++ NEG IF++L + +   K + +KKGD   QAIF+ + + ++D+A  +R+GGFGST
  S:    18 IKLPSRGTAHAAGYDIRAAEDTEIPGDGTIKLVPTGIKAYMPHDNVLFLVNRSSGPYKRGLVLPNSVGVIDADYYNNEKNEGEIFVQLQSIS--GKTVDVKKGDRIVQAIFVPFLLADNDRAGGLRHGGFGST 148
>gi|168483676|ref|ZP_02708628.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC1873-00] >gi|172043024|gb|EDT51070.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC1873-00] (147 aa)
Score = 268, Expect = 2.4e-22, Identities = 68/160 (42%), Positives = 94/160 (58%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           MKI G FE +S      SF ++++       LPKR T H+AGYD       V+ P + V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++  E+VI+ G+   QA+F ++ I + D A  +R GGFGST
  S:     1 MKIRG-FELVS------SFTDENL-------LPKRETAHAAGYDLKVAVRTVVAPGEIVLVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKNITDQ--EVVIEVGERIVQAVFATFLIADGDAAGGVRTGGFGST 145
>gi|194397504|ref|YP_002036743.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae G54] >gi|194357171|gb|ACF55619.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae G54] (147 aa)
Score = 267, Expect = 2.6e-22, Identities = 67/160 (41%), Positives = 95/160 (59%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           MKI G FE +S      SF ++++       LPKR T H+AGYD       V+ P + V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF+++ N T++  E+V++ G+   QA+F ++ I + D A  +R GGFGST
  S:     1 MKIRG-FELVS------SFTDENL-------LPKRETAHAAGYDLKVAVRTVVAPGEIVLVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFVQMKNITDQ--EVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGST 145
>gi|171853892|emb|CAM11854.1| DeoxyUTP pyrophosphatase [Candidatus Phytoplasma australiense] (153 aa)
Score = 265, Expect = 4.5e-22, Identities = 65/151 (43%), Positives = 96/151 (63%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGI-TEDDQASEIRNGGFGSTNK 162
           +++  + FE   +    +I LP+R T+ S GYDF A  ++ IKP+    +PTGI+   +E+  LLI  RSSL  K +L + N VGV+DSDYY +  NEGHIFI L N +++   + I+KG+  AQ IF  + + T +++ S +R GGFGST K
  S:     1 MSQKKRFFEKITLYQTENINLPQRQTEKSGGYDFEAAQNIEIKPQTVQLVPTGIKAFFSENETLLIYARSSLALKKQLMMANGVGVVDSDYYNNLQNEGHIFIPLYNFSSQT--VKIEKGERIAQGIFQPFLLSTNEEKPSFLRKGGFGSTTK 151
>gi|148987739|ref|ZP_01819202.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP6-BS73] >gi|148996425|ref|ZP_01824143.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP11-BS70] >gi|149004173|ref|ZP_01828970.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP14-BS69] >gi|168576943|ref|ZP_02722785.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae MLV-016] >gi|147757000|gb|EDK64039.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP11-BS70] >gi|147757835|gb|EDK64846.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP14-BS69] >gi|147926203|gb|EDK77276.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP6-BS73] >gi|183577426|gb|EDT97954.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae MLV-016] (147 aa)
Score = 265, Expect = 4.9e-22, Identities = 67/160 (41%), Positives = 94/160 (58%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           MKI G FE +S      SF ++++       LPKR T H+AGYD       V+ P + V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++  E+V++ G+   QA+F ++ I + D A  +R GGFGST
  S:     1 MKIRG-FELVS------SFTDENL-------LPKRETAHAAGYDLKVAVRTVVAPGEIVLVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKNITDQ--EVVLEVGERIVQAVFATFLIADGDAAGGVRTGGFGST 145
>gi|125718945|ref|YP_001036078.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus sanguinis SK36] >gi|125498862|gb|ABN45528.1| Deoxyuridinetriphosphatase, putative [Streptococcus sanguinis SK36] (147 aa)
Score = 264, Expect = 7.0e-22, Identities = 68/160 (42%), Positives = 93/160 (58%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           MKI G FE +S      SF N+D+       LPKR T H+AGYD       +I P +   +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++  E+V++ G+   QA+F  + I + D+A  +R GGFGST
  S:     1 MKIRG-FELVS------SFTNEDL-------LPKRETAHAAGYDLKVAERTLIAPGEIKLVPTGVKAYMQPSEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYSNPGNEGHIFAQMKNITDQ--EVVLEVGERVVQAVFAPFLIADGDEAEGVRTGGFGST 145
>gi|15899969|ref|NP_344573.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae TIGR4] >gi|15902067|ref|NP_357617.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae R6] >gi|111657254|ref|ZP_01408022.1| hypothetical protein SpneT_02001534 [Streptococcus pneumoniae TIGR4] >gi|116515930|ref|YP_815441.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae D39] >gi|148985361|ref|ZP_01818566.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP3-BS71] >gi|148986206|ref|ZP_01819158.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP3-BS71] >gi|148995214|ref|ZP_01824049.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP9-BS68] >gi|149006818|ref|ZP_01830504.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP18-BS74] >gi|149010881|ref|ZP_01832186.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP19-BS75] >gi|149023459|ref|ZP_01836048.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP23-BS72] >gi|168486728|ref|ZP_02711236.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC1087-00] >gi|168489515|ref|ZP_02713714.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae SP195] >gi|168493714|ref|ZP_02717857.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC3059-06] >gi|169833109|ref|YP_001693544.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae Hungary19A-6] >gi|182682991|ref|YP_001834738.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae CGSP14] >gi|14971486|gb|AAK74213.1| putative deoxyuridine 5'triphosphate nucleotidohydrolase [Streptococcus pneumoniae TIGR4] >gi|15457552|gb|AAK98827.1| Deoxyuridinetriphosphatase [Streptococcus pneumoniae R6] >gi|116076506|gb|ABJ54226.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae D39] >gi|147761733|gb|EDK68697.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP18-BS74] >gi|147764517|gb|EDK71447.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP19-BS75] >gi|147921820|gb|EDK72948.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP3-BS71] >gi|147922319|gb|EDK73439.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP3-BS71] >gi|147926816|gb|EDK77871.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP9-BS68] >gi|147929782|gb|EDK80772.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae SP23-BS72] >gi|168995611|gb|ACA36223.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae Hungary19A-6] >gi|182628325|gb|ACB89273.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pneumoniae CGSP14] >gi|183570345|gb|EDT90873.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC1087-00] >gi|183572105|gb|EDT92633.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae SP195] >gi|183576226|gb|EDT96754.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC3059-06] (147 aa)
Score = 264, Expect = 7.0e-22, Identities = 67/160 (41%), Positives = 94/160 (58%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           MKI G FE +S      SF ++++       LPKR T H+AGYD       V+ P + V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++  E+V++ G+   QA+F ++ I + D A  +R GGFGST
  S:     1 MKIRG-FELVS------SFTDENL-------LPKRETAHAAGYDLKVAVRTVVAPGEIVLVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKNITDQ--EVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGST 145
>gi|83281000|dbj|BAE53576.1| putative dUTPase [Clostridium botulinum D phage] (155 aa)
Score = 263, Expect = 9.2e-22, Identities = 62/144 (43%), Positives = 94/144 (65%)
  Q:    20 ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           +NK++E    I+LP+R +K SAGYDF  P ++ I+P ++  I T ++  M E  VL+I  RSS+G K  L L NT+GVID+DYY + DN+G+I I L N +  +K + ++ G+  AQ IF+S+ + ++    +IR GG GST  K
  S:    17 KNKNVE----IKLPQRGSKISAGYDFSTPIEVTIQPNESKLIWTDVKAYMQEGEVLIIDVRSSIGVKKGLMLSNTIGVIDADYYQNKDNDGNIGISLRNMS--DKPVTLEAGERIAQGIFISFLVADNGNTDKIREGGIGSTGTK 155
>gi|157151249|ref|YP_001449490.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus gordonii str. Challis substr. CH1] >gi|157076043|gb|ABV10726.1| dUTP diphosphatase [Streptococcus gordonii str. Challis substr. CH1] (147 aa)
Score = 262, Expect = 9.8e-22, Identities = 69/162 (42%), Positives = 93/162 (57%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           MKI G FE +S      SF N D+       LPKR T H+AGYD       +I P +   +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++  E+V++ G+   QA+F  + I + D+A  +R GGFGST K
  S:     1 MKIRG-FELVS------SFTNDDL-------LPKRETAHAAGYDLKVAERTLIAPGEIKLVPTGVKAYMQPGEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKNITDQ--EVVLEVGERVVQAVFAPFLIADGDEADGVRTGGFGSTGK 147
>gi|39938650|ref|NP_950416.1| dUTPase [Onion yellows phytoplasma OY-M] >gi|39721759|dbj|BAD04249.1| dUTPase [Onion yellows phytoplasma OY-M] (150 aa)
Score = 261, Expect = 1.3e-21, Identities = 67/149 (44%), Positives = 89/149 (59%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-YGITEDDQASEIRNGGFGST 160
           +N+ N+ FE         I LP+R TK SAGYDF A   + I P+  + +PTGI+     + VLLI  RSSL  K +L L N VGV+DSDYY +  NEGHIFI L N +    ++   KG+  AQ IF   + IT++ + +  R GGFGST
  S:     1 MNKTNRFFEKVSSYQNQGINLPQRQTKFSAGYDFEAAQSMEIPPQTFILVPTGIKASFPWNEVLLIYVRSSLPLKKQLTLANGVGVVDSDYYNNLQNEGHIFIALYNFSKNPVQVC--KGERIAQGIFQPFFQITQEKENNFARKGGFGST 149
>gi|168492308|ref|ZP_02716451.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC0288-04] >gi|183573463|gb|EDT93991.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Streptococcus pneumoniae CDC0288-04] (147 aa)
Score = 261, Expect = 1.5e-21, Identities = 58/129 (44%), Positives = 80/129 (62%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           LPKR T H+AGYD       V+ P + V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++  E+V++ G+   QA+F ++ I + D A  +R GGFGST
  S:    18 LPKRETAHAAGYDLKVAVRTVVAPGEIVLVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKNITDQ--EVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGST 145
>gi|81177272|ref|ZP_00876121.1| DeoxyUTP pyrophosphatase [Streptococcus suis 89/1591] >gi|80976053|gb|EAP39713.1| DeoxyUTP pyrophosphatase [Streptococcus suis 89/1591] (147 aa)
Score = 260, Expect = 1.9e-21, Identities = 58/131 (44%), Positives = 81/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           LPKR T H+AGYD  A   + ++P +   +PTG++  M  + VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T E   +V++ G+   QA+F  + + + DQA  +R GGFGST K
  S:    18 LPKRETAHAAGYDLKAAERISLEPGEIKLVPTGVKAYMQANEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPANEGHIFAQMRNITEET--VVVEAGERMVQAVFAPFLLADGDQADGVRTGGFGSTGK 147
>gi|85057835|ref|YP_456751.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789940|gb|ABC65672.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Aster yellows witches'-broom phytoplasma AYWB] (165 aa)
Score = 260, Expect = 1.9e-21, Identities = 67/149 (44%), Positives = 90/149 (60%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-YGITEDDQASEIRNGGFGST 160
           +N+ N+ FE         I LP+R TK SAGYDF A   + I P+  + +PTGI+     + VLLI  RSSL  K +L L N VGV+DSDYY +  NEGHIFI L N +    ++   KG+  AQ IF + + IT++ + +  R GGFGST
  S:    16 MNKTNRFFEKVSSYQNQGINLPQRQTKFSAGYDFEASQSIEIPPQTVILVPTGIKAYFPCNEVLLIYVRSSLPLKKQLTLANGVGVVDSDYYNNLQNEGHIFIALYNFSKSPVQVF--KGERIAQGIFQTFFQITQEKENNFYRKGGFGST 164
>gi|146319689|ref|YP_001199401.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus suis 05ZYH33] >gi|146321883|ref|YP_001201594.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus suis 98HAH33] >gi|145690495|gb|ABP91001.1| dUTPase [Streptococcus suis 05ZYH33] >gi|145692689|gb|ABP93194.1| dUTPase [Streptococcus suis 98HAH33] (147 aa)
Score = 260, Expect = 2.0e-21, Identities = 58/131 (44%), Positives = 81/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           LPKR T H+AGYD  A   + ++P +   +PTG++  M  + VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T E   +V++ G+   QA+F  + + + DQA  +R GGFGST K
  S:    18 LPKRETAHAAGYDLKAAETVSLEPGEIKLVPTGVKAYMQANEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPANEGHIFAQMRNITEET--VVVEAGERIVQAVFAPFLLADGDQADGVRTGGFGSTGK 147
>gi|171779001|ref|ZP_02920009.1| hypothetical protein STRINF_00884 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282359|gb|EDT47784.1| hypothetical protein STRINF_00884 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (148 aa)
Score = 259, Expect = 2.3e-21, Identities = 57/131 (43%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           LPKR T H+AGYD  A     I P +   +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T+E   +V++ G+   Q +F+ + + + D+A+ +R GGFGST K
  S:    19 LPKRETAHAAGYDLKAAETTEIAPGEIKLVPTGVKAYMQAGEVLYLFDRSSNPRKKGLVLINSVGVIDGDYYGNPANEGHIFAQMKNITDET--VVVEAGERIVQGVFMPFLVADGDEAAGVRTGGFGSTGK 148
>gi|80159764|ref|YP_398508.1| putative dUTPase [Clostridium phage c-st] >gi|78675354|dbj|BAE47776.1| putative dUTPase [Clostridium phage c-st] (155 aa)
Score = 258, Expect = 2.7e-21, Identities = 61/144 (42%), Positives = 93/144 (64%)
  Q:    20 ENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           +NK++E    I+LP+R +K SAGYDF  P ++ I+P ++  I T ++  M E  VL+I  RSS+G K  L L NT+GVID+DYY + DN+G+I I L N +  +K + ++ G+  AQ IF+ + + ++    +IR GG GST  K
  S:    17 KNKNVE----IKLPQRGSKISAGYDFSTPIEVTIQPNESKLIWTDVKAYMQEGEVLIIDVRSSIGVKKGLMLSNTIGVIDADYYQNKDNDGNIGISLRNMS--DKPVTLEAGERIAQGIFIPFLVADNGNTDKIREGGIGSTGTK 155
>gi|195977370|ref|YP_002122614.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974075|gb|ACG61601.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (148 aa)
Score = 256, Expect = 5.1e-21, Identities = 57/131 (43%), Positives = 79/131 (60%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           LPKR T H+AGYD     +  I P + V +PTG++  M +  VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++   + +  G+   Q +F+ + I + DQAS  R GGFGST +
  S:    19 LPKRETAHAAGYDLSVAEETSIAPGEIVLVPTGVKAYMQDGEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYNNPANEGHIFAQMKNITDQT--ITLSAGERIVQGVFMPFLIADGDQASGERTGGFGSTGR 148
>gi|55821796|ref|YP_140238.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus thermophilus LMG 18311] >gi|55823714|ref|YP_142155.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus thermophilus CNRZ1066] >gi|116628511|ref|YP_821130.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus thermophilus LMD-9] >gi|55737781|gb|AAV61423.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [Streptococcus thermophilus LMG 18311] >gi|55739699|gb|AAV63340.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [Streptococcus thermophilus CNRZ1066] >gi|116101788|gb|ABJ66934.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus thermophilus LMD-9] (148 aa)
Score = 256, Expect = 5.8e-21, Identities = 61/154 (39%), Positives = 89/154 (57%)
  Q:     9 KISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           KI   E   ++ N+D+       LPKR T H+AGYD     + +I P + V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY +  NEGHIF ++ N T++   + ++ G+   Q +F+ + I + D+A  +R GGFGST K
  S:     3 KIRGFELVSTYNNQDL-------LPKRETAHAAGYDLKVAENTMISPGEIVLVPTGVKAYMQPGEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKNITDQ--PVTLEVGERIVQGVFMPFLIVDGDEADGVRTGGFGSTGK 148
>gi|19745371|ref|NP_606507.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS8232] >gi|19747477|gb|AAL97006.1| putative dUTPase, phage associated [Streptococcus pyogenes MGAS8232] (148 aa)
Score = 253, Expect = 1.2e-20, Identities = 62/154 (40%), Positives = 87/154 (56%)
  Q:     9 KISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           KI   E   SF N D+       LPKR T H+AGYD      + I P +   +PTG++  M +  VL +  RSS   K  + L N+VGVID+DYY ++ NEGHIF ++ N T++   L +  G+   Q +F+ + I + DQA   R GGFGST +
  S:     3 KIRGFELVSSFTNPDL-------LPKRETTHAAGYDLSVAEAVTIAPGEIKLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQNITDQPVTLAV--GERIVQGVFMPFLIADGDQARGERTGGFGSTGQ 148
>gi|15672158|ref|NP_266332.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|13878476|sp|Q9CJ30|DUT_LACLA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|12723028|gb|AAK04274.1|AE006255_4 deoxyuridine 5'-triphosphate nucleotidhydrolase [Lactococcus lactis subsp. lactis Il1403] (150 aa)
Score = 252, Expect = 1.5e-20, Identities = 61/131 (46%), Positives = 84/131 (64%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD--QASEIRNGGFGST 160
           I +PKR+T+HSAGYD  A   +   P +   IPTG++  M    VL +  RSS   K  L L N+VGVID DYY + DNEGH+F+++ N T+E  E+VI+KG+   Q +F+ + + + D  Q  E R GGFGST
  S:    17 INIPKRSTEHSAGYDIEAAETVSFAPGEIKLIPTGLKAYMQAGEVLYMYDRSSNPRKKGLVLINSVGVIDKDYYNNPDNEGHMFMQMRNFTDE--EVVIEKGERVVQGVFMPFLVADGDENQEKEERTGGFGST 148
>gi|15674420|ref|NP_268594.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes M1 GAS] >gi|21909702|ref|NP_663970.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS315] >gi|28895085|ref|NP_801435.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes SSI-1] >gi|71902859|ref|YP_279662.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS6180] >gi|71910013|ref|YP_281563.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS5005] >gi|94987831|ref|YP_595932.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS9429] >gi|94989707|ref|YP_597807.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS10270] >gi|139473059|ref|YP_001127774.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes str. Manfredo] >gi|13621513|gb|AAK33315.1| putative dUTPase, phage associated [Streptococcus pyogenes M1 GAS] >gi|21903885|gb|AAM78773.1| putative dUTPase, phage-associated [Streptococcus pyogenes MGAS315] >gi|28810330|dbj|BAC63268.1| putative dUTPase (phage associated) [Streptococcus pyogenes SSI-1] >gi|71801954|gb|AAX71307.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS6180] >gi|71852795|gb|AAZ50818.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS5005] >gi|94541339|gb|ABF31388.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS9429] >gi|94543215|gb|ABF33263.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS10270] >gi|134271305|emb|CAM29522.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes str. Manfredo] (148 aa)
Score = 252, Expect = 1.7e-20, Identities = 62/154 (40%), Positives = 86/154 (55%)
  Q:     9 KISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           KI   E   SF N D+       LPKR T H+AGYD      + I P +   +PTG++  M +  VL +  RSS   K  + L N+VGVID+DYY ++ NEGHIF ++ N T+    L +  G+   Q +F+ + I + DQA   R GGFGST +
  S:     3 KIRGFELVSSFTNPDL-------LPKRETTHAAGYDLSVAEAVTIAPGEIKLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQNITDHPVTLAV--GERIVQGVFMPFLIADGDQARGERTGGFGSTGQ 148
>gi|50913576|ref|YP_059548.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS10394] >gi|50902650|gb|AAT86365.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS10394] (148 aa)
Score = 250, Expect = 2.3e-20, Identities = 60/149 (40%), Positives = 84/149 (56%)
  Q:    14 EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           E   SF N D+       LPKR T H+AGYD      + I P +   +PTG++  M +  VL +  RSS   K  + L N+VGVID+DYY ++ NEGHIF ++ N T+    L +  G+   Q +F+ + I + DQA   R GGFGST +
  S:     8 ELVSSFTNPDL-------LPKRETTHAAGYDLSVAEAVTIAPGEIKLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQNITDHPVTLAV--GERIVQGVFMPFLIADGDQARGERTGGFGSTGQ 148
>gi|75758385|ref|ZP_00738508.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494111|gb|EAO57204.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacillus thuringiensis serovar israelensis ATCC 35646] (160 aa)
Score = 250, Expect = 2.4e-20, Identities = 65/149 (43%), Positives = 80/149 (53%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           LN+F + FEN       S+  P R T ++AGYD  A  D VI P     I TG+   M ED  L +  RS L +   L L N  GVID+D+Y +    HI I L N+  E    V+  GD  AQ IFL Y   +DD ASE+R GGFGST
  S:    18 LNDFKEHFEN------FSVLKPTRKTLNAAGYDIAAVGDYVIPPNSKAIINTGLTAYMKEDEWLALFVRSGLAYGKDLTLQNATGVIDADFYGN----HIRILLRNEGTE--PFVVNHGDRIAQGIFLPYLTADDDYASELRTGGFGST 154
>gi|125623068|ref|YP_001031551.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris MG1363] >gi|124491876|emb|CAL96797.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris MG1363] (150 aa)
Score = 250, Expect = 2.5e-20, Identities = 60/131 (45%), Positives = 84/131 (64%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD--QASEIRNGGFGST 160
           I LPKR+T+HSAGYD  A   +   P +   IPTG++  M    VL +  RSS   K  L L N+VGVID DYY + DNEGH+F+++ N T+E  E++++KG+   Q +F+ + + + D  Q  E R GGFGST
  S:    17 INLPKRSTEHSAGYDIEAAETVRFAPGEIKLIPTGLKAYMQTGEVLYMYDRSSNPRKKGLVLINSVGVIDKDYYNNPDNEGHMFMQMRNFTDE--EVLVEKGERVVQGVFMPFLVADGDENQEKEERTGGFGST 148
>gi|116511009|ref|YP_808225.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris SK11] >gi|116106663|gb|ABJ71803.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris SK11] (150 aa)
Score = 250, Expect = 2.9e-20, Identities = 60/131 (45%), Positives = 84/131 (64%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD--QASEIRNGGFGST 160
           I LPKR+T+HSAGYD  A   +   P +   IPTG++  M    VL +  RSS   K  L L N+VGVID DYY + DNEGH+F+++ N T+E  E++++KG+   Q +F+ + + + D  Q  E R GGFGST
  S:    17 INLPKRSTEHSAGYDIEAAETVRFAPGEIKLIPTGLKAYMQTGEVLYMYDRSSNPRKKGLVLINSVGVIDKDYYNNPDNEGHMFMQMRNFTDE--EVLVEKGERVVQGVFMPFLVADGDENQEKEERTGGFGST 148
>gi|121535273|ref|ZP_01667087.1| deoxyUTP pyrophosphatase [Thermosinus carboxydivorans Nor1] >gi|121306158|gb|EAX47086.1| deoxyUTP pyrophosphatase [Thermosinus carboxydivorans Nor1] (149 aa)
Score = 245, Expect = 1.1e-19, Identities = 62/146 (42%), Positives = 82/146 (56%)
  Q:    17 KSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQ-ASEIRNGGFGSTNK 162
           + FE     +   I LP+R T  SAGYDF A  D+V  P+    IPTG++  M  D  L I  RSSL  K+ L L N  G+ID+DYY +  NEGHI + + N  +  + + I KG   AQ IF  Y + ++D+ A   R GG GST K
  S:     4 RGFEIVSSYIDKGIALPRRQTAASAGYDFAAAEDVVAAPQTVTLIPTGLKAYMLPDEYLSIHIRSSLAVKHGLSLINGQGIIDADYYNNPTNEGHIILAVFN--HGTQAVQIAKGTRIAQGIFNKYLLVDNDRIAGATRTGGIGSTGK 149
>gi|94993590|ref|YP_601688.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS10750] >gi|94547098|gb|ABF37144.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS10750] (148 aa)
Score = 243, Expect = 1.6e-19, Identities = 60/154 (38%), Positives = 85/154 (55%)
  Q:     9 KISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           KI   E   SF N D+       LPKR T H+AGYD      + I P +   +PTG++  M +  VL +  RSS   K  + + N+VGVID+DYY ++ NEGHIF ++ N  +    L +  G+   Q +F+ + I + DQA   R GGFGST +
  S:     3 KIRGFELVSSFTNNDL-------LPKRETTHAAGYDLSVAEAVTIAPGEIKLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIIMINSVGVIDADYYGNEANEGHIFAQMQNIIDHPVTLAV--GERIVQGVFMPFLIADGDQARGERTGGFGSTGQ 148
>gi|194246626|ref|YP_002004265.1| Deoxyuridine 5\'-triphosphate nucleotidohydrolase [Candidatus Phytoplasma mali] >gi|193806983|emb|CAP18418.1| Deoxyuridine 5\'-triphosphate nucleotidohydrolase [Candidatus Phytoplasma mali] (155 aa)
Score = 242, Expect = 2.4e-19, Identities = 61/134 (45%), Positives = 86/134 (64%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY-----GITEDDQASEIRNGGFGSTN 161
           ++I++P+R TK SAGYD  +  D++ +PK+   +PTG++     +  L+I  RSS+  K +L L N VG+ID DYY + +NEGHIFI L N TNE   + I KG+  AQ IF  Y      I  +  ++  R GGFGSTN
  S:    17 HNIKIPQRQTKFSAGYDLESAEDIIFQPKEIKLVPTGVKAYFEPEEFLIICIRSSVPIKKKLILSNGVGIIDHDYYNNKENEGHIFISLYNFTNET--IKINKGERIAQGIFQKYYLVTEKIDNNKISNNKRKGGFGSTN 154
>gi|69245498|ref|ZP_00603462.1| DeoxyUTP pyrophosphatase [Enterococcus faecium DO] >gi|68195749|gb|EAN10186.1| DeoxyUTP pyrophosphatase [Enterococcus faecium DO] (175 aa)
Score = 239, Expect = 4.4e-19, Identities = 68/134 (50%), Positives = 88/134 (65%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVI---------KPKQTVK------------------IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +I LP+RAT H+AGYDF A  ++VI         K  +TV                   +PTGI+  M ED  L +  RSS   K  L L N VGVIDSDYY ++ NEGHI  + TN     K++VIKKG+   Q IFL +   + DQ +  R GGFGS++K
  S:    16 NINLPQRATHHAAGYDFEAAEEVVIPSIWKAGWKKGLETVADGLKKDVSENEKQLKPTLVPTGIKAYMGEDEFLQLANRSSNPLKRFLVLTNGVGVIDSDYYNNEANEGHIMFQFTNFG--FKDVVIKKGERIGQGIFLPFLKADQDQTTAQRQGGFGSSSK 175
>gi|15625451|gb|AAL04097.1|AF397168_2 DutA [Streptococcus mutans] (147 aa)
Score = 234, Expect = 2.0e-18, Identities = 54/129 (41%), Positives = 77/129 (59%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           LPKR T H+AGYD        I     V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY + +NEGHIF ++ N T++   +V++ G+   Q +F+ + + + D+A+  R GGFGST
  S:    18 LPKRETAHAAGYDLKVAERTEISAGAIVLVPTGVKAYMQVGEVLYLFDRSSNPRKKGLVLINSVGVIDGDYYNNPNNEGHIFAQMKNMTDQT--VVLEAGERVVQGVFMPFLLIDGDKATGTRTGGFGST 145
>gi|24378823|ref|NP_720778.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus mutans UA159] >gi|24376698|gb|AAN58084.1|AE014880_11 putative dUTPase [Streptococcus mutans UA159] (148 aa)
Score = 234, Expect = 2.0e-18, Identities = 54/129 (41%), Positives = 77/129 (59%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGST 160
           LPKR T H+AGYD        I     V +PTG++  M    VL +  RSS   K  L L N+VGVID DYY + +NEGHIF ++ N T++   +V++ G+   Q +F+ + + + D+A+  R GGFGST
  S:    19 LPKRETAHAAGYDLKVAERTEISAGAIVLVPTGVKAYMQVGEVLYLFDRSSNPRKKGLVLINSVGVIDGDYYNNPNNEGHIFAQMKNMTDQT--VVLEAGERVVQGVFMPFLLIDGDKATGTRTGGFGST 146
>gi|90962225|ref|YP_536141.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus salivarius UCC118] >gi|90821419|gb|ABE00058.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus salivarius UCC118] (178 aa)
Score = 233, Expect = 2.2e-18, Identities = 65/133 (48%), Positives = 87/133 (65%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI----------------KPKQTVK--------------IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQ-ASEIRNGGFGSTNK 162
           ++LP R TK +AGYDFFA  D ++                K K   K              +PTGI+  M ED  L++  RSS   K  L L N VG+ID+DYY + +NEG IF++L N     K+ +IKKGD   Q IFL Y + ++D+   E R GGFGS+ K
  S:    16 VKLPVRMTKDAAGYDFFAAEDFLLPSIWKFNFLKILYALHKQKNITKTELLEGQKCLKPFLVPTGIKAYMKEDEFLMLANRSSSPLKRSLILPNGVGIIDADYYNNPNNEGEIFVQLVNFG--LKDQLIKKGDRIGQGIFLPYLVADNDEGGKETRTGGFGSSGK 178
>gi|116512485|ref|YP_811392.1| dUTPase [Lactococcus lactis subsp. cremoris SK11] >gi|116108139|gb|ABJ73279.1| dUTPase [Lactococcus lactis subsp. cremoris SK11] (139 aa)
Score = 228, Expect = 8.1e-18, Identities = 53/131 (40%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RATKHSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:    14 IPERATKHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|163791197|ref|ZP_02185614.1| Deoxyuridine 5'-triphosphatase [Carnobacterium sp. AT7] >gi|159873528|gb|EDP67615.1| Deoxyuridine 5'-triphosphatase [Carnobacterium sp. AT7] (179 aa)
Score = 228, Expect = 9.3e-18, Identities = 67/149 (44%), Positives = 92/149 (61%)
  Q:    14 EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVI---------------KPKQT--------------VKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQAS-EIRNGGFGSTNK 162
           E  + FE         IQLP RAT H+AGYDF A  D ++               KPK+T                +PTGI+  M ED  L +  RSS   K++L L N VG+IDSDYY ++ NEGHI+ +  +    +   VIKKGD   Q IF+ +   + D+ +  IR+GGFGS+ +
  S:     2 EKKRGFEVITAYQSKGIQLPIRATNHAAGYDFEAAEDTIVPSIWKVLFKNIAREMKPKETKLAYLAENKKYLKSTLVPTGIKAYMGEDEYLQLANRSSNPIKHQLILPNGVGIIDSDYYNNENNEGHIYFQFIHYGLTDH--VIKKGDRIGQGIFMPFLKADADRVTGNIRSGGFGSSGR 179
>gi|13487824|ref|NP_108702.1| dUTPase [Lactococcus phage Tuc2009] >gi|13346839|gb|AAK19851.1|AF109874_23 dUTPase [Bacteriophage Tuc2009] (139 aa)
Score = 228, Expect = 1.0e-17, Identities = 54/138 (39%), Positives = 83/138 (60%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +L  +  +P+RATKHSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:     7 KLNENATIPERATKHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|45597408|ref|NP_996693.1| dUTPase [Lactococcus phage phiLC3] >gi|45504628|gb|AAS66797.1| dUTPase [Bacteriophage phi LC3] (141 aa)
Score = 227, Expect = 1.1e-17, Identities = 53/138 (38%), Positives = 83/138 (60%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +L  +  +P+RAT+HSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:     7 KLNENATIPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|116511863|ref|YP_809079.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris SK11] >gi|116107517|gb|ABJ72657.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris SK11] (151 aa)
Score = 227, Expect = 1.2e-17, Identities = 59/149 (39%), Positives = 85/149 (57%)
  Q:    14 EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           EF K  EN  I        P+RATKHSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:     4 EFKKLNENATI--------PERATKHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|89212608|gb|ABD63719.1| putative dUTPase [Lactococcus phage ul36.k1t1] >gi|89212712|gb|ABD63821.1| putative dUTPase [Lactococcus phage ul36.t1k1] >gi|89212763|gb|ABD63871.1| putative dUTPase [Lactococcus phage phismq86] (139 aa)
Score = 225, Expect = 1.9e-17, Identities = 52/131 (39%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RAT+HSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:    14 IPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|104774500|ref|YP_619480.1| dUTP diphosphatase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423581|emb|CAI98509.1| dUTP diphosphatase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (184 aa)
Score = 225, Expect = 2.0e-17, Identities = 67/134 (50%), Positives = 88/134 (65%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI---------------------------KPKQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI-RNGGFGSTNKK 163
           + LP+R T  SAGYD  A  D+ I                           + ++ +K   +PTGI+  M ED VL++  RSS  FK  L L N +GVIDSDYY + +NEG IF+++ N     + L IKKG+  AQ IF+ Y  T+DDQ  E  R  GFGST KK
  S:    18 LTLPRRQTLASAGYDIEAARDITIPSIWSLNFVRIFCLIRNGHDLIESDFLQAEEVLKPILVPTGIKAYMPEDEVLILANRSSNTFKRNLSLPNGIGVIDSDYYNNPNNEGEIFVQVLN--YGVRPLKIKKGERIAQGIFIKYLKTDDDQPIESQRLSGFGSTGKK 181
>gi|13095829|ref|NP_076719.1| dUTPase [Lactococcus phage bIL309] >gi|15672437|ref|NP_266611.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|12723333|gb|AAK04553.1|AE006281_19 prophage pi1 protein 16, deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|12831018|gb|AAK08372.1|AF323670_24 dUTPase [bacteriophage bIL309] (139 aa)
Score = 225, Expect = 2.3e-17, Identities = 52/131 (39%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RAT+HSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:    14 IPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|13095772|ref|NP_076663.1| dUTPase [Lactococcus phage bIL286] >gi|15673390|ref|NP_267564.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|12724396|gb|AAK05506.1|AE006372_5 prophage pi3 protein 35, deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|12830961|gb|AAK08316.1|AF323669_29 dUTPase [bacteriophage bIL286] (139 aa)
Score = 225, Expect = 2.3e-17, Identities = 53/138 (38%), Positives = 82/138 (59%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +L  +  +P+RAT+HSAGYD  A   + I+P +   + TG+ V++  D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:     7 KLNGNATIPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGHDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|116514612|ref|YP_813518.1| dUTPase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093927|gb|ABJ59080.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (184 aa)
Score = 224, Expect = 2.6e-17, Identities = 67/134 (50%), Positives = 88/134 (65%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI---------------------------KPKQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI-RNGGFGSTNKK 163
           + LP+R T  SAGYD  A  D+ I                           + ++ +K   +PTGI+  M ED VL++  RSS  FK  L L N +GVIDSDYY + +NEG IF+++ N     + L IKKG+  AQ IF+ Y  T+DDQ  E  R  GFGST KK
  S:    18 LTLPRRQTLASAGYDIEAARDITIPSIWSLNFVRIFRLIRNGHDLIGSDFLQAEEVLKPILVPTGIKAYMPEDEVLILANRSSNTFKRNLSLPNGIGVIDSDYYNNPNNEGEIFVQVLN--YGVRPLKIKKGERIAQGIFIKYLKTDDDQPIESQRLSGFGSTGKK 181
>gi|125623665|ref|YP_001032148.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris MG1363] >gi|124492473|emb|CAL97415.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris MG1363] (139 aa)
Score = 224, Expect = 2.6e-17, Identities = 52/131 (39%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RAT+HSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:    14 IPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|2765131|emb|CAA72644.1| dUTPase [Lactococcus lactis] (139 aa)
Score = 223, Expect = 3.1e-17, Identities = 52/131 (39%), Positives = 79/131 (60%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RATKHSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y   +DD A+  R GGFGST +
  S:    14 IPERATKHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTIDDDNANGKRTGGFGSTGE 138
>gi|81429296|ref|YP_396297.1| deoxyuridine 5'-triphosphatase [Lactobacillus sakei subsp. sakei 23K] >gi|78610939|emb|CAI55991.1| Deoxyuridine 5'-triphosphatase [Lactobacillus sakei subsp. sakei 23K] (179 aa)
Score = 223, Expect = 3.2e-17, Identities = 59/134 (44%), Positives = 90/134 (67%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVI---------------------------KPKQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-SEIRNGGFGSTNK 162
           ++ LP R+T HSAGYDF    D V+                           +  +T+K   +PTGI+  M +D  L+I  RSS   K  L + N VG+IDSDYY +D NEG IFI++ N +   ++++++KG+   Q IF+ Y + +D+ A +  R GGFGS+ +
  S:    16 NLSLPVRSTAHSAGYDFACAEDFVLPSIWHYNFVRLFRMIRNGKPLVDDDFERASKTLKPFLVPTGIKAYMQDDEYLMIANRSSNPLKKGLVIPNGVGIIDSDYYGNDANEGEIFIQMLNFS--PRDVILRKGERIGQGIFMPYLVADDEVAVTTKRTGGFGSSGR 179
>gi|13786552|ref|NP_112684.1| DUT [Lactococcus phage TP901-1] >gi|23455739|ref|NP_695048.1| dUTPase [Lactococcus phage r1t] >gi|13661695|gb|AAK38038.1|AF304433_21 DUT [Lactococcus lactis bacteriophage TP901-1] >gi|1353537|gb|AAB18695.1| dUTPase [Lactococcus phage r1t] (139 aa)
Score = 223, Expect = 3.3e-17, Identities = 53/138 (38%), Positives = 82/138 (59%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +L  +  +P+RAT+HSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T DD A+  R GGFGST +
  S:     7 KLNENATIPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTNDDNANGKRTGGFGSTGE 138
>gi|13095708|ref|NP_076600.1| dUTPase [Lactococcus phage bIL285] >gi|15673010|ref|NP_267184.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|12723979|gb|AAK05126.1|AE006336_5 prophage pi2 protein 21, deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|12830897|gb|AAK08253.1|AF323668_28 dUTPase [bacteriophage bIL285] (139 aa)
Score = 223, Expect = 3.9e-17, Identities = 52/131 (39%), Positives = 79/131 (60%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RAT+HSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T DD A+  R GGFGST +
  S:    14 IPERATEHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTNDDNANGKRTGGFGSTGE 138
>gi|21716095|ref|NP_663658.1| putative dUTPase [Lactococcus phage ul36] >gi|8248169|gb|AAF74088.1| putative dUTPase [Lactococcus lactis bacteriophage ul36] >gi|21700258|gb|AAM75771.1| putative dUTPase [Lactococcus phage ul36] >gi|89212546|gb|ABD63658.1| putative dUTPase [Lactococcus phage ul36.k1] >gi|89212661|gb|ABD63771.1| putative dUTPase [Lactococcus phage ul36.t1] (139 aa)
Score = 222, Expect = 4.0e-17, Identities = 52/130 (40%), Positives = 79/130 (60%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           P+RATKHSAGYD  +   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:    15 PERATKHSAGYDISSSETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|7239211|gb|AAF43128.1|AF208055_15 Orf139b [bacteriophage phi31.1] >gi|8248150|gb|AAF74070.1| putative dUTPase [Lactococcus lactis] >gi|8248186|gb|AAF74104.1| putative dUTPase [Lactococcus lactis bacteriophage ul36.1] (139 aa)
Score = 221, Expect = 5.4e-17, Identities = 51/131 (38%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RAT+HSAGYD  +   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+  R GGFGST +
  S:    14 IPERATEHSAGYDISSSETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGE 138
>gi|58336683|ref|YP_193268.1| dUTPase [Lactobacillus acidophilus NCFM] >gi|58254000|gb|AAV42237.1| dUTPase [Lactobacillus acidophilus NCFM] (183 aa)
Score = 221, Expect = 5.6e-17, Identities = 67/135 (49%), Positives = 87/135 (64%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVIKP---------------------------KQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-SEIRNGGFGSTNKK 163
           +I LP+R T  SAGYD  A  D+ I                              QT+K   +PTG++  M ED VL++  RSS  FK  L L N +GVID+DYY + +NEG IF+++ N     + L I KGD  AQ IF+ Y  T+DD   S  R  GFGSTN+K
  S:    16 NINLPRRQTLASAGYDIEAAEDITIPSIWRLNFVRIFRLIRNGHQLYERDYEMCDQTLKPILVPTGLKAYMPEDEVLILANRSSNTFKRNLALPNGIGVIDADYYNNPNNEGEIFVQVLN--YGVRPLHIHKGDRIAQGIFIKYLKTDDDDPISRQRVSGFGSTNEK 180
>gi|116512799|ref|YP_811706.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris SK11] >gi|116108453|gb|ABJ73593.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris SK11] (139 aa)
Score = 220, Expect = 7.0e-17, Identities = 52/131 (39%), Positives = 79/131 (60%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P+RATKHSAGYD  A   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ Y  T+DD A+    GGFGST +
  S:    14 IPERATKHSAGYDISASETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKYLKTDDDNANGKHTGGFGSTGE 138
>gi|29374697|ref|NP_813849.1| deoxyuridine 5`-triphosphate nucleotidohydrolase, putative [Enterococcus faecalis V583] >gi|29342155|gb|AAO79921.1| deoxyuridine 5`-triphosphate nucleotidohydrolase, putative [Enterococcus faecalis V583] (159 aa)
Score = 219, Expect = 1.0e-16, Identities = 57/134 (42%), Positives = 83/134 (61%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI----------KPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           + +P+RATK +AGYDF A   +V+          +  + + + TGI+  M +   L ++ RSS   K  L L N VGVIDSDYY ++ NEGHI  +  N   E  ++VI+KG+   Q IF  + + +DDQ    R GGFGS+ +K
  S:    17 LSVPQRATKGAAGYDFQAAETVVVPSLWKLQQAGENPKPILVKTGIKAYMPDSEYLELVSRSSNPLKRFLLLANGVGVIDSDYYNNENNEGHIMFQFLNFGYE--DVVIEKGERIGQGIFKPFLLADDDQVEAERTGGFGSSGQK 159
>gi|184154732|ref|YP_001843072.1| dUTPase [Lactobacillus fermentum IFO 3956] >gi|183226076|dbj|BAG26592.1| dUTPase [Lactobacillus fermentum IFO 3956] (179 aa)
Score = 219, Expect = 1.2e-16, Identities = 61/133 (45%), Positives = 87/133 (65%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI-------------KPKQTVK------------------IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI-RNGGFGSTNK 162
           + LPKR TK +AGYDF A  D  +             K +Q  +                  +PTGI+  M  D VL+++ RSS   K RL L N VG+ID+DYY +  NEG IF++L N     ++  IKKG+  AQ IF+ Y + + ++  +  R+GGFGST +
  S:    16 LTLPKRQTKQAAGYDFAAATDFTLPSIWKGNFIRALYKLRQAKRYLTTEELDRADKSLKPYLVPTGIKAYMQPDEVLILVNRSSGPLKRRLILPNGVGIIDADYYDNPANEGEIFVQLVN--YGLRDYHIKKGERIAQGIFVPYLVADQEEVPQAKRSGGFGSTKQ 179
>gi|28377482|ref|NP_784374.1| trimetaphosphatase [Lactobacillus plantarum WCFS1] >gi|28270314|emb|CAD63215.1| trimetaphosphatase [Lactobacillus plantarum WCFS1] (178 aa)
Score = 216, Expect = 2.2e-16, Identities = 61/133 (45%), Positives = 83/133 (62%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI------------------------------KPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY-GITEDDQASEIRNGGFGSTNK 162
           + +P R TK +AGYDF A  D  +                              K  +   +PTGI+  MNE   LL+  RSS   K  L L N +GVID+DYY +  NEG IF++L N     +++ IKKG+  AQ IF  Y  +T++   +  R+GGFGSTNK
  S:    16 LHVPYRTTKQAAGYDFEAAEDFTLPSIWKMNFIKVLWQIHHGETSSAADLDAAAKVLKPWLVPTGIKAFMNEGEYLLLANRSSNPLKRNLILPNGIGVIDADYYNNPKNEGAIFVQLIN--MGIRDVHIKKGERIAQGIFTPYLTVTDETNVTTTRSGGFGSTNK 178
>gi|125624885|ref|YP_001033368.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris MG1363] >gi|124493693|emb|CAL98681.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactococcus lactis subsp. cremoris MG1363] (139 aa)
Score = 216, Expect = 2.5e-16, Identities = 50/132 (37%), Positives = 80/132 (60%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNKK 163
           +P+RAT+HSAGYD  +   + I+P +   + TG+ V++ +D VL +  RSS   K  + L N+VG+IDSDYY  + +G +F+ ++ +      + I KG    Q +F+ +   +DD A+  R GGFGST +K
  S:    14 IPERATEHSAGYDISSSETVTIQPDEIKMVSTGLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKG-LFMNISKEP-----VTISKGQRIMQGVFVKHLTIDDDNANGKRTGGFGSTGEK 139
>gi|116495777|ref|YP_807511.1| dUTPase [Lactobacillus casei ATCC 334] >gi|191639268|ref|YP_001988434.1| Deoxyuridine 5-triphosphatase [Lactobacillus casei] >gi|116105927|gb|ABJ71069.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus casei ATCC 334] >gi|190713570|emb|CAQ67576.1| Deoxyuridine 5-triphosphatase [Lactobacillus casei BL23] (180 aa)
Score = 216, Expect = 2.6e-16, Identities = 61/133 (45%), Positives = 87/133 (65%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKP---------------------------KQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQAS-EIRNGGFGSTNK 162
           + LP R TK +AGYDF+A  D V++                            K+ +K   +PTGI+  M  + VL++  RSS   K+ L L N +GVID+DYY +  NEG IFI+L N     +++VIKKGD   Q IF+ + + + D+     R  GFGST+K
  S:    17 LTLPTRQTKQAAGYDFYAREDFVLRSIWRYDFIRLFRLIKNEHPLTNKDFERAKKVLKPYLVPTGIKAYMQPNEVLVLANRSSSPLKHGLVLPNGIGVIDADYYNNPANEGEIFIQLLNFF--PRDVVIKKGDRIGQGIFMPFLLADGDEGGLAKRQSGFGSTDK 179
>gi|116333226|ref|YP_794753.1| dUTPase [Lactobacillus brevis ATCC 367] >gi|116098573|gb|ABJ63722.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus brevis ATCC 367] (179 aa)
Score = 214, Expect = 3.7e-16, Identities = 61/133 (45%), Positives = 86/133 (64%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKP---------------------------KQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-SEIRNGGFGSTNK 162
           + LP R TK SAGYDF    D  +                             +  +K   +PTGI+  M    VL++  RSS   K++L L N VGVID+DYY ++ NEG IF++L N     +++VIKKG   AQ IF+ Y   +D+QA  + R GGFGS+++
  S:    16 LTLPYRTTKQSAGYDFECATDFTLPSIWRHDVLHAFKQLRHREALTTDELTAGQHDLKPYLVPTGIKAYMQPGEVLILANRSSNPLKHQLVLPNGVGVIDADYYNNEKNEGEIFVQLLNFG--LRDVVIKKGQRIAQGIFMPYLRVDDEQAPQQERIGGFGSSDR 178
>gi|161506923|ref|YP_001576877.1| dUTPase [Lactobacillus helveticus DPC 4571] >gi|160347912|gb|ABX26586.1| dUTPase [Lactobacillus helveticus DPC 4571] (183 aa)
Score = 213, Expect = 4.5e-16, Identities = 64/134 (47%), Positives = 85/134 (63%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI------------------------------KPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-SEIRNGGFGSTNKK 163
           I LP+R T  SAGYD  A  D+ I                              K  + + +PTG++V M ED VL++  RSS  FK  L L N +GVID+DYY + +NEG +F+++ N       L I KG+  AQ IF+ Y  T+DD   S  R  GFGSTN+K
  S:    17 INLPRRQTIASAGYDIEAAEDITIPSIWRLDFVRIFRLIRNGHQLYQRDFEMADKILKPILVPTGLKVYMPEDEVLILANRSSNTFKRHLSLPNGIGVIDADYYNNPNNEGELFVQMLN--YGVCPLHIHKGERIAQGIFMKYLKTDDDNPISRERLSGFGSTNEK 180
>gi|153198453|ref|ZP_01942469.1| hypothetical protein LMRG_02765 [Listeria monocytogenes 10403S] >gi|127631979|gb|EBA21697.1| hypothetical protein LMRG_02765 [Listeria monocytogenes 10403S] (153 aa)
Score = 213, Expect = 4.8e-16, Identities = 66/162 (40%), Positives = 91/162 (56%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M ED VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTIVPGEKHIFWTDIKSYMQEDEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--PVAIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 153
>gi|170016516|ref|YP_001727435.1| dUTPase [Leuconostoc citreum KM20] >gi|169803373|gb|ACA81991.1| dUTPase [Leuconostoc citreum KM20] (179 aa)
Score = 212, Expect = 7.1e-16, Identities = 62/146 (42%), Positives = 89/146 (60%)
  Q:    17 KSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPK------------------------------QTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI--RNGGFGSTNK 162
           + FE    +  + + LPKR+T+ +AGYDF A  D+VI                                 + V +PTGI+  M E   L ++ RSS   K R+ + N VG++D+DYY +  NEG IF +  N     K++VIKKG+   Q IFL Y + + D  +E   R GGFGST +
  S:     2 RGFEIVSTKNQDDLNLPKRSTEAAAGYDFEASEDVVIPSALSNPFFKGLNILSLGKLKNIRDNEDLQGILKPVLVPTGIKAYMAEGEYLQLVSRSSGPIKKRIMMPNAVGIVDADYYNNPSNEGEIFFQFINFG--VKDVVIKKGERIGQGIFLPYLLADGDDTTEKAQRQGGFGSTGQ 178
>gi|16803731|ref|NP_465216.1| hypothetical protein lmo1691 [Listeria monocytogenes EGD-e] >gi|153174866|ref|ZP_01930317.1| hypothetical protein LMIG_02527 [Listeria monocytogenes FSL N3-165] >gi|153179722|ref|ZP_01932918.1| hypothetical protein LMMG_02331 [Listeria monocytogenes F6900] >gi|153185443|ref|ZP_01936013.1| hypothetical protein LMOG_01952 [Listeria monocytogenes J0161] >gi|153191165|ref|ZP_01938427.1| hypothetical protein LMPG_02278 [Listeria monocytogenes J2818] >gi|16411145|emb|CAC99769.1| lmo1691 [Listeria monocytogenes] >gi|126941801|gb|EBA19678.1| hypothetical protein LMOG_01952 [Listeria monocytogenes J0161] >gi|127765326|gb|EBA25675.1| hypothetical protein LMPG_02278 [Listeria monocytogenes J2818] >gi|133729833|gb|EBA31531.1| hypothetical protein LMIG_02527 [Listeria monocytogenes FSL N3-165] >gi|133732563|gb|EBA34261.1| hypothetical protein LMMG_02331 [Listeria monocytogenes F6900] (153 aa)
Score = 212, Expect = 7.4e-16, Identities = 66/162 (40%), Positives = 91/162 (56%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M ED VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTIVPGEKHIFWTDIKSYMQEDEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--PVSIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 153
>gi|148543537|ref|YP_001270907.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus reuteri F275] >gi|184152943|ref|YP_001841284.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus reuteri F275] >gi|148530571|gb|ABQ82570.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus reuteri F275] >gi|183224287|dbj|BAG24804.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus reuteri F275] (178 aa)
Score = 211, Expect = 9.1e-16, Identities = 62/133 (46%), Positives = 85/133 (63%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI-----------------KPKQTVK-------------IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE-DDQASEIRNGGFGSTNK 162
           I LP+R T  +AGYDF A  D V+                 + K T +             +PTGI+  M  D  LL+  RSS  FK RL L N +G++D+DYY +D NEG IF +L N     ++  IKKG+   Q IF+ Y I + ++Q +  R GGFGST +
  S:    16 IHLPQRQTTRAAGYDFEASEDFVLPSIWKGNFLKALWQIHQQKKLTDEEFKAADSCLKPYLVPTGIKAYMQPDEFLLLANRSSGPFKRRLILPNGIGIVDADYYDNDSNEGEIFFQLIN--YGLRDYHIKKGERIGQGIFMPYLIADGEEQPTAKRTGGFGSTKE 178
>gi|167014894|ref|ZP_02277427.1| dUTPase family protein [Listeria monocytogenes FSL J1-194] >gi|167454269|ref|ZP_02320492.1| dUTPase family protein [Listeria monocytogenes FSL J2-064] (153 aa)
Score = 210, Expect = 1.3e-15, Identities = 65/162 (40%), Positives = 91/162 (56%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M E+ VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTILPGEKHIFWTDIKSYMQEEEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--AVAIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 153
>gi|167217730|ref|ZP_02287366.1| dUTPase family protein [Listeria monocytogenes FSL J1-175] (169 aa)
Score = 209, Expect = 1.6e-15, Identities = 65/162 (40%), Positives = 91/162 (56%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M E+ VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTILPGEKHIFWTDIKSYMQEEEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--AVAIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 153
>gi|114564980|ref|YP_752494.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella frigidimarina NCIMB 400] >gi|122298390|sp|Q07WF9|DUT_SHEFN Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|114336273|gb|ABI73655.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella frigidimarina NCIMB 400] (152 aa)
Score = 208, Expect = 2.0e-15, Identities = 54/141 (38%), Positives = 83/141 (58%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT  SAG D  A  D  +VI+P QTV IPTGI + + + S+  +ILPRS +G K+ + L N VG+IDSDY     +G + +   N +  +K   ++ GD  AQ +F+     ++ + ++  +S+   GGFG +  K
  S:    11 DSRIGNEFPLPAYATPGSAGMDLRAMIDTAMVIEPSQTVLIPTGIAIHVADPSLAAVILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSCWNRS--DKPFTLEIGDRLAQLMFVPVIQATFAVVDEFNSSDRGEGGFGHSGTK 152
>gi|47097403|ref|ZP_00234953.1| dUTPase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|47014226|gb|EAL05209.1| dUTPase family protein [Listeria monocytogenes str. 1/2a F6854] (156 aa)
Score = 208, Expect = 2.1e-15, Identities = 61/151 (40%), Positives = 85/151 (56%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           +NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M ED VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:    12 VNEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTIVPGEKHIFWTDIKSYMQEDEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--PVSIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 156
>gi|116493242|ref|YP_804977.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pediococcus pentosaceus ATCC 25745] >gi|116103392|gb|ABJ68535.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pediococcus pentosaceus ATCC 25745] (177 aa)
Score = 207, Expect = 2.4e-15, Identities = 59/131 (45%), Positives = 86/131 (65%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI---------------KPKQTVK---------------IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASE-IRNGGFGST 160
           + LP+R TK +AGYDF A  D V+               + ++ V                +PTGI+  M +D  L++  RSS   K  L L N VG++D+DYY ++ NEG IF++L N      ++ IKKG+   Q IF+ Y + +++ ASE  R GGFGST
  S:    16 LHLPQRQTKAAAGYDFEAAEDFVLPSIWKLNFVKVLWALRHQENVTDEVLDAARAELKPYLVPTGIKAYMEDDEYLMLANRSSNPLKRSLILPNGVGIVDADYYNNESNEGAIFLQLVN--YGITDVKIKKGERIGQGIFMKYLVADNETASEQKRTGGFGST 176
>gi|116873125|ref|YP_849906.1| dUTPase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742003|emb|CAK21127.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (153 aa)
Score = 207, Expect = 2.7e-15, Identities = 66/162 (40%), Positives = 89/162 (54%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE ++ F  +      +I LP R  K SAGYDFF+   + I P++     T I+  M ED VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +    E  I  G+  AQ IF  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTIAPEEKHIFWTDIKSYMQEDEVLNIHVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSTTPVE--ITAGERVAQGIFQKYLVADTDILANESRVGGIGSTGR 153
>gi|47093786|ref|ZP_00231534.1| dUTPase family protein [Listeria monocytogenes str. 4b H7858] >gi|153167415|ref|ZP_01927606.1| hypothetical protein LMHG_01034 [Listeria monocytogenes FSL N1-017] >gi|47017840|gb|EAL08625.1| dUTPase family protein [Listeria monocytogenes str. 4b H7858] >gi|133726930|gb|EBA28628.1| hypothetical protein LMHG_01034 [Listeria monocytogenes FSL N1-017] (156 aa)
Score = 206, Expect = 3.2e-15, Identities = 60/151 (39%), Positives = 85/151 (56%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           +NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M E+ VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:    12 VNEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTILPGEKHIFWTDIKSYMQEEEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--AVAIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 156
>gi|194468081|ref|ZP_03074067.1| deoxyUTP pyrophosphatase [Lactobacillus reuteri 100-23] >gi|194452934|gb|EDX41832.1| deoxyUTP pyrophosphatase [Lactobacillus reuteri 100-23] (178 aa)
Score = 206, Expect = 3.3e-15, Identities = 62/133 (46%), Positives = 85/133 (63%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI-------------------KP--------KQTVK---IPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE-DDQASEIRNGGFGSTNK 162
           I LP+R T  +AGYDF A  D V+                   KP          ++K   +PTGI+  M  D  LL+  RSS  FK RL L N +G++D+DYY +D NEG IF +L N     ++  IKKG+   Q IF+ Y   + ++Q +  R GGFGST +
  S:    16 IHLPQRQTTRAAGYDFEASEDFVLPSIWKGNFLKALWQIHQQKKPIDEEFKAADSSLKPYLVPTGIKAYMQPDEFLLLANRSSGPFKRRLILPNGIGIVDADYYDNDSNEGEIFFQLIN--YGLRDYHIKKGERIGQGIFMPYLTADSEEQPTAKRTGGFGSTKE 178
>gi|46907922|ref|YP_014311.1| dUTPase family protein [Listeria monocytogenes str. 4b F2365] >gi|153202662|ref|ZP_01944139.1| hypothetical protein LMSG_01934 [Listeria monocytogenes HPB2262] >gi|46881191|gb|AAT04488.1| dUTPase family protein [Listeria monocytogenes str. 4b F2365] >gi|133735099|gb|EBA36797.1| hypothetical protein LMSG_01934 [Listeria monocytogenes HPB2262] (156 aa)
Score = 205, Expect = 3.8e-15, Identities = 60/151 (39%), Positives = 85/151 (56%)
  Q:    12 LNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           +NE ++ F  +      +I LP R  K SAGYDFF+   + I P +     T I+  M E+ VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +NE   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:    12 VNEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETVTILPGEKHIFWTDIKSYMQEEEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNE--AVAIEAGERVAQGVFQKYLVADTDIIANESRVGGVGSTGR 156
>gi|147677614|ref|YP_001211829.1| dUTPase [Pelotomaculum thermopropionicum SI] >gi|146273711|dbj|BAF59460.1| dUTPase [Pelotomaculum thermopropionicum SI] (154 aa)
Score = 205, Expect = 4.4e-15, Identities = 54/135 (40%), Positives = 79/135 (58%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           ++I LP+ AT  SAG D  A  D  L + P   VK+PTGI + +   ++  L+ PRS L  K+ + L N VGVIDSDY     +G I I + N +++  E +IK G+  AQ +F+     +  + E+   S    GGFGST +
  S:    18 DAISLPRYATDGSAGLDLPACLDEPLAVPPGARVKVPTGIAIEIPHRNIAGLVFPRSGLASKHGISLANAVGVIDSDY-----KGEIVIAVFNQSDQ--EYLIKPGERVAQLVFVPVFTATLDVVENLNCSSRGEGGFGSTGR 153
>gi|168266134|ref|ZP_02688099.1| hypothetical protein LmonFSL_10600 [Listeria monocytogenes FSL J2-071] (153 aa)
Score = 203, Expect = 6.8e-15, Identities = 64/162 (39%), Positives = 90/162 (55%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE N+ F  +      +I LP R  K SAGYDFF+   + I   +     T ++  M ED VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N ++E   + I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NETNRKFPGQ------TISLPIRGDKGSAGYDFFSNETVSIAAGEKHIFWTDVKSYMQEDEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSSE--PVTIESGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 153
>gi|16800867|ref|NP_471135.1| hypothetical protein lin1799 [Listeria innocua Clip11262] >gi|16414302|emb|CAC97030.1| lin1799 [Listeria innocua] (153 aa)
Score = 201, Expect = 1.1e-14, Identities = 65/162 (40%), Positives = 90/162 (55%)
  Q:     1 MKIMGKFEKISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYS-DNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDD-QASEIRNGGFGSTNK 162
           MK+ G FE +  NE ++ F  +      +I LP R  K SAGYDFF+     I P +     T I+  M ED VL I  RSS+G K  L L N  G+IDS YY +  N+G+I I + N +++  E  I+ G+  AQ +F  Y + + D  A+E R GG GST +
  S:     1 MKVRG-FEVV--NEASRKFPEQ------TISLPIRGDKGSAGYDFFSNETKTIAPGEKHIFWTDIKSYMQEDEVLNIHVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSSDPVE--IESGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR 153
>gi|89895251|ref|YP_518738.1| hypothetical protein DSY2505 [Desulfitobacterium hafniense Y51] >gi|109645598|ref|ZP_01369518.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Desulfitobacterium hafniense DCB-2] >gi|122482386|sp|Q24UJ8|DUT_DESHY Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|89334699|dbj|BAE84294.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109643547|gb|EAT53100.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Desulfitobacterium hafniense DCB-2] (151 aa)
Score = 201, Expect = 1.1e-14, Identities = 59/130 (45%), Positives = 72/130 (55%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSV-LLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE---DDQASEIRN--GGFGST 160
           +LP+ AT  +AG D  A  D  L I+P Q VKIPTG+ + +    V   +  RS L  KY L L N VGVIDSDY      G I + + N  +E    V+K GD  AQ +FL   I E    DQ  E     GGFGST
  S:    18 KLPQYATPGAAGVDLQASLDQELTIEPGQIVKIPTGLAIELPHAGVGAFVFARSGLASKYGLALANGVGVIDSDY-----RGEILVAVINQGSE--PFVVKDGDRIAQMVFLPVFIGEFYLADQLDETGRGCGGFGST 148
>gi|116617308|ref|YP_817679.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096155|gb|ABJ61306.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (179 aa)
Score = 201, Expect = 1.2e-14, Identities = 60/134 (44%), Positives = 83/134 (61%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVIKPK------------------------------QTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI--RNGGFGSTNK 162
           +I +PKR+T+ +AGYDF A  D+ I                                 + V IPTGI+  M E   L ++ RSS   K R+ + N VG++D+DYY ++ NEG IF +  N     K+  IKKG+   Q IFL Y + + D A E   R GGFGST +
  S:    15 NITVPKRSTQQAAGYDFEAAVDITIPSVLSNNFFKGLNILSLGKLSKLRDNEDLQDMLKPVLIPTGIKAYMGEGEYLQLVSRSSGPIKKRIMMPNAVGIVDADYYNNEGNEGEIFFQFINFG--LKDAHIKKGERIGQGIFLPYLLADGDDAVEKSDRKGGFGSTGQ 179
>gi|119943851|ref|YP_941531.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Psychromonas ingrahamii 37] >gi|166918328|sp|A1SR17|DUT_PSYIN Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|119862455|gb|ABM01932.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychromonas ingrahamii 37] (151 aa)
Score = 199, Expect = 2.0e-14, Identities = 54/131 (41%), Positives = 80/131 (61%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP+ AT  SAG D  A  D  L+IKP +T  IPTGI + +++  +   ILPRS LG K+ + L N VG+IDSDY     +G + +   N + E+  L  + G+  AQ +FL     ++ I ++ ++SE   GGFG + K
  S:    19 LPEHATAGSAGMDLRACIDQALIIKPGETQLIPTGIAIHISDPGLAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSTESFRL--EPGERLAQLVFLPVVQATFEIVDEFKSSERGEGGFGHSGK 150
>gi|165977411|ref|YP_001653004.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190151325|ref|YP_001969850.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165877512|gb|ABY70560.1| deoxyuridinetriphosphatase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916456|gb|ACE62708.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (151 aa)
Score = 198, Expect = 2.6e-14, Identities = 56/141 (39%), Positives = 81/141 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  +  L + P QTV IPTGI + + + ++  +ILPRS LG K  + L N VG+IDSDY     +G + + L N +  +K   ++ GD  AQ +F+     S+ I  D   +E   GGFG + K+
  S:    10 DGRIGNEFPLPAYATEGSAGLDLRALTESALTVAPGQTVLIPTGISIYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGPLMVSLWNRS--DKPFTVEVGDRIAQLVFVPVVQASFNIVNDFAQTERGEGGFGHSGKQ 151
>gi|42518490|ref|NP_964420.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus johnsonii NCC 533] >gi|41582775|gb|AAS08386.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus johnsonii NCC 533] (183 aa)
Score = 197, Expect = 3.3e-14, Identities = 59/134 (44%), Positives = 80/134 (59%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI------------------------------KPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY-GITEDDQASEIRNGGFGSTNKK 163
           + LP+R T  SAGYDF    D+V+                              K  +   +PTGI+  M ED VL++  RSS  +K  + L N +GVIDSDYY ++ NEG I+ +L N     + L IKKG+   Q IF+ Y     DD     R GGFGS+  +
  S:    17 LHLPQRQTIASAGYDFECAQDIVLPSIWCMNFVRIFRLIRNGHELNEHDLELAEKVLKPFLVPTGIKAYMPEDEVLILANRSSNTYKRNVTLPNGIGVIDSDYYNNEKNEGEIYFQLIN--YGVRPLKIKKGERIGQGIFMPYLKADNDDPVQRQRLGGFGSSGTR 180
>gi|183597214|ref|ZP_02958707.1| hypothetical protein PROSTU_00457 [Providencia stuartii ATCC 25827] >gi|188023528|gb|EDU61568.1| hypothetical protein PROSTU_00457 [Providencia stuartii ATCC 25827] (151 aa)
Score = 197, Expect = 4.0e-14, Identities = 55/141 (39%), Positives = 79/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA----PYDLVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT  SAG D  A    P DL   P QT  IPTG+ + + +E    +ILPRS LG K+ + L N VG+IDSDY     +G + + + N  N+     I+ G+  AQ +F+      + I +D  A+E   GGFG + ++
  S:    10 DPRIGNEFPLPTYATSGSAGLDLRACLDAPIDLA--PGQTELIPTGLAIHIADEQLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWNRGNQT--FTIEPGERMAQMVFVPVVQAEFNIVDDFDATERGAGGFGHSGRQ 151
>gi|145628109|ref|ZP_01783910.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 22.1-21] >gi|144979884|gb|EDJ89543.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 22.1-21] (151 aa)
Score = 196, Expect = 5.3e-14, Identities = 56/141 (39%), Positives = 81/141 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D    I+P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N  NE     I+ GD  AQ +F+      + I ED Q +E   GGFG + K+
  S:    10 DSRIGNEFPLPTYATEGSAGLDLRALIDESFEIQPDETKLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSMWNRGNE--PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEGGFGHSGKQ 151
>gi|116629007|ref|YP_814179.1| dUTPase [Lactobacillus gasseri ATCC 33323] >gi|116094589|gb|ABJ59741.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Lactobacillus gasseri ATCC 33323] (183 aa)
Score = 195, Expect = 5.5e-14, Identities = 58/134 (43%), Positives = 82/134 (61%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVI------------------------------KPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQ-ASEIRNGGFGSTNKK 163
           + LP+R T  SAGYDF    D+V+                              K  +   +PTGI+  M ED VL++  RSS  +K  + L N +GVIDSDYY ++ NEG I+ +L N     + L IKKG+   Q IF+ Y   ++D+     R GGFGS+  +
  S:    17 LHLPQRQTIASAGYDFECAQDIVLPSIWCTNFVRIFRLIRNSHELNERDLELAEKVLKPFLVPTGIKAYMPEDEVLILANRSSNTYKRNVTLPNGIGVIDSDYYNNEKNEGEIYFQLIN--YGVRPLKIKKGERIGQGIFMPYLKADNDEPVQRQRLGGFGSSGTR 180
>gi|16272892|ref|NP_439115.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae Rd KW20] >gi|42631278|ref|ZP_00156816.1| COG0756: dUTPase [Haemophilus influenzae R2866] >gi|68249542|ref|YP_248654.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 86-028NP] >gi|145637259|ref|ZP_01792920.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittHH] >gi|145638223|ref|ZP_01793833.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittII] >gi|145640622|ref|ZP_01796205.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae R3021] >gi|148826395|ref|YP_001291148.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittEE] >gi|148828131|ref|YP_001292884.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittGG] >gi|166217622|sp|A5UDB4|DUT_HAEIE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217623|sp|A5UI95|DUT_HAEIG Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|1169438|sp|P43792|DUT_HAEIN Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|81336031|sp|Q4QLV3|DUT_HAEI8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|1573979|gb|AAC22615.1| deoxyuridinetriphosphatase (dut) [Haemophilus influenzae Rd KW20] >gi|68057741|gb|AAX87994.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 86-028NP] >gi|145269511|gb|EDK09453.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittHH] >gi|145272552|gb|EDK12459.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittII] >gi|145274548|gb|EDK14411.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 22.4-21] >gi|148716555|gb|ABQ98765.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittEE] >gi|148719373|gb|ABR00501.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittGG] (151 aa)
Score = 195, Expect = 5.8e-14, Identities = 56/141 (39%), Positives = 81/141 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D    I+P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N  NE     I+ GD  AQ +F+      + I ED Q +E   GGFG + K+
  S:    10 DSRIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSMWNRGNE--PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEGGFGHSGKQ 151
>gi|145630050|ref|ZP_01785832.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 22.4-21] >gi|144984331|gb|EDJ91754.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae R3021] (151 aa)
Score = 194, Expect = 7.9e-14, Identities = 56/141 (39%), Positives = 81/141 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D    I+P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N  NE     I+ GD  AQ +F+      + I ED Q +E   GGFG + K+
  S:    10 DSRIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSMWNRGNE--PFNIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEGGFGHSGKQ 151
>gi|145632340|ref|ZP_01788075.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 3655] >gi|145634130|ref|ZP_01789841.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittAA] >gi|144987247|gb|EDJ93777.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae 3655] >gi|145268574|gb|EDK08567.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus influenzae PittAA] (150 aa)
Score = 194, Expect = 8.3e-14, Identities = 56/140 (40%), Positives = 80/140 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + N   LP  AT+ SAG D  A  D    I+P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N  NE     I+ GD  AQ +F+      + I ED Q +E   GGFG + K
  S:    10 DSRIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSMWNRGNE--PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEGGFGHSGK 150
>gi|32034056|ref|ZP_00134300.1| COG0756: dUTPase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209422|ref|YP_001054647.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Actinobacillus pleuropneumoniae L20] >gi|189027730|sp|A3N3Q6|DUT_ACTP2 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|126098214|gb|ABN75042.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [Actinobacillus pleuropneumoniae L20] (151 aa)
Score = 193, Expect = 1.0e-13, Identities = 55/141 (39%), Positives = 80/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  +  L + P QTV IPTGI + + + ++  +ILPRS LG K  + L N VG+IDSDY     +G + + L N +  +K   ++ GD  AQ +F+      + I  D   +E   GGFG + K+
  S:    10 DGRIGNEFPLPAYATEGSAGLDLRALTESALTVAPGQTVLIPTGISIYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGPLMVSLWNRS--DKPFTVEVGDRIAQLVFVPVVQARFNIVNDFAQTERGEGGFGHSGKQ 151
>gi|167622367|ref|YP_001672661.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella halifaxensis HAW-EB4] >gi|189027750|sp|B0TQK9|DUT_SHEHH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|167352389|gb|ABZ75002.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella halifaxensis HAW-EB4] (152 aa)
Score = 193, Expect = 1.2e-13, Identities = 55/141 (39%), Positives = 79/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  D  LVI+P +TV IPTGI + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N  +E     I+ GD  AQ +F+      + + ++   S+   GGFG +  K
  S:    11 DSRIGTEFPLPAYATPGSAGMDLRAITDTQLVIQPGETVLIPTGIAIHVADPSLAAIILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGSE--PFTIEIGDRLAQLVFVPVVQAEFKLVDEFNQSDRGTGGFGHSGTK 152
>gi|157963650|ref|YP_001503684.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella pealeana ATCC 700345] >gi|189027751|sp|A8H9B2|DUT_SHEPA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157848650|gb|ABV89149.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella pealeana ATCC 700345] (152 aa)
Score = 191, Expect = 1.8e-13, Identities = 55/141 (39%), Positives = 79/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  D  LVI+P +TV IPTGI + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N  +E     I+ GD  AQ +F+      + + ++   S+   GGFG +  K
  S:    11 DSRIGTEFPLPAYATPGSAGMDLRAITDTQLVIQPGETVLIPTGIAIHVADPSLAAIILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGSE--PFTIEIGDRLAQLVFVPVVQAEFKLVDEFNQSDRGAGGFGHSGTK 152
>gi|22124014|ref|NP_667437.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis KIM] >gi|45439913|ref|NP_991452.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Microtus str. 91001] >gi|21956756|gb|AAM83688.1|AE013609_13 deoxyuridinetriphosphatase [Yersinia pestis KIM] >gi|45434768|gb|AAS60329.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Microtus str. 91001] (156 aa)
Score = 190, Expect = 2.5e-13, Identities = 50/141 (35%), Positives = 80/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D  + ++P QT  +PTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   SE   GGFG + ++
  S:    15 DPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ 156
>gi|16120400|ref|NP_403713.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis CO92] >gi|51594402|ref|YP_068593.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pseudotuberculosis IP 32953] >gi|150260889|ref|ZP_01917617.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis CA88-4125] >gi|153949654|ref|YP_001399060.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pseudotuberculosis IP 31758] >gi|162419944|ref|YP_001604693.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Angola] >gi|165926111|ref|ZP_02221943.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936135|ref|ZP_02224704.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Orientalis str. IP275] >gi|166011436|ref|ZP_02232334.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213714|ref|ZP_02239749.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402097|ref|ZP_02307574.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419027|ref|ZP_02310780.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426677|ref|ZP_02318430.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|166918331|sp|A7FCT2|DUT_YERP3 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|22095596|sp|Q8ZJP5|DUT_YERPE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|61212382|sp|Q66GD8|DUT_YERPS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|51587684|emb|CAH19284.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pseudotuberculosis IP 32953] >gi|115345879|emb|CAL18737.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis CO92] >gi|149290297|gb|EDM40374.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis CA88-4125] >gi|152961149|gb|ABS48610.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pseudotuberculosis IP 31758] >gi|162352759|gb|ABX86707.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Angola] >gi|165915749|gb|EDR34357.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Orientalis str. IP275] >gi|165921971|gb|EDR39148.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989582|gb|EDR41883.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205116|gb|EDR49596.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963021|gb|EDR59042.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048472|gb|EDR59880.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054366|gb|EDR64183.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis biovar Mediaevalis str. K1973002] (151 aa)
Score = 190, Expect = 2.5e-13, Identities = 50/141 (35%), Positives = 80/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D  + ++P QT  +PTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   SE   GGFG + ++
  S:    10 DPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ 151
>gi|108809486|ref|YP_653402.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Antiqua] >gi|108813963|ref|YP_649730.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Nepal516] >gi|145601098|ref|YP_001165174.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Pestoides F] >gi|170026364|ref|YP_001722869.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Yersinia pseudotuberculosis YPIII] >gi|186893390|ref|YP_001870502.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Yersinia pseudotuberculosis PB1/+] >gi|108777611|gb|ABG20130.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Nepal516] >gi|108781399|gb|ABG15457.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Antiqua] >gi|145212794|gb|ABP42201.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia pestis Pestoides F] >gi|169752898|gb|ACA70416.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Yersinia pseudotuberculosis YPIII] >gi|186696416|gb|ACC87045.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Yersinia pseudotuberculosis PB1/+] (152 aa)
Score = 190, Expect = 2.5e-13, Identities = 50/141 (35%), Positives = 80/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D  + ++P QT  +PTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   SE   GGFG + ++
  S:    11 DPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ 152
>gi|90581386|ref|ZP_01237181.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Vibrio angustum S14] >gi|90437363|gb|EAS62559.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Vibrio angustum S14] (151 aa)
Score = 189, Expect = 2.9e-13, Identities = 51/140 (36%), Positives = 77/140 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + N   LP  AT+ SAG D  A  D  L + P +T  +PTG+ + + + S+   ILPRS LG K+ + L N VG+IDSDY     +G + + + N         I+ GD  AQ +FL      + I +D  +++   GGFG + +
  S:    10 DPRVGNEFPLPAYATEGSAGLDLRACLDEALTVAPGETHLVPTGLAIHIGDSSLAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWN--RGETTFTIEPGDRIAQLVFLPVIQAQFNIVDDFDSTDRGEGGFGHSGR 150
>gi|37528676|ref|NP_932021.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|46576245|sp|Q7MAX3|DUT_PHOLL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|36788115|emb|CAE17239.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Photorhabdus luminescens subsp. laumondii TTO1] (152 aa)
Score = 189, Expect = 3.0e-13, Identities = 49/132 (37%), Positives = 78/132 (59%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P QT  +PTG+ + + ++ +  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N    +K   I+ G+  AQ +F+      + + ED + SE  +GGFG + ++
  S:    20 LPTYATPGSAGLDLRACLDNAVELAPGQTELLPTGLAIHIGDEQLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN--RGDKAFTIQPGERIAQIVFVPVVQAEFNLVEDFETSERGSGGFGHSGRQ 152
>gi|91784977|ref|YP_560183.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia xenovorans LB400] >gi|123358507|sp|Q13UV8|DUT_BURXL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91688931|gb|ABE32131.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia xenovorans LB400] (148 aa)
Score = 188, Expect = 3.7e-13, Identities = 53/132 (40%), Positives = 72/132 (54%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A  D  L +KP +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N        V+   +  AQ + +      + I +D + SE   GGFGST K
  S:    15 QLPAYATTGSAGLDLRACLDEPLTLKPGETALVPTGLAIHVGDPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISTWN--RGETTFVLNPMERLAQLVIVPVVQAEFNIVDDFETSERGAGGFGSTGK 147
>gi|94499763|ref|ZP_01306299.1| dUTPase [Oceanobacter sp. RED65] >gi|94427964|gb|EAT12938.1| dUTPase [Oceanobacter sp. RED65] (152 aa)
Score = 188, Expect = 4.0e-13, Identities = 54/146 (36%), Positives = 86/146 (58%)
  Q:    17 KSFENK--DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           KSF+ K  D  L N I +P   T+ SAG D  A    ++ I+P +T  IPTG+ + + ++ +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N +N +    ++ G+  AQ + +      +   E+ +A++   GGFGST K
  S:     3 KSFQVKILDNRLGNDIPMPSYGTEGSAGLDLRACLEENITIEPGETKLIPTGMSIYIEDNGLAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWNRSNTS--FTMEVGERIAQLVIVPVVQAEFDFVEEFEATDRGEGGFGSTGK 151
>gi|194684455|emb|CAR46198.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Proteus mirabilis HI4320] (151 aa)
Score = 188, Expect = 4.4e-13, Identities = 51/132 (38%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  LV+ P QT  +PTG+ V + +E    ++LPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ + +      + I ED  A+E   GGFG + ++
  S:    19 LPAYATTGSAGLDLRACLDAPLVLAPGQTELLPTGLAVHIADEGLAAMVLPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQAFTIEPGERIAQMVIVPVVQAEFNIVEDFTATERGTGGFGHSGRQ 151
>gi|46129100|ref|ZP_00155752.2| COG0756: dUTPase [Haemophilus influenzae R2846] (151 aa)
Score = 187, Expect = 4.7e-13, Identities = 55/141 (39%), Positives = 80/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D    I+P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N  NE     I+ GD  AQ +F+      + I ED Q +E    GFG + K+
  S:    10 DSRIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSMWNRGNE--PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEDGFGHSGKQ 151
>gi|78486245|ref|YP_392170.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Thiomicrospira crunogena XCL-2] >gi|91206615|sp|Q31EC7|DUT_THICR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|78364531|gb|ABB42496.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Thiomicrospira crunogena XCL-2] (153 aa)
Score = 187, Expect = 5.7e-13, Identities = 51/138 (36%), Positives = 78/138 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY------GITEDDQASEIRNGGFGST 160
           D  L   I++P   TK SAG D  A    D++I+P QTV IPTG+ + +++  +  ++LPRS LG K+ + L N VG+IDSDY     +G + +   N + E   + +  G+  AQ + +         + E   A+E   GGFG T
  S:    11 DPRLGKEIEMPHYGTKGSAGLDLRACIENDMIIEPGQTVLIPTGMAIHLDDPGLAAMLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSEEAYNVTV--GERIAQMVIVPVLQPVFTQVEEFGDATERGEGGFGHT 150
>gi|77958458|ref|ZP_00822491.1| COG0756: dUTPase [Yersinia bercovieri ATCC 43970] (152 aa)
Score = 187, Expect = 5.7e-13, Identities = 50/141 (35%), Positives = 79/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D  +   P QT  +PTG+ + + ++++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   SE   GGFG + ++
  S:    11 DPRVGNEFPLPTYATEGSAGLDLRACLDESVNLLPGQTTLLPTGLAIHIADNALAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFDLSERGTGGFGHSGRQ 152
>gi|77961979|ref|ZP_00825806.1| COG0756: dUTPase [Yersinia mollaretii ATCC 43969] (152 aa)
Score = 187, Expect = 6.0e-13, Identities = 49/141 (34%), Positives = 79/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  D  +   P QT  +PTG+ + + ++++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   +E   GGFG + ++
  S:    11 DPRVGNEFPLPTYATEGSAGLDLRACLDKAVDLLPGQTTLLPTGLAIHIGDNALAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFDLTERGTGGFGHSGRQ 152
>gi|83643897|ref|YP_432332.1| dUTPase [Hahella chejuensis KCTC 2396] >gi|123726460|sp|Q2SN67|DUT_HAHCH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|83631940|gb|ABC27907.1| dUTPase [Hahella chejuensis KCTC 2396] (152 aa)
Score = 186, Expect = 6.1e-13, Identities = 53/141 (37%), Positives = 76/141 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNKK 163
           D  L N I LP  AT  SAG D  A     + ++P +T  IPTG+ + +++  +  ++LPRS LG K+ + L N VG+IDSDY     +G + +   N  NE     I  G+  AQ +      + + I +D   S    GGFGST  K
  S:    11 DKRLGNEIPLPAYATDGSAGLDLRACLAEPVTLQPGETTLIPTGMAIHLSDPGLAAMLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGEVMVSCWNRGNE--AFTISVGERIAQMVIVPVVQVGFEIVDDFDDSSRGAGGFGSTGTK 152
>gi|91213157|ref|YP_543143.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli UTI89] >gi|117625912|ref|YP_859235.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli APEC O1] >gi|122421885|sp|Q1R4V2|DUT_ECOUT Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166918321|sp|A1AHH1|DUT_ECOK1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91074731|gb|ABE09612.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli UTI89] >gi|115515036|gb|ABJ03111.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli APEC O1] (152 aa)
Score = 186, Expect = 7.4e-13, Identities = 49/132 (37%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   +N    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    20 LPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDN--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 152
>gi|53803059|ref|YP_115179.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylococcus capsulatus str. Bath] >gi|61212362|sp|Q603M1|DUT_METCA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|53756820|gb|AAU91111.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Methylococcus capsulatus str. Bath] (151 aa)
Score = 186, Expect = 7.8e-13, Identities = 54/140 (38%), Positives = 76/140 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNE-DSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           D  L N I LP  AT  +AG D  A  D  LV++P +T  IPTG  + + + D   ++LPRS LG K+ + L N VG+IDSDY     +G + +   N   E  E+ +  G+  AQ +F     +S+   E    S    GGFG T +
  S:    10 DSRLGNEIPLPHYATPGAAGLDLRACLDASLVLQPGETRLIPTGFAIHIGDPDLAAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQVLVSCWNRGPEPFEIAV--GERIAQMVFVPVVQVSFEQVEAFAESRRAEGGFGHTGR 150
>gi|119773466|ref|YP_926206.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella amazonensis SB2B] >gi|166218221|sp|A1S2D0|DUT_SHEAM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|119765966|gb|ABL98536.1| dUTP diphosphatase [Shewanella amazonensis SB2B] (152 aa)
Score = 185, Expect = 8.3e-13, Identities = 55/141 (39%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  L I P +TV IPTGI V + + S+  +ILPRS +G K+ + L N VG+IDSDY     +G + +   N  NE   L I  GD  AQ +F+      + + ++   S    GGFG +  +
  S:    11 DSRIGSEFPLPAYATPGSAGMDLRAMLDTNLTIAPGETVLIPTGIAVHVADPSLAAVILPRSGMGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGNEPYTLQI--GDRLAQLVFVPVVQAEFKLVDEFDTSMRGEGGFGHSGTR 152
>gi|91774669|ref|YP_544425.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylobacillus flagellatus KT] >gi|91708656|gb|ABE48584.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylobacillus flagellatus KT] (150 aa)
Score = 185, Expect = 9.2e-13, Identities = 50/132 (37%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A   +   + P +T+ IPTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N   E+   ++   +  AQ + +     ++ I +D QASE   GGFGST ++
  S:    18 LPSYATPGSAGLDLRACTEHTQTLAPGETIMIPTGMAIHLADPHYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLLVSCWNRGKES--FILNPLERIAQLVIVPVMQANFNIVDDFQASERGTGGFGSTGRQ 150
>gi|187925137|ref|YP_001896779.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia phytofirmans PsJN] >gi|187716331|gb|ACD17555.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia phytofirmans PsJN] (148 aa)
Score = 184, Expect = 1.1e-12, Identities = 52/132 (39%), Positives = 72/132 (54%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A  D  L +KP +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N        V+   +  AQ + +      + I +D + S+   GGFGST K
  S:    15 QLPAYATTGSAGLDLRACLDEALTLKPGETALVPTGLAIHVGDAGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISTWN--RGETTFVLNPMERLAQLVIVPVVQAEFNIVDDFETSDRGAGGFGSTGK 147
>gi|33596594|ref|NP_884237.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella parapertussis 12822] >gi|33601147|ref|NP_888707.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella bronchiseptica RB50] >gi|48427884|sp|Q7W8Z8|DUT_BORPA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|48427885|sp|Q7WKE3|DUT_BORBR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|33573295|emb|CAE37276.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella parapertussis] >gi|33575582|emb|CAE32660.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella bronchiseptica RB50] (149 aa)
Score = 184, Expect = 1.1e-12, Identities = 51/131 (38%), Positives = 74/131 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  +  LVI+P QTV +PTG+ + + +     +ILPRS LG K+ + L N VG+IDSDY     +G + +   N     +   +   +  AQ +      +++ + ED  ASE   GGFGST +
  S:    17 LPAYATPGSAGLDLRACTEASLVIEPGQTVLVPTGLAIHIGDPRYAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGTQPFTLDPMERLAQLVIVPVQQVAFNVVEDFDASERGAGGFGSTGR 148
>gi|33593561|ref|NP_881205.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella pertussis Tohama I] >gi|48427883|sp|Q7VVR1|DUT_BORPE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|33572917|emb|CAE42853.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella pertussis Tohama I] (149 aa)
Score = 184, Expect = 1.1e-12, Identities = 51/131 (38%), Positives = 74/131 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  +  LVI+P QTV +PTG+ + + +     +ILPRS LG K+ + L N VG+IDSDY     +G + +   N     +   +   +  AQ +      +++ + ED  ASE   GGFGST +
  S:    17 LPAYATPGSAGLDLRACTEASLVIEPGQTVLVPTGLAIHIGDPRYAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGTQPFTLDPMERLAQLVIVPVQQVAFNVVEDFDASERGAGGFGSTGR 148
>gi|189424900|ref|YP_001952077.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacter lovleyi SZ] >gi|189421159|gb|ACD95557.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacter lovleyi SZ] (154 aa)
Score = 184, Expect = 1.2e-12, Identities = 52/135 (38%), Positives = 78/135 (57%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLIL-PRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY------GITEDDQASEIRNGGFGSTNK 162
           +SI LP+ AT  SA  D  A  D  + + P +TV IP+GI + +++ +++ IL PRS LG K+ + L NT+GVIDSDY     +G I I + N  ++     I+ G+   Q +F+         + E  + S    GGFG T K
  S:    17 SSIPLPQYATDGSAALDLRACLDEAVAVAPGETVTIPSGIAISIHDPNLVAILAPRSGLGIKHGIVLANTIGVIDSDY-----QGEIKIGIRNQGSQTYN--IQPGERVCQMLFMPVVQACLRVVEEFSEESARGTGGFGHTGK 153
>gi|123440461|ref|YP_001004455.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166218230|sp|A1JHX0|DUT_YERE8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|122087422|emb|CAL10203.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] (151 aa)
Score = 184, Expect = 1.3e-12, Identities = 50/141 (35%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A     +   P QT  +PTG+ + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   SE   GGFG + ++
  S:    10 DPRVGNEFPLPTYATEGSAGLDLRACLSEAVDLLPGQTTLLPTGLAIHIGDSSLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVIQAEFNLVEDFDLSERGTGGFGHSGRQ 151
>gi|167585703|ref|ZP_02378091.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia ubonensis Bu] (148 aa)
Score = 183, Expect = 1.4e-12, Identities = 52/131 (39%), Positives = 72/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  L +KP +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E V+   +  AQ + +      + I +D  AS+   GGFGST +
  S:    16 LPAYATTGSAGLDLRACLDAPLTLKPGETALVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAASDRGAGGFGSTGR 147
>gi|33151904|ref|NP_873257.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus ducreyi 35000HP] >gi|48427881|sp|Q7VN49|DUT_HAEDU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|33148125|gb|AAP95646.1| deoxyuridinetriphosphatase [Haemophilus ducreyi 35000HP] (152 aa)
Score = 183, Expect = 1.5e-12, Identities = 53/132 (40%), Positives = 77/132 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  + ++  QTV IPTGI V + + ++  +ILPRS LG K  + L N VG+IDSDY     +G + + + N +  +K   I+ GD  AQ +F+     S+ I  D + +    GGFG + K+
  S:    20 LPTYATTGSAGLDLRALIDSAITVEAGQTVLIPTGISVYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGPLMVSIWNRS--DKPFTIEVGDRIAQLVFVPVVQASFNIVTDFEQTSRGEGGFGHSGKQ 152
>gi|77972441|ref|ZP_00828007.1| COG0756: dUTPase [Yersinia frederiksenii ATCC 33641] (152 aa)
Score = 183, Expect = 1.5e-12, Identities = 49/141 (34%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A     +   P QT  +PTG+ + + ++++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ G+  AQ +F+      + + ED   SE   GGFG + ++
  S:    11 DPRVGNEFPLPTYATEGSAGLDLRACLSEAVDLLPGQTTLLPTGLAIHIGDNALAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWN--RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFDLSERGTGGFGHSGRQ 152
>gi|117620912|ref|YP_854691.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166217601|sp|A0KEM6|DUT_AERHH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|117562319|gb|ABK39267.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (152 aa)
Score = 183, Expect = 1.6e-12, Identities = 49/141 (34%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  D  L + P  T  +PTG+ + + +  +   ILPRS LG K+ + L N VG+IDSDY     +G + + + N  N+N    ++ G+  AQ + +     S+ + ++   SE   GGFGS+ ++
  S:    11 DARIGTEYPLPAYATPGSAGMDLRALLDAPLTLAPGDTTLVPTGLAIHIQDPGLCATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWNRGNDN--FTMQPGERIAQLVIMPVVQASFQLVDEFNQSERGEGGFGSSGRQ 152
>gi|15603019|ref|NP_246091.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431440|sp|P57914|DUT_PASMU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|12721502|gb|AAK03238.1| Dut [Pasteurella multocida subsp. multocida str. Pm70] (151 aa)
Score = 183, Expect = 1.6e-12, Identities = 50/132 (37%), Positives = 77/132 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT+ SAG D  A  D  + ++  QTV IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + L N + E     ++ GD  AQ +F+      + +  D   +E   GGFG + K+
  S:    19 LPTYATEGSAGLDLRALIDAPMTVEAGQTVLIPTGLSLYIADPTLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSLWNRSTE--PFKVEVGDRIAQLVFVPVVQAEFNVVSDFAQTERGEGGFGHSGKQ 151
>gi|127514411|ref|YP_001095608.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella loihica PV-4] >gi|166218224|sp|A3QIQ1|DUT_SHELP Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|126639706|gb|ABO25349.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella loihica PV-4] (152 aa)
Score = 183, Expect = 1.7e-12, Identities = 53/141 (37%), Positives = 80/141 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  +  +VI+P +T  IPTGI V + + S+  +ILPRS +G K+ + L N VG+IDSDY     +G + +   N +NE   L I  GD  AQ +F+      + + ++   S+   GGFG +  +
  S:    11 DSRIGSQFPLPAYATPGSAGMDLRAMIETTMVIQPGETQLIPTGIAVHVADPSLAAVILPRSGMGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSNEPFTLEI--GDRLAQLVFVPVVQAEFKLVDEFDTSDRGEGGFGHSGTQ 152
>gi|186475337|ref|YP_001856807.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia phymatum STM815] >gi|184191796|gb|ACC69761.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia phymatum STM815] (148 aa)
Score = 183, Expect = 1.7e-12, Identities = 51/132 (38%), Positives = 72/132 (54%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A  D  L ++P QTV +PTG+ + + +     LILPRS +G K+ + L N VG+IDSDY     +G + I   N         +   +  AQ + +     ++ I ++   SE   GGFGST K
  S:    15 QLPAYATTGSAGLDLRACLDAPLTLEPGQTVLVPTGLAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMISTWN--RGTTTFTLNPMERLAQLVIVPVVQATFNIVDEFDTSERGEGGFGSTGK 147
>gi|167835729|ref|ZP_02462612.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia thailandensis MSMB43] (148 aa)
Score = 182, Expect = 2.0e-12, Identities = 51/131 (38%), Positives = 72/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LPK AT  SAG D  A  D  + +KP  T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E V+   +  AQ + +     ++ + +D   SE   GGFGST +
  S:    16 LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGHAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGQTEFVLNPFERLAQLVIVPVVQATFNVVDDFAQSERGAGGFGSTGR 147
>gi|126172627|ref|YP_001048776.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella baltica OS155] >gi|166218222|sp|A3CZJ4|DUT_SHEB5 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|125995832|gb|ABN59907.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella baltica OS155] (152 aa)
Score = 181, Expect = 2.3e-12, Identities = 53/141 (37%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  L I P +TV IPTGI + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N ++    L I  GD  AQ +F+      + + ++  +S+   GGFG +  K
  S:    11 DSRIGSEFPLPAYATPGSAGMDLRAMIDTTLTIAPGETVLIPTGIAIHVADQGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSDSPFALEI--GDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK 152
>gi|167561851|ref|ZP_02354767.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia oklahomensis EO147] >gi|167569074|ref|ZP_02361948.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia oklahomensis C6786] (148 aa)
Score = 181, Expect = 2.3e-12, Identities = 51/131 (38%), Positives = 72/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LPK AT  SAG D  A  D  + +KP  T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E V+   +  AQ + +     ++ + +D   SE   GGFGST +
  S:    16 LPKYATTGSAGLDLRACLDAPITLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGQTEFVLNPFERLAQLVIVPVVQAAFNLVDDFAQSERGAGGFGSTGR 147
>gi|134094082|ref|YP_001099157.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Herminiimonas arsenicoxydans] >gi|166918324|sp|A4G3E3|DUT_HERAR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|133737985|emb|CAL61030.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Herminiimonas arsenicoxydans] (149 aa)
Score = 181, Expect = 2.5e-12, Identities = 51/132 (38%), Positives = 73/132 (55%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           Q+P  AT  SAG D  A  +  + IKP +T  IPTG+ + + N     +ILPRS +G K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ +      + + I +D  +SE   GGFGST K
  S:    16 QMPAYATSGSAGLDLRACIEAPITIKPGETHLIPTGLAIHIGNPAYAAVILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQAEFVLNPMERLAQLVIVPVLQVGFNIVDDFDSSERGAGGFGSTGK 148
>gi|146309766|ref|YP_001174840.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Enterobacter sp. 638] >gi|166918322|sp|A4W509|DUT_ENT38 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|145316642|gb|ABP58789.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Enterobacter sp. 638] (152 aa)
Score = 181, Expect = 2.5e-12, Identities = 48/132 (36%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  + + P  T  IPTG+ + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + + +D  A++   GGFG + +K
  S:    20 LPTYATSGSAGLDLRACLDEAVALAPGATTLIPTGLAIHVADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWNRGQDS--FTIEPGERIAQMVFVPVVQAEFNLVDDFDATDRGEGGFGHSGRK 152
>gi|194334336|ref|YP_002016196.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Prosthecochloris aestuarii DSM 271] >gi|194312154|gb|ACF46549.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Prosthecochloris aestuarii DSM 271] (145 aa)
Score = 181, Expect = 2.5e-12, Identities = 48/129 (37%), Positives = 66/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           LP+ AT+H+AG D  A  D  L I+P +TV +PTG+ V + E     + PRS L  KY + L N    ID+DY      G + + L N   E     +  GD  AQ +   Y   E  +  E+      +GGFG T
  S:    15 LPRYATQHAAGMDIAACLDVPLTIQPSETVLVPTGLAVELPEGYEAQLRPRSGLALKYAISLPNAPATIDADY-----RGEVKVILVNLGQE--PFCVNHGDRIAQMVIARYEHAELQEVEELSRTPRGSGGFGHT 143
>gi|110807683|ref|YP_691203.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shigella flexneri 5 str. 8401] >gi|123342269|sp|Q0SYG7|DUT_SHIF8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|110617231|gb|ABF05898.1| deoxyuridinetriphosphatase [Shigella flexneri 5 str. 8401] (151 aa)
Score = 181, Expect = 2.7e-12, Identities = 49/141 (34%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    10 DPRVRKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 151
>gi|24114909|ref|NP_709419.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shigella flexneri 2a str. 301] >gi|30065084|ref|NP_839255.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shigella flexneri 2a str. 2457T] >gi|46576288|sp|Q83PN3|DUT_SHIFL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|24054151|gb|AAN45126.1| deoxyuridinetriphosphatase [Shigella flexneri 2a str. 301] >gi|30043345|gb|AAP19066.1| deoxyuridinetriphosphatase [Shigella flexneri 2a str. 2457T] (152 aa)
Score = 181, Expect = 2.7e-12, Identities = 49/141 (34%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    11 DPRVRKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 152
>gi|118595304|ref|ZP_01552651.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylophilales bacterium HTCC2181] >gi|118441082|gb|EAV47709.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylophilales bacterium HTCC2181] (150 aa)
Score = 181, Expect = 2.7e-12, Identities = 54/147 (36%), Positives = 82/147 (55%)
  Q:    16 NKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNE-DSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           N S + K +    +  +P  A+K +AG D  A  +  L+I+P +T  IPTGI + + + +   LILPRS LG K+ + L N VG+IDSDY     +G + +   N    +KE  I   D  AQ + +     S+ + E+ + +E    GFGST K
  S:     2 NLSVDYKILNPLITSHIPNYASKGAAGLDLRACVEQSLLIRPGETELIPTGISIFIKDPNYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELLVSCWN--RGDKEFTINSLDRIAQLVLVPVLQPSFNLVEEYENTERGESGFGSTGK 149
>gi|56459349|ref|YP_154630.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Idiomarina loihiensis L2TR] >gi|61212311|sp|Q5QZB6|DUT_IDILO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|56178359|gb|AAV81081.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Idiomarina loihiensis L2TR] (151 aa)
Score = 181, Expect = 2.8e-12, Identities = 55/140 (39%), Positives = 77/140 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNE-DSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  +  SI LP+ AT+ SAG D  A  D  L I+P QT  I TGI + + + +    ILPRS LG K+ L L N VG+IDSDY     +G + +   N +N+     I+ GD  AQ + L        I E+   ++   GGFG + +
  S:    10 DDRIGQSIPLPEYATQGSAGMDLRACLDQPLTIEPGQTQLIGTGIAMYIGDPNYAATILPRSGLGHKHGLVLGNLVGLIDSDY-----QGELKVSCWNRSNQ--AYTIEPGDRIAQLVILPVVQAQMSIVEEFHETDRGEGGFGHSGR 150
>gi|15804181|ref|NP_290220.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli O157:H7 EDL933] >gi|15833769|ref|NP_312542.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli O157:H7 str. Sakai] >gi|82546003|ref|YP_409950.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shigella boydii Sb227] >gi|82779130|ref|YP_405479.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shigella dysenteriae Sd197] >gi|157157952|ref|YP_001465120.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli E24377A] >gi|157163121|ref|YP_001460439.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli HS] >gi|187733172|ref|YP_001882337.1| dUTP diphosphatase [Shigella boydii CDC 3083-94] >gi|187775653|ref|ZP_02797401.2| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4196] >gi|188024741|ref|ZP_02773734.2| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4113] >gi|188496308|ref|ZP_03003578.1| dUTP diphosphatase [Escherichia coli 53638] >gi|191170597|ref|ZP_03032150.1| dUTP diphosphatase [Escherichia coli F11] >gi|194430069|ref|ZP_03062574.1| dUTP diphosphatase [Escherichia coli B171] >gi|194435802|ref|ZP_03067905.1| dUTP diphosphatase [Escherichia coli 101-1] >gi|166918319|sp|A7ZTJ1|DUT_ECO24 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166918320|sp|A8A6A2|DUT_ECOHS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|54037010|sp|P64007|DUT_ECO57 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|54040748|sp|P64006|DUT_ECOL6 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91206611|sp|Q31UY6|DUT_SHIBS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91206612|sp|Q329L7|DUT_SHIDS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|12518396|gb|AAG58784.1|AE005591_8 deoxyuridinetriphosphatase [Escherichia coli O157:H7 EDL933] >gi|13363990|dbj|BAB37938.1| deoxyuridinetriphosphatase [Escherichia coli O157:H7 str. Sakai] >gi|81243278|gb|ABB63988.1| deoxyuridinetriphosphatase [Shigella dysenteriae Sd197] >gi|81247414|gb|ABB68122.1| deoxyuridinetriphosphatase [Shigella boydii Sb227] >gi|157068801|gb|ABV08056.1| dUTP diphosphatase [Escherichia coli HS] >gi|157079982|gb|ABV19690.1| dUTP diphosphatase [Escherichia coli E24377A] >gi|187430164|gb|ACD09438.1| dUTP diphosphatase [Shigella boydii CDC 3083-94] >gi|187771420|gb|EDU35264.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4196] >gi|188016912|gb|EDU55034.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4113] >gi|188491507|gb|EDU66610.1| dUTP diphosphatase [Escherichia coli 53638] >gi|190909405|gb|EDV68991.1| dUTP diphosphatase [Escherichia coli F11] >gi|194411896|gb|EDX28213.1| dUTP diphosphatase [Escherichia coli B171] >gi|194425345|gb|EDX41329.1| dUTP diphosphatase [Escherichia coli 101-1] (151 aa)
Score = 181, Expect = 2.9e-12, Identities = 48/132 (36%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    19 LPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 151
>gi|26250286|ref|NP_756326.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli CFT073] >gi|110643881|ref|YP_671611.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli 536] >gi|168709316|ref|ZP_02741593.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli O157:H7 str. EC4045] >gi|168735146|ref|ZP_02767423.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli O157:H7 str. EC4115] >gi|168753464|ref|ZP_02778471.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4401] >gi|168759737|ref|ZP_02784744.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4501] >gi|168766060|ref|ZP_02791067.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4486] >gi|168785516|ref|ZP_02810523.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC869] >gi|168791141|ref|ZP_02816148.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli O157:H7 str. EC4042] >gi|168798585|ref|ZP_02823592.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC508] >gi|170018130|ref|YP_001723084.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Escherichia coli ATCC 8739] >gi|170683040|ref|YP_001745940.1| dUTP diphosphatase [Escherichia coli SMS-3-5] >gi|189010079|ref|ZP_02804802.2| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4076] >gi|191167803|ref|ZP_03029609.1| dUTP diphosphatase [Escherichia coli B7A] >gi|193063834|ref|ZP_03044921.1| dUTP diphosphatase [Escherichia coli E22] >gi|193070397|ref|ZP_03051339.1| dUTP diphosphatase [Escherichia coli E110019] >gi|194431268|ref|ZP_03063561.1| dUTP diphosphatase [Shigella dysenteriae 1012] >gi|195936201|ref|ZP_03081583.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli O157:H7 str. EC4024] >gi|26110716|gb|AAN82900.1|AE016769_15 Deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli CFT073] >gi|110345473|gb|ABG71710.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Escherichia coli 536] >gi|169753058|gb|ACA75757.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Escherichia coli ATCC 8739] >gi|170520758|gb|ACB18936.1| dUTP diphosphatase [Escherichia coli SMS-3-5] >gi|189002253|gb|EDU71239.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4076] >gi|189358911|gb|EDU77330.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4401] >gi|189364660|gb|EDU83079.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4486] >gi|189369473|gb|EDU87889.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC4501] >gi|189374472|gb|EDU92888.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC869] >gi|189378842|gb|EDU97258.1| dUTP diphosphatase [Escherichia coli O157:H7 str. EC508] >gi|190902146|gb|EDV61889.1| dUTP diphosphatase [Escherichia coli B7A] >gi|192930549|gb|EDV83156.1| dUTP diphosphatase [Escherichia coli E22] >gi|192956336|gb|EDV86797.1| dUTP diphosphatase [Escherichia coli E110019] >gi|194420723|gb|EDX36799.1| dUTP diphosphatase [Shigella dysenteriae 1012] (152 aa)
Score = 181, Expect = 2.9e-12, Identities = 48/132 (36%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    20 LPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 152
>gi|153092913|gb|EDN73944.1| dUTP diphosphatase [Mannheimia haemolytica PHL213] (151 aa)
Score = 180, Expect = 3.1e-12, Identities = 52/141 (36%), Positives = 81/141 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT+ SAG D  A  +  L +K  +TV IPTGI + + + ++  +ILPRS LG K  + L N VG+IDSDY     +G + + L N +    +  +  GD  AQ +F+     S+ I ++ + ++   GGFG + K+
  S:    10 DSRIGNEFPLPAYATEGSAGLDLRAMLNEPLTVKAGETVLIPTGISIYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGELKVSLWNRS--QADFTVNVGDRIAQLVFVPVVQASFNIVQEFEQTDRGEGGFGHSGKQ 151
>gi|161523960|ref|YP_001578972.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia multivorans ATCC 17616] >gi|189351279|ref|YP_001946907.1| dUTP pyrophosphatase [Burkholderia multivorans ATCC 17616] >gi|160341389|gb|ABX14475.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia multivorans ATCC 17616] >gi|189335301|dbj|BAG44371.1| dUTP pyrophosphatase [Burkholderia multivorans ATCC 17616] (148 aa)
Score = 180, Expect = 3.3e-12, Identities = 51/131 (38%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  L +KP  T  +PTG+ + + + +   LILPRS LG K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ + +      + I +D   SE   GGFGST +
  S:    16 LPAYATAGSAGLDLRACLDAPLTLKPGDTALVPTGLAIHLADPNYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSERGAGGFGSTGR 147
>gi|149115473|ref|ZP_01842215.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella baltica OS223] >gi|152998925|ref|YP_001364606.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella baltica OS185] >gi|160873511|ref|YP_001552827.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella baltica OS195] >gi|166218223|sp|A6WIA4|DUT_SHEB8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|189027749|sp|A9KY02|DUT_SHEB9 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|146864613|gb|EDK50010.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella baltica OS223] >gi|151363543|gb|ABS06543.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella baltica OS185] >gi|160859033|gb|ABX47567.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella baltica OS195] (152 aa)
Score = 180, Expect = 3.3e-12, Identities = 53/141 (37%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  L I P +TV IPTGI + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N ++    L I  GD  AQ +F+      + + ++  +S+   GGFG +  K
  S:    11 DSRIGSEFPLPAYATPGSAGMDLRAMIDTTLTIAPGETVLIPTGIAIHVADPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSDSPFALEI--GDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK 152
>gi|54295322|ref|YP_127737.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Legionella pneumophila str. Lens] >gi|61212347|sp|Q5WTW6|DUT_LEGPL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|53755154|emb|CAH16647.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Legionella pneumophila str. Lens] (152 aa)
Score = 180, Expect = 3.5e-12, Identities = 51/140 (36%), Positives = 77/140 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + ++I LP  AT  SAG D        + + P+QTV +PTGI + + +  +  +ILPRS LG K  + L N VG+IDSDY     +G + I   N + E+    +  GD  AQ +F+     S+ +  +   S    GGFGS+ +
  S:    11 DSRIGDTISLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGELKISCWNRSQEH--FTVNPGDRIAQLVFIPVVQASFEVVNEFTESSRGEGGFGSSGR 151
>gi|154706860|ref|YP_001425120.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii Dugway 5J108-111] >gi|189027735|sp|A9KGS5|DUT_COXBN Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|154356146|gb|ABS77608.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii Dugway 5J108-111] (152 aa)
Score = 180, Expect = 3.7e-12, Identities = 54/140 (38%), Positives = 75/140 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  L +   LP  ATK SAG D  A  D  L I+P +T  I TG+ + +   +V   ILPRS LG K+ + L N VG+IDSDY     +G + +   N   E     I  GD  AQ + L      + + E+ + +E   GGFGS+ +
  S:    11 DKRLGSEFPLPAYATKGSAGLDLRACLDEPLKIEPDETCLISTGLAIYLGHSNVAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGKE--PYTINPGDRIAQLVVLPILKAQFAVVEEFELTERGAGGFGSSGQ 151
>gi|156936193|ref|YP_001440109.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Enterobacter sakazakii ATCC BAA-894] >gi|166918323|sp|A7MQ93|DUT_ENTS8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|156534447|gb|ABU79273.1| hypothetical protein ESA_04092 [Enterobacter sakazakii ATCC BAA-894] (152 aa)
Score = 179, Expect = 3.9e-12, Identities = 48/132 (36%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  + + P  T  +PTG+ + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + + ED  A++   GGFG + +K
  S:    20 LPTYATSGSAGLDLRACLDESVELTPGATTLLPTGLAIHIADPSLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWNRGQQS--FTIEPGERIAQMVFVPVVQAEFNLVEDFTATDRGEGGFGHSGRK 152
>gi|34498536|ref|NP_902751.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Chromobacterium violaceum ATCC 12472] >gi|48427878|sp|Q7MBE8|DUT_CHRVO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|34104392|gb|AAQ60750.1| dUTP diphosphatase [Chromobacterium violaceum ATCC 12472] (150 aa)
Score = 179, Expect = 4.0e-12, Identities = 49/131 (37%), Positives = 77/131 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  +  + I+P +T  +PTGI + +++  +  ++LPRS LG K+ + L N VG+IDSDY     +G +F+ + N   +   L  +  +  AQ + +     S+ I +D  AS+   GGFGST +
  S:    18 LPAYATAGSAGLDLRAATEETMTIQPGETQLVPTGIAIHLSDPGLAAMLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQMFVSVWNRGQQPFRL--EPMERIAQMVIVPVVQASFNIVDDFDASDRGAGGFGSTGR 149
>gi|52842695|ref|YP_096494.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629806|gb|AAU28547.1| deoxyuridinetriphosphatase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (156 aa)
Score = 179, Expect = 4.9e-12, Identities = 51/140 (36%), Positives = 77/140 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + ++I LP  AT  SAG D        + + P+QTV +PTGI + + +  +  +ILPRS LG K  + L N VG+IDSDY     +G + I   N + E+    +  GD  AQ +F+     S+ +  +   S    GGFGS+ +
  S:    15 DSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGELKISCWNRSQEH--FTVNPGDRIAQLVFIPVVQASFEVVNEFTESSRGEGGFGSSGR 155
>gi|61212357|sp|Q5ZSN0|DUT_LEGPH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) (152 aa)
Score = 179, Expect = 4.9e-12, Identities = 51/140 (36%), Positives = 77/140 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + ++I LP  AT  SAG D        + + P+QTV +PTGI + + +  +  +ILPRS LG K  + L N VG+IDSDY     +G + I   N + E+    +  GD  AQ +F+     S+ +  +   S    GGFGS+ +
  S:    11 DSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGELKISCWNRSQEH--FTVNPGDRIAQLVFIPVVQASFEVVNEFTESSRGEGGFGSSGR 151
>gi|54298487|ref|YP_124856.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Legionella pneumophila str. Paris] >gi|61212350|sp|Q5X242|DUT_LEGPA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|53752272|emb|CAH13704.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Legionella pneumophila str. Paris] (152 aa)
Score = 179, Expect = 4.9e-12, Identities = 51/140 (36%), Positives = 77/140 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + ++I LP  AT  SAG D        + + P+QTV +PTGI + + +  +  +ILPRS LG K  + L N VG+IDSDY     +G + I   N + E+    +  GD  AQ +F+     S+ +  +   S    GGFGS+ +
  S:    11 DSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGELKISCWNRSQEH--FTVNPGDRIAQLVFIPVVQTSFEVVNEFTESSRGEGGFGSSGR 151
>gi|77461762|ref|YP_351269.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas fluorescens PfO-1] >gi|91206608|sp|Q3K4M6|DUT_PSEPF Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|77385765|gb|ABA77278.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas fluorescens PfO-1] (151 aa)
Score = 178, Expect = 5.2e-12, Identities = 51/132 (38%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGSTNKK 163
           LP+ AT  SAG D  A    D+VIKP +TV IPTG+ V + + ++  LILPRS +G K+ + L N VG+IDSDY     +G + +   N      E  +  G+  AQ + +      + + E+   +E   GGFG +  K
  S:    19 LPQYATPGSAGLDLRAMLQEDIVIKPGETVLIPTGLSVYIGDPNLAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWN--RGQTEFTMPVGERLAQLVLVPVVQAHFEMVEEFVETERGTGGFGHSGTK 151
>gi|167855897|ref|ZP_02478647.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus parasuis 29755] >gi|167852985|gb|EDS24249.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus parasuis 29755] (151 aa)
Score = 178, Expect = 5.3e-12, Identities = 51/132 (38%), Positives = 77/132 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  +  L ++   TV IPTGI V + + ++  +ILPRS LG K  + L N +G+IDSDY     +G + + L N +  +K   ++ GD  AQ +F+      + I E+  A++   GGFG + K+
  S:    19 LPTYATTGSAGLDLRALIEQPLTVEAGHTVLIPTGISVYIADPNLAAVILPRSGLGHKNGIVLGNLIGLIDSDY-----QGPLMVSLWNRS--DKPFTVEVGDRIAQLVFVPVVQAQFNIVEEFTATDRGEGGFGHSGKQ 151
>gi|149376405|ref|ZP_01894167.1| dUTPase [Marinobacter algicola DG893] >gi|149359246|gb|EDM47708.1| dUTPase [Marinobacter algicola DG893] (153 aa)
Score = 178, Expect = 6.2e-12, Identities = 54/147 (36%), Positives = 80/147 (54%)
  Q:    17 KSFENK--DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           K+F+ +  D  +  S+  P+ AT  SAG D  A  D  L +KP QT  I TG+ + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N      E  I  G+  AQ + +      + +     AS   +GGFGST  +
  S:     4 KTFQVRILDDRIGRSVPFPEYATDGSAGLDLRACLDAPLTLKPGQTELIKTGLSIHIADTSLAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQSEFTIDVGERIAQLVLVPVVQADFEVVSSFDASVRGDGGFGSTGTR 153
>gi|152979959|ref|YP_001352515.1| dUTP pyrophosphatase [Janthinobacterium sp. Marseille] >gi|166918325|sp|A6SW68|DUT_JANMA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|151280036|gb|ABR88446.1| dUTP pyrophosphatase [Janthinobacterium sp. Marseille] (149 aa)
Score = 178, Expect = 6.4e-12, Identities = 52/146 (35%), Positives = 77/146 (52%)
  Q:    17 KSFENKDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           K+ E K ++     QLP  AT  SAG D  A  D  + IKP +T  +PTG+ + + +     +ILPRS +G K+ + L N VG+IDSDY     +G + +   N      E  +   +  AQ +      + + + E+   SE   GGFGST K
  S:     2 KTIEVKILDPRMQEQLPAYATAGSAGLDLRACLDAPITIKPGETHLVPTGLAIHLADPGYAAMILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTEFTLNPMERLAQLVIVPVLQVGFNVVEEFDTSERGIGGFGSTGK 148
>gi|145301066|ref|YP_001143907.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Aeromonas salmonicida subsp. salmonicida A449] >gi|166217602|sp|A4STD7|DUT_AERS4 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|142853838|gb|ABO92159.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Aeromonas salmonicida subsp. salmonicida A449] (152 aa)
Score = 178, Expect = 6.4e-12, Identities = 47/141 (33%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  D  + + P  T+ +PTG+ + + +  +   ILPRS LG K+ + L N VG+IDSDY     +G + + + N  N++    ++ G+  AQ + +     S+ + ++   SE   GGFGS+ ++
  S:    11 DARIGTEYPLPAYATPGSAGMDLRALLDAPITLAPGDTILVPTGLAIHIQDPGLCATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSVWNRGNDS--FTMQPGERIAQLVIMPVVQASFQLVDEFNQSERGEGGFGSSGRQ 152
>gi|56964611|ref|YP_176342.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacillus clausii KSM-K16] >gi|56910854|dbj|BAD65381.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacillus clausii KSM-K16] (169 aa)
Score = 177, Expect = 6.9e-12, Identities = 47/129 (36%), Positives = 77/129 (59%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDT-------------------NENKELVIKKGDGFAQAIFLSY---GITEDDQASEIRN--GGFGST 160
           +P   ++ +AG+D +A  D++I+P QT K+P G+   +    VL I+PRS + ++ +L+  N+VGVIDSD  Y      +F  ++ DT                    E+   +I+KGD   Q +        + + D+ SE +   GGFGST
  S:    15 MPTYGSEGAAGFDLYAAEDVIIEPGQTKKVPLGLAFELPPGYVLYIMPRSGISYETKLRQPNSVGVIDSD--YRGEVAMMFDNISQDTWSNAAKGVDGMPDHSTTDKYESGSYIIRKGDRVCQGVIQKLPKIELVQVDRLSETKRGAGGFGST 165
>gi|194562606|ref|YP_002097629.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia dolosa AUO158] >gi|124894230|gb|EAY68110.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia dolosa AUO158] (148 aa)
Score = 177, Expect = 7.1e-12, Identities = 51/131 (38%), Positives = 72/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  + +KP +T  +PTG+ + + + +   LILPRS LG K+ + L N VG+IDSDY     +  + I   N      E V+   +  AQ + +      + I +D  ASE   GGFGST +
  S:    16 LPTYATAGSAGLDLRACIDAPISLKPGETALVPTGLAIHVADPNYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QDQLMISTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAASERGEGGFGSTGR 147
>gi|74314126|ref|YP_312545.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shigella sonnei Ss046] >gi|91206613|sp|Q3YW02|DUT_SHISS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|73857603|gb|AAZ90310.1| deoxyuridinetriphosphatase [Shigella sonnei Ss046] (151 aa)
Score = 177, Expect = 7.4e-12, Identities = 47/132 (35%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  +  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    19 LPTYATSGSAGLDLRACLDDAVELAPGDSTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 151
>gi|157149257|ref|YP_001456576.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Citrobacter koseri ATCC BAA-895] >gi|166918318|sp|A8ARM7|DUT_CITK8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157086462|gb|ABV16140.1| hypothetical protein CKO_05097 [Citrobacter koseri ATCC BAA-895] (152 aa)
Score = 177, Expect = 7.5e-12, Identities = 46/132 (34%), Positives = 77/132 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + + E+ +A++   GGFG + +K
  S:    20 LPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSIWNRGQDS--FTIEPGERIAQMVFVPVVQAEFNLVEEFEATDRGEGGFGHSGRK 152
>gi|124267754|ref|YP_001021758.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylibium petroleiphilum PM1] >gi|166217625|sp|A2SIY4|DUT_METPP Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|124260529|gb|ABM95523.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylibium petroleiphilum PM1] (149 aa)
Score = 177, Expect = 7.6e-12, Identities = 51/133 (38%), Positives = 76/133 (57%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           QLP  AT  SAG D  A  D  L+++P QT  IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N         ++  +  AQ + +     S+ + +D  ASE   GGFGST ++
  S:    16 QLPAYATPGSAGLDLRACLDAPLLLEPGQTQLIPTGLSIHIGDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWN--RGLAAFTVQPLERIAQLVIVPVVQASFRVVDDFGASERGEGGFGSTGQR 149
>gi|157373076|ref|YP_001481065.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Serratia proteamaculans 568] >gi|166918330|sp|A8GLE7|DUT_SERP5 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157324840|gb|ABV43937.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Serratia proteamaculans 568] (152 aa)
Score = 177, Expect = 8.2e-12, Identities = 48/131 (36%), Positives = 74/131 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  ++  P +T  +PTG+ + + + D   +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     K   I+ G+  AQ +F+      + + E+  +SE   GGFG + +
  S:    20 LPTYATPGSAGLDLRACLDSAVELAPGETQLLPTGLAIHIADTDLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN--RGQKSFTIEPGERIAQMVFVPVVQAEFNLVEEFDSSERGAGGFGHSGR 151
>gi|152972486|ref|YP_001337632.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166918326|sp|A6TFN1|DUT_KLEP7 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|150957335|gb|ABR79365.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (152 aa)
Score = 176, Expect = 8.9e-12, Identities = 47/132 (35%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   ++   +I+ G+  AQ +F+      + + E   A++   GGFG + +K
  S:    20 LPTYATSGSAGLDLRACLDDAVELAPGATTLLPTGLAIHIADPSLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWNRGQQS--FIIEPGERIAQMVFVPVVQAEFNLVESFDATDRGEGGFGHSGRK 152
>gi|134296688|ref|YP_001120423.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia vietnamiensis G4] >gi|166217615|sp|A4JH35|DUT_BURVG Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|134139845|gb|ABO55588.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia vietnamiensis G4] (148 aa)
Score = 176, Expect = 9.5e-12, Identities = 49/131 (37%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ + +      + I +D   SE   GGFGST +
  S:    16 LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQSEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSERGEGGFGSTGR 147
>gi|83718436|ref|YP_441323.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia thailandensis E264] >gi|167580107|ref|ZP_02372981.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia thailandensis TXDOH] >gi|167618172|ref|ZP_02386803.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia thailandensis Bt4] >gi|123537857|sp|Q2T0H6|DUT_BURTA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|83652261|gb|ABC36324.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia thailandensis E264] (148 aa)
Score = 176, Expect = 1.0e-11, Identities = 51/131 (38%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LPK AT  SAG D  A  D  + +KP  T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E V+   +  AQ + +     ++ I  D   S+   GGFGST +
  S:    16 LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGQTEFVLNPFERLAQLVIVPVVQATFNIVGDFAQSDRGAGGFGSTGR 147
>gi|170767102|ref|ZP_02901555.1| dUTP diphosphatase [Escherichia albertii TW07627] >gi|170124540|gb|EDS93471.1| dUTP diphosphatase [Escherichia albertii TW07627] (151 aa)
Score = 176, Expect = 1.0e-11, Identities = 47/132 (35%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + E+  A++   GGFG + ++
  S:    19 LPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEEFDATDRGEGGFGHSGRQ 151
>gi|16131511|ref|NP_418097.1| deoxyuridinetriphosphatase [Escherichia coli str. K-12 substr. MG1655] >gi|89110371|ref|AP_004151.1| deoxyuridinetriphosphatase [Escherichia coli W3110] >gi|170083148|ref|YP_001732468.1| deoxyuridinetriphosphatase [Escherichia coli str. K12 substr. DH10B] >gi|118953|sp|P06968|DUT_ECOLI Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|41297|emb|CAA25859.1| unnamed protein product [Escherichia coli] >gi|41300|emb|CAA24897.1| unnamed protein product [Escherichia coli] >gi|290490|gb|AAA61993.1| deoxyuridinetriphosphatase >gi|1790071|gb|AAC76664.1| deoxyuridinetriphosphatase [Escherichia coli str. K-12 substr. MG1655] >gi|85676402|dbj|BAE77652.1| deoxyuridinetriphosphatase [Escherichia coli W3110] >gi|169890983|gb|ACB04690.1| deoxyuridinetriphosphatase [Escherichia coli str. K12 substr. DH10B] (151 aa)
Score = 176, Expect = 1.1e-11, Identities = 47/132 (35%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  +  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    19 LPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 151
>gi|1311150|pdb|1DUP|A Chain A, Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase (D-Utpase) >gi|7766857|pdb|1EU5|A Chain A, Structure Of E. Coli Dutpase At 1.45 A >gi|55669663|pdb|1RN8|A Chain A, Crystal Structure Of Dutpase Complexed With Substrate Analogue Imido-Dutp >gi|55669719|pdb|1SEH|A Chain A, Crystal Structure Of E. Coli Dutpase Complexed With The Product Dump >gi|157830893|pdb|1DUD|A Chain A, Deoxyuridine 5'-Triphosphate Nucleotide Hydrolase (D- Utpase) Complexed With The Substrate Analogue Deoxyuridine 5'-Diphosphate (D-Udp) >gi|157835082|pdb|2HR6|A Chain A, Crystal Structure Of Dutpase In Complex With Substrate Analogue Dudp And Manganese >gi|157835089|pdb|2HRM|A Chain A, Crystal Structure Of Dutpase Complexed With Substrate Analogue Methylene-Dutp >gi|157874586|pdb|1EUW|A Chain A, Atomic Resolution Structure Of E. Coli Dutpase (152 aa)
Score = 176, Expect = 1.1e-11, Identities = 47/132 (35%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  +  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    20 LPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 152
>gi|90408985|ref|ZP_01217116.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychromonas sp. CNPT3] >gi|90309899|gb|EAS38053.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychromonas sp. CNPT3] (151 aa)
Score = 176, Expect = 1.1e-11, Identities = 52/140 (37%), Positives = 76/140 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + +    PK AT  SAG D  A  D  L++ P +T  I TGI + + + ++   ILPRS LG K+ + L N VG+IDSDY+     G + +   N +  +  LV   G+  AQ +FL     S+ + E    ++   GGFG T K
  S:    10 DPRIGHEFPFPKHATSGSAGVDLCACIDEPLILAPGETKLIATGIAIHIADPTLAATILPRSGLGHKHGIVLGNLVGLIDSDYH-----GPLMVSCWNRSQTSFTLV--PGERLAQLVFLPVVQVSFDVVESFTQTDRGEGGFGHTGK 150
>gi|85060188|ref|YP_455890.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Sodalis glossinidius str. 'morsitans'] >gi|123518741|sp|Q2NQU0|DUT_SODGM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|84780708|dbj|BAE75485.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Sodalis glossinidius str. 'morsitans'] (151 aa)
Score = 175, Expect = 1.2e-11, Identities = 49/141 (34%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  +V+ P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   +     I+ G+  AQ +F+      + + E    SE   GGFG + ++
  S:    10 DRRICDRFPLPAYATTGSAGLDLRACIDEPMVLAPGETTLIPTGLAIHIADANLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSVWNRGQD--IFTIEPGERMAQMVFVPVVQAEFNLVESFDTSERGEGGFGHSGRQ 151
>gi|78067316|ref|YP_370085.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia sp. 383] >gi|91206594|sp|Q39DM5|DUT_BURS3 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|77968061|gb|ABB09441.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia sp. 383] (148 aa)
Score = 175, Expect = 1.2e-11, Identities = 49/131 (37%), Positives = 72/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E V+   +  AQ + +      + I +D   S+  +GGFGST +
  S:    16 LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMISTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAESDRGDGGFGSTGR 147
>gi|152994656|ref|YP_001339491.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Marinomonas sp. MWYL1] >gi|150835580|gb|ABR69556.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Marinomonas sp. MWYL1] (152 aa)
Score = 175, Expect = 1.3e-11, Identities = 50/134 (37%), Positives = 73/134 (54%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           I LP  AT+ SAG D  A  D  I   P +T  +PTG+ + + + ++   ILPRS LG K+ + L N VG+IDSDY     +G + +   N    N    I+ G+  AQ + L      + I  + +++E   GGFG T  K
  S:    18 IPLPTYATEGSAGLDLRACLDQAIDLAPGETTLLPTGLSIYIQDPNLAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGNTTFTIEPGERVAQLVLLPVVQAEFNIVTEFESTERGEGGFGHTGTK 152
>gi|163750746|ref|ZP_02157982.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella benthica KT99] >gi|161329590|gb|EDQ00582.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella benthica KT99] (152 aa)
Score = 175, Expect = 1.3e-11, Identities = 49/132 (37%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  +  ++++P +T+ IPTGI + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N  NE   L I  GD  AQ +F+      + + ++   S    GGFG +  +
  S:    20 LPTYATPGSAGMDLRAMIETSMIVEPGETILIPTGISIHVADPGLAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGNEPFTLEI--GDRLAQLVFVPVIQAEFKLVDEFDNSSRGEGGFGHSGTQ 152
>gi|170693567|ref|ZP_02884725.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia graminis C4D1M] >gi|170141349|gb|EDT09519.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia graminis C4D1M] (148 aa)
Score = 175, Expect = 1.3e-11, Identities = 51/132 (38%), Positives = 71/132 (53%)
  Q:    31 QLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A     L ++P QT  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N        V+   +  AQ + +      + I ++ + SE   GGFGST K
  S:    15 QLPAYATTGSAGLDLRACLKEPLTLEPGQTALVPTGLAIHVGDPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGETTFVLNPMERLAQLVIVPVVQAQFNIVDEFEQSERGAGGFGSTGK 147
>gi|149908599|ref|ZP_01897261.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Moritella sp. PE36] >gi|149808433|gb|EDM68370.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Moritella sp. PE36] (151 aa)
Score = 175, Expect = 1.3e-11, Identities = 52/132 (39%), Positives = 73/132 (55%)
  Q:    32 LPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A     L + P +T  IPTGI + + + S+   ILPRS LG K+ + L N VG+IDSDY     +G + I   N   ++   +I+ GD  AQ + +        I E+  +SE   GGFG + K+
  S:    19 LPSYATPGSAGLDLRACLAQPLTVNPGETHLIPTGIAIHIADPSMAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISCWNRGQDS--FIIQPGDRIAQMMIVPVIQAELIIVEEFDSSERGEGGFGHSGKQ 151
>gi|62182224|ref|YP_218641.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616811|ref|YP_001590776.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167541945|ref|ZP_02337521.1| hypothetical protein Sentent_01625 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167549021|ref|ZP_02342780.1| hypothetical protein Sentente_00830 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167555568|ref|ZP_02348586.1| hypothetical protein Sententeri_01650 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168220122|ref|ZP_02645354.1| hypothetical protein Senterenterica_07016 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168224867|ref|ZP_02650098.1| hypothetical protein Sententeric_03763 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168233255|ref|ZP_02658313.1| hypothetical protein Sententerica_19885 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168235336|ref|ZP_02660394.1| hypothetical protein Senteenterica_04064 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168241910|ref|ZP_02666842.1| hypothetical protein Senterienterica_09772 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168818439|ref|ZP_02830439.1| hypothetical protein Salentericaenterica_03571 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194444221|ref|YP_002042980.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450428|ref|YP_002047762.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194470772|ref|ZP_03076756.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734537|ref|YP_002116665.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189027748|sp|A9MVN5|DUT_SALPB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|75479867|sp|Q57IA2|DUT_SALCH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|62129857|gb|AAX67560.1| deoxyuridinetriphosphatase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161366175|gb|ABX69943.1| hypothetical protein SPAB_04630 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194402884|gb|ACF63106.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408732|gb|ACF68951.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194457136|gb|EDX45975.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710039|gb|ACF89260.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (152 aa)
Score = 175, Expect = 1.4e-11, Identities = 47/132 (35%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + + E   A+E   GGFG + +K
  S:    20 LPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSIWNRGQDS--FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEGGFGHSGRK 152
>gi|16762578|ref|NP_458195.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767016|ref|NP_462631.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella typhimurium LT2] >gi|29144067|ref|NP_807409.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415621|ref|YP_152696.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167995204|ref|ZP_02576294.1| hypothetical protein Sententer_01000066_0100027410 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168260515|ref|ZP_02682488.1| hypothetical protein Salmentericaenterica_05475 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168473224|ref|ZP_02702247.1| hypothetical protein Salmoentericaenterica_01095 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|195873761|ref|ZP_03080107.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|54037011|sp|P64009|DUT_SALTI Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|54040749|sp|P64008|DUT_SALTY Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|81599224|sp|Q5PC28|DUT_SALPA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|25290385|pir||AB0971 deoxyuridine 5'-triphosphate nucleotidohydrolase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422299|gb|AAL22590.1| deoxyuridinetriphosphatase [Salmonella typhimurium LT2] >gi|16504883|emb|CAD03262.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139704|gb|AAO71269.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129878|gb|AAV79384.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|195632128|gb|EDX50612.1| dUTP diphosphatase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (151 aa)
Score = 175, Expect = 1.4e-11, Identities = 47/132 (35%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + + E   A+E   GGFG + +K
  S:    19 LPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSIWNRGQDS--FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEGGFGHSGRK 151
>gi|161505734|ref|YP_001572846.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189027747|sp|A9MKN5|DUT_SALAR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|160867081|gb|ABX23704.1| hypothetical protein SARI_03910 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (152 aa)
Score = 175, Expect = 1.4e-11, Identities = 47/132 (35%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + + E   A+E   GGFG + +K
  S:    20 LPTYATSGSAGLDLRACLDGAVELAPGATTLVPTGLAIHIADPSLAAVMLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSIWNRGQDS--FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEGGFGHSGRK 152
>gi|167823088|ref|ZP_02454559.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 9] (148 aa)
Score = 174, Expect = 1.5e-11, Identities = 50/131 (38%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LPK AT  SAG D  A  D  + +KP  T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E  +   +  AQ + +      + + +D   SE   GGFGST +
  S:    16 LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYTALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGQTEFALNPFERLAQLVIVPVVQARFNLVDDFAQSERGAGGFGSTGR 147
>gi|53718544|ref|YP_107530.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei K96243] >gi|53726226|ref|YP_103809.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia mallei ATCC 23344] >gi|67641268|ref|ZP_00440050.1| COG0756: dUTPase [Burkholderia mallei GB8 horse 4] >gi|76810731|ref|YP_332531.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1710b] >gi|121598317|ref|YP_993958.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia mallei SAVP1] >gi|124384292|ref|YP_001027023.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia mallei NCTC 10229] >gi|126439439|ref|YP_001058015.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 668] >gi|126450526|ref|YP_001081646.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia mallei NCTC 10247] >gi|126451592|ref|YP_001065249.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1106a] >gi|134281030|ref|ZP_01767739.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 305] >gi|161357122|ref|ZP_02102998.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1106b] >gi|161370761|ref|ZP_02110327.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1710a] >gi|166998896|ref|ZP_02264748.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia mallei PRL-20] >gi|167718450|ref|ZP_02401686.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei DM98] >gi|167737500|ref|ZP_02410274.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 14] >gi|167814618|ref|ZP_02446298.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 91] >gi|167844649|ref|ZP_02470157.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei B7210] >gi|167893180|ref|ZP_02480582.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 7894] >gi|167901634|ref|ZP_02488839.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei NCTC 13177] >gi|167909883|ref|ZP_02496974.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 112] >gi|167917906|ref|ZP_02504997.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei BCC215] >gi|194316525|ref|YP_002012034.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei ATCC 10399] >gi|194504201|ref|YP_002033773.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1655] >gi|194508583|ref|YP_002021117.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei Pasteur 52237] >gi|194515896|ref|YP_002051436.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei S13] >gi|194522749|ref|YP_002058282.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei FMH] >gi|194527731|ref|YP_002063254.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei JHU] >gi|194576997|ref|YP_002111878.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei 2002721280] >gi|166217610|sp|A3MN10|DUT_BURM7 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217611|sp|A2S504|DUT_BURM9 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217612|sp|A1V6V5|DUT_BURMS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217613|sp|A3NSC8|DUT_BURP0 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217614|sp|A3N6P4|DUT_BURP6 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|61212365|sp|Q62HL1|DUT_BURMA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|61212371|sp|Q63WI6|DUT_BURPS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91206593|sp|Q3JV72|DUT_BURP1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|52208958|emb|CAH34897.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei K96243] >gi|52429649|gb|AAU50242.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei ATCC 23344] >gi|76580184|gb|ABA49659.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1710b] >gi|121227127|gb|ABM49645.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei SAVP1] >gi|124292312|gb|ABN01581.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei NCTC 10229] >gi|126218932|gb|ABN82438.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 668] >gi|126225234|gb|ABN88774.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1106a] >gi|126243396|gb|ABO06489.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei NCTC 10247] >gi|134247336|gb|EBA47421.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 305] >gi|147746759|gb|EDK53836.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei FMH] >gi|147751741|gb|EDK58808.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei JHU] >gi|148025255|gb|EDK83409.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei 2002721280] >gi|157938562|gb|EDO94232.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei Pasteur 52237] >gi|160696823|gb|EDP86793.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Burkholderia mallei ATCC 10399] >gi|169653129|gb|EDS85822.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei S13] >gi|184212038|gb|EDU09081.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia pseudomallei 1655] (148 aa)
Score = 174, Expect = 1.6e-11, Identities = 50/131 (38%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LPK AT  SAG D  A  D  + +KP  T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + I   N      E  +   +  AQ + +      + + +D   SE   GGFGST +
  S:    16 LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISTWN--RGQTEFALNPFERLAQLVIVPVVQARFNLVDDFAQSERGAGGFGSTGR 147
>gi|104784330|ref|YP_610828.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas entomophila L48] >gi|122401254|sp|Q1I2U1|DUT_PSEE4 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|95113317|emb|CAK18045.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas entomophila L48] (151 aa)
Score = 174, Expect = 1.7e-11, Identities = 52/141 (36%), Positives = 74/141 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGSTNKK 163
           D  L     LP+ AT  SAG D  A    D V++P QT+ IPTG+ V + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    N    I  G+  AQ I +      + I E    ++   GGFG +  +
  S:    10 DPRLGTEFPLPQYATPGSAGLDLRALLKEDTVLEPGQTLLIPTGLSVYIGDPGLAAMILPRSGLGHKHGVVLGNLVGLIDSDY-----QGELMVSCWN--RGNTPFTITIGERIAQLILVPVVQAHFDIVEQFDETQRGTGGFGHSGTR 151
>gi|120597167|ref|YP_961741.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella sp. W3-18-1] >gi|124545971|ref|ZP_01705121.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella putrefaciens 200] >gi|146291567|ref|YP_001181991.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella putrefaciens CN-32] >gi|166218225|sp|A4Y2K9|DUT_SHEPC Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166218227|sp|A1REU2|DUT_SHESW Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|120557260|gb|ABM23187.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella sp. W3-18-1] >gi|124510574|gb|EAY54643.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella putrefaciens 200] >gi|145563257|gb|ABP74192.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella putrefaciens CN-32] (152 aa)
Score = 174, Expect = 1.7e-11, Identities = 52/141 (36%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  + I P +T  IPTGI + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N +N    L I  GD  AQ +F+      + + ++  +S+   GGFG +  K
  S:    11 DSRIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSNSPFTLDI--GDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK 152
>gi|29653644|ref|NP_819336.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii RSA 493] >gi|153208648|ref|ZP_01946900.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii 'MSU Goat Q177'] >gi|161831512|ref|YP_001596243.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii RSA 331] >gi|165919765|ref|ZP_02219508.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii RSA 334] >gi|189027736|sp|A9NB28|DUT_COXBR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|3023662|sp|Q45920|DUT_COXBU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|483522|emb|CAA55678.1| orf 152 [Coxiella burnetii] >gi|29540906|gb|AAO89850.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii RSA 493] >gi|120575834|gb|EAX32458.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii 'MSU Goat Q177'] >gi|161763379|gb|ABX79021.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii RSA 331] >gi|165916848|gb|EDR35452.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Coxiella burnetii RSA 334] (152 aa)
Score = 174, Expect = 1.7e-11, Identities = 53/140 (37%), Positives = 74/140 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  L +   LP  AT  SAG D  A  D  L I+P +T  I TG+ + +   +V   ILPRS LG K+ + L N VG+IDSDY     +G + +   N   E     I  GD  AQ + L      + + E+ + +E   GGFGS+ +
  S:    11 DKRLGSEFPLPAYATTGSAGLDLRACLDEPLKIEPDETCLISTGLAIYLGHSNVAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGKE--PYTINPGDRIAQLVVLPILKAQFAVVEEFELTERGAGGFGSSGQ 151
>gi|172061475|ref|YP_001809127.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia ambifaria MC40-6] >gi|171993992|gb|ACB64911.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia ambifaria MC40-6] (148 aa)
Score = 174, Expect = 1.8e-11, Identities = 48/131 (36%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           +P  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ + +      + I +D   SE   GGFGST +
  S:    16 MPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSERGEGGFGSTGR 147
>gi|148360060|ref|YP_001251267.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Legionella pneumophila str. Corby] >gi|166217624|sp|A5IEX1|DUT_LEGPC Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|148281833|gb|ABQ55921.1| deoxyuridinetriphosphatase [Legionella pneumophila str. Corby] (152 aa)
Score = 174, Expect = 1.9e-11, Identities = 50/140 (35%), Positives = 76/140 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  + ++I LP  AT  SAG D        + + P+Q V +PTGI + + +  +  +ILPRS LG K  + L N VG+IDSDY     +G + I   N + E+    +  GD  AQ +F+     S+ +  +   S    GGFGS+ +
  S:    11 DSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQAVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGELKISCWNRSQEH--FTVNPGDRIAQLVFIPVVQASFEVVNEFTESSRGEGGFGSSGR 151
>gi|167749871|ref|ZP_02421998.1| hypothetical protein EUBSIR_00839 [Eubacterium siraeum DSM 15702] >gi|167657183|gb|EDS01313.1| hypothetical protein EUBSIR_00839 [Eubacterium siraeum DSM 15702] (145 aa)
Score = 173, Expect = 2.1e-11, Identities = 49/138 (35%), Positives = 74/138 (53%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           +L +  +LP+RAT  SAG D  A  D  +V+ P     IPTG+ + +       +  RS L  K+ + L N VGVIDSDY      G + I + N ++E     +K G+  AQ + +      YG+ ++   +E   GGFGST +
  S:     7 KLNSKAKLPERATATSAGADLCACIDDDVVLMPGDRKLIPTGLAIAVPTGYGGFVFARSGLSSKFGVSLANCVGVIDSDY-----RGEVKISVINHSDE--PYTVKNGERIAQLVIMPVDLCEYGLCDELDDTERGTGGFGSTGR 144
>gi|157373524|ref|YP_001472124.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella sediminis HAW-EB3] >gi|189027752|sp|A8FQ73|DUT_SHESH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157315898|gb|ABV34996.1| dUTP diphosphatase [Shewanella sediminis HAW-EB3] (152 aa)
Score = 173, Expect = 2.2e-11, Identities = 54/141 (38%), Positives = 75/141 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  +  I+  P +T+ IPTGI + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N  +E   L I  GD  AQ +F+     E     E  N     GGFG +  K
  S:    11 DSRIGSQFPLPAYATPGSAGMDLRAMLETSIQVAPGETILIPTGISIHVADSSLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRGSEPFTLEI--GDRLAQLVFVPVVQAEFKLVDEFDNSSRGEGGFGHSGTK 152
>gi|155371447|ref|YP_001426981.1| hypothetical protein ATCV1_Z500L [Acanthocystis turfacea Chlorella virus 1] >gi|155124767|gb|ABT16634.1| hypothetical protein ATCV1_Z500L [Acanthocystis turfacea Chlorella virus 1] (162 aa)
Score = 173, Expect = 2.2e-11, Identities = 48/138 (34%), Positives = 72/138 (52%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE----DDQASEIRNGGFGSTNK 162
           +L  S  +P R T  SAGYD  +  D+V+     V +PTG+ +++  ++   I PRS L FK+   +D   GV+D+DY        + + L N +  + E  IKKGD  AQ +     + +    DD     R GGFGST +
  S:    30 KLDESAVVPTRGTALSAGYDLSSVADVVVPSLGRVAVPTGLAIKVPANTYGRIAPRSGLAFKH--GIDVLAGVVDADY-----RAEVKVILYNTSGVDYE--IKKGDRIAQLVIEKIEMLDVAVVDDLEETSRTGGFGSTGR 162
>gi|152977699|ref|YP_001343328.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Actinobacillus succinogenes 130Z] >gi|171472901|sp|A6VK96|DUT_ACTSZ Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|150839422|gb|ABR73393.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Actinobacillus succinogenes 130Z] (151 aa)
Score = 173, Expect = 2.5e-11, Identities = 50/132 (37%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D    I+P +T  IPTG+ V + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N +  +K   ++ GD  AQ +F+      + I  + + ++   GGFG + KK
  S:    19 LPAYATTGSAGLDLRALTDEAFEIQPGETKLIPTGLSVYIADPQLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGPLMVSMWNRS--DKPFKVEVGDRIAQLVFVPVVQAEFNIVAEFEQTDRGEGGFGHSGKK 151
>gi|50119104|ref|YP_048271.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pectobacterium atrosepticum SCRI1043] >gi|56404361|sp|Q6DAV9|DUT_ERWCT Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|49609630|emb|CAG73063.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Erwinia carotovora subsp. atroseptica SCRI1043] (152 aa)
Score = 172, Expect = 2.5e-11, Identities = 48/131 (36%), Positives = 73/131 (55%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPK--QTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  I+ K  +T  IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   +     ++ G+  AQ +F+      + + ED   SE   GGFG + +
  S:    20 LPTYATPGSAGLDLRACLDQAIELKAGETTLIPTGLAIHIADTGLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWNRGQQT--FTVEPGERIAQMVFVPVVQAEFNLVEDFVGSERGEGGFGHSGR 151
>gi|113460288|ref|YP_718347.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus somnus 129PT] >gi|170718862|ref|YP_001783362.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Haemophilus somnus 2336] >gi|123327072|sp|Q0I0Y1|DUT_HAES1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|189027739|sp|B0UUW5|DUT_HAES2 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|112822331|gb|ABI24420.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Haemophilus somnus 129PT] >gi|168826991|gb|ACA32362.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Haemophilus somnus 2336] (151 aa)
Score = 172, Expect = 2.9e-11, Identities = 52/132 (39%), Positives = 77/132 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D    ++P +T  I TG+ + + + ++  +ILPRS LG K  + L N VG+IDSDY     +G + + L N +  +K   I+ GD  AQ +F+      + I E+ Q ++  NGGFG + KK
  S:    19 LPTYATIGSAGLDLRALVDEGFEVQPGETKLISTGLSIYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDY-----QGPLMVSLWNRS--DKPFKIEIGDRIAQLVFVPVVQAEFNIVEEFQQTDRGNGGFGHSGKK 151
>gi|69934601|ref|ZP_00629679.1| DeoxyUTP pyrophosphatase, subfamily 1 [Paracoccus denitrificans PD1222] >gi|119384679|ref|YP_915735.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Paracoccus denitrificans PD1222] >gi|119374446|gb|ABL70039.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Paracoccus denitrificans PD1222] (153 aa)
Score = 171, Expect = 3.7e-11, Identities = 50/134 (37%), Positives = 73/134 (54%)
  Q:    29 SIQLPKRATKHSAGYDFFAPY---DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           ++ LP+  T+ SAG D  A     +LV+ P Q   +PTG+RV++ E   + + PRSSL  K+ + L NT G IDSD  Y    G I I L+      +   I  G+  AQA+       +Y + E  + +    GGFGST +
  S:    18 ALPLPEYQTRGSAGADLRADLGGGELVLDPGQIRLVPTGLRVQIPEGYEMQVRPRSSLALKHGVTLPNTPGTIDSD--YRGPLGVIMINLS-----QQPYTIHHGERIAQAVVAPVTRAAYVMAEALEQTARGEGGFGSTGR 152
>gi|187929802|ref|YP_001900289.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Ralstonia pickettii 12J] >gi|187726692|gb|ACD27857.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Ralstonia pickettii 12J] (148 aa)
Score = 171, Expect = 3.7e-11, Identities = 51/132 (38%), Positives = 71/132 (53%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP+ AT  SAG D  A  D  L I+P  T  IPTG+ + + +     LILPRS +G K+ + L N VG+IDSDY     +G + +   N    +   V+   +  AQ + +        I +D   SE   GGFGST +
  S:    15 QLPQYATTGSAGLDLRACVDAPLTIEPGTTHLIPTGMAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGSTAFVLNPMERLAQLVIVPVVQAELNIVDDFAESERGAGGFGSTGR 147
>gi|167772483|ref|ZP_02444536.1| hypothetical protein ANACOL_03861 [Anaerotruncus colihominis DSM 17241] >gi|167665586|gb|EDS09716.1| hypothetical protein ANACOL_03861 [Anaerotruncus colihominis DSM 17241] (146 aa)
Score = 171, Expect = 3.7e-11, Identities = 51/135 (37%), Positives = 67/135 (49%)
  Q:    26 LYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGI-----TEDDQASEIRNGGFGST 160
           L  S Q+P  AT  SAG D  A  D  + ++P     IPTG+ V++       I  RS LG +Y +   N VGVIDSDY      G I + L N + E    VI+ G   AQ + L+         E    ++   GGFGST
  S:    10 LRPSAQIPSYATPGSAGLDLCADLDAPVTLEPGGAATIPTGLAVQLEPGRAGFIFARSGLGVRYGIVPSNCVGVIDSDY-----RGEILVGLRNQSQE--AFVIEPGMRVAQMVILAVETPPLLECEALDGTQRGTGGFGST 144
>gi|24375734|ref|NP_719777.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella oneidensis MR-1] >gi|32171387|sp|Q8E9M0|DUT_SHEON Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|24350675|gb|AAN57221.1|AE015858_2 deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella oneidensis MR-1] (152 aa)
Score = 171, Expect = 3.8e-11, Identities = 50/141 (35%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  + I P +T  +PTGI + + +  +  LILPRS LG K+ + L N VG++DSDY     +G + +   N ++    L I  GD  AQ +F+      + + ++  +S+   GGFG +  K
  S:    11 DSRIGSEFPLPAYATPGSAGMDLRAMIDTTMTIAPGETQLVPTGIAIHVADPGLAALILPRSGLGHKHGIVLGNLVGLVDSDY-----QGPLMVSCWNRSDTPFTLEI--GDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK 152
>gi|163783569|ref|ZP_02178559.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881189|gb|EDP74703.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Hydrogenivirga sp. 128-5-R1-1] (148 aa)
Score = 171, Expect = 3.8e-11, Identities = 49/131 (37%), Positives = 71/131 (54%)
  Q:    30 IQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGI-----TEDDQASEIRNGGFGST 160
           I+LP  AT+HSAG+D  A  P  +V+KP     IPTG    + E     + PRS L  K  + + N+ G +DSDY      G + + L N  +E  E+VI++G+  AQ +            E+  A+   +GGFGST
  S:    15 IELPSYATEHSAGFDLRAAVPKRIVLKPMDRALIPTGFIFEIPEGYEGQVRPRSGLAIKKGITVLNSPGTVDSDY-----RGEVKVILINLGHE--EVVIERGERIAQMVIAPVSRAHLIEVEEVSATARGDGGFGST 145
>gi|113971927|ref|YP_735720.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella sp. MR-4] >gi|117922204|ref|YP_871396.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella sp. ANA-3] >gi|123324585|sp|Q0HE54|DUT_SHESM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166218226|sp|A0L1S1|DUT_SHESA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|113886611|gb|ABI40663.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella sp. MR-4] >gi|117614536|gb|ABK49990.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella sp. ANA-3] (152 aa)
Score = 171, Expect = 3.9e-11, Identities = 51/141 (36%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  + I P +T  IPTGI + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N ++    L I  GD  AQ +F+      + + ++  +S+   GGFG +  K
  S:    11 DSRIGSEFPLPAYATPGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSDTPFTLEI--GDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK 152
>gi|55669664|pdb|1RNJ|A Chain A, Crystal Structure Of Inactive Mutant Dutpase Complexed With Substrate Analogue Imido-Dutp >gi|55669795|pdb|1SYL|A Chain A, Crystal Structure Of Inactive Mutant Dutpase Complexed With Substrate Dutp (152 aa)
Score = 171, Expect = 4.1e-11, Identities = 46/132 (34%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  +  ++  P  T  +PTG+ + + + S+  ++LPRS LG K+ + L N VG+I+SDY     +G + I + N   ++    I+ G+  AQ IF+      + + ED  A++   GGFG + ++
  S:    20 LPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLINSDY-----QGQLMISVWNRGQDS--FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 152
>gi|169823588|ref|YP_001691091.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Finegoldia magna ATCC 29328] >gi|167832208|dbj|BAG09123.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Finegoldia magna ATCC 29328] (142 aa)
Score = 171, Expect = 4.1e-11, Identities = 55/129 (42%), Positives = 74/129 (57%)
  Q:    34 KRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIRN-----GGFGSTNK 162
           K  TK SAG D  A  D    +K K+ V I T I V + +    +++PRSS+G K  L L NTVG+IDSDY      G I +K  N  NEN  + I+ G+  AQ I + Y    + + D  +E+       GGFGSTN+
  S:    11 KVGTKDSAGIDLPACLDEKTTVKAKEYVDINTKIHVEIPQGCFGMVVPRSSIGTKKHLALQNTVGIIDSDY-----RGAIKLKFFNYGNEN--IAIEDGEYVAQMIIVPYTSVDLQKVDTLNELSETERGAGGFGSTNR 142
>gi|167036323|ref|YP_001671554.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas putida GB-1] >gi|189027745|sp|B0KQ89|DUT_PSEPG Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166862811|gb|ABZ01219.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Pseudomonas putida GB-1] (151 aa)
Score = 171, Expect = 4.2e-11, Identities = 51/138 (36%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP  AT  SAG D  A    D V++P QT+ IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N +  N    I  G+  AQ + +      + I E    S+   GGFG +
  S:    10 DPRLGSEFPLPTYATPGSAGLDLRALLKEDTVLEPGQTLLIPTGLSIYIGDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWNRS--NTPFTIAVGERIAQLVLVPVVQAHFDIVEAFDESQRGAGGFGHS 148
>gi|170719371|ref|YP_001747059.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Pseudomonas putida W619] >gi|169757374|gb|ACA70690.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Pseudomonas putida W619] (151 aa)
Score = 171, Expect = 4.2e-11, Identities = 50/138 (36%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP+ AT  SAG D  A    D V++P QT+ IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    N    I  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRLGSEFPLPQYATPGSAGLDLRALLKEDTVLEPGQTLLIPTGLSIYIGDPGLAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGNTPFTIAVGERIAQLVLVPVVQAHFEVVEAFDESQRGTGGFGHS 148
>gi|115352613|ref|YP_774452.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia ambifaria AMMD] >gi|122322416|sp|Q0BCK5|DUT_BURCM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|115282601|gb|ABI88118.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia ambifaria AMMD] (148 aa)
Score = 170, Expect = 4.9e-11, Identities = 47/131 (35%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           +P  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ + +      + I +D   S+   GGFGST +
  S:    16 MPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSDRGEGGFGSTGR 147
>gi|71892379|ref|YP_278113.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|91206591|sp|Q491W8|DUT_BLOPB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|71796485|gb|AAZ41236.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Candidatus Blochmannia pennsylvanicus str. BPEN] (149 aa)
Score = 170, Expect = 5.4e-11, Identities = 47/117 (40%), Positives = 65/117 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           D  +Y    LPK AT  SAG D  A  D  L I P +T  I TGI + +++  +  +ILPRS LG KY + L N VG+IDSDY     +G + + L N     K+ ++  G   AQ +F+
  S:    10 DNRIYKHFYLPKYATSGSAGLDLSACLDKPLTIYPGKTHLISTGIAIHISDTKIAGVILPRSGLGHKYGIVLGNLVGLIDSDY-----QGELIVSLWN--RGPKKYIVYPGKRIAQLVFM 122
>gi|171319744|ref|ZP_02908832.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia ambifaria MEX-5] >gi|171095016|gb|EDT40039.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia ambifaria MEX-5] (148 aa)
Score = 170, Expect = 5.6e-11, Identities = 47/131 (35%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           +P  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ + +      + I +D   S+   GGFGST +
  S:    16 MPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGGTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSDRGEGGFGSTGR 147
>gi|153885604|ref|ZP_02006760.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Ralstonia pickettii 12D] >gi|151577526|gb|EDN41926.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Ralstonia pickettii 12D] (148 aa)
Score = 169, Expect = 5.9e-11, Identities = 50/132 (37%), Positives = 71/132 (53%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP+ AT  SAG D  A  D  L I+P  T  +PTG+ + + +     LILPRS +G K+ + L N VG+IDSDY     +G + +   N    +   V+   +  AQ + +        I +D   SE   GGFGST +
  S:    15 QLPQYATTGSAGLDLRACIDAPLTIEPGTTHLVPTGMAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGSTAFVLNPMERLAQLVIVPVVQAELNIVDDFAESERGAGGFGSTGR 147
>gi|71908753|ref|YP_286340.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Dechloromonas aromatica RCB] >gi|91206598|sp|Q47BB1|DUT_DECAR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|71848374|gb|AAZ47870.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Dechloromonas aromatica RCB] (149 aa)
Score = 169, Expect = 6.0e-11, Identities = 49/130 (37%), Positives = 71/130 (54%)
  Q:    33 PKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           P  AT  SAG D  A  +  L ++P QT  +PTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N    +    +   D  AQ I      + + I +D  AS    GGFGST K
  S:    18 PHYATPGSAGLDLRACIEAPLHVEPGQTTLVPTGMAIHLADPGLAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSVWN--RGHASFTLNPLDRIAQLIIVPVLQVGFNIVDDFDASHRGEGGFGSTGK 148
>gi|26991962|ref|NP_747387.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas putida KT2440] >gi|32171375|sp|Q88C95|DUT_PSEPK Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|24987091|gb|AAN70851.1|AE016729_9 deoxyuridine 5-triphosphate nucleotidohydrolase [Pseudomonas putida KT2440] (151 aa)
Score = 169, Expect = 6.5e-11, Identities = 51/138 (36%), Positives = 73/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP  AT  SAG D  A    D +++P QTV IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    N    I  G+  AQ + +      + I E    S+   GGFG +
  S:    10 DPRLGSEFPLPAYATPGSAGLDLRALLKEDTILEPGQTVLIPTGLSIYIGDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGNTPFTIAVGERIAQLVLVPVVQAHFEIVEAFDESQRGAGGFGHS 148
>gi|149277492|ref|ZP_01883633.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pedobacter sp. BAL39] >gi|149231725|gb|EDM37103.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pedobacter sp. BAL39] (143 aa)
Score = 168, Expect = 8.7e-11, Identities = 45/131 (34%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDF--FAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           LP+  T H+AG D   F   ++VIKP Q V +PTG+ + +       I PRS L +K+ + + N+ G ID+DY      G I + L N +  + + V+  GD  AQ +   +     + A E+ +     GG+G T K
  S:    13 LPQYETAHAAGMDMRAFVDAEVVIKPLQRVLVPTGLHIELPVGFEAQIRPRSGLAYKHGISIVNSPGTIDADY-----RGEIKVLLVNLS--DTDFVVNNGDRIAQMVIAKHETISWELADELSDTARGAGGYGHTGK 143
>gi|74318604|ref|YP_316344.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Thiobacillus denitrificans ATCC 25259] >gi|91206616|sp|Q3SFR7|DUT_THIDA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|74058099|gb|AAZ98539.1| DeoxyUTP pyrophosphatase [Thiobacillus denitrificans ATCC 25259] (146 aa)
Score = 168, Expect = 8.8e-11, Identities = 48/133 (36%), Positives = 74/133 (55%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           QLP  AT  +AG D  A  D  + + P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N + ++ ELV    +  AQ + +      + I E  + +    GGFGST ++
  S:    13 QLPHYATPGAAGLDLRACIDAPITLAPGETRLVPTGMAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRSEQSFELV--PLERLAQLVIVPVVQARFNIVEAFETTARGEGGFGSTGRQ 146
>gi|38639933|ref|NP_943888.1| hypothetical protein Aeh1p010 [Aeromonas phage Aeh1] >gi|33414622|gb|AAQ17665.1| hypothetical protein Aeh1ORF010c [Bacteriophage Aeh1] (161 aa)
Score = 168, Expect = 9.1e-11, Identities = 55/133 (41%), Positives = 77/133 (57%)
  Q:    31 QLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNE---DSVLL-------ILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY----GITED---DQASEIRNGGFGSTNKK 163
           +LP   +  +AG D  A     +V+KP + + IP+G+++ +      SV L       ILPRS LGFK+ ++L NT GVIDSDY+     G I IKL N+     +L I  GD   Q +F  Y    G  E    D+ +E    G GS+  K
  S:    17 ELPAFKSAEAAGIDLRAAIAETVVLKPGEDIVIPSGLKMDIGALQLASVFLDIGVYGCILPRSGLGFKHYVRLANTAGVIDSDYH-----GEIMIKLRNEG--TGDLTIVPGDRVVQMVFHLYVKGFGFKEVESFDRNTERGESGIGSSGVK 161
>gi|50084110|ref|YP_045620.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter sp. ADP1] >gi|56404364|sp|Q6FDR0|DUT_ACIAD Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|49530086|emb|CAG67798.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter sp. ADP1] (150 aa)
Score = 168, Expect = 9.5e-11, Identities = 51/132 (38%), Positives = 72/132 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI-----RNGGFGSTNKK 163
           LP  AT  SAG D  A  D  + I+P QTV I TG+ + +++ +   LILPRS LG K+ + L N VG+IDSDY     +G + I + N         ++ G+  AQ + +     E +Q  E        GGFG T +K
  S:    18 LPSYATTGSAGLDLRACLDEAIQIEPGQTVLIKTGMAIYIHDTNFAGLILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISVWNRGQNT--FTLEPGERLAQYVLVPVIQAEFEQVEEFVATDRGAGGFGHTGQK 150
>gi|52425992|ref|YP_089129.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mannheimia succiniciproducens MBEL55E] >gi|61212376|sp|Q65R66|DUT_MANSM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|52308044|gb|AAU38544.1| Dut protein [Mannheimia succiniciproducens MBEL55E] (151 aa)
Score = 167, Expect = 1.0e-10, Identities = 52/141 (36%), Positives = 78/141 (55%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA----PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + N   LP  AT  SAG D  A     +DL  +P +T  IPTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N     +   I+ GD  AQ +F+      + I  D   +E   GGFG + K+
  S:    10 DSRIGNEFPLPAYATSGSAGLDLRALIEEGFDL--QPGETKLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSMWN--RGEQPFRIEVGDRIAQLVFVPVVQAEFNIVTDFTQTERGEGGFGHSGKQ 151
>gi|169831100|ref|YP_001717082.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Candidatus Desulforudis audaxviator MP104C] >gi|169637944|gb|ACA59450.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Candidatus Desulforudis audaxviator MP104C] (155 aa)
Score = 167, Expect = 1.0e-10, Identities = 49/130 (37%), Positives = 69/130 (53%)
  Q:    33 PKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           P  AT  +AG D  A  D  L I P + V+IPTGI V++ E +++ L+  RS L  ++ + L N VGVID+DY      G I   + N   E     +  GD  AQ + +   + E +   E+       GGFGST K
  S:    25 PAYATSGAAGLDLCAALDSSLTIAPGERVQIPTGIAVQLPERNLVGLVFGRSGLAARHGITLANGVGVIDADY-----TGEIICPVVNHGTE--PFTLSPGDRIAQLVCVPIAVAEVEYVFELAETARGAGGFGSTGK 155
>gi|77412158|ref|ZP_00788480.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae CJB111] >gi|77161776|gb|EAO72765.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae CJB111] (87 aa)
Score = 167, Expect = 1.1e-10, Identities = 39/88 (44%), Positives = 59/88 (67%)
  Q:    75 LLILPRSSLGFKYRLQLDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           L +  RSS   K  + L N+VGVID DYY +  NEGHIF ++ N T++   +++++G+   QA+F  + + +DDQA+ +R GGFGST K
  S:     1 LYLYDRSSNPRKKGIVLINSVGVIDGDYYNNQVNEGHIFAQMQNITDQ--AVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK 87
>gi|148550396|ref|YP_001270498.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas putida F1] >gi|166217636|sp|A5WB04|DUT_PSEP1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|148514454|gb|ABQ81314.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas putida F1] (151 aa)
Score = 167, Expect = 1.2e-10, Identities = 50/138 (36%), Positives = 73/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP  AT  SAG D  A    D +++P QT+ IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    N    I  G+  AQ + +      + I E    S+   GGFG +
  S:    10 DPRLGSEFPLPAYATPGSAGLDLRALLKEDTLLEPGQTILIPTGLSIYIGDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGNTPFTIAVGERIAQLVLVPVVQAHFDIVEAFDESQRGAGGFGHS 148
>gi|146309392|ref|YP_001189857.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas mendocina ymp] >gi|166217635|sp|A4Y0K9|DUT_PSEMY Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|145577593|gb|ABP87125.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas mendocina ymp] (151 aa)
Score = 166, Expect = 1.3e-10, Identities = 49/138 (35%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L     LP+ AT  SAG D  A    D+V++P QTV IPTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    +    I  G+  AQ + +      + + E    ++   GGFG +
  S:    10 DPRLGQEFPLPQYATPGSAGLDLRAMLKEDIVLEPGQTVLIPTGLSIYIGDPGLAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGHTPFTIAIGERIAQLVLVPVVQAHFELVEQFDETQRGAGGFGHS 148
>gi|118728022|ref|ZP_01576600.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Clostridium cellulolyticum H10] >gi|118662585|gb|EAV69268.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Clostridium cellulolyticum H10] (167 aa)
Score = 166, Expect = 1.4e-10, Identities = 54/129 (41%), Positives = 74/129 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTND-----------TNENKE-----LVIKKGDGFAQAIFL---SYGITEDDQASEI---RNGGFGST 160
           LPK A    AG D +A   ++I P +TV +PTG++V + E   + + PRS + FK  L++ N+ G IDS Y    +E  I I  ++D           T E KE      +I+KGD  AQ +         T  D   EI   R GGFGST
  S:    16 LPKYANPGDAGMDVYAAESVMIAPGETVVVPTGLKVAIPEGYEIQVRPRSGISFKTPLRVPNSPGTIDSGY---RDELGIIISNSSDIDVPDNRETPYTLEEKENRKGTYIIRKGDRIAQIVLQVVPKMKFTVVDSVREIGSDRGGGFGST 163
>gi|28867324|ref|NP_789943.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas syringae pv. tomato str. DC3000] >gi|32171374|sp|Q88BD3|DUT_PSESM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|28850558|gb|AAO53638.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Pseudomonas syringae pv. tomato str. DC3000] (151 aa)
Score = 165, Expect = 1.7e-10, Identities = 49/138 (35%), Positives = 73/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           D  + N   LP  AT  SAG D  A    D +++P QT+ IPTG+ + + +  +  LILPRS LG K+ + L N VG+IDSDY     +G + +   N         I  G+  AQ + +      + + E+   S+   GGFG +
  S:    10 DPRIGNEFPLPAYATVGSAGLDLRAMLKEDTLLEPGQTLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQTAFTIAVGERIAQLVLVPVVQARFELVEEFDESQRGTGGFGHS 148
>gi|109081025|ref|XP_001113050.1| PREDICTED: dUTP pyrophosphatase isoform 5 [Macaca mulatta] (252 aa)
Score = 165, Expect = 1.8e-10, Identities = 49/130 (37%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  KY   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:   126 PTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKYF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 251
>gi|91791691|ref|YP_561342.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella denitrificans OS217] >gi|123166543|sp|Q12SF7|DUT_SHEDO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91713693|gb|ABE53619.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Shewanella denitrificans OS217] (152 aa)
Score = 165, Expect = 1.8e-10, Identities = 48/132 (36%), Positives = 75/132 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  L + P +T  IPTGI + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N ++    L +  G+  AQ +F+      + + ++ + S+   GGFG +  +
  S:    20 LPAYATPGSAGMDLRAMVDTELTLAPGETKLIPTGIAIHVADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSDTPFTLTL--GERLAQLVFVPVVQAQFTLVDEFERSDRGEGGFGHSGTQ 152
>gi|18043437|gb|AAH19979.1| Dutp protein [Mus musculus] >gi|74183168|dbj|BAE22532.1| unnamed protein product [Mus musculus] >gi|123858098|emb|CAM17717.1| deoxyuridine triphosphatase [Mus musculus] >gi|148696190|gb|EDL28137.1| deoxyuridine triphosphatase, isoform CRA_b [Mus musculus] (200 aa)
Score = 165, Expect = 1.9e-10, Identities = 49/130 (37%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD F+ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   +SY   E+ Q    +E  +GGFGST K
  S:    74 PTRGSARAAGYDLFSAYDYTISPMEKAIVKTDIQIAVPSGCYGRVAPRSGLAVKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERISYPDLEEVQTLDDTERGSGGFGSTGK 199
>gi|134298366|ref|YP_001111862.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Desulfotomaculum reducens MI-1] >gi|134051066|gb|ABO49037.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Desulfotomaculum reducens MI-1] (148 aa)
Score = 165, Expect = 1.9e-10, Identities = 48/143 (33%), Positives = 75/143 (52%)
  Q:    18 SFEN---KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           SF+N   K  +++ + ++PK+AT  SAG+D        I P +   + TG+   +     +L+ PRS    K+ + L N VGV+DSDY      G + + L N  +   E+  + GD  AQAI  +    E  +  E+ +     GGFGST
  S:     3 SFKNCLVKIKKIHENAEIPKKATSESAGFDLHTIESFTIYPGEHKSVRTGLVFELPPSYAMLVYPRSGNAKKHGITLSNAVGVVDSDY-----RGEVMVLLYNTGDH--EVSFQVGDRIAQAIIHALPDIELIECEELSDTKRGKGGFGST 146
>gi|194558408|ref|YP_002093434.1| dUTP pyrophosphatase [Burkholderia cenocepacia PC184] >gi|124872199|gb|EAY63915.1| dUTP pyrophosphatase [Burkholderia cenocepacia PC184] (148 aa)
Score = 165, Expect = 2.0e-10, Identities = 47/131 (35%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N      E V+   +  AQ + +      + I ++   S+   GGFGST +
  S:    16 LPAYATTGSAGPDLRACLDAPVTLQPGETTLVPTGLAIHLADPRYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTEFVLNPFERLAQLVIVPVVQAQFNIVDEFTESDRGEGGFGSTGR 147
>gi|170728882|ref|YP_001762908.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella woodyi ATCC 51908] >gi|169814229|gb|ACA88813.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella woodyi ATCC 51908] (152 aa)
Score = 164, Expect = 2.2e-10, Identities = 51/129 (39%), Positives = 70/129 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           LP  AT  SAG D  A  +  L + P +T  IPTGI + + + S+  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    +K   I+ GD  AQ +F+     E     E  N     GGFG +
  S:    20 LPAYATPGSAGMDLRAMIETSLSVAPGETRLIPTGISIHVADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWN--RGDKPYTIEIGDRLAQLVFVPVVQAEFKLVDEFDNSLRGEGGFGHS 149
>gi|15794059|ref|NP_283881.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis Z2491] >gi|22095603|sp|Q9JUW1|DUT_NEIMA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|121052012|emb|CAM08321.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis Z2491] (150 aa)
Score = 164, Expect = 2.2e-10, Identities = 48/129 (37%), Positives = 74/129 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           +P  ATK SAG D  A  D  +V++P +T  +PTG+ + + + S   ++LPRS LG K+ + L N VG+IDSDY     +G + + L N ++E     +K  +  AQ + +      +   E+   S    GGFGST
  S:    18 VPVYATKGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLADPSYAAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELKVSLWNRSSE--PFTVKPFERIAQMVIVPIVQARFKRVEEFVGSSRGEGGFGST 147
>gi|124262824|ref|YP_001023294.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylibium petroleiphilum PM1] >gi|124262070|gb|ABM97059.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Methylibium petroleiphilum PM1] (147 aa)
Score = 164, Expect = 2.3e-10, Identities = 51/130 (39%), Positives = 71/130 (54%)
  Q:    31 QLPKRATKHSAGYDFFAPYD---LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIRN--GGFGST 160
           ++P+ AT  +A +D  A  D     I P  +V   TG+   + E  VL +  RS  GFK+ ++L NT G+IDSDY  S     + +KL ND  E  E  +K GD  AQA+ +        E DQ ++     GGFGST
  S:    15 RVPEYATSGAACFDLHACIDDGPPSIVPGASVAFDTGLAFEIPEGYVLQVFSRSGHGFKHGVRLANTTGIIDSDYRDS-----VKVKLHNDGKEPFE--VKAGDRIAQAMVIPVPRCSFEEVDQLTDTARGLGGFGST 145
>gi|109081023|ref|XP_001112992.1| PREDICTED: dUTP pyrophosphatase isoform 3 [Macaca mulatta] >gi|90081266|dbj|BAE90113.1| unnamed protein product [Macaca fascicularis] (192 aa)
Score = 164, Expect = 2.4e-10, Identities = 49/130 (37%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  KY   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    66 PTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKYF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 191
>gi|196195576|gb|EDX90535.1| dUTP diphosphatase superfamily [Alcanivorax sp. DG881] (150 aa)
Score = 164, Expect = 2.4e-10, Identities = 50/140 (35%), Positives = 75/140 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQ-----ASEIRNGGFGSTNK 162
           D  L +SI LP  AT  SAG D  A     L ++P  T  +PTG+ + +++     +ILPRS LG K+ + L N VG+IDSDY     +G + +   N     +   ++ G+  AQ + +     E +Q     ASE   GGFG + +
  S:     9 DARLGDSIPLPHYATDGSAGLDLRAMVKEPLTLQPGDTELLPTGMSIFIDDPGYAGMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQQPFTLEPGERIAQLVIVPVMQVELEQVESFSASERGEGGFGHSGR 149
>gi|33520049|ref|NP_878881.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Candidatus Blochmannia floridanus] >gi|48427882|sp|Q7VRK0|DUT_BLOFL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|33504395|emb|CAD83288.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Candidatus Blochmannia floridanus] (151 aa)
Score = 164, Expect = 2.4e-10, Identities = 45/109 (41%), Positives = 63/109 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS 140
           LP+  T  SAG D  A  +  + I PK+T  IPTGI + + +  V  +ILPRS LG  Y + L NT+G+IDSDY     +G I I L N    + + ++  G   AQ +F+S
  S:    18 LPQHITPGSAGLDLLACIEKPVSILPKETRLIPTGIAIYIEDIEVAGIILPRSGLGHYYGIVLGNTIGLIDSDY-----QGEIMISLWN--RGSNKFILYPGKRIAQLLFIS 122
>gi|114045867|ref|YP_736417.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Shewanella sp. MR-7] >gi|123326958|sp|Q0HZU5|DUT_SHESR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|113887309|gb|ABI41360.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Shewanella sp. MR-7] (152 aa)
Score = 164, Expect = 2.5e-10, Identities = 50/141 (35%), Positives = 77/141 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  + +   LP  AT  SAG D  A  D  + I P +T  IPTGI + + +  +  ++LPRS LG K+ + L N VG+IDSDY     +G + +   N ++    L I  GD  AQ +F+      + + ++  +S+   GGFG +  K
  S:    11 DSRIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGPLMVSCWNRSDIPFTLEI--GDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK 152
>gi|126664664|ref|ZP_01735648.1| dUTPase [Marinobacter sp. ELB17] >gi|126630990|gb|EBA01604.1| dUTPase [Marinobacter sp. ELB17] (153 aa)
Score = 164, Expect = 2.5e-10, Identities = 49/140 (35%), Positives = 73/140 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           D  +  SI  P  AT  SAG D  A     LV++P  T  I TG+ + + + D   LILPRS LG K+ + L N VG+IDSDY     +G + +   N         ++ G+  AQ + +      + + ++  +S    GGFGST +
  S:    12 DERIGQSIAFPAYATDGSAGLDLRACLSQPLVLEPGDTQLIGTGLAIHIADPDLAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQTRFTVEPGERLAQLVLVPVVQAEFEVVDEFDSSHRGTGGFGSTGR 152
>gi|188532225|ref|YP_001906022.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTP pyrophosphatase) [Erwinia tasmaniensis] >gi|188027267|emb|CAO95110.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTP pyrophosphatase) [Erwinia tasmaniensis] (152 aa)
Score = 164, Expect = 2.7e-10, Identities = 47/141 (33%), Positives = 76/141 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           D  +     LP  AT  SAG D  A  +   V++P  T  +PTG+ + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   ++    I+ G+  AQ +F+      + +  D  AS    GGFG + ++
  S:    11 DARVGTDFPLPTYATSGSAGLDLRACLNEATVLQPGATTLLPTGLAIHIADPQLAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGPLMVSVWNRGQDS--FTIEPGERIAQMVFVPVVQAEFNLVNDFDASVRGEGGFGHSGRQ 152
>gi|70733336|ref|YP_263111.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas fluorescens Pf-5] >gi|91206607|sp|Q4K3S2|DUT_PSEF5 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|68347635|gb|AAY95241.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas fluorescens Pf-5] (151 aa)
Score = 164, Expect = 2.7e-10, Identities = 49/138 (35%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  + N   LP+ AT  SAG D  A    D +++P QT+ IPTG+ V + +  +  LILPRS LG K+ + L N VG+IDSDY     +G + +   N       + +  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRIGNEFPLPQYATPGSAGLDLRAMLKEDTLLEPGQTLLIPTGLSVYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWNRGQTAFNIAV--GERIAQLVLVPVVQAHFEVVEAFDESQRGAGGFGHS 148
>gi|145295809|ref|YP_001138630.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Corynebacterium glutamicum R] >gi|166217617|sp|A4QER2|DUT_CORGB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|140845729|dbj|BAF54728.1| hypothetical protein [Corynebacterium glutamicum R] (149 aa)
Score = 164, Expect = 2.7e-10, Identities = 47/141 (33%), Positives = 71/141 (50%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNG-----GFGSTNK 162
           K + L   + LPKRA +  AG D  A  D VI P     + TGI + +   +V L+ PRS L  +  L + N  G ID+DY      G I + L N  +  K ++I +GD  AQ +     + + ++  E+ +      G+GST K
  S:     8 KIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADY-----RGEIKVCLIN-LDPEKPIMITRGDRIAQLVIQKVELVDFEEVEELDDTVRGDQGYGSTGK 147
>gi|19553109|ref|NP_601111.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Corynebacterium glutamicum ATCC 13032] >gi|62390744|ref|YP_226146.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Corynebacterium glutamicum ATCC 13032] >gi|45593161|sp|Q8NPA9|DUT_CORGL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|21324675|dbj|BAB99298.1| dUTPase [Corynebacterium glutamicum ATCC 13032] >gi|41326082|emb|CAF20245.1| PROBABLE DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHY [Corynebacterium glutamicum ATCC 13032] (149 aa)
Score = 164, Expect = 2.7e-10, Identities = 47/141 (33%), Positives = 71/141 (50%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNG-----GFGSTNK 162
           K + L   + LPKRA +  AG D  A  D VI P     + TGI + +   +V L+ PRS L  +  L + N  G ID+DY      G I + L N  +  K ++I +GD  AQ +     + + ++  E+ +      G+GST K
  S:     8 KIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADY-----RGEIKVCLIN-LDPEKPIMITRGDRIAQLVIQKVELVDFEEVEELDDTVRGDQGYGSTGK 147
>gi|15617151|ref|NP_240364.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131999|sp|P57623|DUT_BUCAI Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|25290397|pir||B84995 dUTP diphosphatase (EC 3.6.1.23) [imported] - Buchnera sp. (strain APS) >gi|10039216|dbj|BAB13250.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (154 aa)
Score = 163, Expect = 2.8e-10, Identities = 47/117 (40%), Positives = 66/117 (56%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPK--QTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           D  + N+  LP  AT  S+G D  A  D  +K K  +T+ IPTGI + + N +   LILPRS LG K  + L N VG+IDSDY     +G + I L N +++  +  +   D  AQ IF+
  S:    10 DSRMKNNFSLPSYATLGSSGLDLRACLDETVKLKAHKTILIPTGIAIYIANPNITALILPRSGLGHKKGIVLGNLVGLIDSDY-----QGQLMISLWNRSDQ--DFYVNPHDRVAQIIFV 122
>gi|124516255|gb|EAY57763.1| putative DeoxyUTP pyrophosphatase, subfamily 1 [Leptospirillum sp. Group II UBA] (157 aa)
Score = 163, Expect = 2.9e-10, Identities = 53/138 (38%), Positives = 75/138 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP  +T  SAG D  A  D  L + P + V+IP+GI + + + SV  L+ PRS LG +  L L N  GVID+DY      G + + L N   E   L I+ GD  AQ +F+S     + + ++   +E   GGFG T
  S:    18 DGRLPDPFPLPSFSTPGSAGMDLRAMPDGPLRLAPGERVRIPSGIAIHIGDPSVAGLVFPRSGLGSR-GLVLSNLTGVIDADY-----TGPLTLALWNAGEE--PLDIRPGDRVAQIVFVSVVRPVWEVVDEHHFTERGEGGFGHT 155
>gi|82703255|ref|YP_412821.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosospira multiformis ATCC 25196] >gi|91206601|sp|Q2Y742|DUT_NITMU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|82411320|gb|ABB75429.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosospira multiformis ATCC 25196] (149 aa)
Score = 163, Expect = 2.9e-10, Identities = 51/140 (36%), Positives = 79/140 (56%)
  Q:    23 DIELYNSI---QLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQ-----AIFLSYGITEDDQASEIRNGGFGSTNK 162
           DI++ +S    QLP  AT  SAG D  A   + + I+P +   IPTGI + +++  +  L+LPRS LG K+ + + N VG+IDSDY     +G IF+   N        ++   +  AQ      + + + + +D + SE    GFGST K
  S:     5 DIKILDSRLKDQLPAYATSGSAGLDLRACIEHVMTIQPGEAHLIPTGIAIHLSDPGLAALVLPRSGLGHKHGIVMGNLVGLIDSDY-----QGQIFVSCWN--RGQAPFLLNPLERIAQLVVVPVVQVGFKVVDDFEQSERGANGFGSTGK 148
>gi|87120859|ref|ZP_01076751.1| DeoxyUTP pyrophosphatase subfamily 1 [Marinomonas sp. MED121] >gi|86163697|gb|EAQ64970.1| DeoxyUTP pyrophosphatase subfamily 1 [Marinomonas sp. MED121] (152 aa)
Score = 163, Expect = 3.0e-10, Identities = 47/122 (38%), Positives = 65/122 (53%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASE 151
           I LP  AT+ SAG D  A  D  + +KP  T  IPTG+ + + + S+   ILPRS LG K+ + L N VG+IDSDY     +G + +   N      E  I+ G+  AQ + L     E D  +E
  S:    18 IPLPSYATEGSAGLDLRACLDEAITLKPGDTKLIPTGLSIYIQDPSLAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQTEFTIEAGERIAQLVLLPVVQAEFDIVTE 135
>gi|120556467|ref|YP_960818.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Marinobacter aquaeolei VT8] >gi|120326316|gb|ABM20631.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Marinobacter aquaeolei VT8] (153 aa)
Score = 163, Expect = 3.0e-10, Identities = 50/138 (36%), Positives = 72/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           D  +   I  P+ AT+ SAG D  A       I P +T  IPTG+ V + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N         I+ G+  AQ + +      + I  +  AS+   GGFGST
  S:    12 DDRIGTGIPFPEYATEGSAGLDLRAALKEAKTIMPGETFLIPTGLSVHIADPELAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQTPFTIEVGERIAQMVLVPVVQADFEIVTEFDASDRGEGGFGST 150
>gi|121593420|ref|YP_985316.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acidovorax sp. JS42] >gi|120605500|gb|ABM41240.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acidovorax sp. JS42] (148 aa)
Score = 163, Expect = 3.1e-10, Identities = 47/132 (35%), Positives = 72/132 (54%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A  +  L ++P     +PTGI + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N + +     ++  +  AQ + +      + + ++  ASE   GG+GST K
  S:    15 QLPTYATPGSAGLDLRACLEAPLTLEPNAWQLVPTGIAIYLQDPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRSPQ--AFTLQPMERLAQLVIVPVVQAQFNVVQEFPASERGEGGYGSTGK 147
>gi|148263965|ref|YP_001230671.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacter uraniireducens Rf4] >gi|146397465|gb|ABQ26098.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Geobacter uraniireducens Rf4] (163 aa)
Score = 163, Expect = 3.1e-10, Identities = 47/131 (35%), Positives = 69/131 (52%)
  Q:    32 LPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           LP+  T H+AG D  A    DLV+KP     +PTGI + + E     I PRS L  K+ + L N+ G ID+DY      G I + + N   E    +IK  +  AQ +F  +     ++A+E+ +     GGFG T +
  S:    33 LPQYMTLHAAGMDLSACLSEDLVLKPGARTLVPTGIAIELPEGYEAQIRPRSGLALKHGVTLVNSPGTIDADY-----RGEIGVIIINHGEE--PFIIKNQERIAQMVFAPFIRAIFEEAAELGDTQRGAGGFGHTGR 163
>gi|195952524|ref|YP_002120814.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Hydrogenobaculum sp. Y04AAS1] >gi|195932136|gb|ACG56836.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Hydrogenobaculum sp. Y04AAS1] (144 aa)
Score = 163, Expect = 3.1e-10, Identities = 51/139 (36%), Positives = 74/139 (53%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLV-IKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNKK 163
           +L     LP  AT  ++G D F   D+V I+P + V + TGI + + E     I PRS L  K  + + N+ G ID DY      G I + L N +  +KE++I+KG+  AQ + +     E  +A E+ N     GGFGST  K
  S:     7 KLREDAALPFYATSGASGLDLFCVDDVVVIRPFERVLVSTGIAIELPEGYEAQIRPRSGLALKKGVTVLNSPGTIDHDY-----RGEIKVILINLS--DKEVIIEKGERIAQMVIVPVLKVEVVEAKELSNTQRQDGGFGSTGMK 144
>gi|17547182|ref|NP_520584.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia solanacearum GMI1000] >gi|22095594|sp|Q8XWL1|DUT_RALSO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|17429484|emb|CAD16170.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dutpase) (dutp pyrophosphatase) protein [Ralstonia solanacearum] (148 aa)
Score = 163, Expect = 3.3e-10, Identities = 50/132 (37%), Positives = 70/132 (53%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP+ AT  SAG D  A  D  L ++P  T  IPTG+ + + +     LILPRS +G K+ + L N VG+IDSDY     +G + I   N    +   V+   +  AQ + +        I +    SE   GGFGST +
  S:    15 QLPQYATPGSAGLDLRACLDAPLTLEPGSTHLIPTGMAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMISTWN--RGDTAFVLNPMERLAQLVIVPVVQAELNIVDAFAESERGAGGFGSTGR 147
>gi|77409719|ref|ZP_00786381.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae COH1] >gi|77171671|gb|EAO74878.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae COH1] (71 aa)
Score = 163, Expect = 3.6e-10, Identities = 34/72 (47%), Positives = 52/72 (72%)
  Q:    91 LDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           L N+VGVID DYY +  NEGHIF ++ N T++   +++++G+   QA+F  + + +DDQA+ +R GGFGST K
  S:     1 LINSVGVIDGDYYNNQVNEGHIFAQMQNITDQ--AVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK 71
>gi|121634667|ref|YP_974912.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis FAM18] >gi|120866373|emb|CAM10116.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis FAM18] (160 aa)
Score = 162, Expect = 3.9e-10, Identities = 48/129 (37%), Positives = 73/129 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           +P  ATK SAG D  A  D  +V++P +T  +PTG+ + + N     ++LPRS LG K+ + L N VG+IDSDY     +G + + L N ++E     +K  +  AQ + +      +   E+   S    GGFGST
  S:    28 VPVYATKGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELKVSLWNRSSE--PFTVKPFERIAQMVVVPIVQARFKRVEEFVGSSRGEGGFGST 157
>gi|88813086|ref|ZP_01128328.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrococcus mobilis Nb-231] >gi|88789719|gb|EAR20844.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrococcus mobilis Nb-231] (151 aa)
Score = 162, Expect = 4.2e-10, Identities = 49/117 (41%), Positives = 62/117 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           D  L +    P+ AT  SAG D  A  +  L +   QT  IPTGI V + N     LILPRS LG K+ + L N VG+IDSDY     +G IF+   N     K   I+ G+  AQ IF+
  S:    10 DPRLESEFTPPEYATDGSAGLDLRACLEAPLTLGADQTELIPTGIAVHIGNTGFAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQIFVSCWN--RGMKPFTIEPGERIAQLIFI 122
>gi|88797502|ref|ZP_01113091.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Reinekea sp. MED297] >gi|88779674|gb|EAR10860.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Reinekea sp. MED297] (152 aa)
Score = 162, Expect = 4.2e-10, Identities = 52/138 (37%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL--LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           D  +   I LP   T  +AG D  A  D  L I+P +T  I TG+ + + ED  L   ILPRS LG K+ + L N VG+IDSDY     +G + +   N     +   I+ GD  AQ + L     S+ + ++   ++   GGFGST
  S:    11 DPRVGQDIPLPAYGTDGAAGMDLRALLDEPLTIQPGETHLIGTGLAIYI-EDPALAATILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQQAFTIEPGDRIAQLVLLPVVQASFTVVDEFADTQRGAGGFGST 149
>gi|146296969|ref|YP_001180740.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410545|gb|ABP67549.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Caldicellulosiruptor saccharolyticus DSM 8903] (146 aa)
Score = 162, Expect = 4.3e-10, Identities = 52/131 (39%), Positives = 70/131 (53%)
  Q:    30 IQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIR--NGGFGST 160
           + LP+ A+  SAG D FA    ++VI P +   I TGI + + +     I PRS L  KY + + N+ G IDSDY      G I I L N   E    ++K+GD  AQ +   Y    I E  + SE    +GGFGST
  S:    14 LPLPQYASAGSAGMDLFACVENEVVINPGEIKLIRTGIYIELPDGYEAQIRPRSGLALKYGITILNSPGTIDSDY-----RGEICIILINLGKE--PFIVKRGDRIAQMVVCKYEKVKIEEVYKLSETERGDGGFGST 144
>gi|77406228|ref|ZP_00783297.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae H36B] >gi|77175178|gb|EAO77978.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Streptococcus agalactiae H36B] (79 aa)
Score = 162, Expect = 4.5e-10, Identities = 34/72 (47%), Positives = 52/72 (72%)
  Q:    91 LDNTVGVIDSDYYYSD-NEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           L N+VGVID DYY +  NEGHIF ++ N T++   +++++G+   QA+F  + + +DDQA+ +R GGFGST K
  S:     9 LINSVGVIDGDYYNNQVNEGHIFAQMQNITDQ--AVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK 79
>gi|158256462|dbj|BAF84204.1| unnamed protein product [Homo sapiens] (164 aa)
Score = 162, Expect = 4.7e-10, Identities = 49/130 (37%), Positives = 69/130 (53%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRSSL  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    38 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSSLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 163
>gi|156399732|ref|XP_001638655.1| predicted protein [Nematostella vectensis] >gi|156225777|gb|EDO46592.1| predicted protein [Nematostella vectensis] (162 aa)
Score = 161, Expect = 4.9e-10, Identities = 47/130 (36%), Positives = 67/130 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           P R + H+AGYD ++ YD+ I  +    + T I V + +     + PRSSL +K+  Q+D   GVID D  Y  N G +   L +   E     +K+GD  AQ I       S    ED  ++E   GG+GST K
  S:    37 PTRGSSHAAGYDLYSAYDVSIPAQGKALVKTDIAVAIPDGCYGRVAPRSSLAWKH--QIDVGAGVIDRD--YRGNVGVVLFNLGSSAYE-----VKQGDRIAQLIVERIQTPSIVEVEDLDSTERGAGGYGSTGK 162
>gi|21281687|ref|NP_076084.2| deoxyuridine triphosphatase [Mus musculus] >gi|12833509|dbj|BAB22551.1| unnamed protein product [Mus musculus] >gi|12847511|dbj|BAB27599.1| unnamed protein product [Mus musculus] >gi|26346110|dbj|BAC36706.1| unnamed protein product [Mus musculus] >gi|31657212|gb|AAH53693.1| Deoxyuridine triphosphatase [Mus musculus] >gi|74142206|dbj|BAE31868.1| unnamed protein product [Mus musculus] >gi|74220093|dbj|BAE31237.1| unnamed protein product [Mus musculus] >gi|123858099|emb|CAM17718.1| deoxyuridine triphosphatase [Mus musculus] >gi|148696189|gb|EDL28136.1| deoxyuridine triphosphatase, isoform CRA_a [Mus musculus] (162 aa)
Score = 161, Expect = 5.0e-10, Identities = 49/130 (37%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD F+ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   +SY   E+ Q    +E  +GGFGST K
  S:    36 PTRGSARAAGYDLFSAYDYTISPMEKAIVKTDIQIAVPSGCYGRVAPRSGLAVKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERISYPDLEEVQTLDDTERGSGGFGSTGK 161
>gi|146280866|ref|YP_001171019.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas stutzeri A1501] >gi|166217637|sp|A4VGS6|DUT_PSEU5 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|145569071|gb|ABP78177.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas stutzeri A1501] (151 aa)
Score = 161, Expect = 5.3e-10, Identities = 48/138 (34%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           D  L     LP+ AT  SAG D  A    D V++P QT+ IPTG+ + + + ++  L+LPRS LG K+ + L N VG+IDSDY     +G + +   N         I  G+  AQ + +      + + +   +S+   GGFG +
  S:    10 DPRLGRDFPLPEYATPGSAGLDLRAMLQQDTVLEPGQTLLIPTGLAIHIADPTLAALVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQSAFTIAVGERIAQLMLVPVVQARFELVDSFDSSDRGAGGFGHS 148
>gi|107023453|ref|YP_621780.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia cenocepacia AU 1054] >gi|116690535|ref|YP_836158.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia cenocepacia HI2424] >gi|170733876|ref|YP_001765823.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia cenocepacia MC0-3] >gi|123071991|sp|Q1BU98|DUT_BURCA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217609|sp|A0K9T8|DUT_BURCH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|105893642|gb|ABF76807.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia cenocepacia AU 1054] >gi|116648624|gb|ABK09265.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Burkholderia cenocepacia HI2424] >gi|169817118|gb|ACA91701.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Burkholderia cenocepacia MC0-3] (148 aa)
Score = 161, Expect = 5.3e-10, Identities = 46/131 (35%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  + ++P +T  +PTG+ + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N        V+   +  AQ + +      + I ++   S+   GGFGST +
  S:    16 LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTESDRGEGGFGSTGR 147
>gi|32491150|ref|NP_871404.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340050|sp|Q8D2F3|DUT_WIGBR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|25166357|dbj|BAC24547.1| dut [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (153 aa)
Score = 161, Expect = 5.3e-10, Identities = 46/108 (42%), Positives = 65/108 (60%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           LPK  T  S+G D  A  D  + + P +TV I TG+ + +++  +  LILPRS L  KY + L NT+G+IDSDY     +G I I + N +N+N   +I  GD  AQ IF+
  S:    20 LPKYFTDGSSGMDLRACIDKEINLNPNETVLISTGVSIDISDQKISGLILPRSGLSHKYGIILSNTIGLIDSDY-----QGPIMISMLNRSNKN--FLISIGDRIAQIIFV 123
>gi|160900534|ref|YP_001566116.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Delftia acidovorans SPH-1] >gi|160366118|gb|ABX37731.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Delftia acidovorans SPH-1] (149 aa)
Score = 161, Expect = 5.5e-10, Identities = 50/143 (34%), Positives = 81/143 (56%)
  Q:    21 NKDIELYNSI---QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITED-DQASEIRNGGFGSTNKK 163
           N DI++ ++     +P  AT  SAG D  A  D  L+++P Q   +PTG+ + + +     +ILPRS +G K+ + L N VG+IDSDY     +G + +   N +       ++  D  AQ I +     S+ + E+ +  SE   GG+GST K+
  S:     2 NVDIKILDARLRENMPAYATPGSAGLDLRACIDAPLMLEPGQWQLVPTGMAMYLKDPGYAAMILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRS--TTAFTLQPMDRLAQLIIVPVVQPSFNVVEEFESTSERGAGGYGSTGKQ 149
>gi|8347092|gb|AAF74514.1|AF091101_1 dUTPase [Mus musculus] (162 aa)
Score = 161, Expect = 5.5e-10, Identities = 50/139 (35%), Positives = 70/139 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           + L      P R +  +AGYD F+ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   +SY   E+ Q    +E  +GGFGST K
  S:    27 VRLSEHATTPTRGSARAAGYDLFSAYDYTISPMEKAIVKTDIQIAVPSGCYGRVAPRSGLAVKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERISYPDLEEVQTLDDTERGSGGFGSTGK 161
>gi|42526552|ref|NP_971650.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Treponema denticola ATCC 35405] >gi|48427870|sp|P61912|DUT_TREDE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|41816745|gb|AAS11531.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Treponema denticola ATCC 35405] (144 aa)
Score = 161, Expect = 5.6e-10, Identities = 48/129 (37%), Positives = 69/129 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           LP+  T  SAG D  A  +  +++KP Q   IPTG+ V + +   L + PRS L  K+ + + NT G +DSDY      G + + L N  NE  +  I+ GD  AQA+       +  Q  E+ N     GG+GST
  S:    13 LPEYKTSGSAGADLRALIEEPIILKPMQRCLIPTGLSVELPKGIELQVRPRSGLALKHGITVLNTPGTVDSDY-----RGELAVLLINLGNE--DFKIENGDRIAQAVIAQAIQADFLQKDELSNTERGAGGYGST 141
>gi|71733551|ref|YP_272513.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|91206606|sp|Q48Q06|DUT_PSE14 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|71554104|gb|AAZ33315.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas syringae pv. phaseolicola 1448A] (151 aa)
Score = 161, Expect = 5.7e-10, Identities = 49/138 (35%), Positives = 73/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  + N   LP  AT  SAG D  A    D V++P QT+ IPTG+ + + +  +  LILPRS LG K+ + L N VG+IDSDY     +G + +   N       + +  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRIGNEFPLPAYATVGSAGLDLRAMLKEDTVLEPGQTLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWNRGQTAFNIAV--GERIAQLVLVPVVQAHFELVEAFDESQRGAGGFGHS 148
>gi|152985391|ref|YP_001351413.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa PA7] >gi|166217634|sp|A6VEC8|DUT_PSEA7 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|150960549|gb|ABR82574.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa PA7] (151 aa)
Score = 161, Expect = 5.8e-10, Identities = 49/138 (35%), Positives = 71/138 (51%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L     LP+ AT  SAG D  A    D V+ P QT+ IPTG+ + + +  +  L+LPRS LG K+ + L N VG+IDSDY     +G + +   N         I  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRLGTDFPLPQYATPGSAGLDLRAMLEEDTVLGPGQTLLIPTGLSIHIADPGLAALVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGESPFTIAVGERIAQLVLVPVVQAHFELVEQFDESQRGAGGFGHS 148
>gi|109081029|ref|XP_001113023.1| PREDICTED: dUTP pyrophosphatase isoform 4 [Macaca mulatta] >gi|90076500|dbj|BAE87930.1| unnamed protein product [Macaca fascicularis] (164 aa)
Score = 161, Expect = 6.1e-10, Identities = 49/130 (37%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  KY   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    38 PTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKYF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 163
>gi|148260722|ref|YP_001234849.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Acidiphilium cryptum JF-5] >gi|166918315|sp|A5FZ98|DUT_ACICJ Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|146402403|gb|ABQ30930.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acidiphilium cryptum JF-5] (154 aa)
Score = 160, Expect = 6.2e-10, Identities = 48/131 (36%), Positives = 67/131 (51%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           + LP  AT  SAG D  A  D  +VI P     +PTG+ + +  D  L + PRS L  K+ + + N+ G IDSDY      G I + + N   E  E  + +G   AQA+      L +  T+D   +    GGFGST
  S:    16 LPLPDYATAGSAGLDLLAAVDAPVVIAPGARALVPTGLAIALPPDFELQVRPRSGLALKHGIVIPNSPGTIDSDY-----RGEIQVIVLNAGTEAFE--VTRGMRIAQAVLAPVSRLVWQETDDLDRTAREAGGFGST 146
>gi|187477900|ref|YP_785924.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella avium 197N] >gi|123515318|sp|Q2L2L5|DUT_BORA1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|115422486|emb|CAJ49011.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bordetella avium 197N] (149 aa)
Score = 160, Expect = 6.4e-10, Identities = 46/131 (35%), Positives = 71/131 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  + ++P  T  +PTG+ + + +     +ILPRS LG K+ + L N VG+IDSDY     +G + +   N         ++  +  AQ +      +S+ + ++  ASE   GGFGST +
  S:    17 LPTYATPGSAGLDLRACIDKAITLEPGATTLVPTGLAIHVADPGYAAIILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWN--RGQTAFTLEPMERLAQLVIVPVQQVSFNVVDEFGASERGAGGFGSTGR 148
>gi|57545047|gb|AAW51452.1| deoxyuridine triphosphatase [Paramecium bursaria Chlorella virus IL3A] (141 aa)
Score = 160, Expect = 6.6e-10, Identities = 47/136 (34%), Positives = 70/136 (51%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           +L  S   P R ++ +AGYD  +  D+V+     + + TGI +R+ + +   I PRS L +KY   +D   GVID DY      G + + L N T   ++ +IKKGD  AQ I          +  D   +   +GGFGST
  S:     8 KLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAYKY--GIDVLAGVIDEDY-----TGEVKVILYNTT--ERDYIIKKGDRIAQLILEQIVTPGVAVVLDLSDTARGSGGFGST 139
>gi|116053468|ref|YP_793795.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa UCBPP-PA14] >gi|122256511|sp|Q02E41|DUT_PSEAB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|115588689|gb|ABJ14704.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa UCBPP-PA14] (151 aa)
Score = 160, Expect = 7.0e-10, Identities = 49/138 (35%), Positives = 72/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP+ AT  SAG D  A    D V+ P QT+ IPTG+ + + +  +  L+LPRS LG K+ + L N VG+IDSDY     +G + +   N         I  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRLGSDFPLPQYATPGSAGLDLRAMLKEDTVLGPGQTLLIPTGLSIYIADPGLAALVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGESPFTIAVGERIAQLVLVPVVQAHFELVEQFDESQRGAGGFGHS 148
>gi|70906441|ref|NP_001020419.1| deoxyuridine triphosphatase isoform 1 precursor [Homo sapiens] >gi|47123503|gb|AAH70339.1| Deoxyuridine triphosphatase [Homo sapiens] >gi|111494149|gb|AAI10378.1| Deoxyuridine triphosphatase [Homo sapiens] >gi|119597756|gb|EAW77350.1| dUTP pyrophosphatase, isoform CRA_b [Homo sapiens] (252 aa)
Score = 160, Expect = 7.1e-10, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:   126 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 251
>gi|3041664|sp|P33316|DUT_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial precursor (dUTPase) (dUTP pyrophosphatase) >gi|2443580|gb|AAB71393.1| dUTPase [Homo sapiens] >gi|2735292|gb|AAB94642.1| deoxyuridine triphosphate nucleotidohydrolase precursor [Homo sapiens] (252 aa)
Score = 160, Expect = 7.1e-10, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:   126 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 251
>gi|66043490|ref|YP_233331.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas syringae pv. syringae B728a] >gi|75503903|sp|Q4ZZX9|DUT_PSEU2 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|63254197|gb|AAY35293.1| DeoxyUTP pyrophosphatase, subfamily 1 [Pseudomonas syringae pv. syringae B728a] (151 aa)
Score = 160, Expect = 7.2e-10, Identities = 48/138 (34%), Positives = 74/138 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  + N   LP  AT  SAG D  A    D +++P QT+ IPTG+ + + +  +  LILPRS LG K+ + L N VG+IDSDY     +G + +   N  +    + +  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRIGNEFPLPAYATTGSAGLDLRAMLKEDTLLEPGQTLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWNRGHTAFNIAV--GERIAQLVLVPVVQAHFELVEAFDESQRGAGGFGHS 148
>gi|39996695|ref|NP_952646.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Geobacter sulfurreducens PCA] >gi|48427866|sp|P61908|DUT_GEOSL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|39983576|gb|AAR34969.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Geobacter sulfurreducens PCA] (149 aa)
Score = 160, Expect = 7.4e-10, Identities = 44/135 (32%), Positives = 72/135 (53%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY------GITEDDQASEIRNGGFGSTNK 162
           + + LP+  T H+AG D  A  D  LV++P +   +PTGI + + +     I PRS L  K+ + L N+ G ID DY      G I + + N   +    V+++G+  AQ +F  +       + E D+ +   +GGFG T +
  S:    15 SDLPLPRYMTPHAAGMDLCADVDADLVLEPGERALVPTGIAIALPDGFEAQIRPRSGLALKHGIALVNSPGTIDPDY-----RGEIGVIIVNHGAD--AFVVRRGERIAQMVFAPFVRAELLDVDELDETAR-GDGGFGHTGR 149
>gi|153872978|ref|ZP_02001717.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Beggiatoa sp. PS] >gi|152070554|gb|EDN68281.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Beggiatoa sp. PS] (150 aa)
Score = 160, Expect = 7.7e-10, Identities = 47/136 (34%), Positives = 71/136 (52%)
  Q:    28 NSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN---GGFGSTNKK 163
           N I LP+ AT  +AG D  A     L+++P +T  I +GI + ++  ++  ++LPRS LG  + + L N VG+IDSDY          IK+      NK   I  G+   Q +F+     +    +E+     GGFGST  K
  S:    16 NEIPLPEYATDGAAGIDLRACLTAPLILQPHETQLIGSGIAINIHTPNIAAVLLPRSGLGVNHGIVLANLVGLIDSDYRKE-------IKIAVWNRSNKSFTINPGERLCQMVFVPIVQVDFKWVTELEENGRGGFGSTGLK 150
>gi|155370367|ref|YP_001425901.1| hypothetical protein FR483_N269L [Paramecium bursaria Chlorella virus FR483] >gi|155123687|gb|ABT15554.1| hypothetical protein FR483_N269L [Paramecium bursaria Chlorella virus FR483] (139 aa)
Score = 160, Expect = 7.8e-10, Identities = 47/130 (36%), Positives = 67/130 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE----DDQASEIRNGGFGSTNK 162
           P R +  +AGYD  +  D+V+     V + TG+ +R+   +   I PRS L +KY   +D   GVID DY    NE  + +  T++T+ +    IKKGD  AQ +       E    DD     R GGFGST +
  S:    15 PVRGSDGAAGYDLSSVVDIVVPALGRVAVATGLAMRVPSGTYGRIAPRSGLAYKY--GIDVLAGVIDEDY---RNEVLVILYNTSETDYS----IKKGDRIAQLVLEKISTPEIEIVDDLDETSRTGGFGSTGR 139
>gi|18640099|ref|NP_570173.1| SPV013 dUTPase [Swinepox virus] >gi|18448506|gb|AAL69752.1| SPV013 dUTPase [Swinepox virus] (142 aa)
Score = 160, Expect = 7.8e-10, Identities = 51/139 (36%), Positives = 72/139 (51%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGST 160
           K ++L N+  +P R+T  SAGYD ++ Y   +KP   + + T I + + +     I PRS L   Y + +    GVIDSDY      G I I   N  N   +  IK GD  AQ IF  + Y I E+ +    +E  N GFGS+
  S:     6 KCVKLSNNAIIPNRSTSGSAGYDLYSAYSYTVKPYNRILVRTDICLMIPDKCYGRISPRSGLSLNYNIDIGG--GVIDSDY-----RGEIGIVFIN--NGCSDFNIKVGDRIAQIIFERVEYPIMEEVKCLEDTERGNSGFGSS 140
>gi|160881166|ref|YP_001560134.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Clostridium phytofermentans ISDg] >gi|160429832|gb|ABX43395.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Clostridium phytofermentans ISDg] (148 aa)
Score = 160, Expect = 8.0e-10, Identities = 53/132 (40%), Positives = 72/132 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYDL---VIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITEDDQASE-IR-NGGFGSTNKK 163
           LP R +  +AGYD +A  D     IKP +TVKI TG+ + +       I  RS +  K  L+  N VGV DSDY      G   I L NDT+  +   I   +  AQ +   +LS   TE ++ S+ +R +GGFGST  K
  S:    16 LPTRGSVEAAGYDLYACLDTDACEIKPHETVKIGTGLAIEIPSGYFGGIFARSGIAAKNGLRPANCVGVADSDY-----RGEYIIALHNDTDIVQ--TIANHERIAQLVVIPYLSVDFTEVEELSDTVRGDGGFGSTGTK 148
>gi|85710821|ref|ZP_01041882.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Idiomarina baltica OS145] >gi|85695225|gb|EAQ33162.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Idiomarina baltica OS145] (151 aa)
Score = 160, Expect = 8.1e-10, Identities = 49/134 (36%), Positives = 74/134 (55%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           I LP+ AT  SAG D  A  D  + I   QT  + TG+ + + N +    +LPRS LG K+ + L N VG+IDSDY     +G + + + N +   ++ VI+ GD  AQ + +        I  +  AS+   GGFG + K+
  S:    17 IPLPEYATSGSAGMDLRACIDAPMTIAAGQTHLVGTGLAMHIGNPNYAATLLPRSGLGHKHGIILGNLVGLIDSDY-----QGELKVSVWNRS--ERDYVIEPGDRIAQLVIVPVIQADLNIVNEFAASDRGQGGFGHSGKQ 151
>gi|169824457|ref|YP_001692068.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Finegoldia magna ATCC 29328] >gi|167831262|dbj|BAG08178.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Finegoldia magna ATCC 29328] (143 aa)
Score = 159, Expect = 8.7e-10, Identities = 50/129 (38%), Positives = 67/129 (51%)
  Q:    32 LPKRATKHSAGYDF--FAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-----SEIRNGGFGST 160
           LPK +T  S+G D   +   D+ +KP +   IPTGI + + E   + I PRS L  K+ + L N VG IDSDY      G I I + N +NE  E  I  GD   Q I   Y   E  +      ++  +GGFG T
  S:    13 LPKYSTIGSSGMDLRAYTENDITLKPLERTLIPTGIYISIPEGYEIQIRPRSGLSIKHGITLINCVGTIDSDY-----RGEIKIPVVNLSNE--EYTISTGDRICQMILQKYENIEFAEVEVLDETDRNDGGFGHT 141
>gi|78222803|ref|YP_384550.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Geobacter metallireducens GS-15] >gi|91206600|sp|Q39V99|DUT_GEOMG Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|78194058|gb|ABB31825.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Geobacter metallireducens GS-15] (148 aa)
Score = 159, Expect = 9.3e-10, Identities = 46/131 (35%), Positives = 68/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG---ITEDDQASEIR--NGGFGSTNK 162
           LP   T H+AG D  A    DLV+ P +   +PTG+ + + +     I PRS L  K+ + L N+ G ID DY      G I + L N  +E    V+++G+  AQ +F  +    + E D+  E     GGFG T +
  S:    18 LPCYMTVHAAGMDLCADLVDDLVLNPGERKLVPTGLAIALPDGFEAQIRPRSGLALKHGIALVNSPGTIDPDY-----RGEIGVILINHGSE--PFVVRRGERIAQMVFAPFARAELVEVDELDETARGEGGFGHTGR 148
>gi|58584612|ref|YP_198185.1| dUTPase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75497916|sp|Q5GST1|DUT_WOLTR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|58418928|gb|AAW70943.1| dUTPase [Wolbachia endosymbiont strain TRS of Brugia malayi] (156 aa)
Score = 159, Expect = 9.5e-10, Identities = 55/159 (34%), Positives = 82/159 (51%)
  Q:     4 MGKFEKISLN-EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-YGITEDD------QASEIRNGGFGSTNK 162
           MG+ ++  +  E  K    KD+ L      P  AT  SAG D +A     +V+ P + + IPTGI + +       I PRS L  KY + + N+ G IDSDY      G + + L N +N+  E  IK+GD  AQ +    + +  DD      + +E   GGFGS+ +
  S:     1 MGRIQRNKIKVEIKKLSHGKDLPL------PCYATMQSAGMDLYAALGNSIVLNPLERLLIPTGIVIVIPNGFEGQIRPRSGLAAKYGITVLNSPGTIDSDY-----RGEVKVCLINLSNQPYE--IKRGDRIAQILIAPVFRVIWDDAERLCTEETERSAGGFGSSGR 156
>gi|194098208|ref|YP_002001256.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria gonorrhoeae NCCP11945] >gi|193933498|gb|ACF29322.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria gonorrhoeae NCCP11945] (150 aa)
Score = 159, Expect = 9.6e-10, Identities = 47/129 (36%), Positives = 72/129 (55%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           +P  AT+ SAG D  A  D  +V++P +T  +PTG+ + + N     ++LPRS LG K+ + L N VG+IDSDY     +G + + L N  +E     +K  +  AQ + +      +   E+   S    GGFGST
  S:    18 IPAYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYTAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELKVSLWNRGSE--PFTVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEGGFGST 147
>gi|118580532|ref|YP_901782.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Pelobacter propionicus DSM 2379] >gi|118503242|gb|ABK99724.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pelobacter propionicus DSM 2379] (154 aa)
Score = 159, Expect = 9.7e-10, Identities = 51/135 (37%), Positives = 74/135 (54%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITED-DQASEIRNGGFGSTNK 162
           + I LP  AT  +A  D  A  +    ++P +T  IP+GI + +++   V LI+PRS LG K+ + L NTVGVIDSDY     +G I I + N         I+ G+   Q +F+     +  + E   + SE   GGFG T K
  S:    17 SKIPLPCYATDGAAAMDLRACLEGPRTVQPGETALIPSGIAIAIHDPGLVALIVPRSGLGIKHGIVLANTVGVIDSDY-----QGEIGIGIHN--RGEAPYTIEPGERICQMMFMPVVQVTLNLVESFSRESERGAGGFGHTGK 153
>gi|15676789|ref|NP_273934.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis MC58] >gi|22095604|sp|Q9JZU7|DUT_NEIMB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|7226130|gb|AAF41302.1| deoxyuridine 5`-triphosphate nucleotidohydrolase [Neisseria meningitidis MC58] (150 aa)
Score = 159, Expect = 1.0e-09, Identities = 47/129 (36%), Positives = 73/129 (56%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           +P  AT+ SAG D  A  D  +V++P +T  +PTG+ + + N     ++LPRS LG K+ + L N VG+IDSDY     +G + + L N ++E     +K  +  AQ + +      +   E+   S    GGFGST
  S:    18 VPVYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELKVSLWNRSSE--PFTVKPFERIAQMVVVPIVQAGFKRVEEFVGSSRGEGGFGST 147
>gi|171464056|ref|YP_001798169.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Polynucleobacter necessarius STIR1] >gi|171193594|gb|ACB44555.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Polynucleobacter necessarius STIR1] (149 aa)
Score = 159, Expect = 1.0e-09, Identities = 48/132 (36%), Positives = 69/132 (52%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP   T  SAG D  A  D  + I P QTV +PTG+ + + +      ILPRS LG K+ + L N VG+IDSDY     +G + +   N  +   +L  +  +  AQ + +        + E+   S    GGFGST +
  S:    16 QLPTYGTPGSAGLDLRACIDEAITIAPGQTVLVPTGLAIYVEDPRYAAFILPRSGLGHKHSIVLGNLVGLIDSDY-----QGQLMVSTWNRGSTTFKL--EPMERLAQLVVMPVQQVELKVVEEFTESSRGAGGFGSTGR 148
>gi|59800897|ref|YP_207609.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria gonorrhoeae FA 1090] >gi|161869825|ref|YP_001598994.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis 053442] >gi|189027741|sp|A9M439|DUT_NEIM0 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|75432542|sp|Q5F9E0|DUT_NEIG1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|59717792|gb|AAW89197.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria gonorrhoeae FA 1090] >gi|161595378|gb|ABX73038.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Neisseria meningitidis 053442] (150 aa)
Score = 159, Expect = 1.0e-09, Identities = 47/129 (36%), Positives = 72/129 (55%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           +P  AT+ SAG D  A  D  +V++P +T  +PTG+ + + N     ++LPRS LG K+ + L N VG+IDSDY     +G + + L N  +E     +K  +  AQ + +      +   E+   S    GGFGST
  S:    18 IPAYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELKVSLWNRGSE--PFAVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEGGFGST 147
>gi|110833073|ref|YP_691932.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Alcanivorax borkumensis SK2] >gi|123149769|sp|Q0VT60|DUT_ALCBS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|110646184|emb|CAL15660.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Alcanivorax borkumensis SK2] (150 aa)
Score = 158, Expect = 1.1e-09, Identities = 49/141 (34%), Positives = 75/141 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQ-----ASEIRNGGFGSTNKK 163
           D  L +SI LP  AT  SAG D  A     L ++P  T  +PTG+ + +++     +ILPRS LG K+ + L N VG+IDSDY     +G + +   N     +   ++ G+  AQ + +     E  Q     AS+   GGFG + ++
  S:     9 DTRLGDSIPLPHYATDGSAGLDLRAMVKEPLTLQPGDTELLPTGMSIFIDDPGYAGMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGQQPFTLEPGERVAQLVIVPVMQVELKQVESFSASKRGEGGFGHSGRQ 150
>gi|126740150|ref|ZP_01755839.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Roseobacter sp. SK209-2-6] >gi|126718605|gb|EBA15318.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Roseobacter sp. SK209-2-6] (149 aa)
Score = 158, Expect = 1.1e-09, Identities = 49/135 (36%), Positives = 73/135 (54%)
  Q:    28 NSIQLPKRATKHSAGYD---FFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITE--DDQASEIRNGGFGSTNK 162
           N + LP  AT  +AG D   F     L ++P + V I TG+ V + E + + I PRSS+  K ++ + N+   ID DY      G I++ L     +   +V+  GD FAQA+    L   + E  +  A+E  +GGFGST K
  S:    13 NDLPLPGYATAGAAGMDLRAFLPDGSLTLEPGEVVMISTGLSVELPESTEMQIRPRSSMALKQQIIIPNSPATIDEDY-----RGIIYVGLYLLGGD--PVVLNHGDRFAQAVIAPVLKPEVIEVRELTATERGSGGFGSTGK 148
>gi|118054251|ref|ZP_01522791.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Comamonas testosteroni KF-1] >gi|117998450|gb|EAV12614.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Comamonas testosteroni KF-1] (168 aa)
Score = 158, Expect = 1.2e-09, Identities = 48/132 (36%), Positives = 72/132 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITED-DQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A  D  + ++P Q   IPTG+ + + +     LILPRS +G K+ + L N VG+IDSDY     +G + +   N +       ++  D  AQ + +      + + +D   ASE   GG+GST K+
  S:    35 LPAYATPGSAGLDLRACIDAPVTLEPGQWQLIPTGMAMHLKDPHYAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRS--QTAFTLQPMDRLAQLVIVPVVQAQFNLVDDFADASERGEGGYGSTGKQ 168
>gi|150003975|ref|YP_001298719.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacteroides vulgatus ATCC 8482] >gi|166217605|sp|A6L083|DUT_BACV8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|149932399|gb|ABR39097.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacteroides vulgatus ATCC 8482] (144 aa)
Score = 158, Expect = 1.2e-09, Identities = 49/132 (37%), Positives = 70/132 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-----SEIRNGGFGSTNKK 163
           LP+ AT  SAG D  A  D  +V+KP Q   +PTG+ + + E     I PRS L  K  + + N+ G ID+DY      G I I L N ++E  + +I+ G+  AQ +   +   E  +      +E   GGFG T KK
  S:    13 LPEYATGQSAGMDIRANLDEPIVLKPLQRCLVPTGLYIALPEGFEAQIRPRSGLAIKKGIGVLNSPGTIDADY-----RGEICIILVNLSSE--DFMIEDGERIAQMVVARHEHAEWQEVEVLDETERGAGGFGHTGKK 144
>gi|83595874|gb|ABC25236.1| deoxyuridine 5''-triphosphate nucleotidohydrolase [uncultured marine bacterium Ant4D3] (154 aa)
Score = 158, Expect = 1.2e-09, Identities = 48/141 (34%), Positives = 75/141 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE----DDQASEIRN-GGFGSTNKK 163
           D  +   I LP  AT  SAG D  A  D  + + P QT  IPTG+ + + + ++  ++LPRS LG K+ + L N VG+IDSDY     +G + +   N        +I+  +  AQ + +     E    DD  + +R  GGFG + ++
  S:    13 DPRVGQEIPLPTYATAGSAGMDLRACIDHAITLNPGQTELIPTGMAIHIEDQNLCAMLLPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSCWN--RGATPFIIEPAERIAQMVLVPVVQAELTIVDDFDASLRGLGGFGHSGRQ 154
>gi|67154912|ref|ZP_00416657.1| DeoxyUTP pyrophosphatase, subfamily 1 [Azotobacter vinelandii AvOP] >gi|67089045|gb|EAM08511.1| DeoxyUTP pyrophosphatase, subfamily 1 [Azotobacter vinelandii AvOP] (151 aa)
Score = 158, Expect = 1.3e-09, Identities = 48/138 (34%), Positives = 72/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP  AT  SAG D  A    +L ++P QT  IPTG+ + + +  +  L+LPRS LG K+ + L N VG+IDSDY     +G + I   N       + +  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRLGSDYPLPAYATAGSAGLDLRAMLQEELTLEPGQTALIPTGLAIHIADPGLAALVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMISCWNRGQSTFRIAV--GERIAQLVLVPVMQAHFQLVESFDESQRGAGGFGHS 148
>gi|109081031|ref|XP_001112963.1| PREDICTED: dUTP pyrophosphatase isoform 2 [Macaca mulatta] >gi|90083489|dbj|BAE90827.1| unnamed protein product [Macaca fascicularis] (141 aa)
Score = 158, Expect = 1.4e-09, Identities = 49/130 (37%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  KY   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    15 PTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKYF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 140
>gi|171059325|ref|YP_001791674.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Leptothrix cholodnii SP-6] >gi|170776770|gb|ACB34909.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Leptothrix cholodnii SP-6] (150 aa)
Score = 157, Expect = 1.4e-09, Identities = 51/147 (34%), Positives = 78/147 (53%)
  Q:    16 NKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLV--IKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           N   E K ++   + QLP  AT  +AG D  A  DL   I P QT  IPTGI + + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + +   N    +    ++  +  AQ + +      +   ++ +AS+    GFGST +
  S:     2 NTQIEYKLLDARLAEQLPAYATPGAAGLDLRACIDLPLEIAPGQTTLIPTGIAIHIADPGLAAIILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSCWN--RGSVAYAVQPLERIAQLVIVPVVQAQFRQVDEFEASDRGVAGFGSTGR 149
>gi|157953857|ref|YP_001498748.1| hypothetical protein AR158_C667L [Paramecium bursaria Chlorella virus AR158] >gi|156068505|gb|ABU44212.1| hypothetical protein AR158_C667L [Paramecium bursaria Chlorella virus AR158] (141 aa)
Score = 157, Expect = 1.4e-09, Identities = 49/129 (37%), Positives = 68/129 (52%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           +P RAT+ SAGYD  +  D+VI     V + TG+ +R+   +   I PRS L +KY   +D   GVIDSD+      G I + L N +    + +IKKGD  AQ I       +     E+ +     GGFGST
  S:    15 VPTRATEGSAGYDISSIEDVVIPASGRVAVSTGLSIRVPNGTYGRIAPRSGLAYKY--GIDVLAGVIDSDFV-----GEIKVILYNTS--ELDYIIKKGDRIAQLILEQIMTPDVAIVLELEDTMRGEGGFGST 139
>gi|67459012|ref|YP_246636.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia felis URRWXCal2] >gi|75536552|sp|Q4ULV2|DUT_RICFE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|67004545|gb|AAY61471.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia felis URRWXCal2] (148 aa)
Score = 157, Expect = 1.4e-09, Identities = 50/132 (37%), Positives = 71/132 (53%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           S  LP+ AT+HSAG D  A  +  + IK  +   IPTGI + + +     I PRS L  K+ + + N+ G ID+DY      G I + L N   E  + VI+KG   AQ I   Y     +++S +      +GGFGST
  S:    15 SGSLPEYATEHSAGMDLIAANEQPITIKAGEIQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVILINLGKE--DFVIEKGMRIAQMIIAKYERILWEESSSLTETMRGSGGFGST 146
>gi|60654529|gb|AAX29955.1| dUTP pyrophosphatase [synthetic construct] (165 aa)
Score = 157, Expect = 1.4e-09, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    38 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 163
>gi|4503423|ref|NP_001939.1| deoxyuridine triphosphatase isoform 2 [Homo sapiens] >gi|157835079|pdb|2HQU|A Chain A, Human Dutpase In Complex With Alpha,Beta-Iminodutp And Magnesium Ion >gi|157835080|pdb|2HQU|B Chain B, Human Dutpase In Complex With Alpha,Beta-Iminodutp And Magnesium Ion >gi|157835081|pdb|2HQU|C Chain C, Human Dutpase In Complex With Alpha,Beta-Iminodutp And Magnesium Ion >gi|1144332|gb|AAC50418.1| deoxyuridine nucleotidohydrolase >gi|1421818|gb|AAC51123.1| deoxyuridine triphosphatase >gi|2443581|gb|AAB71394.1| dUTPase [Homo sapiens] >gi|10257385|dbj|BAB13724.1| dUTP pyrophosphatase [Homo sapiens] >gi|21708114|gb|AAH33645.1| Deoxyuridine triphosphatase [Homo sapiens] >gi|49456401|emb|CAG46521.1| DUT [Homo sapiens] >gi|49456519|emb|CAG46580.1| DUT [Homo sapiens] >gi|60115828|gb|AAX14045.1| dUTP pyrophosphatase [Homo sapiens] >gi|60820926|gb|AAX36554.1| dUTP pyrophosphatase [synthetic construct] >gi|61364276|gb|AAX42517.1| dUTP pyrophosphatase [synthetic construct] >gi|123980576|gb|ABM82117.1| dUTP pyrophosphatase [synthetic construct] >gi|123995399|gb|ABM85301.1| dUTP pyrophosphatase [synthetic construct] >gi|189053252|dbj|BAG35058.1| unnamed protein product [Homo sapiens] >gi|1589539|prf||2211321A dehydrouridine triphosphate nucleotidohydrolase (164 aa)
Score = 157, Expect = 1.5e-09, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    38 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 163
>gi|15600514|ref|NP_254008.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa PAO1] >gi|107104423|ref|ZP_01368341.1| hypothetical protein PaerPA_01005500 [Pseudomonas aeruginosa PACS2] >gi|194548970|ref|YP_002083998.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa C3719] >gi|194554778|ref|YP_002089805.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa 2192] >gi|22095602|sp|Q9HTN3|DUT_PSEAE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|9951638|gb|AAG08706.1|AE004944_10 deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa PAO1] >gi|126169916|gb|EAZ55427.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa C3719] >gi|126197171|gb|EAZ61234.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pseudomonas aeruginosa 2192] (151 aa)
Score = 157, Expect = 1.5e-09, Identities = 49/138 (35%), Positives = 72/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           D  L +   LP+ AT  SAG D  A    D V+ P QT+ IPTG+ + + +  +  L+LPRS LG K+ + L N VG+IDSDY     +G + +   N         I  G+  AQ + +      + + E    S+   GGFG +
  S:    10 DPRLGSDFPLPQYATPGSAGLDLRAMLKEDSVLGPGQTLLIPTGLSIYIADPGLAALVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSCWN--RGESPFTIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAGGFGHS 148
>gi|194391118|dbj|BAG60677.1| unnamed protein product [Homo sapiens] (252 aa)
Score = 157, Expect = 1.6e-09, Identities = 48/130 (36%), Positives = 67/130 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+    D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:   126 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--TDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 251
>gi|60831844|gb|AAX36986.1| dUTP pyrophosphatase [synthetic construct] (165 aa)
Score = 157, Expect = 1.8e-09, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    38 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 163
>gi|93005400|ref|YP_579837.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychrobacter cryohalolentis K5] >gi|122415846|sp|Q1QDA0|DUT_PSYCK Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|92393078|gb|ABE74353.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychrobacter cryohalolentis K5] (154 aa)
Score = 156, Expect = 1.9e-09, Identities = 50/143 (34%), Positives = 74/143 (51%)
  Q:    21 NKDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG------ITEDDQASEIRNGGFGSTNKK 163
           N  I    +  LP RAT  SAG D  A  D  L IK   T  I TG+ V + + +   +ILPRS LG K+ + L N VG+ID+DY     +G + + + N + E  + V+   +  AQ + +         +TE    S    GGFG + ++
  S:    10 NPKITEDKAFSLPTRATDGSAGIDLRACIDEPLTIKAGATHLIGTGLAVYIQDPNFAGMILPRSGLGHKHGIVLGNLVGLIDADY-----QGELMVSIWNRSQE--DFVLTPAERMAQYVVVPVARPEFEVVTEFSDTSARGAGGFGHSGRQ 154
>gi|116328847|ref|YP_798567.1| dUTP diphosphatase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331756|ref|YP_801474.1| dUTP diphosphatase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122280505|sp|Q04QV4|DUT_LEPBJ Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|122283368|sp|Q04Z61|DUT_LEPBL Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|116121591|gb|ABJ79634.1| dUTP diphosphatase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125445|gb|ABJ76716.1| dUTP diphosphatase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (145 aa)
Score = 156, Expect = 1.9e-09, Identities = 48/136 (35%), Positives = 71/136 (52%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN------GGFGST 160
           +L ++ +LP   TKH+AGYD  A  D  L+++P +   +PTG+   + ++    I PRS    K ++ + N+ G IDSDY      G + I L N    N   VI+ G   AQ +      T  +  SE  +      GGFGST
  S:     7 KLRSNAELPVLQTKHAAGYDVHACLDSNLILEPNKVTLVPTGLSFEIPQEYHFEIRPRSGFSTKNQILIPNSPGTIDSDY-----RGELMIPLFNLG--NIPFVIEHGMRIAQLLIRETHYTNWELVSEFTDTTERGTGGFGST 143
>gi|52801706|ref|YP_094055.1| E4 ORFA [Bovine adenovirus A] (142 aa)
Score = 156, Expect = 2.0e-09, Identities = 46/137 (33%), Positives = 69/137 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA-----SEIRNGGFGST 160
           + + +S   PKRA+  +AGYD  A + + I+      +PTG+++R+ E     + PRS  G      LD   GVIDSDY      G +F+ L N  N +  ++I  G   AQ +     + E  +      +E   GGFGST
  S:     8 VRVSDSAVPPKRASNGAAGYDLCASHYVEIQAGSRALVPTGLKLRIPEGHYGRVAPRS--GLSVTQGLDVGAGVIDSDY-----RGEVFVLLFNHGNHH--VLISPGQRVAQLVIQKISLPEVQEVDTLDDTERGEGGFGST 140
>gi|118405166|ref|NP_001072956.1| dUTP pyrophosphatase [Gallus gallus] >gi|53130842|emb|CAG31750.1| hypothetical protein [Gallus gallus] (166 aa)
Score = 156, Expect = 2.0e-09, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P + +  +AGYD ++ YD VI P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E   GGFGST K
  S:    40 PSKGSARAAGYDLYSAYDYVIPPMEKAVVKTDIQIALPAGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKETFE--VKKGDRIAQLICERIFYPELEEVQALDDTERGEGGFGSTGK 165
>gi|15605775|ref|NP_213152.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Aquifex aeolicus VF5] >gi|3913521|sp|O66592|DUT_AQUAE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|2982943|gb|AAC06559.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Aquifex aeolicus VF5] (150 aa)
Score = 156, Expect = 2.1e-09, Identities = 50/134 (37%), Positives = 72/134 (53%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNKK 163
           + LP  AT HS+G D  A  +  L IKP + V IPTG+ + + E     + PRS L +K  L + N  G ID+DY      G + + L N  NE  E+VI++G+  AQ +      +     E+   ++   GGFGST  K
  S:    17 LPLPSYATPHSSGLDLRAAIEKPLKIKPFERVLIPTGLILEIPEGYEGQVRPRSGLAWKKGLTVLNAPGTIDADY-----RGEVKVILVNLGNE--EVVIERGERIAQLVIAPVQRVEVVEVEEVSQTQRGEGGFGSTGTK 150
>gi|189461550|ref|ZP_03010335.1| hypothetical protein BACCOP_02209 [Bacteroides coprocola DSM 17136] >gi|189431756|gb|EDV00741.1| hypothetical protein BACCOP_02209 [Bacteroides coprocola DSM 17136] (155 aa)
Score = 156, Expect = 2.1e-09, Identities = 48/132 (36%), Positives = 68/132 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNKK 163
           LP+ AT  SAG D  A  D  +V+KP Q   +PTG+ + + E     I PRS L  K  + L NT G ID+DY      G I + + N + E  + +I+ G+  AQ +   Y   E  +   + +     GGFG T  K
  S:    24 LPQYATSSSAGMDLRANLDNPIVLKPLQRCLVPTGLYIALPEGFEAQIRPRSGLALKKGITLLNTPGTIDADY-----RGEIGVIVINLSAE--DFIIEDGERIAQMVIARYEQAEWQEVEVLEDTERGAGGFGHTGVK 155
>gi|167520908|ref|XP_001744793.1| predicted protein [Monosiga brevicollis MX1] >gi|163777124|gb|EDQ90742.1| predicted protein [Monosiga brevicollis MX1] (143 aa)
Score = 156, Expect = 2.1e-09, Identities = 49/130 (37%), Positives = 64/130 (49%)
  Q:    31 QLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--------LSYGITEDDQASEIRNGGFGST 160
           QLPKR +  +AGYD +A  D VI  +    + TG+ + + E     I PRSSL  K+   LD   GVID DY      G + + + N   +  E  +KKG+  AQ I            G   D    E   GGFGST
  S:    15 QLPKRGSPEAAGYDLYAVEDTVIAAQGKAIVKTGLIMEIPEGCYGRIAPRSSLAAKH--HLDVGAGVIDRDY-----RGEVGVVMFNFAQQ--EFTVKKGERIAQLILECIFTPLVEEVGSLSDTSRGE---GGFGST 140
>gi|84686306|ref|ZP_01014201.1| Probable deoxyuridine-triphosphatase [Rhodobacterales bacterium HTCC2654] >gi|84665833|gb|EAQ12308.1| Probable deoxyuridine-triphosphatase [Rhodobacterales bacterium HTCC2654] (156 aa)
Score = 156, Expect = 2.2e-09, Identities = 52/135 (38%), Positives = 68/135 (50%)
  Q:    29 SIQLPKRATKHSAGYDFFA---PYD----LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNKK 163
           ++ LP   T  +AG D  A   P D      + P +   +PTG+RV + +   + I PRS L  K+ L L NT G IDSDY      G + + L N   E     I  GD  AQAI       +Y + E    S   +GGFGST  K
  S:    17 NVALPSYETAGAAGADIRANLMPEDRDTGFTLAPMERRIVPTGLRVEIPDGFEMQIRPRSGLALKHGLSLPNTPGTIDSDY-----RGPLGVLLVNFGAE--PYTIGHGDRIAQAIVAPVVQATYEVVEALGDSHRGDGGFGSTGTK 156
>gi|34580536|ref|ZP_00142016.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Rickettsia sibirica 246] >gi|28261921|gb|EAA25425.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Rickettsia sibirica 246] (148 aa)
Score = 156, Expect = 2.2e-09, Identities = 49/132 (37%), Positives = 70/132 (53%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           S  LP+ AT+HSAG D  A  +  + IK      IPTGI + + +     I PRS L  K+ + + N+ G ID+DY      G I + L N   E  + +I+KG   AQ I   Y     +++S +      +GGFGST
  S:    15 SGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVILINLGKE--DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSGGFGST 146
>gi|165969105|ref|YP_001651005.1| dUTPase [Orgyia leucostigma NPV] >gi|164663601|gb|ABY65821.1| dUTPase [Orgyia leucostigma NPV] (140 aa)
Score = 156, Expect = 2.3e-09, Identities = 44/130 (33%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDD--QASEIRNGGFGSTNK 162
           P+ AT  SAGYD  AP D VIK + +  + TG+ + +       I  +S L FK+++ +    GV+D+DY      G I + L N    +++   K+GD  AQ +   Y    + E D   ++E    GFGST +
  S:    15 PQLATDGSAGYDLRAPEDFVIKARDSCTVDTGLAIELPRGLYAKIESKSGLAFKHQIVV--AAGVVDNDY-----RGKICVILMNHGKRSRQF--KRGDKIAQMVLHKYYTVPMVEADVLSSTERACNGFGSTGR 140
>gi|114330797|ref|YP_747019.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosomonas eutropha C91] >gi|123127464|sp|Q0AHX8|DUT_NITEC Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|114307811|gb|ABI59054.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosomonas eutropha C91] (149 aa)
Score = 156, Expect = 2.4e-09, Identities = 48/131 (36%), Positives = 68/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
            P  AT  SAG D  A  D    I P +T+ IP+GI + + N     ++LPRS LG K+ + L N VG+IDSDY     +G I +   N         ++  +  AQ + +     S+ +  D Q S+    GFGST K
  S:    17 FPGYATPGSAGLDLRACIDERTEIHPGETLLIPSGIAIHLANPGFAAVVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQILVSCWN--RGQTTFALEPLERIAQLVIVPVIQASFNVVNDFQHSQRGERGFGSTGK 148
>gi|92115098|ref|YP_575026.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Chromohalobacter salexigens DSM 3043] >gi|91798188|gb|ABE60327.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Chromohalobacter salexigens DSM 3043] (158 aa)
Score = 155, Expect = 2.4e-09, Identities = 47/131 (35%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  L + P     + TG+ V + +  +  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N   +    V++ G+  AQ + +     +  I ED   SE   GGFG + +
  S:    26 LPSYATAGSAGLDLRALLDGPLTLAPGDCELVRTGLAVHIGDPGLAGMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSVWNRGRD--AFVLEPGERLAQYVLVPVVQATLDIVEDFAVSERAAGGFGHSGR 157
>gi|194290609|ref|YP_002006516.1| deoxyuridinetriphosphatase [Cupriavidus taiwanensis] >gi|193224444|emb|CAQ70455.1| deoxyuridinetriphosphatase [Cupriavidus taiwanensis] (166 aa)
Score = 155, Expect = 2.4e-09, Identities = 51/133 (38%), Positives = 70/133 (52%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVK-IPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKE-LVIKKGDGFAQAIFLSY------GITEDDQASEIRNGGFGST 160
           N   LP   ++ +A  D  A  D  + I P    + +P GI V M N      I+PRS LG K  L L N++GVID+DY     +G I + + N      E +VI+ G+  AQ +F+         + E  Q SE   GGFGST
  S:    19 NEWGLPAYQSEMAAAIDLHACVDAPVAIAPGTPAQLVPAGIAVHMGNPYMAATIVPRSGLGHKKGLVLGNSIGVIDADY-----QGQIMVSVWNRNAPGTEPIVIQPGERIAQMMFVPVLRPVFSTVEEFSQDSERGAGGFGST 157
>gi|154496389|ref|ZP_02035085.1| hypothetical protein BACCAP_00678 [Bacteroides capillosus ATCC 29799] >gi|150274472|gb|EDN01549.1| hypothetical protein BACCAP_00678 [Bacteroides capillosus ATCC 29799] (149 aa)
Score = 155, Expect = 2.4e-09, Identities = 48/133 (36%), Positives = 69/133 (51%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           I  P  A+  +A  D  A  D  + ++P+  V IPTGI + + + + V L+  RS LG K+ + L N VGVIDSDY      G I + LTN +  +    +  GD  AQ   +        + +    +E   GGFGST K
  S:    16 IPAPFYASAGAAAMDLCACVDEPVTVEPRALVSIPTGIAIALPSAEYVALVFARSGLGIKHGITLSNGVGVIDSDY-----RGEIRVGLTNLS--DTAYTVAPGDRIAQLAVMPVVQAQLEVCDSLDETERGQGGFGSTGK 149
>gi|15892469|ref|NP_360183.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia conorii str. Malish 7] >gi|167471682|ref|ZP_02336386.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia africae ESF-5] >gi|22095597|sp|Q92I74|DUT_RICCN Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|15619625|gb|AAL03084.1| deoxyuridine 5-triphosphate nucleotidohydrolase [EC:3.6.1.23] [Rickettsia conorii str. Malish 7] (148 aa)
Score = 155, Expect = 2.5e-09, Identities = 49/132 (37%), Positives = 70/132 (53%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           S  LP+ AT+HSAG D  A  +  + IK      IPTGI + + +     I PRS L  K+ + + N+ G ID+DY      G I + L N   E  + +I+KG   AQ I   Y     +++S +      +GGFGST
  S:    15 SGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVILINLGKE--DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSGGFGST 146
>gi|114656884|ref|XP_523069.2| PREDICTED: dUTP pyrophosphatase isoform 6 [Pan troglodytes] (252 aa)
Score = 155, Expect = 2.6e-09, Identities = 45/130 (34%), Positives = 65/130 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I     +      +D   +E  +GGFGST K
  S:   126 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQDLDDTERGSGGFGSTGK 251
>gi|418297|sp|P32208|DUT_SWPVK Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|347475|gb|AAC37860.1| pseudoprotease (142 aa)
Score = 155, Expect = 2.6e-09, Identities = 50/139 (35%), Positives = 71/139 (51%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGST 160
           K ++L N+  +P R+   SAGYD ++ Y   +KP   + + T I + + +     I PRS L   Y + +    GVIDSDY      G I I   N  N   +  IK GD  AQ IF  + Y I E+ +    +E  N GFGS+
  S:     6 KCVKLSNNAIIPNRSMSGSAGYDLYSAYSYTVKPYNRILVRTDICLMIPDKCYGRISPRSGLSLNYNIDIGG--GVIDSDY-----RGEIGIVFIN--NGCSDFNIKVGDRIAQIIFERVEYPIMEEVKCLEDTERGNSGFGSS 140
>gi|155121950|gb|ABT13818.1| hypothetical protein MT325_M264L [Paramecium bursaria chlorella virus MT325] (140 aa)
Score = 155, Expect = 2.8e-09, Identities = 44/128 (34%), Positives = 67/128 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           P R +  +AGYD  +  D+V+     V + TG+ +R+   +   I PRS L +KY   +D   GVID DY      G + + L N +   ++ +IKKGD  AQ +          I +D + ++   GGFGST
  S:    15 PARGSDGAAGYDLSSVVDIVVPALGRVAVATGLAMRVPSGTYGRIAPRSGLAYKY--GIDVLAGVIDEDY-----RGEVKVILFNTS--ERDYIIKKGDRIAQLVLEKISTPEVAIVDDLEDTQRGVGGFGST 138
>gi|83746255|ref|ZP_00943308.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia solanacearum UW551] >gi|83727005|gb|EAP74130.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia solanacearum UW551] (148 aa)
Score = 155, Expect = 3.0e-09, Identities = 49/132 (37%), Positives = 69/132 (52%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           Q P+ AT  SAG D  A  D  L ++P  T  IPTG+ + + +     LILPRS +G K+ + L N VG+IDSDY     +G + I   N    +   V+   +  AQ + +        I +    SE   GGFGST +
  S:    15 QHPQYATPGSAGLDLRACIDAPLTLEPGSTHLIPTGMAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDY-----QGQLMISTWN--RGSTAFVLNPMERLAQLVIVPVVQAELNIVDAFAESERGAGGFGSTGR 147
>gi|94991708|ref|YP_599807.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS2096] >gi|94545216|gb|ABF35263.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Streptococcus pyogenes MGAS2096] (96 aa)
Score = 155, Expect = 3.0e-09, Identities = 39/95 (41%), Positives = 51/95 (53%)
  Q:     9 KISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYY 103
           KI   E   SF N D+       LPKR T H+AGYD      + I P +   +PTG++  M +  VL +  RSS   K  + L N+VGVID+DYY
  S:     3 KIRGFELVSSFTNPDL-------LPKRETTHAAGYDLSVAEAVTIAPGEIKLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYY 90
>gi|40795464|gb|AAR90929.1| conserved hypothetical protein [Aeromonas phage 65] (163 aa)
Score = 154, Expect = 3.2e-09, Identities = 48/132 (36%), Positives = 77/132 (58%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSV--------LLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTND--TNE------NKELVIKKGDGFAQAIF------LSYGITEDDQASEIR-NGGFGSTNKK 163
           +P    +  A  D   P  +++KP + + + TG+R  M++            +ILPRS LGFK+  +L NTVG+ID +Y     +G I +K+ N+   NE      NK L I KG+ F Q +F      + +   +D +   +R + G GS+  K
  S:    14 MPDFQREGDAAIDLRTPEAIMLKPGEDIIVNTGMRFDMSQIETDIPGVGIAAMILPRSGLGFKFYTRLANTVGLIDGNY-----QGEIMVKVRNEHIVNEDDPMTFNKVLHIPKGERFCQMVFIPVFNKIKFNRVDDFETQTVRGSAGIGSSGTK 163
>gi|30249433|ref|NP_841503.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosomonas europaea ATCC 19718] >gi|48427886|sp|Q82UM1|DUT_NITEU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|30138796|emb|CAD85373.1| dUTPase [Nitrosomonas europaea ATCC 19718] (149 aa)
Score = 154, Expect = 3.3e-09, Identities = 46/131 (35%), Positives = 68/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
            P  AT  SAG D  A  D  + I P +T+ IP+GI + + +     ++LPRS LG K+ + L N VG+IDSDY     +G I +   N         +   +  AQ + +      + + E+ Q S+    GFGST K
  S:    17 FPGYATPGSAGLDLRACIDERMEIHPGETLLIPSGIAIHLADPGFAAMVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQILVSCWNRGQAG--FTLDPMERIAQLVIVPVVQAGFNVVENFQPSQRGEQGFGSTGK 148
>gi|89901422|ref|YP_523893.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Rhodoferax ferrireducens T118] >gi|122478888|sp|Q21V41|DUT_RHOFD Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|89346159|gb|ABD70362.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rhodoferax ferrireducens T118] (149 aa)
Score = 154, Expect = 3.3e-09, Identities = 47/132 (35%), Positives = 69/132 (52%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A  D  L + P     +PTGI + + +     +ILPRS LG K+ + L N VG+IDSDY     +G + +   N +  +    I+  +  AQ + +      + +  +  AS    GG+GST K
  S:    16 QLPAYATPGSAGLDLRACLDAPLTLLPNAWQLVPTGIAIYLKDPKFAAMILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRS--DVAFTIEPMERIAQLVIVPVLQAQFNVVSEFPASARGEGGYGSTGK 148
>gi|15604264|ref|NP_220780.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia prowazekii str. Madrid E] >gi|7674012|sp|Q9ZDD2|DUT_RICPR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|3860956|emb|CAA14856.1| DEOXYURIDINE 5-TRIPHOSPHATE NUCLEOTIDOHYDROLASE (dut) [Rickettsia prowazekii] (148 aa)
Score = 154, Expect = 3.5e-09, Identities = 50/129 (38%), Positives = 67/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           LP+ AT+HSAG D  A  +  + IK      IPTGI + + E     I PRS L  K+ + + N+ G ID+DY      G I + L N    NK+ +I+KG   AQ I   Y      + S +       GGFGST
  S:    18 LPEYATEHSAGMDLVAANEQSITIKVGSIQLIPTGIAIALPESFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVLLINLG--NKDFIIEKGMRIAQMIIAKYERVLWAETSILTETMRGRGGFGST 146
>gi|157964479|ref|YP_001499303.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia massiliae MTU5] >gi|166918329|sp|A8F1H0|DUT_RICM5 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157844255|gb|ABV84756.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia massiliae MTU5] (148 aa)
Score = 154, Expect = 3.5e-09, Identities = 49/132 (37%), Positives = 70/132 (53%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           S  LP+ AT+HSAG D  A  +  + IK      IPTGI + + +     I PRS L  K+ + + N+ G ID+DY      G I + L N   E  + +I+KG   AQ I   Y     +++S +      +GGFGST
  S:    15 SGSLPEYATEHSAGMDLIAANEQPITIKAGAIQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVILINLGKE--DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSGGFGST 146
>gi|70906444|ref|NP_001020420.1| deoxyuridine triphosphatase isoform 3 [Homo sapiens] >gi|181844|gb|AAA58444.1| dUTP pyrophosphatase >gi|292877|gb|AAA36801.1| dUTP nucleotidohydrolase >gi|119597757|gb|EAW77351.1| dUTP pyrophosphatase, isoform CRA_c [Homo sapiens] (141 aa)
Score = 154, Expect = 3.5e-09, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    15 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 140
>gi|34810576|pdb|1Q5H|A Chain A, Human Dutp Pyrophosphatase Complex With Dudp >gi|34810577|pdb|1Q5H|B Chain B, Human Dutp Pyrophosphatase Complex With Dudp >gi|34810578|pdb|1Q5H|C Chain C, Human Dutp Pyrophosphatase Complex With Dudp >gi|34810580|pdb|1Q5U|X Chain X, Human Dutp Pyrophosphatase >gi|34810581|pdb|1Q5U|Y Chain Y, Human Dutp Pyrophosphatase >gi|34810582|pdb|1Q5U|Z Chain Z, Human Dutp Pyrophosphatase (147 aa)
Score = 154, Expect = 3.5e-09, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    21 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 146
>gi|119868273|ref|YP_938225.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium sp. KMS] >gi|126434766|ref|YP_001070457.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium sp. JLS] >gi|166217629|sp|A3PYI9|DUT_MYCSJ Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217630|sp|A1UF27|DUT_MYCSK Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|119694362|gb|ABL91435.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium sp. KMS] >gi|126234566|gb|ABN97966.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium sp. JLS] (154 aa)
Score = 154, Expect = 3.9e-09, Identities = 41/139 (29%), Positives = 65/139 (46%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + +P RA    AG D F+  D+ + P Q   +PTGI V +    V L+ PRS L  +  L + N+ G ID+ Y      G I + L N  + +  +VI++GD  AQ +     + E  + +     G   T +
  S:     8 LRLDRELPMPARAHDGDAGVDLFSARDVELAPGQRELVPTGIAVAIPHGMVGLVHPRSGLAARVGLSIVNSPGTIDAGY-----RGEIKVSLIN-LDPHAPIVIRRGDRIAQLLVQRVELPELVEVTSFDEAGLAETTR 140
>gi|163841140|ref|YP_001625545.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Renibacterium salmoninarum ATCC 33209] >gi|162954616|gb|ABY24131.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Renibacterium salmoninarum ATCC 33209] (203 aa)
Score = 153, Expect = 4.2e-09, Identities = 37/108 (34%), Positives = 57/108 (52%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI 137
           ++ P  A    AG D     DLVI P + V  PTG+ + + E  V LI PRS L  K+ L + N+ G +D+ Y      G I + L N T++++ + + +GD  AQ +
  S:    64 LEAPSYAHPGDAGADLRTRIDLVIAPGERVLAPTGVAIALPEGYVALIHPRSGLATKHGLTIVNSPGTVDAGY-----RGEIAVTLLN-TDQHQSITLSRGDRIAQMV 165
>gi|119897430|ref|YP_932643.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Azoarcus sp. BH72] >gi|166217604|sp|A1K4K1|DUT_AZOSB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|119669843|emb|CAL93756.1| dUTP diphosphatase [Azoarcus sp. BH72] (149 aa)
Score = 153, Expect = 4.2e-09, Identities = 43/130 (33%), Positives = 73/130 (56%)
  Q:    33 PKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFA-----QAIFLSYGITEDDQASEIRNGGFGSTNK 162
           P  A+  +AG D  A  D  +++ P +T  +P+G+ + + +  +  ++LPRS LG K+ + L N VG+IDSDY     +G +F+ + N   +     I+  +  A       + + + + +D  ASE   GGFGST K
  S:    18 PAYASAGAAGLDLRACLDAPVLLHPGETTLVPSGLAIHLADPGLAAMVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQVFVSVWNRGRD--VFTIQPMERIAQLVVVPVLQVGFNVVDDFAASERGEGGFGSTGK 148
>gi|190570486|ref|YP_001974844.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Wolbachia pipientis] >gi|190356758|emb|CAQ54117.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Wolbachia pipientis] (153 aa)
Score = 153, Expect = 4.3e-09, Identities = 52/143 (36%), Positives = 78/143 (54%)
  Q:    20 ENKDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEI-RN-GGFGSTNK 162
           E K +    S+ LP  AT  SAG D +A  D  +++ P + + IPTGI + +       + PRS L  K+ + + N+ G IDSDY      G + + L N +N+  E  IK+GD  AQ +      + +   E+  A E  RN GGFGS+ +
  S:     9 EIKKLSHGKSLPLPCYATMQSAGMDLYAALDDSVILNPLERLLIPTGIVIAIPNGFEGQVRPRSGLAAKHGITVLNSPGTIDSDY-----RGEVKVCLINLSNQPYE--IKRGDRIAQILITPVPEIIWNNIEEFYAKETARNEGGFGSSGR 153
>gi|160932401|ref|ZP_02079791.1| hypothetical protein CLOLEP_01236 [Clostridium leptum DSM 753] >gi|156868360|gb|EDO61732.1| hypothetical protein CLOLEP_01236 [Clostridium leptum DSM 753] (139 aa)
Score = 153, Expect = 4.5e-09, Identities = 47/132 (35%), Positives = 69/132 (52%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           ++P+RAT+ +AG D  A  D  + + P     IP+GI V +        +  RS LG K+ + L N VGVIDSDY      G I + L N   +  E  I+ G+  AQ + +        +A+E+       GGFGST +
  S:     6 EVPQRATEGAAGLDLRACIDAPVTLAPGGLAMIPSGIAVSLPGSGYAAFVFARSGLGVKHGISLSNGVGVIDSDY-----RGEICVGLCNLGTQPYE--IQPGERIAQLVVMPVCPLPVQEAAELDQTQRGAGGFGSTGR 138
>gi|145589923|ref|YP_001156520.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189027743|sp|A4SZP2|DUT_POLSQ Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|145048329|gb|ABP34956.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Polynucleobacter sp. QLW-P1DMWA-1] (149 aa)
Score = 153, Expect = 4.8e-09, Identities = 48/132 (36%), Positives = 69/132 (52%)
  Q:    31 QLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP   T  SAG D  A  D  I+  P QTV +PTG+ + + +      ILPRS LG K+ + L N VG+IDSDY     +G + +   N  +   +L  +  +  AQ + +        + E+   S    GGFGST +
  S:    16 QLPSYGTPGSAGLDLRACIDEAIEIVPGQTVLVPTGLAIYVEDPRYAAFILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSTWNRGSNPFKL--EPMERLAQLVVMPIQQVELKVVEEFTESSRGAGGFGSTGR 148
>gi|58040919|ref|YP_192883.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Gluconobacter oxydans 621H] >gi|81556891|sp|Q5FN20|DUT_GLUOX Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|58003333|gb|AAW62227.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Gluconobacter oxydans 621H] (151 aa)
Score = 153, Expect = 4.9e-09, Identities = 44/131 (33%), Positives = 65/131 (49%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           + LP  AT  +AG+DF A  D  + I P + V +PTG+ + +     L + PRS L  K+ + L N+ G ID DY      G + I + N   E     +++G   AQ +      L +   E    +    GGFGST
  S:    19 LPLPAYATAGAAGFDFLAAVDAPMTIAPGERVLVPTGLCIALPPAYELQVRPRSGLALKHGITLPNSPGTIDEDY-----RGELRIIVMNAGTE--PFTVERGTRIAQGVLAPVSRLRWTEVETLDETARGEGGFGST 149
>gi|163722478|ref|ZP_02130016.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Desulfatibacillum alkenivorans AK-01] >gi|161404232|gb|EDQ28462.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Desulfatibacillum alkenivorans AK-01] (154 aa)
Score = 153, Expect = 4.9e-09, Identities = 50/131 (38%), Positives = 66/131 (50%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITEDDQASEI-RN-GGFGST 160
           + LP+  T  SAG D  A  D  L + P     +PTG+ + + +   + + PRS L  K  + L NT G IDSDY      G + I L N + E +   I +GD  AQ I        +TE D   E  RN GGFG T
  S:    22 LPLPRCMTPGSAGMDICAALDEDLAMAPGDIALVPTGLAMAIPQGFEVQVRPRSGLAIKQGVSLVNTPGTIDSDY-----RGEVKIGLINLSRETR--TISRGDRIAQLIVGRVFQARLTETDSLDETERNGGGFGHT 152
>gi|84499723|ref|ZP_00998011.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Oceanicola batsensis HTCC2597] >gi|84392867|gb|EAQ05078.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Oceanicola batsensis HTCC2597] (153 aa)
Score = 153, Expect = 5.0e-09, Identities = 45/133 (33%), Positives = 69/133 (51%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD----LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           I LP  AT+ +AG D  A +     + ++P     +PTG+R+ + E   + + PRS L  K+ L L N+ G IDSDY      G + + L N    +   V+  GD  AQ +       ++ + ED   +    GGFGST +
  S:    18 IALPAYATEGAAGADLRANFPDRGAVTLEPGARALVPTGLRMAIPEGYEVQVRPRSGLALKHGLTLPNSPGTIDSDY-----RGEVGVILANLG--DAPFVVAHGDRIAQMVVAPVTQAAFAVVEDLVDTLRGAGGFGSTGR 152
>gi|74000610|ref|XP_851889.1| PREDICTED: similar to Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial precursor (dUTPase) (dUTP pyrophosphatase) [Canis familiaris] (214 aa)
Score = 153, Expect = 5.1e-09, Identities = 46/130 (35%), Positives = 68/130 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P + +  +AGYD ++ YD ++ P +   + T I+V +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ Q    +E  +GGFGST K
  S:    88 PTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGK 213
>gi|125974575|ref|YP_001038485.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Clostridium thermocellum ATCC 27405] >gi|196251938|ref|ZP_03150603.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Clostridium thermocellum DSM 4150] >gi|125714800|gb|ABN53292.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Clostridium thermocellum ATCC 27405] >gi|196198696|gb|EDX93528.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Clostridium thermocellum DSM 4150] (172 aa)
Score = 152, Expect = 5.5e-09, Identities = 50/129 (38%), Positives = 74/129 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFI----------------KLTNDTNENKELV--IKKGDGFAQAIF-----LSYGITEDDQASEI---RNGGFGST 160
           +PK A    AG D  A  D++I+P +TV +PTG+++ + E   + + PRS +     L++ N+ G IDS   Y D  G I                  + T D+  NK+ V  I+KGD  AQ +      + + +   D   EI   R GGFGST
  S:    18 IPKYAKPWDAGMDICAAEDVIIRPGETVIVPTGLKMAIPEGYEIQVRPRSGISLNTPLRITNSPGTIDSG--YRDEIGIIITNTSPASGGGEISSGQNEFTIDSKGNKQGVYKIRKGDRIAQIVLQRVPRIQFKVV--DSVKEIGNNRGGGFGST 168
>gi|68304255|ref|YP_249723.1| dUTPase [Chrysodeixis chalcites nucleopolyhedrovirus] >gi|67973084|gb|AAY84050.1| dUTPase [Chrysodeixis chalcites nucleopolyhedrovirus] (166 aa)
Score = 152, Expect = 5.7e-09, Identities = 46/130 (35%), Positives = 67/130 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           P+RAT  SAGYD + P D+ +KP++   +  GI +++       I  RS L  K+ + +    G+ID+DY      G + + L N +   KE   KKGD  AQ I  SY         E+ +     GGFGST +
  S:    41 PQRATLGSAGYDLYTPTDVCLKPQKWTVVDIGIAIQLPPKRYGRIAERSGLATKHGIGIQ--AGIIDTDY-----RGPVGVCLINRS--KKEYNFKKGDKIAQMIIESYHTPNVIMVDELDDTDRGSGGFGSTGQ 166
>gi|158338327|ref|YP_001519504.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acaryochloris marina MBIC11017] >gi|189027729|sp|B0C9N7|DUT_ACAM1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|158308568|gb|ABW30185.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acaryochloris marina MBIC11017] (143 aa)
Score = 152, Expect = 6.0e-09, Identities = 45/139 (32%), Positives = 69/139 (49%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           K I+L  S Q+P+ +    AG D FA     I P  +  IPTGI + + + +   + PRS L  K+ + + N+ G ID+ Y      G I + L N   E  ++V  +G   AQ +       E ++ +E+       GGFGST
  S:     4 KIIKLTESAQVPRYSHADDAGLDLFAIEAQKILPGASALIPTGIAIELPQGTEAQVRPRSGLALKHSITVLNSPGTIDAGY-----RGEIGVILINHGQETFQVV--EGMKIAQMVIAPIMRAEIEEVTELSATQRGEGGFGST 140
>gi|157953045|ref|YP_001497937.1| hypothetical protein NY2A_B741L [Paramecium bursaria Chlorella virus NY2A] >gi|155123272|gb|ABT15140.1| hypothetical protein NY2A_B741L [Paramecium bursaria Chlorella virus NY2A] (141 aa)
Score = 152, Expect = 6.1e-09, Identities = 42/107 (39%), Positives = 58/107 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           +P RAT+ SAGYD  +  D+VI     V + TG+ +R+   +   I PRS L +KY   +D   GVIDSD+      G I + L N +    + +IKKGD  AQ I 
  S:    15 VPTRATEGSAGYDISSVEDVVIPASGRVAVSTGLSIRVPNGTYGRIAPRSGLAYKY--GIDVLAGVIDSDFV-----GEIKVILYNTS--ELDYIIKKGDRIAQLIL 112
>gi|71065148|ref|YP_263875.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychrobacter arcticus 273-4] >gi|91206609|sp|Q4FU67|DUT_PSYA2 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|71038133|gb|AAZ18441.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychrobacter arcticus 273-4] (154 aa)
Score = 152, Expect = 6.1e-09, Identities = 49/143 (34%), Positives = 74/143 (51%)
  Q:    21 NKDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG------ITEDDQASEIRNGGFGSTNKK 163
           N  I    +  LP RAT  SAG D  A  D  L IK   T  I TG+ + + + +   +ILPRS LG K+ + L N VG+ID+DY     +G + + + N + E  + V+   +  AQ + +         +TE    S    GGFG + ++
  S:    10 NPKITEDKAFSLPTRATDGSAGIDLRACIDEPLTIKAGTTHLIGTGLAIYIQDPNFAGMILPRSGLGHKHGIVLGNLVGLIDADY-----QGELMVSIWNRSLE--DFVLNPAERMAQYVVVPVARPEFEVVTEFSDTSARGAGGFGHSGRQ 154
>gi|85860513|ref|YP_462715.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Syntrophus aciditrophicus SB] >gi|123517494|sp|Q2LWT5|DUT_SYNAS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|85723604|gb|ABC78547.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Syntrophus aciditrophicus SB] (150 aa)
Score = 152, Expect = 6.1e-09, Identities = 43/136 (31%), Positives = 71/136 (52%)
  Q:    27 YNSIQLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           +  + LP+  ++H+AG D  A    ++VI P +   IPTGI + + E     I PRS L  K+ + L N  G ID+DY      G I + L N  N+    V+ +G   AQ +      +++  +   + +   +GGFG T++
  S:    14 FEGLSLPRYMSEHAAGMDICAAVADEVVILPGERALIPTGIAIALPEGFEAQIRPRSGLALKHGVTLVNAPGTIDADY-----RGEIGVLLINHGND--PFVVARGSRVAQMVIAPVCRVAWSESGSLETTTRGDGGFGHTDE 149
>gi|68172029|ref|ZP_00545319.1| DeoxyUTP pyrophosphatase, subfamily 1 [Ehrlichia chaffeensis str. Sapulpa] >gi|88657998|ref|YP_507316.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Ehrlichia chaffeensis str. Arkansas] >gi|67998547|gb|EAM85310.1| DeoxyUTP pyrophosphatase, subfamily 1 [Ehrlichia chaffeensis str. Sapulpa] >gi|88599455|gb|ABD44924.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Ehrlichia chaffeensis str. Arkansas] (155 aa)
Score = 152, Expect = 6.3e-09, Identities = 48/133 (36%), Positives = 72/133 (54%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNG--GFGST 160
           N++ LP  +T +S+G D ++    D++++P   V I TGI + +       + PRS L  K+ + + NT G ID+DY      G I + L N  NE     IK GD  AQ I      +S+ + ED    + + G  GFGST
  S:    19 NNLPLPSYSTDNSSGMDLYSAVVTDVILEPGCRVCINTGIAISVPNGYEAQVRPRSGLALKFGITVLNTPGTIDADY-----RGEIKVILINLGNE--AYTIKYGDRIAQMIIAPITRISWDLVEDFDNDKTKRGAQGFGST 153
>gi|149928082|ref|ZP_01916329.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Limnobacter sp. MED105] >gi|149823168|gb|EDM82405.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Limnobacter sp. MED105] (150 aa)
Score = 152, Expect = 6.5e-09, Identities = 48/133 (36%), Positives = 69/133 (51%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNE-DSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNKK 163
           QLP   T  SAG D  A  +  L ++P Q   +PTG+ + + + +    ILPRS LG K  L L N VG+IDSDY     +G + +   N +     + I+  +  AQ + L      + +  D   SE   GGFGST  +
  S:    17 QLPAYGTPGSAGIDLRACLNEALTLQPGQAELVPTGLSMYIGDPNYCATILPRSGLGHKKGLVLGNLVGLIDSDY-----QGPLMVSAWNRS--QVAVTIEPMERIAQLVILPVAHADFKVVSDFTPSERGEGGFGSTGTR 150
>gi|149194431|ref|ZP_01871528.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Caminibacter mediatlanticus TB-2] >gi|149135606|gb|EDM24085.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Caminibacter mediatlanticus TB-2] (142 aa)
Score = 152, Expect = 6.7e-09, Identities = 50/131 (38%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITEDDQASEIR--NGGFGSTNK 162
           LPK  T  +AG+D  +  ++VIK  +   I TG+   + +     I PRS L FKY + + N+ G IDSDY      G I + L N   E+ E  IKKGD  +Q +    +   I E +  S  +  +GGFGST K
  S:    14 LPKYQTDEAAGFDLHSIENVVIKVGERKLISTGLAFEIEKGFEAQIRPRSGLAFKYGITVLNSPGTIDSDY-----RGEIKVLLINLGEEDFE--IKKGDRISQVVIAPVIQAEIIEVEILSNTQRGSGGFGSTGK 142
>gi|108799158|ref|YP_639355.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium sp. MCS] >gi|108769577|gb|ABG08299.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium sp. MCS] (139 aa)
Score = 152, Expect = 6.7e-09, Identities = 40/131 (30%), Positives = 62/131 (47%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           +P RA    AG D F+  D+ + P Q   +PTGI V +    V L+ PRS L  +  L + N+ G ID+ Y      G I + L N  + +  +VI++GD  AQ +     + E  + +     G   T +
  S:     1 MPARAHDGDAGVDLFSARDVELAPGQRELVPTGIAVAIPHGMVGLVHPRSGLAARVGLSIVNSPGTIDAGY-----RGEIKVSLIN-LDPHAPIVIRRGDRIAQLLVQRVELPELVEVTSFDEAGLAETTR 125
>gi|109081027|ref|XP_001112932.1| PREDICTED: dUTP pyrophosphatase isoform 1 [Macaca mulatta] (218 aa)
Score = 151, Expect = 7.3e-09, Identities = 47/123 (38%), Positives = 65/123 (52%)
  Q:    40 SAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           +AGYD ++ YD  I P +   + T I++ +       + PRS L  KY   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    99 AAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKYF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 217
>gi|114656882|ref|XP_001165897.1| PREDICTED: similar to dUTPase isoform 4 [Pan troglodytes] (167 aa)
Score = 151, Expect = 7.6e-09, Identities = 45/130 (34%), Positives = 65/130 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I     +      +D   +E  +GGFGST K
  S:    41 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQDLDDTERGSGGFGSTGK 166
>gi|190572471|ref|YP_001970316.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase [Stenotrophomonas maltophilia K279a] >gi|190010393|emb|CAQ44001.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase [Stenotrophomonas maltophilia K279a] (157 aa)
Score = 151, Expect = 7.6e-09, Identities = 47/138 (34%), Positives = 72/138 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           D    +S  LP  AT+ SAG D  A  D  L ++P  T  +P+G+ + + +  +  +ILPRS LG ++ + L N  G+ID+DY     +G + I + N   E     I+ GD  AQ +      +S  + +    S    GGFG T
  S:    16 DPRFGDSWPLPAYATEASAGMDLRAALDTALTLQPGDTALVPSGLAIHIADPHLCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGPLLISVWNRGRE--AFTIEPGDRIAQLVVVPIARVSLQVVDTFTDSVRGTGGFGHT 154
>gi|113869003|ref|YP_727492.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia eutropha H16] >gi|113527779|emb|CAJ94124.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia eutropha H16] (166 aa)
Score = 151, Expect = 8.0e-09, Identities = 50/133 (37%), Positives = 70/133 (52%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVK-IPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKE-LVIKKGDGFAQAIFLSY------GITEDDQASEIRNGGFGST 160
           N   LP   ++ +A  D  A  D  + I P    + +P GI V M N      I+PRS LG K  L L N++GVID+DY     +G I + + N      E +VI+ G+  AQ +F+         + E  + SE   GGFGST
  S:    19 NEWGLPAYQSEMAAAIDLHACVDAPVSIAPGTPAQLVPAGIAVHMGNPYMAATIVPRSGLGHKKGLVLGNSIGVIDADY-----QGQIMVSVWNRNAPGTEPIVIQPGERIAQMMFVPVLRPVFSTVAEFSEDSERGAGGFGST 157
>gi|114656890|ref|XP_001165929.1| PREDICTED: dUTP pyrophosphatase isoform 5 [Pan troglodytes] (164 aa)
Score = 151, Expect = 8.0e-09, Identities = 45/130 (34%), Positives = 65/130 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I     +      +D   +E  +GGFGST K
  S:    38 PTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQDLDDTERGSGGFGSTGK 163
>gi|157828422|ref|YP_001494664.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933134|ref|YP_001649923.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia rickettsii str. Iowa] >gi|166218220|sp|A8GRY1|DUT_RICRS Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|189027746|sp|B0BXE1|DUT_RICRO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157800903|gb|ABV76156.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908221|gb|ABY72517.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia rickettsii str. Iowa] (148 aa)
Score = 151, Expect = 8.0e-09, Identities = 50/132 (37%), Positives = 70/132 (53%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG-ITEDDQASEIR----NGGFGST 160
           S  LP+ AT+HSAG D  A  +  + IK      IPTGI + + +     I PRS L  K+ + + N+ G ID+DY      G I + L N   E  + +I+KG   AQ I   Y  I  ++  S +     +GGFGST
  S:    15 SGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVILINLGKE--DFIIEKGMRIAQMIIAKYERILWEESISLMETMRGSGGFGST 146
>gi|9633823|ref|NP_051901.1| gp012L [Rabbit fibroma virus] >gi|6578542|gb|AAF17896.1|AF170722_14 gp012L [Rabbit fibroma virus] (143 aa)
Score = 151, Expect = 8.9e-09, Identities = 42/117 (35%), Positives = 59/117 (50%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           K ++      LP +ATK +AGYD ++ Y  +I+P +   + T I + + E     I PRS L  K+   +D   GVID DY      G++ I L N  N      +KKGD  AQ IF
  S:     6 KCVKFSEHASLPTKATKDAAGYDLYSAYAYIIRPSERCLVKTDIGLSIPEGCYGRIAPRSGLSLKF--SIDVGGGVIDRDY-----RGNVGIILIN--NGKDTYYVKKGDKVAQIIF 113
>gi|48097825|ref|XP_393899.1| PREDICTED: similar to Deoxyuridine 5-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) (PPAR-interacting protein 4) (PIP4) isoform 1 [Apis mellifera] (142 aa)
Score = 151, Expect = 8.9e-09, Identities = 44/131 (33%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           +P + +K++AGYD  + Y+ ++ P     I T +++ + E++   I PRS L +K+   +D   GVID+DY      G++ + L N +NE     I  GD  AQ I       E  + + + N     GGFGST K
  S:    15 IPTKGSKYAAGYDLRSAYEYIVPPNGKELIKTDLQIEVPENTYGRIAPRSGLAWKH--HIDVGAGVIDADY-----RGNVGVVLFNHSNE--PFKISPGDRIAQLICEKIIYPELQEVNNLDNTDRGDGGFGSTGK 141
>gi|194206679|ref|XP_001499927.2| PREDICTED: similar to deoxyuridine triphosphatase [Equus caballus] (332 aa)
Score = 150, Expect = 1.0e-08, Identities = 45/130 (34%), Positives = 67/130 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQ---ASEIRNGGFGSTNK 162
           P + +  +AGYD ++ YD  + P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ Q    +E  +GGFGST K
  S:   206 PTKGSARAAGYDLYSAYDYTVPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQVLDVTERGSGGFGSTGK 331
>gi|21233281|ref|NP_639198.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66770239|ref|YP_245001.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas campestris pv. campestris str. 8004] >gi|188993437|ref|YP_001905447.1| hypothetical protein xccb100_4042 [Xanthomonas campestris pv. campestris] >gi|48474736|sp|Q8P458|DUT_XANCP Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|81303813|sp|Q4UPP2|DUT_XANC8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|21115118|gb|AAM43089.1| dUTPase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575571|gb|AAY50981.1| dUTPase [Xanthomonas campestris pv. campestris str. 8004] >gi|167735197|emb|CAP53409.1| unnamed protein product [Xanthomonas campestris pv. campestris] (152 aa)
Score = 150, Expect = 1.0e-08, Identities = 46/129 (35%), Positives = 68/129 (52%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LP  AT+ SAG D  A  +  + ++P     IP+GI + +++  V  +ILPRS LG ++ + L N  G+ID+DY     +G + I   N   E     I+ GD  AQ + L     S  + +    S    GGFG T
  S:    20 LPAYATEASAGMDLRAALEAPMTLEPGDAALIPSGIAIHLDDPQVCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGPLLISTWNRGRE--AFTIEPGDRIAQLVILPIVRVSLQVVDTFVDSARGAGGFGHT 149
>gi|120403457|ref|YP_953286.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium vanbaalenii PYR-1] >gi|166217633|sp|A1T7Y0|DUT_MYCVP Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|119956275|gb|ABM13280.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium vanbaalenii PYR-1] (154 aa)
Score = 150, Expect = 1.1e-08, Identities = 40/139 (28%), Positives = 63/139 (45%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+ + P Q   +PTGI V +    V LI PRS L  +  L + N+ G +D+ Y      G I + L N  +    + I++GD  AQ +     + E  + +     G   T +
  S:     8 VRLDRDLPLPSRAHDGDAGVDLYSAQDVELAPGQRALVPTGIAVAIPHGMVGLIHPRSGLAARVGLSIVNSPGTVDAGY-----RGEIKVSLIN-LDPAAPIAIRRGDRIAQLLVQRVELPELVEVTSFDEAGLADTTR 140
>gi|9632112|ref|NP_048907.1| hypothetical protein PBCV1_A551L [Paramecium bursaria Chlorella virus 1] >gi|3913545|sp|O41033|DUT_PBCV1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|2447054|gb|AAC96912.1| similar to tomato dUTP pyrophosphatase, corresponds to GenBank Accesssion Number S40549 [Paramecium bursaria Chlorella virus 1] (141 aa)
Score = 150, Expect = 1.1e-08, Identities = 41/114 (35%), Positives = 59/114 (51%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           +L  S   P R ++ +AGYD  +  D+V+     + + TGI +R+   +   I PRS L +KY   +D   GVIDSDY      G +   L N T   ++ +IKKGD  AQ I 
  S:     8 KLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPNGTYGRIAPRSGLAYKY--GIDVLAGVIDSDY-----RGELKAILYNTT--ERDYIIKKGDRIAQLIL 112
>gi|110636446|ref|YP_676653.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Cytophaga hutchinsonii ATCC 33406] >gi|123059092|sp|Q11Z53|DUT_CYTH3 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|110279127|gb|ABG57313.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Cytophaga hutchinsonii ATCC 33406] (154 aa)
Score = 149, Expect = 1.2e-08, Identities = 49/154 (31%), Positives = 80/154 (51%)
  Q:     9 KISLNEFNKSFENKDIELYNSIQLPKRATKHSAGYDF--FAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL----SYGITEDDQASEIR-NGGFGSTNK 162
           K  LN+ N +   K +   N+  LP   T  +AG D   +    +V++P Q   +PTG+ + + E +   I PRS L FK+ + + N+ G ID+DY      G I + L N +NE     I+ G+  AQ +      ++ +  ++ +  +R   GFGST K
  S:     2 KRCLNKANMTTSVKIVNKSNN-ALPAYQTAQAAGMDLSAYITEAIVLQPLQRQLVPTGLFIELPEHTEAQIRPRSGLAFKHGITVLNSPGTIDADY-----RGEIKVLLVNLSNE--AFTIQSGERIAQIVIAKVEHAHFVEVEELSDSLRAAAGFGSTGK 154
>gi|120610016|ref|YP_969694.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120588480|gb|ABM31920.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acidovorax avenae subsp. citrulli AAC00-1] (148 aa)
Score = 149, Expect = 1.2e-08, Identities = 45/132 (34%), Positives = 70/132 (53%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           QLP  AT  SAG D  A  D  L ++P     +PTGI + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N +  +    ++  +  AQ + +      + + ++  A+     G+GST K
  S:    15 QLPAYATPGSAGLDLRACLDAPLTLQPNAWQLVPTGIAIYLKDPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRS--DIAFTLQPMERLAQLVIVPVVQAQFHVVQEFPATARGENGYGSTGK 147
>gi|42520137|ref|NP_966052.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|99034411|ref|ZP_01314421.1| hypothetical protein Wendoof_01000774 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|48427871|sp|P61913|DUT_WOLPM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|42409874|gb|AAS13986.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Wolbachia endosymbiont of Drosophila melanogaster] (153 aa)
Score = 149, Expect = 1.2e-08, Identities = 52/133 (39%), Positives = 75/133 (56%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQ---ASEI-RN-GGFGSTNK 162
           + LP  AT  SAG D +A  +   V+ P + + +PTGI + +       I PRS L  K+ + + N+ G IDSDY      G + I L N +N+  E  IK+GD  AQ +   +S  I +D +   A E  RN GGFGS+ +
  S:    19 LSLPCYATTQSAGMDLYAALNDSAVLNPLERLLVPTGIVIAIPNGFEGQIRPRSGLAAKHGITVLNSPGTIDSDY-----RGEVKICLINLSNQPYE--IKRGDRIAQILISPVSQVIWDDREEFCAEETGRNAGGFGSSGR 153
>gi|9633174|ref|NP_050279.1| dUTPAse homolog [Fowl adenovirus D] >gi|56160708|ref|AP_000367.1| ORF1 [Fowl adenovirus D] >gi|7531093|sp|Q9YYS0|DUT_ADEG8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|5739098|gb|AAD50334.1|AF083975_1 dUTPAse homolog [Fowl adenovirus 9] >gi|3845650|gb|AAC71662.1| dUTPase homolog [fowl adenovirus 8] >gi|78067995|gb|ABB18320.1| ORF1 [Fowl adenovirus 2] (163 aa)
Score = 149, Expect = 1.3e-08, Identities = 47/128 (36%), Positives = 65/128 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITEDDQASEIRNG--GFGST 160
           P+RAT  +AGYD  +  D+V+ PK    IPT +  +        I PRS L  K+   +D   GVIDSDY      G + + L N ++ N    +++GD  AQ I    L+  + E     E   G  GFGST
  S:    27 PQRATSGAAGYDLCSSADVVVPPKSRSLIPTDLSFQFPRGVYGRIAPRSGLAVKFF--IDVGAGVIDSDY-----RGIVSVLLFNFSDHN--FNVRRGDRIAQLILERHLTPDLEERSGLDETARGAAGFGST 150
>gi|115503092|gb|ABI99010.1| DUTPase [Deerpox virus W-1170-84] (144 aa)
Score = 149, Expect = 1.3e-08, Identities = 47/139 (33%), Positives = 71/139 (51%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           K ++L     +PK+AT +SAGYD ++ YD  + P   + + T I + + E     I PRS L   Y + +    GVID DY      G+I + + N++    E  IK GD  AQ IF        ++  E++     N GFGS+
  S:     7 KCLKLSEFATIPKKATHNSAGYDLYSAYDYTVNPLDRILVRTDISLEIPECCYGRIAPRSGLALNYNIDIGG--GVIDRDY-----RGNIGVIVINNSTCVFE--IKAGDRIAQIIFERIENPSIEEVLELKDTFRGNRGFGSS 141
>gi|49080340|gb|AAT50006.1| PA5321 [synthetic construct] (152 aa)
Score = 149, Expect = 1.3e-08, Identities = 37/80 (46%), Positives = 50/80 (62%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDY 102
           D  L +   LP+ AT  SAG D  A    D V+ P QT+ IPTG+ + + +  +  L+LPRS LG K+ + L N VG+IDSDY
  S:    10 DPRLGSDFPLPQYATPGSAGLDLRAMLKEDSVLGPGQTLLIPTGLSIYIADPGLAALVLPRSGLGHKHGIVLGNLVGLIDSDY 92
>gi|194364063|ref|YP_002026673.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Stenotrophomonas maltophilia R551-3] >gi|194346867|gb|ACF49990.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Stenotrophomonas maltophilia R551-3] (157 aa)
Score = 149, Expect = 1.4e-08, Identities = 47/138 (34%), Positives = 70/138 (50%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE----DDQASEIR-NGGFGST 160
           D    +S  LP  AT  SAG D  A  D  L ++P  T  +P+G+ + + +  +  +ILPRS LG ++ + L N  G+ID+DY     +G + I + N   E     I+ GD  AQ + +          D     +R  GGFG T
  S:    16 DPRFGDSWPLPAYATAASAGMDLRAALDTALTLQPGDTALVPSGLAIHIADPHLCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGPLLISVWNRGRE--AFTIEPGDRIAQLVVVPIARVNLQVVDTFTDSVRGTGGFGHT 154
>gi|167386817|ref|XP_001737913.1| deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial precursor, putative [Entamoeba dispar SAW760] >gi|165899099|gb|EDR25785.1| deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial precursor, putative [Entamoeba dispar SAW760] (142 aa)
Score = 149, Expect = 1.4e-08, Identities = 48/138 (34%), Positives = 69/138 (50%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG---ITEDDQASEIRNG--GFGSTNK 162
           +L     +P R + ++AG D ++  + +I+P     + TGI V++       I PRSSL  KY + +    GVID DY      G I + L N +NE      +KGD  AQ I        I+E  + +E   G  GFGST K
  S:     9 KLAEDATIPTRGSNYAAGIDLYSNTNFIIQPHDRFLVSTGIAVQIPHQCYGRIAPRSSLALKYGIDVGG--GVIDEDY-----RGEIKVILFNHSNE--IFNCRKGDRIAQLIIERISCCRISEVKELNETDRGSNGFGSTGK 142
>gi|163815687|ref|ZP_02207059.1| hypothetical protein COPEUT_01867 [Coprococcus eutactus ATCC 27759] >gi|158448992|gb|EDP25987.1| hypothetical protein COPEUT_01867 [Coprococcus eutactus ATCC 27759] (147 aa)
Score = 149, Expect = 1.4e-08, Identities = 46/132 (34%), Positives = 67/132 (50%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGSTNKK 163
           +P   ++++AG D +A  D  + I+P QTV I TGI + +      L+  RS L  K  L   N VGVID+DY      G I + L N   + +   ++ G+  AQ +   Y +    Q  E+       GGFGST  K
  S:    16 IPTYGSEYAAGADLYACLDSAVDIEPGQTVLIHTGIAMEIPAGYAGLVYARSGLASKKGLAPANKVGVIDADY-----RGEIMVALHNHGTQAQP--VEPGERIAQLVIAPYIVGAFHQVDELSETVRGEGGFGSTGSK 147
>gi|27904979|ref|NP_778105.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|29427396|sp|P59408|DUT_BUCBP Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|27904377|gb|AAO27210.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (152 aa)
Score = 149, Expect = 1.5e-08, Identities = 43/117 (36%), Positives = 63/117 (53%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           D  +     LP  AT  S+G D  A     +++ P +TV IPTGI V +++  +  +ILPRS LG    + L N VG+IDSDY     +G + + L N  + N    +K G   AQ +F+
  S:    10 DDRIGTQFSLPSYATSGSSGLDLRACIKDSIILLPNETVLIPTGIAVYIDDPYITAIILPRSGLGHVQGIVLGNLVGLIDSDY-----QGQVMVSLWNRGSRN--FSVKVGMRIAQIVFI 122
>gi|157803849|ref|YP_001492398.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia canadensis str. McKiel] >gi|166218219|sp|A8EZ30|DUT_RICCK Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157785112|gb|ABV73613.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia canadensis str. McKiel] (148 aa)
Score = 149, Expect = 1.5e-08, Identities = 49/129 (37%), Positives = 69/129 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           LPK AT+HSAG D  A     ++IK  +   IPTGI + + +     I PRS L  K+ + + N+ G IDSDY      G I + L N   E  + +I+KG   AQ I   Y      +++ +      +GGFGST
  S:    18 LPKYATEHSAGMDLIAANKQPIIIKIGEIQLIPTGIAIALPDLFEAQIRPRSGLAVKHGITVANSPGTIDSDY-----RGEIKVILINLGKE--DFIIEKGMRIAQMIISKYERILWKESNTLEETVRGSGGFGST 146
>gi|114705021|ref|ZP_01437929.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Fulvimarina pelagi HTCC2506] >gi|114539806|gb|EAU42926.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Fulvimarina pelagi HTCC2506] (148 aa)
Score = 148, Expect = 1.7e-08, Identities = 47/131 (35%), Positives = 69/131 (52%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           I+ P+  +K +AG D  A  D  LV++P +   +P+G    + +D  + I PRS L   + + + NT G +DSDY      G + I L N   E   L  ++GD  AQA+       SY    D +A+    GGFGST
  S:    16 IEPPRYESKGAAGADIRAAIDEELVLQPGERALVPSGFSFAVPQDYEMQIRPRSGLAALHGVTVLNTPGTVDSDY-----RGEVKIILINLGAEAFRL--QRGDRIAQAVVAPVTRASYVEVADLEATVRGEGGFGST 146
>gi|77166440|ref|YP_344965.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosococcus oceani ATCC 19707] >gi|91206602|sp|Q3J6W1|DUT_NITOC Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|76884754|gb|ABA59435.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Nitrosococcus oceani ATCC 19707] (151 aa)
Score = 148, Expect = 1.7e-08, Identities = 51/140 (36%), Positives = 68/140 (48%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGSTNK 162
           D  L     LP  AT  +AG D  A  +  L I P  T  IPTG+ + + +     ++LPRS LG K  + L N VG+IDSDY     +G I +   N   E   L +  G+  AQ IF+     E +Q           GGFG T +
  S:    10 DSRLGKEFPLPDYATAGAAGLDLRACIERPLAILPGATKLIPTGLAIYIADPRFAAVLLPRSGLGHKQGIVLGNLVGLIDSDY-----QGEILVSCWNRGAEPFTLAV--GERIAQMIFVPVVQMEFEQVETFTATLRGEGGFGHTGR 150
>gi|109149619|ref|XP_001084330.1| PREDICTED: similar to dUTP pyrophosphatase isoform 2 [Macaca mulatta] (164 aa)
Score = 148, Expect = 1.7e-08, Identities = 47/130 (36%), Positives = 67/130 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P   +  +AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ QA   +E  +GGFGST K
  S:    38 PTLGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGK 163
>gi|85709421|ref|ZP_01040486.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Erythrobacter sp. NAP1] >gi|85688131|gb|EAQ28135.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Erythrobacter sp. NAP1] (152 aa)
Score = 148, Expect = 1.8e-08, Identities = 37/109 (33%), Positives = 55/109 (50%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           + LP  AT  SAG D  +  D+ I P     + TG+ V + +   + + PRS L FK+ + + NT G IDSDY      G + + L N  +E  +  I +GD  AQ + 
  S:    18 LSLPAYATDGSAGMDIVSAEDVTIAPGARHAVATGLSVAIPQGFEIQVRPRSGLAFKHGITVPNTPGTIDSDY-----RGELKVLLINHGSE--DFAIARGDRVAQLVL 119
>gi|67470091|ref|XP_651016.1| deoxyuridine 5'-triphosphate nucleotidohydrolase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56467697|gb|EAL45630.1| deoxyuridine 5'-triphosphate nucleotidohydrolase, putative [Entamoeba histolytica HM-1:IMSS] (142 aa)
Score = 148, Expect = 1.8e-08, Identities = 49/131 (37%), Positives = 70/131 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSY-GITEDDQASEIRNG--GFGSTNK 162
           +P R +K +AG D ++  + +I+P +   + TG+ V++       I PRSSL  KY   +D   GVID DY      G I + L N +NE      +KGD  AQ I   +SY  I+E  + +    G  GFGST K
  S:    16 VPTRGSKCAAGIDLYSNTNFIIQPHERFLVSTGVSVQIPHQCYGRIAPRSSLALKY--GIDVGAGVIDEDY-----RGEIKVILFNHSNE--IFNGRKGDRIAQLIIERISYCRISEVKELNTTDRGTNGFGSTGK 142
>gi|77976330|ref|ZP_00831827.1| COG0756: dUTPase [Yersinia intermedia ATCC 29909] (111 aa)
Score = 148, Expect = 2.0e-08, Identities = 37/95 (38%), Positives = 55/95 (57%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYDLVIK--PKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTN 117
           D  + N   LP  AT+ SAG D  A  D  +   P QT  +PTG+ + + + ++  +ILPRS LG K+ + L N VG+IDSDY     +G + + + N
  S:    11 DPRVGNEFPLPTYATEGSAGLDLRACLDEAVDLLPGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGVVLGNLVGLIDSDY-----QGQLMVSVWN 103
>gi|148912895|ref|YP_001293209.1| hypothetical protein GTPV_gp015 [Goatpox virus Pellor] (146 aa)
Score = 147, Expect = 2.2e-08, Identities = 49/137 (35%), Positives = 69/137 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR--------NGGFGST 160
           I L    +LP ++T  SAGYD ++ YD ++K K+ + + T I + + +     I PRS L   Y + +    GVID D  Y  N G IFI      N      IK+GD  AQ IF      E  +  E++        N GFGS+
  S:    11 IRLSAFAKLPTKSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYGIDIGG--GVIDED--YRGNIGVIFI-----NNSKNTFNIKRGDRVAQIIFEK---VEYPKIKEVKCLDGTNRDNNGFGSS 143
>gi|83944883|ref|ZP_00957249.1| putative deoxyuridine 5'triphosphate nucleotidohydrolase [Oceanicaulis alexandrii HTCC2633] >gi|83851665|gb|EAP89520.1| putative deoxyuridine 5'triphosphate nucleotidohydrolase [Oceanicaulis alexandrii HTCC2633] (148 aa)
Score = 147, Expect = 2.2e-08, Identities = 48/139 (34%), Positives = 70/139 (50%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFA--PYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           K +E +  ++LP   T  SAG D  A  P D  +VI P +   IPTGI + + E     I PRS L  K  +   NT G +D+DY      G + + L N   E    V+++G+  AQ +      +S+   +    +    GGFGST
  S:     6 KTLEHFEGLELPAYQTAGSAGLDLPAAVPADEPVVIAPGEWKLIPTGICIALPEGYEAQIRPRSGLAAKKGISCVNTPGTVDADY-----RGELRVNLINHGRE--PFVVQRGERIAQMVIGQFTQISWNPVDALDETARGQGGFGST 146
>gi|114326820|ref|YP_743977.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Granulibacter bethesdensis CGDNIH1] >gi|114314994|gb|ABI61054.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Granulibacter bethesdensis CGDNIH1] (145 aa)
Score = 147, Expect = 2.5e-08, Identities = 44/131 (33%), Positives = 63/131 (48%)
  Q:    30 IQLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           + LP  AT  +AG D  A     + I P     IPTG+R+ +     L I PRS L  K+ + L NT G ID DY      G + I + N   E    ++++G   AQ +       ++   +    +E   GGFGST
  S:    14 LSLPAYATPGAAGMDLLAAVTESVTIPPGGRALIPTGLRMALPPGHELQIRPRSGLALKHGITLPNTPGTIDEDY-----RGEVGIIVLNTGTE--PFIVERGMRIAQGVLAPVIRGTFQTVDSLDDTERGTGGFGST 144
>gi|99080302|ref|YP_612456.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Silicibacter sp. TM1040] >gi|99036582|gb|ABF63194.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Silicibacter sp. TM1040] (163 aa)
Score = 146, Expect = 2.7e-08, Identities = 50/129 (38%), Positives = 70/129 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQ------TVKIPTGIRVRMNEDS-VLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKE-LVIKKGDGFAQAIF---LSYGITEDD---QASEIRNGGFGST 160
           +P   T+ SA  D FA  D    PK+       V IP+G+   M + S   L++PRS LG K  L + N VG+ID+DY      G +FI   N        +VI+ G+  AQ +F   L   + E +    ++E   GGFGST
  S:    22 MPSYQTQGSAAIDLFACID---APKEIAPQAPAVLIPSGLAFYMGDQSCAALVMPRSGLGHKKGLVMGNNVGLIDADY-----TGEVFISAWNRNPPGAAPIVIEPGERIAQLMFVPVLRATLNEVETFSNSTERGAGGFGST 156
>gi|39933160|ref|NP_945436.1| putative deoxyuridine 5'triphosphate nucleotidohydrolase [Rhodopseudomonas palustris CGA009] >gi|167367346|ref|ZP_02301488.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Rhodopseudomonas palustris TIE-1] >gi|192288516|ref|YP_001989121.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Rhodopseudomonas palustris TIE-1] >gi|48427869|sp|P61911|DUT_RHOPA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|39652785|emb|CAE25524.1| putative deoxyuridine 5'triphosphate nucleotidohydrolase [Rhodopseudomonas palustris CGA009] >gi|192282265|gb|ACE98645.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Rhodopseudomonas palustris TIE-1] (152 aa)
Score = 146, Expect = 2.8e-08, Identities = 45/133 (33%), Positives = 68/133 (51%)
  Q:    30 IQLPKRATKHSAGYDFFA--PYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           + LP+  T H+AG D  A  P D  L ++P + V +PTG+ + + E+    + PRS L  K+ + + N  G ID+DY      G I + L N   E     I++G+  AQ +        +   E    S    GGFGST +
  S:    18 LPLPEYQTAHAAGLDLIAAVPQDAPLTLQPGRYVLVPTGLTIALPENYEAQVRPRSGLAAKHGVTVLNAPGTIDADY-----RGEIGVLLINHGTE--PFAIRRGERIAQMVIAPVSRAQFVAVEALPESGRGAGGFGSTGR 152
>gi|157335340|emb|CAO61170.1| unnamed protein product [Vitis vinifera] (176 aa)
Score = 146, Expect = 2.8e-08, Identities = 47/129 (36%), Positives = 69/129 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGIT------EDDQASEIRNGGFGST 160
           LP RA+  SAGYD  +  +  +  +    +PT + + + E +   I PRS L +KY   +D   GVID+DY      G + + L N ++ + E  +K GD  AQ I +   IT      ED  ++E   GGFGST
  S:    50 LPSRASPLSAGYDLSSATETKVPARGKALVPTDLSIGIPEGTYARIAPRSGLAWKY--SIDVGAGVIDADY-----RGPVGVILFNHSDVDFE--VKVGDRIAQLI-IEKIITPEVMEVEDLDSTERGVGGFGST 174
>gi|109638736|ref|YP_656650.1| dUTP diphosphatase (dUTPase) [Ranid herpesvirus 2] >gi|109138223|gb|ABG25701.1| ORF142 [Ranid herpesvirus 2] (140 aa)
Score = 146, Expect = 2.8e-08, Identities = 47/129 (36%), Positives = 64/129 (49%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGSTN 161
           P RAT+HSAGYD       V++     K+ TGI + + E     I+ RS +  K    +    GVID+DY      G I I   N  N N +L I  G   AQ IF + G     +++E+      +G FGSTN
  S:    14 PSRATEHSAGYDLSPCIPTVLRANAITKVHTGIALEIPEGYYGRIVERSCMAVK---DMCACGGVIDADY-----RGEIIILFKN--NNNMDLPICDGARIAQIIFEACGRFTLQESAELTCTQRGDGAFGSTN 137
>gi|183220918|ref|YP_001838914.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase; dUTP pyrophosphatase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911014|ref|YP_001962569.1| dUTP diphosphatase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775690|gb|ABZ93991.1| dUTP diphosphatase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779340|gb|ABZ97638.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase; dUTP pyrophosphatase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (149 aa)
Score = 146, Expect = 2.9e-08, Identities = 46/131 (35%), Positives = 67/131 (51%)
  Q:    32 LPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           LP+  T  +AG D  A    +L++   + V +PTG+ + + E     I PRS    K+R+ + N+ G IDSDY      G I I L N + E  + V+K G   AQ +      L   +     A++   GGFGST K
  S:    19 LPEYKTPGAAGMDLSACLSENLLLPKGEVVLVPTGLAMAIPEGYEGQIRPRSGFSTKHRIIMPNSPGTIDSDY-----RGEILIPLLNLSGE--DFVLKPGTRVAQLVIQAVSQLPIQVVTGLDATQRGTGGFGSTGK 149
>gi|16758374|ref|NP_446044.1| deoxyuridine triphosphatase isoform 1 [Rattus norvegicus] >gi|14916974|sp|P70583|DUT_RAT Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) (PPAR-interacting protein 4) (PIP4) >gi|5922020|gb|AAC34734.2| dUTPase [Rattus norvegicus] >gi|149023172|gb|EDL80066.1| deoxyuridine triphosphatase, isoform CRA_a [Rattus norvegicus] (205 aa)
Score = 146, Expect = 2.9e-08, Identities = 46/130 (35%), Positives = 66/130 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I   +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ Q    +E  +GGFGST K
  S:    79 PTRGSARAAGYDLYSAYDYTIPSMEKALVKTDIQIAVPSGCYGRVAPRSGLAVKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERILYPDLEEVQTLDNTERGSGGFGSTGK 204
>gi|125860176|ref|YP_001036346.1| dUTPase [Spodoptera frugiperda MNPV] >gi|120969321|gb|ABM45764.1| dUTPase [Spodoptera frugiperda MNPV] (144 aa)
Score = 146, Expect = 3.0e-08, Identities = 44/130 (33%), Positives = 69/130 (53%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNG-----GFGSTNK 162
           P+ AT  +AGYD + P D +IKP + + I T + +++ E +   I  RS    KY + +    GVID+DY      G I + L N   +N++   ++GD  AQ I  +Y     +Q  E+ +      GFGST +
  S:    19 PRMATAGAAGYDLYTPVDFIIKPGRQIIIDTEVSIQLPEGTYAQIASRSGNAVKYEVVV--LAGVIDNDY-----RGSIKVLLRNLGKKNRQF--QRGDRIAQLIINNYYKFSWEQVDELCDTDRGEQGFGSTGQ 144
>gi|62637402|ref|YP_227400.1| DUTPase [Mule deer poxvirus] >gi|115503262|gb|ABI99180.1| DUTPase [Deerpox virus W-848-83] (144 aa)
Score = 146, Expect = 3.0e-08, Identities = 47/139 (33%), Positives = 69/139 (49%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           K ++L     +PK+AT +SAGYD ++ YD  + P   + + T I + + E     I PRS L   Y + +    GVID DY      G+I + + N  N      IK GD  AQ IF        ++  E++     N GFGS+
  S:     7 KCLKLSEFATIPKKATYNSAGYDLYSAYDYTVNPFDRILVRTDISLEIPECCYGRIAPRSGLALNYNIDIGG--GVIDRDY-----RGNIGVIVIN--NSTCVFEIKTGDRIAQIIFERIENPSIEEVLELKDTFRGNRGFGSS 141
>gi|91789038|ref|YP_549990.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Polaromonas sp. JS666] >gi|91698263|gb|ABE45092.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Polaromonas sp. JS666] (148 aa)
Score = 146, Expect = 3.1e-08, Identities = 47/131 (35%), Positives = 68/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  L +       +PTGI + + +     LILPRS LG K+ + L N VG+IDSDY     +G + +   N +  +    I+  +  AQ + +      + +  +  ASE   GG+GST K
  S:    16 LPHYATPGSAGLDLRACLDAPLTLGANAWQLVPTGIAIHLCDPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRS--DVPFTIEPMERIAQLVVVPVVQAEFNVVTEFPASERGEGGYGSTGK 147
>gi|16127943|ref|NP_422507.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Caulobacter crescentus CB15] >gi|22095601|sp|Q9A253|DUT_CAUCR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|13425481|gb|AAK25675.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Caulobacter crescentus CB15] (155 aa)
Score = 146, Expect = 3.1e-08, Identities = 46/131 (35%), Positives = 67/131 (51%)
  Q:    30 IQLPKRATKHSAGYDFFA--PYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGI-----TEDDQASEIRNGGFGST 160
           + +P  AT  +AG+D  A  P D  +V+KP      PTG  V + +   + + PRS L  K  + + N  G +DSDY      G + + L N   E  +  I++GD  AQ +  +         ED  A+E   GGFGST
  S:    21 LPVPAYATVGAAGFDLRAHVPDDAPIVLKPGARCMAPTGFSVAIPDGYEMQVRPRSGLALKNGVTVVNAPGTVDSDY-----RGQVCVLLINLGEE--DFTIRRGDRIAQGVIAAAPQWPLVEVEDLDATERGAGGFGST 153
>gi|147862089|emb|CAN82958.1| hypothetical protein [Vitis vinifera] (176 aa)
Score = 146, Expect = 3.2e-08, Identities = 47/129 (36%), Positives = 69/129 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGIT------EDDQASEIRNGGFGST 160
           LP RA+  SAGYD  +  +  +  +    +PT + + + E +   I PRS L +KY   +D   GVID+DY      G + + L N ++ + E  +K GD  AQ I +   IT      ED  ++E   GGFGST
  S:    50 LPSRASPLSAGYDLSSATETKVPARGKALVPTDLSIGIPEGTYARIAPRSGLAWKY--SIDVGAGVIDADY-----RGPVGVILFNHSDVDFE--VKVGDRIAQLI-IEKIITPEVVEVEDLDSTERGVGGFGST 174
>gi|157825674|ref|YP_001493394.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia akari str. Hartford] >gi|166218217|sp|A8GNB1|DUT_RICAH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|157799632|gb|ABV74886.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia akari str. Hartford] (148 aa)
Score = 146, Expect = 3.2e-08, Identities = 49/132 (37%), Positives = 70/132 (53%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           S  LP+ AT+HSAG D  A  +  + IK  +   IPTGI + +       I PRS L  K+ + + N+ G ID+DY      G I + L N   +  + VI+KG   AQ I   Y     +++S +      +GGFGST
  S:    15 SGSLPEYATEHSAGMDLIAANEQPITIKAGEIQLIPTGIAIALPYSFEAQIRPRSGLAVKHGITVANSPGTIDADY-----RGEIKVILINLGTQ--DFVIEKGMRIAQIIISKYERILWEESSILTETMRGSGGFGST 146
>gi|22595710|gb|AAN02742.1| dUTPase [lumpy skin disease virus] (146 aa)
Score = 146, Expect = 3.3e-08, Identities = 49/137 (35%), Positives = 69/137 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR--------NGGFGST 160
           I L    +LP ++T  SAGYD ++ YD ++K K+ + + T I + + +     I PRS L   Y + +    GVID D  Y  N G IFI      N      IK+GD  AQ IF      E  +  E++        N GFGS+
  S:    11 IRLSAFAKLPTKSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYCIDIGG--GVIDED--YRGNIGVIFI-----NNGKNTFNIKRGDRVAQIIFEK---VEYPKIKEVKCLDGTNRDNNGFGSS 143
>gi|169630086|ref|YP_001703735.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Mycobacterium abscessus] >gi|169242053|emb|CAM63081.1| Probable deoxyuridine 5-triphosphate nucleotidohydrolase [Mycobacterium abscessus] (150 aa)
Score = 146, Expect = 3.3e-08, Identities = 41/139 (29%), Positives = 64/139 (46%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+VI+P +   + TGI V +    V L+ PRS L  +  L + N+ G ID+ Y      G + + L N  +E   +VI +GD  AQ +     + E  +       G   T +
  S:     4 VRLDRELPLPSRAHADDAGVDLYSAEDVVIEPGRRTLVGTGIAVAIPSGMVGLVHPRSGLAARVGLSIVNSPGTIDAGY-----RGEVKVNLINLDSE-VPIVIARGDRIAQLLVQQVELPELVEVDSFDEAGLAVTTR 136
>gi|90592779|ref|YP_529732.1| dUTPase [Agrotis segetum nucleopolyhedrovirus] >gi|71559229|gb|AAZ38228.1| dUTPase [Agrotis segetum nucleopolyhedrovirus] (142 aa)
Score = 146, Expect = 3.4e-08, Identities = 43/130 (33%), Positives = 70/130 (53%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIRN--GGFGSTNK 162
           P+ A++ +AGYD + P+D VIK + ++ I TG+ + M  +    I  RS    K+  Q+    GVID+DY      G + + L N   ++++   ++GD  AQ I   Y    + E +Q S  +    GFGST +
  S:    17 PRMASEGAAGYDLYTPHDFVIKARDSMLIDTGVCIEMPPNMYAQIKSRSGNAVKH--QIVAAAGVIDNDY-----RGTLSVLLFNHGKKSRQF--RRGDRIAQFIVRQYYKLPLKECEQLSHTKRDANGFGSTGR 142
>gi|114566444|ref|YP_753598.1| dUTP diphosphatase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122318486|sp|Q0AYH7|DUT_SYNWW Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|114337379|gb|ABI68227.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (145 aa)
Score = 146, Expect = 3.4e-08, Identities = 45/133 (33%), Positives = 72/133 (54%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN--------GGFGST 160
           + + LP+  T  S+G D +A  D  ++I   + V +PTG+ + + E     I PRS L  KY + L NT G ID+DY      G I + + N    +K+ ++K+G+  AQ +F      E  +  E+++        GGFG T
  S:    11 HDLPLPRYMTPGSSGLDLYAAVDEEILIPSGKIVLVPTGLALAIPEGYEAQIRPRSGLALKYGITLLNTPGTIDADY-----RGEIKVIVINLG--DKDYILKRGERIAQMVFSR---VEKAEFMEVKSLDETLRGAGGFGHT 143
>gi|73542434|ref|YP_296954.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia eutropha JMP134] >gi|72119847|gb|AAZ62110.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Ralstonia eutropha JMP134] (166 aa)
Score = 145, Expect = 3.5e-08, Identities = 48/133 (36%), Positives = 67/133 (50%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVK---IPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKE-LVIKKGDGFAQAIFLSY------GITEDDQASEIRNGGFGST 160
           N   LP   +  +A  D  A  D  +          +P GI V M N      I+PRS LG K  L L N++GVID+DY     +G I + + N      E +VI+ G+  AQ +F+         + E  ++SE   GGFGST
  S:    19 NEWGLPAYQSDMAAAIDLHACVDAPVSIAAGTAAQLVPAGIAVHMGNPYMAATIVPRSGLGHKKGLVLGNSIGVIDADY-----QGQIMVSVWNRNAPGTEPIVIQPGERIAQMMFVPVLRPVFTTVEEFSESSERGAGGFGST 157
>gi|21492472|ref|NP_659591.1| dUTPase [Sheeppox virus] (146 aa)
Score = 145, Expect = 3.6e-08, Identities = 49/137 (35%), Positives = 69/137 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR--------NGGFGST 160
           I L    +LP ++T  SAGYD ++ YD ++K K+ + + T I + + +     I PRS L   Y + +    GVID D  Y  N G IFI      N      IK+GD  AQ IF      E  +  E++        N GFGS+
  S:    11 IRLSAFAKLPTKSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYGIDIGG--GVIDED--YRGNIGVIFI-----NNGKNTFNIKRGDRVAQIIFEK---VEYPKIKEVKCLDGTNRDNNGFGSS 143
>gi|189346432|ref|YP_001942961.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Chlorobium limicola DSM 245] >gi|189340579|gb|ACD89982.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Chlorobium limicola DSM 245] (153 aa)
Score = 145, Expect = 3.8e-08, Identities = 44/139 (31%), Positives = 66/139 (47%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           K + +     LP  AT H+AG D  A  D  ++++P  T  IP+G  + + E     + PRS L  K+ + L N+   ID+DY      G + + L N   E     +  GD  AQ +       + D+A E+       GGFG T
  S:     5 KIVRVNKKAHLPVYATAHAAGMDVAACLDEPVMLEPFSTALIPSGFAIELPEGYEAQLRPRSGLALKHLISLPNSPATIDADY-----RGEVRVILVNFGKE--PFSVAHGDRIAQMVVSRVERVDFDEAEELSMTQRGEGGFGHT 143
>gi|121604095|ref|YP_981424.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Polaromonas naphthalenivorans CJ2] >gi|120593064|gb|ABM36503.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Polaromonas naphthalenivorans CJ2] (148 aa)
Score = 145, Expect = 3.9e-08, Identities = 48/131 (36%), Positives = 68/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           LP  AT  SAG D  A  D  L +       IPTG+ V + N     LILPRS LG K+ + L N VG+IDSDY     +G + +   N +  +    I+  +  AQ + +      + +  +  A+E   GG+GST K
  S:    16 LPGYATPGSAGLDLRACLDAPLTLGANAWQLIPTGMAVYLHNPGYAALILPRSGLGHKHGIVLGNLVGLIDSDY-----QGQLMVSAWNRS--DVPFTIEPMERIAQLVIVPVVQARFNVVSEFVATERGEGGYGSTGK 147
>gi|192812897|ref|ZP_03041563.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacillus sp. Y412MC10] >gi|192798225|gb|EDV74739.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacillus sp. Y412MC10] (148 aa)
Score = 145, Expect = 4.0e-08, Identities = 42/133 (31%), Positives = 67/133 (50%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           ++LP + ++ +AG+D  A     +V+ P +   IPTG  + M  +    I PRS L +K+ +   N  G ID+DY      G + + L N   E     I++ +  AQ +F S    E  +  E+ +     GGFG T K
  S:    16 VKLPVKMSELAAGFDLHAAVQEPVVLNPGERKLIPTGFAIAMPAELEAQIRPRSGLAYKHGITCLNAPGTIDADY-----RGEVKVLLVNLGQE--PFAIERNERIAQMVFKSVPAVEFTEVDELSDTVRGAGGFGHTGK 148
>gi|169634039|ref|YP_001707775.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter baumannii SDF] >gi|169796933|ref|YP_001714726.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter baumannii AYE] >gi|184157157|ref|YP_001845496.1| dUTPase [Acinetobacter baumannii ACICU] >gi|169149860|emb|CAM87751.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter baumannii] >gi|169152831|emb|CAP01860.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter baumannii] >gi|183208751|gb|ACC56149.1| dUTPase [Acinetobacter baumannii ACICU] >gi|193076635|gb|ABO11318.2| deoxyuridine 5'-triphosphate nucleotidohydrolase [Acinetobacter baumannii ATCC 17978] (150 aa)
Score = 145, Expect = 4.1e-08, Identities = 48/132 (36%), Positives = 73/132 (55%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL----SYGITEDDQASEIRN-GGFGSTNKK 163
           LP  AT  SAG D  A  D  + I+P QTV + TG+ + +++ +   LILPRS LG K+ + L N VG+IDSDY     +G + + + N       L  + G+  AQ + +    +     ++    +R  GGFG T K+
  S:    18 LPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRSGLGHKHGIVLGNLVGLIDSDY-----QGELMVSVWNRGQTTFRL--EPGERLAQYVLVPVVQAEFEQVEEFEETLRGAGGFGHTGKQ 150
>gi|153008593|ref|YP_001369808.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Ochrobactrum anthropi ATCC 49188] >gi|151560481|gb|ABS13979.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Ochrobactrum anthropi ATCC 49188] (170 aa)
Score = 145, Expect = 4.1e-08, Identities = 49/137 (35%), Positives = 70/137 (51%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPY----DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITEDDQASEIRN--GGFGST 160
           +E    ++LP   T  SAG D  A       +V+ P +   +PTG+   + E   + I PRS L FK  +   NT G IDSDY      G + + L N  ++  +  I++G   AQA+F   +   I E  Q +E     GGFGST
  S:    29 LEHAKGLELPAYETTGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLIFEIPEGFEVQIRPRSGLAFKNGITCLNTPGTIDSDY-----RGEVKVLLINLGDD--DFRIERGMRIAQAVFAPVVQPKIEERAQVTETARGAGGFGST 167
>gi|9633648|ref|NP_051726.1| deoxyuridine 5'triphosphatenucleotidohydrolase [Myxoma virus] >gi|6523867|gb|AAF14900.1|AF170726_16 deoxyuridine 5'triphosphatenucleotidohydrolase [Myxoma virus] >gi|170664477|gb|ACB28634.1| deoxyuridine 5 triphosphatenucleotidohydrolase [Myxoma virus] >gi|170664649|gb|ACB28805.1| deoxyuridine 5 triphosphatenucleotidohydrolase [recombinant virus 6918VP60-T2] (148 aa)
Score = 145, Expect = 4.2e-08, Identities = 42/117 (35%), Positives = 58/117 (49%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           K ++      LP +AT  +AGYD ++ Y  +I P +   + T I + + E     I PRS +  K+   +D   GVID DY      G+I I L N  N N    +KKGD  AQ IF
  S:    12 KCVKFSEHASLPTKATADAAGYDLYSAYAYIIPPHKRCLVKTDIGLGIPEGCYGRIAPRSGMSLKF--SIDVGGGVIDRDY-----RGNIGIILIN--NGNDTYYVKKGDKVAQIIF 119
>gi|193212411|ref|YP_001998364.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Chlorobaculum parvum NCIB 8327] >gi|193085888|gb|ACF11164.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Chlorobaculum parvum NCIB 8327] (150 aa)
Score = 145, Expect = 4.4e-08, Identities = 42/139 (30%), Positives = 66/139 (47%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           K + L     LP  AT H+AG D  A  D  + ++P  +  IPTG+ + + E     + PRS L  ++ + L N+   ID+DY      G + + L N   E     +  GD  AQ +      +++   +    +E   GGFG T
  S:     5 KIVRLKEKASLPAYATAHAAGMDVSACLDAPVTLEPSSSALIPTGLAIELPEGYEAQLRPRSGLALRHLISLPNSPATIDADY-----RGEVGVILINHGRE--PFTVNHGDRIAQMVVSKVDRVAFEEVDSLSDTERGEGGFGHT 143
>gi|110598907|ref|ZP_01387154.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Chlorobium ferrooxidans DSM 13031] >gi|110339475|gb|EAT58003.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Chlorobium ferrooxidans DSM 13031] (148 aa)
Score = 145, Expect = 4.4e-08, Identities = 45/139 (32%), Positives = 65/139 (46%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI-----RNGGFGST 160
           K + L     LP  AT H+AG D  A  +  L I P  T  IP+G  + + E     + PRS L  +  + L N+   ID+DY      G + + L N   E    +++ GD  AQ +         D+ SE+      +GGFG T
  S:     5 KIVRLNKQAVLPVYATAHAAGMDISACIEEPLTIAPLTTALIPSGFALELPEGYEAQLRPRSGLALRSMISLPNSPATIDADY-----RGEVKVILINYGRE--PFIVRNGDRIAQMVVAKVENVSFDEVSELGSTARGDGGFGHT 143
>gi|808757|gb|AAA66812.1| pol polyprotein (991 aa)
Score = 145, Expect = 4.4e-08, Identities = 48/129 (37%), Positives = 68/129 (52%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA------SEIRNGGFGST 160
           LPKRA    AGYD   P ++ I   Q  KIP  +R+ + ED   ++  +SS   K         G+IDS Y     +G I + + N  + +KE++I +G  FAQ I +   I ED +A      +E  N GFGST
  S:   586 LPKRA--EDAGYDLICPQEVCIPAGQVRKIPINLRINLKEDQWAMVGTKSSFASKGVFVQG---GIIDSGY-----QGIIQVVVYN--SNDKEVIIPQGRKFAQLILMPL-IHEDLEAWGETRRTERGNQGFGST 707
>gi|90971313|ref|YP_536867.1| pol protein [Ovine lentivirus] >gi|130649|sp|P16901|POL_OMVVS Pol polyprotein [Contains: Protease (Retropepsin); Reverse transcriptase/ribonuclease H (RT); Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase); Integrase (IN)] >gi|423982|pir||B46335 HIV-1 retropepsin (EC 3.4.23.16) - Maedi/Visna virus (strain SA-OMVV) >gi|90970031|gb|ABE02804.1| pol protein [Ovine lentivirus] (1086 aa)
Score = 144, Expect = 4.5e-08, Identities = 48/129 (37%), Positives = 68/129 (52%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA------SEIRNGGFGST 160
           LPKRA    AGYD   P ++ I   Q  KIP  +R+ + ED   ++  +SS   K         G+IDS Y     +G I + + N  + +KE++I +G  FAQ I +   I ED +A      +E  N GFGST
  S:   681 LPKRA--EDAGYDLICPQEVCIPAGQVRKIPINLRINLKEDQWAMVGTKSSFASKGVFVQG---GIIDSGY-----QGIIQVVVYN--SNDKEVIIPQGRKFAQLILMPL-IHEDLEAWGETRRTERGNQGFGST 802
>gi|15150457|ref|NP_150452.1| LSDV018 dUTPase [Lumpy skin disease virus NI-2490] >gi|15149029|gb|AAK84979.1| LSDV018 dUTPase [Lumpy skin disease virus NI-2490] >gi|22595551|gb|AAN02584.1| dUTPase [Lumpy skin disease virus NW-LW] (146 aa)
Score = 144, Expect = 4.8e-08, Identities = 49/137 (35%), Positives = 69/137 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR--------NGGFGST 160
           I L    +LP ++T  SAGYD ++ YD ++K K+ + + T I + + +     I PRS L   Y + +    GVID D  Y  N G IFI      N      IK+GD  AQ IF      E  +  E++        N GFGS+
  S:    11 IRLSAFAKLPTKSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYGIDIGG--GVIDED--YRGNIGVIFI-----NNGKNTFNIKRGDRVAQIIFEK---VEYPKIKEVKCLDGTNRDNNGFGSS 143
>gi|114656886|ref|XP_001165866.1| PREDICTED: similar to DUTP pyrophosphatase isoform 3 [Pan troglodytes] (218 aa)
Score = 144, Expect = 4.9e-08, Identities = 46/134 (34%), Positives = 65/134 (48%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           S+QL        AGYD ++ YD  I P +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I     +      +D   +E  +GGFGST K
  S:    88 SMQLRFARLSEHAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERIFYPEIEEVQDLDDTERGSGGFGSTGK 217
>gi|167464502|ref|ZP_02329591.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Paenibacillus larvae subsp. larvae BRL-230010] (150 aa)
Score = 144, Expect = 5.1e-08, Identities = 37/109 (33%), Positives = 59/109 (54%)
  Q:    30 IQLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           + LP + +  ++GYD  A    D++++P +   IPTG  + M E+    I PRS L +KY +   N+ G ID+DY      G I + L N  +E     I++G+  AQ +F
  S:    17 LPLPVKMSVAASGYDLHAAIEQDVILQPGERQLIPTGYAISMPEELEAQIRPRSGLAYKYGITTLNSPGTIDADY-----RGEIKVLLINHGHE--PFRIERGERIAQMVF 120
>gi|157745625|ref|XP_001667909.1| Hypothetical protein CBG03725 [Caenorhabditis briggsae AF16] >gi|187035965|emb|CAP24571.1| C. briggsae CBR-DUT-1 protein [Caenorhabditis briggsae] (487 aa)
Score = 144, Expect = 5.6e-08, Identities = 49/149 (32%), Positives = 72/149 (48%)
  Q:    14 EFNKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           EF KS EN          +P   ++ +AG D ++  D+ +  K  + + TGI +++       + PRS L  K+   +D   GVIDSDY      G + + L N    + E  +KKGD  AQ I     F  Y   +  + +E   GGFGST K
  S:   351 EFTKSTENA--------HMPTNGSETAAGADLYSAEDVTVPAKGKLSVSTGIHMKLPLGYYGRVAPRSGLAAKHF--IDVGAGVIDSDY-----RGEVKVLLFNFNEADFE--VKKGDRIAQIICEQIAFCDYQKVDTLEDTERGAGGFGSTGK 487
Score = 119, Expect = 4.3e-05, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           +L  +   P   ++ +AG D ++  D+V+     V + T I++ +       + PRS L  K+   +D   GV+DSDY      G I + L N +  + E  +KKGD  AQ +         + ASE+ N      GFGST +
  S:   191 QLNENAHAPTYGSEEAAGADLYSAEDVVVPANSKVCVSTAIQMELPFGYYGRVAPRSGLAAKHF--IDVGAGVVDSDY-----RGEIKVLLFNFSKTDFE--VKKGDRIAQLVCEKIAHCVYEAASELENTDRGDNGFGSTGE 324
Score = 116, Expect = 1.0e-04, Identities = 41/138 (29%), Positives = 68/138 (49%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           EL +  ++P   +  +AG D ++  D+V+       + TG+++ +       + PRS L  K+   +D   GVIDSDY      G + + L N    + E  +KKGD  AQ I       +Y    + + ++   GGFGST +
  S:    35 ELNSDAKMPTYGSPSAAGADLYSAEDVVVPSNGKYCVSTGLQLEIPIGYYGRVAPRSGLAAKHF--IDVGAGVIDSDY-----RGEVKVLLFNFNATDFE--VKKGDRIAQLICEQIGNGTYAEVTNLETTDRGTGGFGSTGQ 168
>gi|28210898|ref|NP_781842.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Clostridium tetani E88] >gi|32171379|sp|Q895R1|DUT_CLOTE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|28203337|gb|AAO35779.1| deoxyuridine 5-triphosphate nucleotidohydrolase [Clostridium tetani E88] (145 aa)
Score = 143, Expect = 6.0e-08, Identities = 49/137 (35%), Positives = 69/137 (50%)
  Q:    26 LYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITEDDQASEIR--NGGFGSTNK 162
           L    +LP+ A  + AG D F+  D +I P +   I TGI + + E++   I PRS L  K  + + NT G ID+ Y      G I I L N   +N +  ++KG   AQ +    +   I E    SE +   GGFGST K
  S:    11 LKEDAKLPQYAHDNDAGMDLFSTEDKIINPGKHALILTGISIELPENTEAQIRPRSGLALKNGVTVLNTPGTIDAGY-----RGEIGIILINHGEKNFQ--VEKGMKIAQMVIKPIVKVNIEEVKMLSESQRGKGGFGSTGK 145
>gi|108710306|gb|ABF98101.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|125593932|gb|EAZ33991.1| hypothetical protein OsJ_017474 [Oryza sativa (japonica cultivar-group)] (171 aa)
Score = 143, Expect = 6.4e-08, Identities = 41/129 (31%), Positives = 64/129 (49%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LP R +  +AGYD  +  ++V+  +    +PT + + + E +   + PRS L  K+   +D   GVID+DY      G + + L N  + + +  +K GD  AQ I            ED  A+    GGFGST
  S:    45 LPSRGSALAAGYDLSSAAEVVVPARGKAMVPTDLSIAIPEGTYARVAPRSGLALKH--SIDVGAGVIDADY-----RGPVGVILFN--HSDTDFAVKPGDRIAQMIIEVIVTPEVAEVEDLDATVRGEGGFGST 169
>gi|31126720|gb|AAP44642.1| putative deoxyuridine triphosphatase [Oryza sativa (japonica cultivar-group)] (225 aa)
Score = 143, Expect = 6.4e-08, Identities = 41/129 (31%), Positives = 64/129 (49%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LP R +  +AGYD  +  ++V+  +    +PT + + + E +   + PRS L  K+   +D   GVID+DY      G + + L N  + + +  +K GD  AQ I            ED  A+    GGFGST
  S:    99 LPSRGSALAAGYDLSSAAEVVVPARGKAMVPTDLSIAIPEGTYARVAPRSGLALKH--SIDVGAGVIDADY-----RGPVGVILFN--HSDTDFAVKPGDRIAQMIIEVIVTPEVAEVEDLDATVRGEGGFGST 223
>gi|170787824|gb|EDT28868.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [Oligotropha carboxidovorans OM5] (152 aa)
Score = 143, Expect = 6.5e-08, Identities = 43/133 (32%), Positives = 67/133 (50%)
  Q:    30 IQLPKRATKHSAGYDFFA--PYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           + LP   T+H+AG D  A  P D  L I P +   +PTG+ + +       + PRS L  K+ + + N  G ID+DY      G I + L N   E    +I++G+  AQ +      +++    +   S    GGFGST +
  S:    18 LPLPAYQTEHAAGLDLLAAVPEDKPLAIAPGERALVPTGLAIALPAGYEAQVRPRSGLAVKHGVTVLNAPGTIDADY-----RGEIGVPLINHGRET--FIIRRGERIAQMVVAPVVQIAFEPVAELPMSARGAGGFGSTGR 152
>gi|119960870|ref|YP_947541.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Arthrobacter aurescens TC1] >gi|119947729|gb|ABM06640.1| putative deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Arthrobacter aurescens TC1] (196 aa)
Score = 143, Expect = 6.5e-08, Identities = 37/108 (34%), Positives = 54/108 (50%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI 137
           ++ P  A    AG D  A  D+ + P Q   +PTG+ + + E  V LI PRS L  K+ L + N  G +D+ Y      G I + L N   EN  + +K+GD  AQ +
  S:    59 LEAPSYAHPGDAGADLRARVDVHLAPGQRKLVPTGVSIALPEGFVALIHPRSGLATKHGLTVVNAPGTVDAGY-----RGEIAVTLLNTDQENA-IDLKRGDRIAQMV 160
>gi|114321993|ref|YP_743676.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Alkalilimnicola ehrlichei MLHE-1] >gi|114228387|gb|ABI58186.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Alkalilimnicola ehrlichei MLHE-1] (122 aa)
Score = 143, Expect = 6.8e-08, Identities = 41/112 (36%), Positives = 60/112 (53%)
  Q:    51 LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGSTNK 162
           L + P QT  +P+G+ V M +  +   +LPRS LG K+ + L N VG+IDSDY     +G I I   N   E    VI  G+  AQ +F+      + + ++   S    GGFG T +
  S:    11 LTLAPGQTELLPSGMAVHMADAGMAATVLPRSGLGHKHGIVLGNLVGLIDSDY-----QGQILISCWNRGIE--PFVINPGERVAQLVFVPVLRPRFQVVDEFTPSTRGEGGFGHTGR 121
>gi|13876670|gb|AAK43558.1| dUTPase [lumpy skin disease virus] (146 aa)
Score = 143, Expect = 7.5e-08, Identities = 49/137 (35%), Positives = 68/137 (49%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR--------NGGFGST 160
           I L    +LP  +T  SAGYD ++ YD ++K K+ + + T I + + +     I PRS L   Y + +    GVID D  Y  N G IFI      N      IK+GD  AQ IF      E  +  E++        N GFGS+
  S:    11 IRLSAFAKLPTTSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYCIDIGG--GVIDED--YRGNIGVIFI-----NNGKNTFNIKRGDRVAQIIFEK---VEYPKIKEVKCLDGTNRDNNGFGSS 143
>gi|116670197|ref|YP_831130.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Arthrobacter sp. FB24] >gi|116610306|gb|ABK03030.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Arthrobacter sp. FB24] (182 aa)
Score = 142, Expect = 8.1e-08, Identities = 35/108 (32%), Positives = 56/108 (51%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI 137
           ++ P  A    AG D  A  D+V++P +   +PTG+ + +    V LI PRS L  K+ L + N  G +D+ Y      G I + L N T+  K + +++GD  AQ +
  S:    39 LEAPSYAHPGDAGADLRAREDVVLEPGERRLVPTGVSIALPNGFVALIHPRSGLATKHGLTVVNAPGTVDAGY-----RGEIAVTLLN-TDREKSIELRRGDRIAQMV 140
>gi|148557772|ref|YP_001265354.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Sphingomonas wittichii RW1] >gi|166218229|sp|A5VG00|DUT_SPHWW Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|148502962|gb|ABQ71216.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Sphingomonas wittichii RW1] (149 aa)
Score = 142, Expect = 8.2e-08, Identities = 41/133 (30%), Positives = 65/133 (48%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           + LP  AT H+AG D  +  D+ + P     + TG  + + E   + + PRS L  K+ +   NT G ID+DY      G + + L N  +E  E  +K+G+  AQ +       ++    D   +    GGFGST +
  S:    19 LPLPAYATAHAAGLDVVSAEDVTLAPGARHAVATGFAIAIPEGYEVQVRPRSGLALKHGVTCLNTPGTIDADY-----RGEVKVILANLGSEPFE--VKRGERIAQLVPAAVQRAAFAEVSDLDETARGAGGFGSTGR 149
>gi|91205147|ref|YP_537502.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia bellii RML369-C] >gi|157827518|ref|YP_001496582.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia bellii OSU 85-389] >gi|166218218|sp|A8GXE5|DUT_RICB8 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|122425921|sp|Q1RJQ1|DUT_RICBR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91068691|gb|ABE04413.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia bellii RML369-C] >gi|157802822|gb|ABV79545.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia bellii OSU 85-389] (150 aa)
Score = 142, Expect = 8.4e-08, Identities = 48/130 (36%), Positives = 70/130 (53%)
  Q:    31 QLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           +LP+ AT HSAG D  A  +  + IK  +   IPTGI + + E     I PRS L  K  + + N+ G ID+DY      G I + L N   +  + VI+KG   AQ +      +S+  +E  + +   +GGFGST
  S:    17 KLPEYATDHSAGMDLTAANEQPITIKAGEIQLIPTGIAIALPELFEAQIRPRSGLAAKNGITVANSPGTIDADY-----RGEIKVILINLGKD--DFVIEKGMRIAQMVISKYERISWKESETLEETARGSGGFGST 146
>gi|58580120|ref|YP_199136.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|188578897|ref|YP_001915826.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|75436948|sp|Q5H5L9|DUT_XANOR Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|58424714|gb|AAW73751.1| dUTPase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|188523349|gb|ACD61294.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas oryzae pv. oryzae PXO99A] (155 aa)
Score = 142, Expect = 8.7e-08, Identities = 44/129 (34%), Positives = 66/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LP  AT+ SAG D  A  +  + ++P     IP+GI + + +  +  +ILPRS LG ++ + L N  G+ID+DY     +G + I   N   E     I+ GD  AQ + L        + +    S    GGFG T
  S:    23 LPAHATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGPLLISTWNRGRE--AFTIEPGDRIAQLVILPIVRAGLQVVDTFVDSARGAGGFGHT 152
>gi|416922|sp|P32518|DUT_LYCES Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) (P18) >gi|251897|gb|AAB22611.1| deoxyuridine triphosphatase; dUTPase; P18 [Lycopersicon esculentum] (169 aa)
Score = 142, Expect = 8.9e-08, Identities = 45/129 (34%), Positives = 67/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE----DDQASEIR-NGGFGST 160
           LP RA+  +AGYD  +  +  +  +    +PT + + + + +   I PRS L +KY   +D   GVID+DY      G + + L N +  + E  +K GD  AQ I       E    DD  S +R +GGFGST
  S:    43 LPSRASSLAAGYDLSSAAETKVPARGKALVPTDLSIAVPQGTYARIAPRSGLAWKY--SIDVGAGVIDADY-----RGPVGVVLFNHSEVDFE--VKVGDRIAQLIVQKIVTPEVEQVDDLDSTVRGSGGFGST 167
>gi|160895084|ref|ZP_02075858.1| hypothetical protein CLOL250_02635 [Clostridium sp. L2-50] >gi|156863515|gb|EDO56946.1| hypothetical protein CLOL250_02635 [Clostridium sp. L2-50] (148 aa)
Score = 142, Expect = 9.2e-08, Identities = 46/139 (33%), Positives = 71/139 (51%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGI----TEDDQASEIR-NGGFGSTNKK 163
           +L  +  +P   ++ +AG D +A  D  + I   +T  I TG+ + +      L+  RS L  K  L   N VGVID+DY      G I + L N +N ++   I+ G+  AQ +   Y      T D+ +  +R  GGFGST +K
  S:    10 KLNENATIPSYGSEFAAGADLYACMDEPVTIAAGETQFIHTGLAIEIPAGYAGLVYARSGLACKRGLAPANKVGVIDADY-----RGEIMVALHNHSNVDQ--TIESGERIAQLVITPYITGCFHTVDELSDTVRGEGGFGSTGRK 148
>gi|94497708|ref|ZP_01304276.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Sphingomonas sp. SKA58] >gi|94422925|gb|EAT07958.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) [Sphingomonas sp. SKA58] (151 aa)
Score = 142, Expect = 9.2e-08, Identities = 43/131 (32%), Positives = 62/131 (47%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGST 160
           + LP  AT  +AG D  +  +LV+ P     + TG  + + E   +   PRS L  K+ + L NT G ID+DY      G + I L N  +E     I +GD  AQ +       S+   +    +    GGFGST
  S:    21 LPLPAYATAQAAGMDVVSAEELVLSPGGRHAVATGFAMAIPEGYEIQARPRSGLALKHGISLPNTPGTIDADY-----RGEVKIILINLGDE--PFAIARGDRVAQLVVAPVQLASFAEVDSLDDTARGKGGFGST 149
>gi|146329377|ref|YP_001209723.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Dichelobacter nodosus VCS1703A] >gi|166217618|sp|A5EYG1|DUT_DICNV Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|146232847|gb|ABQ13825.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Dichelobacter nodosus VCS1703A] (154 aa)
Score = 142, Expect = 9.3e-08, Identities = 48/140 (34%), Positives = 73/140 (52%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDF---FAPYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS------YGITEDDQASEIR-NGGFGSTNK 162
           D  L   I LP  AT  SA  D    FA   +V+   +   I +G+   + + +   ++LPRS LG+K+ + L N VG+IDSDY     +G + I L N +     + +  G+  AQ +FL       + +   DQ    R +GGFG T +
  S:    10 DPRLGGEIPLPTYATSGSAALDIRAVFAEESIVLAADECRLIGSGLAFHIADPNYCGIVLPRSGLGYKHGIVLGNLVGLIDSDY-----QGELKIPLWNRSQTPYTVTL--GERIAQLLFLPIAQAQLFPVESFDQKQSTRGSGGFGHTGR 153
>gi|195386176|ref|XP_002051780.1| GJ10455 [Drosophila virilis] >gi|194148237|gb|EDW63935.1| GJ10455 [Drosophila virilis] (510 aa)
Score = 141, Expect = 1.0e-07, Identities = 42/131 (32%), Positives = 71/131 (54%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNKK 163
           P+R ++ +AG+D  + YDL++  +    + T ++V++ E S   + PRS L  K    +D   GV+D DY      G++ + L N ++ + E  +K+GD  AQ I     I E +Q  ++ +      GFGST  K
  S:    35 PQRGSERAAGFDLRSAYDLIVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNF--IDVGAGVVDEDY-----RGNLGVVLFNHSDTDFE--VKRGDRIAQFICERISIPELEQVDKLDDTVRGESGFGSTGVK 161
Score = 127, Expect = 4.3e-06, Identities = 42/131 (32%), Positives = 68/131 (51%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITEDDQASEIRNG--GFGSTNKK 163
           P+R ++ +AG D  + YDL++       + T ++V++ E S   + PRS L  K    +D   GV+D DY      G++ + L N ++ + E  +K+GD  AQ I          E+D+  +   G  GFGST  K
  S:   355 PQRGSEKAAGLDLRSAYDLIVPAHGKAIVKTDLQVQLPEGSYGRVAPRSGLAVKNF--IDVGAGVVDEDY-----RGNLGVVLFNHSDTDFE--VKRGDRIAQFICELIFYPEPKEEDKLDDTERGEAGFGSTGVK 481
Score = 126, Expect = 5.6e-06, Identities = 41/131 (31%), Positives = 69/131 (52%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITEDDQASEIRNG--GFGSTNKK 163
           P+R ++ +AG D  + YDL +  +    + T ++V++ E S   + PRS L  K    +D   GV+D DY      G++ + L N ++ + E  +K+GD  AQ I        + ++D+  +   G  GFGST  K
  S:   195 PQRGSEKAAGLDLRSAYDLKVPSRGKAIVKTDLQVQLPEGSYGRVAPRSGLAVKNF--IDVGAGVVDEDY-----RGNLGVVLFNHSDTDFE--VKRGDRIAQFICERIFYPELEQEDKLDDTERGEAGFGSTGVK 321
>gi|169183280|ref|ZP_02843787.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Thauera sp. MZ1T] >gi|169009515|gb|EDS56290.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Thauera sp. MZ1T] (149 aa)
Score = 141, Expect = 1.0e-07, Identities = 31/85 (36%), Positives = 53/85 (62%)
  Q:    33 PKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTN 117
           P  AT+ +AG D  A  P  + + P +T  +P+G+ + +++  +  ++LPRS LG K+ + L N +G+IDSDY     +G IF+ + N
  S:    18 PAYATEGAAGLDLRACLPGPITLHPGETTLVPSGLAIHLSDPGLAAMVLPRSGLGHKHGIVLGNLIGLIDSDY-----QGQIFVSVWN 100
>gi|34557198|ref|NP_907013.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Wolinella succinogenes DSM 1740] >gi|46576243|sp|Q7M9N1|DUT_WOLSU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|34482914|emb|CAE09913.1| DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE [Wolinella succinogenes] (149 aa)
Score = 141, Expect = 1.0e-07, Identities = 45/146 (30%), Positives = 69/146 (47%)
  Q:    17 KSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           K  + + ++L+ +  +P   +  +AG+D      L I P     + TG+ + + E   L I PRS L  K+ + + NT G +DSDY      G I + L N   E+    I+ GD  AQ +     I E  +   +       GGFGST K
  S:     5 KKMKIRLLKLHPNAVIPAYQSAGAAGFDLCCVESLEIPPLGRALVSTGLALALEEGYELQIRPRSGLALKHGITVLNTPGTVDSDY-----RGEIKVILINLGAES--FSIQAGDRIAQGVVSRLSIAELCEVESLDETARGAGGFGSTGK 148
>gi|116794417|gb|ABK27136.1| unknown [Picea sitchensis] (186 aa)
Score = 141, Expect = 1.0e-07, Identities = 43/129 (33%), Positives = 66/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQ----AIFLSYGITEDDQASEIRN-GGFGST 160
           LP R +  +AGYD  +    V+  +    +PT + + + E +   I PRS L +K+   +D   GVID+DY      G + + L N ++++ E  +K GD  AQ     I     +  +D  S  R  GGFGST
  S:    60 LPSRGSALAAGYDLSSASSCVVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKH--SIDVGAGVIDADY-----RGPVGVILFNHSDQDFE--VKVGDRIAQLIIEKILTPKALEVEDLDSTFRGVGGFGST 184
>gi|51473589|ref|YP_067346.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Rickettsia typhi str. Wilmington] >gi|56404349|sp|Q68WX8|DUT_RICTY Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|51459901|gb|AAU03864.1| dUTP pyrophosphatase; Deoxyuridine-triphosphatase.; Desoxyuridine 5prime-triphosphatase.; Desoxyuridine 5prime-triphosphate nucleotidohydrolase.; dUTP pyrophosphatase.; dUTPase. [Rickettsia typhi str. Wilmington] (148 aa)
Score = 141, Expect = 1.0e-07, Identities = 48/132 (36%), Positives = 67/132 (50%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           S  LP  AT+HSAG D  A  +  ++IK      IPTGI + + +     I PRS L  K+ + + N+ G ID+DY      G I + L N     K+ +I++G   AQ I   Y      + S +       GGFGST
  S:    15 SGNLPAYATEHSAGVDLIAANEQTILIKVGSIQLIPTGIAIALPDSFEAQIRPRSGLAIKHGITVANSPGTIDADY-----RGEIKVLLINLG--KKDFLIERGMRIAQMIIAKYERVLWAETSILTETMRGRGGFGST 146
>gi|78068034|gb|ABB18356.1| ORF1 [Fowl adenovirus 8] (153 aa)
Score = 141, Expect = 1.1e-07, Identities = 37/106 (34%), Positives = 53/106 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           P +AT  SAGYD F+  D+V+ P+    IPT +  +        I PRS L  K+   +D   GV+DSDY      G + + L N +  N    +++GD  AQ I 
  S:    27 PAKATSGSAGYDLFSAADVVVPPRSRALIPTDLSFQFPRGVYGRIAPRSGLAVKFF--IDVGAGVVDSDY-----RGIVSVLLFNFSEHN--FNVRRGDRIAQMIL 123
>gi|56416915|ref|YP_153989.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Anaplasma marginale str. St. Maries] >gi|81599136|sp|Q5PAE6|DUT_ANAMM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|56388147|gb|AAV86734.1| deoxyuridine 5'triphosphate nucleotidohydrolase [Anaplasma marginale str. St. Maries] (147 aa)
Score = 141, Expect = 1.1e-07, Identities = 45/131 (34%), Positives = 65/131 (49%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           + LP  AT  SAG D +A  D  LV+ P     + TG+ + + +     I  RS L   + + + N  G IDSDY      G I + L+N  +E  + VI +GD  AQ +       E ++ + I       GGFGST
  S:    15 LPLPSYATPKSAGLDLYAAVDSKLVVHPGGRCAVKTGVALELPDGYEAQIRSRSGLAANFGICVLNAPGTIDSDY-----RGEITVVLSNFGSE--DYVISRGDRVAQMVIAPVERVEWEEVNSITATSRGEGGFGST 145
>gi|9634708|ref|NP_039001.1| ORF FPV038 dUTP pyrophosphatase vaccinia F2L homolog [Fowlpox virus] >gi|18203102|sp|Q9J5G5|DUT_FOWPV Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|7271536|gb|AAF44382.1|AF198100_29 ORF FPV038 dUTP pyrophosphatase vaccinia F2L homolog [Fowlpox virus] >gi|41023330|emb|CAE52584.1| putative dUTPase [Fowlpox virus (isolate HP-438[Munich])] (145 aa)
Score = 141, Expect = 1.1e-07, Identities = 48/133 (36%), Positives = 69/133 (51%)
  Q:    31 QLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--------LSYGITEDDQASEIRNGGFGSTNKK 163
           +LP + T +SAGYD ++ YD VI+P     I T I +++       I PRS L + Y   +D   GVIDSDY      G++ + L N    + +  + KGD  AQ IF        +     E+   ++  N GFGST  K
  S:    14 KLPYKQTSYSAGYDLYSAYDYVIEPMNKELIKTDIILKIPNGYYGRIAPRSGLAYNYF--IDVGAGVIDSDY-----RGNVGVLLFNFG--STQFNVCKGDRIAQIIFEKIAYPKIIEVTTLEEINITDRGNSGFGSTGLK 145
>gi|124521618|ref|ZP_01696507.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Bacillus coagulans 36D1] >gi|124496687|gb|EAY44272.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Bacillus coagulans 36D1] (150 aa)
Score = 141, Expect = 1.1e-07, Identities = 45/135 (33%), Positives = 65/135 (48%)
  Q:    26 LYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           L+   QLP+RA    AG D ++  +  I P +   I TGI + +   +   + PRS L  K+R+ + N+ G ID  Y      G I + L N         ++KG   AQ I      ++  +TE    SE   GGFGST
  S:    10 LHPDAQLPQRANPGDAGLDLYSIEEKNIAPGEAELIRTGIAIELPRRTEAQVRPRSGLALKHRVTVLNSPGTIDEGY-----RGEIKVILINFG--KTPFKVEKGMRIAQMIIAPVMSVTVSVTEQLAESERGEGGFGST 142
>gi|145224514|ref|YP_001135192.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium gilvum PYR-GCK] >gi|189027740|sp|A4TCR4|DUT_MYCGI Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|145217000|gb|ABP46404.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium gilvum PYR-GCK] (154 aa)
Score = 141, Expect = 1.1e-07, Identities = 39/139 (28%), Positives = 63/139 (45%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+ + P +   +PTG+ V +    V LI PRS L  +  L + NT G +D+ Y      G I + L N  + +  + I +GD  AQ +     + E  + +     G   T +
  S:     8 VRLDPDLPLPSRAHDGDAGVDLYSAQDVELGPGERALVPTGVAVAIPHGMVGLIHPRSGLAARVGLSIVNTPGTVDAGY-----RGEIKVCLIN-LDTSTPITIGRGDRIAQLLVQRVELPELVEVTSFDEAGLADTTR 140
>gi|94400930|ref|NP_001035361.1| deoxyuridine triphosphatase isoform 2 [Rattus norvegicus] >gi|149023173|gb|EDL80067.1| deoxyuridine triphosphatase, isoform CRA_b [Rattus norvegicus] (161 aa)
Score = 141, Expect = 1.1e-07, Identities = 46/130 (35%), Positives = 66/130 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGSTNK 162
           P R +  +AGYD ++ YD  I   +   + T I++ +       + PRS L  K+   +D   GVID DY      G++ + L N   E  E  +KKGD  AQ I   + Y   E+ Q    +E  +GGFGST K
  S:    35 PTRGSARAAGYDLYSAYDYTIPSMEKALVKTDIQIAVPSGCYGRVAPRSGLAVKHF--IDVGAGVIDEDY-----RGNVGVVLFNFGKEKFE--VKKGDRIAQLICERILYPDLEEVQTLDNTERGSGGFGSTGK 160
>gi|25028355|ref|NP_738409.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Corynebacterium efficiens YS-314] >gi|48427890|sp|Q8FPH9|DUT_COREF Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|23493640|dbj|BAC18609.1| putative dUTP nucleotidohydrolase [Corynebacterium efficiens YS-314] (181 aa)
Score = 141, Expect = 1.1e-07, Identities = 43/133 (32%), Positives = 66/133 (49%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGI---TEDDQASEIRNG--GFGSTNK 162
           + +P+RA +  AG D  +  D+VI P     + TG+ + +   +V LI PRS L  +  L + N  G +D+DY      G I + L N  + +  + I +GD  AQ I     +    E D+  E   G  G GST +
  S:    46 LPMPRRAHRGDAGVDLHSTTDVVIAPGHRELVGTGVAIALPLGTVGLIHPRSGLAAREGLSIVNAPGTVDADY-----RGEIKVCLIN-LDPSTPITITRGDRIAQLIIQRVELVDFVEVDELDETTRGDQGHGSTGR 177
>gi|84662702|ref|YP_453666.1| putative dUTPase [Xanthomonas phage OP2] >gi|84570751|dbj|BAE72813.1| putative dUTPase [Xanthomonas oryzae phage OP2] (157 aa)
Score = 141, Expect = 1.3e-07, Identities = 38/108 (35%), Positives = 58/108 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           LP  AT+ SAG D  A  +  + ++P     IP+GI + + +  +  +ILPRS LG ++ + L N  G+ID+DY     +G + I   N   E     I+ GD  AQ + L
  S:    25 LPAYATEASAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGSLLISTWNRGRE--AFTIEPGDRIAQLVIL 128
>gi|148653623|ref|YP_001280716.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychrobacter sp. PRwf-1] >gi|172048553|sp|A5WGH5|DUT_PSYWF Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|148572707|gb|ABQ94766.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Psychrobacter sp. PRwf-1] (154 aa)
Score = 141, Expect = 1.3e-07, Identities = 44/132 (33%), Positives = 76/132 (57%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITED-DQASEIRNGGFGSTNKK 163
           +P RAT  SAG D  A  D  + IK  +T  I TG+ + + + +   +ILPRS LG K+ + L N VG+ID+DY     +G + + + N +  + + V+   +  AQ + +     S+ + E+ ++ S    GGFG + ++
  S:    21 MPTRATDGSAGIDLRACIDEPITIKAGETKLIGTGMAIYIADPNYAGIILPRSGLGHKHGIVLGNLVGLIDADY-----QGELMVSVWNRS--DTDFVLNPAERMAQYMVVPVVRPSFQVVEEFNELSARGAGGFGHSGRQ 154
>gi|119356656|ref|YP_911300.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Chlorobium phaeobacteroides DSM 266] >gi|166217616|sp|A1BEP9|DUT_CHLPD Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|119354005|gb|ABL64876.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Chlorobium phaeobacteroides DSM 266] (153 aa)
Score = 141, Expect = 1.3e-07, Identities = 48/139 (34%), Positives = 67/139 (48%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQ----ASEIR-NGGFGST 160
           K + L     LP  AT H+AG D  A    ++V+ P +T  IP+G  + + E     + PRS L  ++ + L NT   ID+DY      G + I L N   E    V+  GD  AQ +         D+    AS  R +GGFG T
  S:     5 KIVRLNEKALLPVYATTHAAGMDVAACLEENVVVLPFETALIPSGFAIELPEGYEAQLRPRSGLALRHLISLPNTPATIDADY-----RGEVKIILINYGQE--PFVVHHGDRVAQMVVAKVERVFFDEVLTLASSSRADGGFGHT 143
>gi|20069953|ref|NP_613157.1| dUTPase [Mamestra configurata NPV-A] >gi|20043347|gb|AAM09182.1| dUTPase [Mamestra configurata NPV-A] >gi|33331785|gb|AAQ11093.1| putative dUTPase [Mamestra configurata nucleopolyhedrovirus A] (142 aa)
Score = 141, Expect = 1.3e-07, Identities = 44/131 (33%), Positives = 67/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIR--NGGFGSTNK 162
           +P+ AT  SAGYD   P D VIK +    +  G+ + +  D+   +  RS L F +++ +    GVID+DY      G I + L N   +++    K+GD  AQ I   Y    + E D+ S  +    GFGST +
  S:    16 VPQMATAGSAGYDLRTPVDFVIKARDKHIVDIGVAIELPYDTYAQVKSRSGLAFHHQIVVG--AGVIDNDY-----RGTINVLLFNHGKKSR--TFKRGDKIAQMIVHQYCKLPLIETDELSTTQRDTNGFGSTGR 142
>gi|153809209|ref|ZP_01961877.1| hypothetical protein BACCAC_03520 [Bacteroides caccae ATCC 43185] >gi|149128185|gb|EDM19405.1| hypothetical protein BACCAC_03520 [Bacteroides caccae ATCC 43185] (144 aa)
Score = 141, Expect = 1.3e-07, Identities = 48/132 (36%), Positives = 69/132 (52%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQA----------SEIRNGGFGSTNKK 163
           LP  AT+ SAG D  A     + ++P Q   +PTG+ + + +     I PRS L  K  + + N+ G ID+DY      G I I L N ++E    VI+ G+  AQ +     I + +QA          +E   GGFG T KK
  S:    13 LPAYATELSAGMDIRANLSEPITLEPLQRCLVPTGLYIALPQGFEAQIRPRSGLAIKKGITVLNSPGTIDADY-----RGEICIILVNLSSET--FVIEDGERIAQMV-----IAKHEQAVWQEVEVLDETERGAGGFGHTGKK 144
>gi|56695324|ref|YP_165672.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Silicibacter pomeroyi DSS-3] >gi|81558746|sp|Q5LWD3|DUT_SILPO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|56677061|gb|AAV93727.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Silicibacter pomeroyi DSS-3] (151 aa)
Score = 141, Expect = 1.3e-07, Identities = 48/133 (36%), Positives = 65/133 (48%)
  Q:    30 IQLPKRATKHSAGYDFFAPY----DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           + LP   T  +AG D  A       L + P     IPTG+RV +     + I PRS L  K+ + L NT G IDSDY      G + + L N   E  E+V   G+  AQ +        + +TE    +E   GGFGST +
  S:    16 VPLPSYETTGAAGADIRANLPDRGSLTLAPGGRALIPTGLRVEIPAGYEIQIRPRSGLALKHGITLPNTPGTIDSDY-----RGPLGVILLNAGAEPFEVV--HGERIAQLVVAPVVQARFELTEALGETERGAGGFGSTGR 150
>gi|84622121|ref|YP_449493.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|166713829|ref|ZP_02245036.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas oryzae pv. oryzicola BLS256] >gi|123523354|sp|Q2P8A8|DUT_XANOM Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|84366061|dbj|BAE67219.1| dUTPase [Xanthomonas oryzae pv. oryzae MAFF 311018] (155 aa)
Score = 140, Expect = 1.3e-07, Identities = 44/129 (34%), Positives = 66/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LP  AT+ SAG D  A  +  + ++P     IP+GI + + +  +  +ILPRS LG ++ + L N  G+ID+DY     +G + I   N   E     I+ GD  AQ + L        + +    S    GGFG T
  S:    23 LPAYATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGPLLISTWNRGRE--AFTIEPGDRIAQLVILPIVRAGLQVVDTFVDSARGAGGFGHT 152
>gi|21244632|ref|NP_644214.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas axonopodis pv. citri str. 306] >gi|78049582|ref|YP_365757.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|48474235|sp|Q8PFR5|DUT_XANAC Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91206617|sp|Q3BNA6|DUT_XANC5 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|21110315|gb|AAM38750.1| dUTPase [Xanthomonas axonopodis pv. citri str. 306] >gi|78038012|emb|CAJ25757.1| dUTPase [Xanthomonas campestris pv. vesicatoria str. 85-10] (155 aa)
Score = 140, Expect = 1.3e-07, Identities = 44/129 (34%), Positives = 66/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LP  AT+ SAG D  A  +  + ++P     IP+GI + + +  +  +ILPRS LG ++ + L N  G+ID+DY     +G + I   N   E     I+ GD  AQ + L        + +    S    GGFG T
  S:    23 LPAYATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRHGIVLGNGTGLIDADY-----QGPLLISTWNRGRE--AFTIEPGDRIAQLVILPIVRMGLQVVDTFVDSARGAGGFGHT 152
>gi|187903089|ref|YP_001883380.1| dUTPase [Musca domestica salivary gland hypertrophy virus] >gi|187384738|gb|ACD03511.1| dUTPase [Musca domestica salivary gland hypertrophy virus] (150 aa)
Score = 140, Expect = 1.4e-07, Identities = 45/128 (35%), Positives = 62/128 (48%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITED-------DQASEIRNGGFGST 160
           PKR T  SAGYD  +   +V+ P+    I T I +R+   +   I  RS L F++   +D   G+ID DY      G I + L N  + +   V+  GD  AQ I  +Y  T         D  +E    GFGST
  S:    16 PKRCTAKSAGYDLHSAVAVVVAPRSHQHIATDICLRLPTGTYGRIAARSGLAFRH--AIDVGAGIIDEDY-----RGPIGVILFN--HSDVPFVVNIGDRIAQLIIQTYLSTATFRQVDSLDDETERGTAGFGST 141
>gi|183982031|ref|YP_001850322.1| deoxyuridine 5'-triphosphate nucleotidohydrolase DutT [Mycobacterium marinum M] >gi|183175357|gb|ACC40467.1| deoxyuridine 5'-triphosphate nucleotidohydrolase DutT [Mycobacterium marinum M] (154 aa)
Score = 140, Expect = 1.4e-07, Identities = 39/139 (28%), Positives = 65/139 (46%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+V+ P Q   + TG+ V +    V L+ PRS L  +  L + N+ G ID+ Y      G + + L N  +    +V+ +GD  AQ +     + E  + S     G  +T++
  S:     8 VRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPRSGLASRVGLSIVNSPGTIDAGY-----RGELKVALIN-LDPATPIVVNRGDRIAQLLVQRVELLELVEVSSFDEAGLAATSR 140
>gi|22549475|ref|NP_689248.1| putative dUTPase [Mamestra configurata nucleopolyhedrovirus B] >gi|22476654|gb|AAM95060.1| putative dUTPase [Mamestra configurata nucleopolyhedrovirus B] (142 aa)
Score = 140, Expect = 1.5e-07, Identities = 44/131 (33%), Positives = 67/131 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIR--NGGFGSTNK 162
           +P+ AT  SAGYD   P D VIK +    +  G+ + +  D+   +  RS L F +++ +    GVID+DY      G I + L N   +++    K+GD  AQ I   Y    + E +Q S  +    GFGST +
  S:    16 VPQMATAGSAGYDLRTPVDFVIKARDKHIVDIGVAIELPYDTYAQVKSRSGLAFHHQIVVG--AGVIDNDY-----RGTINVLLFNHGKKSR--TFKRGDKIAQMIVHQYCKLPLIETNQLSTTQRDTNGFGSTGR 142
>gi|194336828|ref|YP_002018622.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Pelodictyon phaeoclathratiforme BU-1] >gi|194309305|gb|ACF44005.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Pelodictyon phaeoclathratiforme BU-1] (148 aa)
Score = 140, Expect = 1.5e-07, Identities = 43/139 (30%), Positives = 64/139 (46%)
  Q:    22 KDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGST 160
           K + L     LP  AT H+AG D  A  +  + I+P  T  IP+G  + + E     + PRS L  +  + L NT   ID+DY      G + + L N   E    ++  GD  AQ +         ++  E+ +     GGFG T
  S:     5 KIVRLNKQASLPVYATAHAAGMDISACIEAPITIQPSTTALIPSGFALELPEGYEAQLRPRSGLALRSMISLPNTPATIDADY-----RGEVKVILINYGKE--PFLVSHGDRIAQMVVAKVEAVRFEEVEELGSTVRGEGGFGHT 143
>gi|71988561|ref|NP_001021553.1| DeoxyUTPase family member (dut-1) [Caenorhabditis elegans] >gi|2098797|gb|AAB57697.1| deoxyuridinetriphosphatase [Caenorhabditis elegans] >gi|3878339|emb|CAB03175.1| C. elegans protein K07A1.2, confirmed by transcript evidence [Caenorhabditis elegans] (491 aa)
Score = 140, Expect = 1.6e-07, Identities = 46/138 (33%), Positives = 69/138 (50%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           +L  + Q P   ++ +AG D ++  D+ +       + TGI++ +       + PRS L  K+   +D   GVIDSDY      G + + L N T+   E  +KKGD  AQ I    G    + ASE+ N     GGFGST +
  S:   191 QLNENAQTPTYGSEEAAGADLYSAEDITVPAHGKCCVSTGIQMELPFGYYGRVAPRSGLAAKHF--IDVGAGVIDSDY-----RGEVKVLLFNFTDNAFE--VKKGDRIAQLICEKIGHCVYEAASELENTDRGAGGFGSTGQ 324
Score = 131, Expect = 1.5e-06, Identities = 41/135 (30%), Positives = 68/135 (50%)
  Q:    28 NSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI-----FLSYGITEDDQASEIRNGGFGSTNK 162
           ++ Q+P   +  +AG D ++  D+ +  +  + + TGI++ +       + PRS L  K+   +D   GVIDSDY      G + + L N    + E  +KKGD  AQ +       +Y   E  + +E   GGFGST +
  S:   357 DNAQMPTYGSAEAAGADLYSAEDVTVPARGKLCVSTGIQMALPIGYYGRVAPRSGLAAKHF--IDVGAGVIDSDY-----RGEVKVLLFNFGENDFE--VKKGDRIAQLVCEQIALCTYSKVESLEVTERGAGGFGSTGQ 487
Score = 109, Expect = 6.4e-04, Identities = 42/138 (30%), Positives = 66/138 (47%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQASEIRN---GGFGSTNK 162
           E+    Q P   +  SAG D ++  D+V+     + + TG+++ +       + PRS L  K+   +D   GVIDSDY      G + + L N      E  +K GD  A+ I   +  G  E+ ++    N   GGFGST +
  S:    35 EMVGDAQKPTYGSISSAGADLYSAEDVVVPANGKLCVSTGLQIELPIGYYGRVAPRSGLAAKHF--IDVGAGVIDSDY-----RGEVKVLLFNFNTTAFE--VKTGDRIAKLICEQIGNGTYEEVKSLPSTNRGAGGFGSTGE 168
>gi|54400512|ref|NP_001006005.1| deoxyuridine triphosphatase [Danio rerio] >gi|53733948|gb|AAH83489.1| DUTP pyrophosphatase [Danio rerio] >gi|182889352|gb|AAI64977.1| Dut protein [synthetic construct] (187 aa)
Score = 140, Expect = 1.6e-07, Identities = 44/128 (34%), Positives = 65/128 (50%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF--LSYGITEDDQA---SEIRNGGFGST 160
           P R +  +AGYD ++ YD  I P     + TGI++ +       + PRS L  K+   +D   GV+D DY      G++ + + N   E  E  +KKGD  AQ I   + Y   ++ Q    +E   GGFGST
  S:    61 PSRGSNRAAGYDLYSAYDYSIGPMDKTLVKTGIQIAVPHGYYGRVAPRSGLAVKHF--VDVGAGVVDEDY-----RGNLGVVIFNFNKEPFE--VKKGDRIAQLICEKICYPDLQELQTLDETERGAGGFGST 184
>gi|194666256|ref|XP_001787407.1| PREDICTED: similar to Pro-Pol [Bos taurus] (1798 aa)
Score = 140, Expect = 1.6e-07, Identities = 50/146 (34%), Positives = 73/146 (50%)
  Q:    16 NKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQ-TVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY--GITEDDQASEIRNGGFGSTN 161
           N +F   D +  N ++   RAT  SAG D  +    ++ P   T+KIPTG++  +    V +IL RSSL  +    L    GVIDSDY      G I I ++  T   K   I +G   AQ + L Y   I +    +E ++ GFGS++
  S:   220 NGAFLGPDQQSGNGLRELIRATPGSAGLDLSSTTSTILTPDSPTIKIPTGVKGPLPTGLVGIILGRSSLAIQ---GLTIIPGVIDSDY-----TGEIQIMISPPT---KTFQIHQGQRIAQLLLLPYHNAIGQTATQNERQDKGFGSSD 357
>gi|131840149|ref|YP_001096158.1| ORF123 [Koi herpesvirus] >gi|84181519|gb|ABC55122.1| hypothetical protein [Koi herpesvirus] >gi|109706724|gb|ABG42950.1| ORF123 [Koi herpesvirus] >gi|129560641|dbj|BAF48936.1| hypothetical protein [Koi herpesvirus] (273 aa)
Score = 140, Expect = 1.6e-07, Identities = 49/130 (37%), Positives = 67/130 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPK-QTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---GITEDDQASEIRN--GGFGSTN 161
           LP +AT  SAGYD     D+VI P+ +   +  GI + + E +   I  RS  G   R  L    GVID DY  S   G +F  LT+D      + +K+GD  AQ IF       +   D+ S+ +   GGFGST+
  S:    21 LPSQATPKSAGYDLTCRADVVIPPRCKATVVDIGITMEIPEGTYGRIAGRS--GLSLRTGLSVLAGVIDQDYRGSI--GVMFQNLTDDA-----VPLKRGDKIAQIIFERICHPNVCLADELSDTQRGAGGFGSTD 147
>gi|145620868|ref|ZP_01776881.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacter bemidjiensis Bem] >gi|144942811|gb|EDJ77923.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacter bemidjiensis Bem] >gi|197087058|gb|ACH38329.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Geobacter bemidjiensis Bem] (146 aa)
Score = 140, Expect = 1.7e-07, Identities = 42/139 (30%), Positives = 67/139 (48%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPY--DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRN-----GGFGSTNK 162
           I+   +  LP   T+H+AG D  A    D V+ P +   +PTG+ + +       + PRS L  ++ + L N+ G ID+DY      G I + L N  +E     +  G+  AQ +F      E  +  E+ +     GGFG T +
  S:     8 IKRLRATPLPAYMTEHAAGVDLCASLSADFVLAPGERALVPTGLAIELPPGFEAQVRPRSGLALRHGIALVNSPGTIDADY-----RGEIGVILINLGSE--PFTVSDGERIAQMVFARCERAEFIEVDELGDTARGAGGFGHTGR 146
>gi|17986641|ref|NP_539275.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella melitensis 16M] >gi|148560480|ref|YP_001259529.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella ovis ATCC 25840] >gi|17982257|gb|AAL51539.1| DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE [Brucella melitensis 16M] >gi|148371737|gb|ABQ61716.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella ovis ATCC 25840] (174 aa)
Score = 139, Expect = 1.7e-07, Identities = 48/137 (35%), Positives = 70/137 (51%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPY----DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITEDDQASEIRN--GGFGST 160
           +E    + LP   T  SAG D  A       +V+ P +   +PTG+ + + +   + I PRS L FK  +   NT G IDSDY      G + + L N  ++  +  I++G   AQA+F   +   I E  + SE     GGFGST
  S:    33 LEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLAFKNGITCLNTPGTIDSDY-----RGEVKVLLINLGDD--DFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAGGFGST 171
>gi|23502533|ref|NP_698660.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella suis 1330] >gi|62290547|ref|YP_222340.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella abortus bv. 1 str. 9-941] >gi|82700463|ref|YP_415037.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella melitensis biovar Abortus 2308] >gi|161619606|ref|YP_001593493.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella canis ATCC 23365] >gi|163845255|ref|YP_001622910.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella suis ATCC 23445] >gi|189024768|ref|YP_001935536.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella abortus S19] >gi|189027731|sp|A9M7H5|DUT_BRUC2 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|189027732|sp|A9WWF2|DUT_BRUSI Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|54037009|sp|P64005|DUT_BRUSU Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|54040747|sp|P64004|DUT_BRUME Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|75496364|sp|Q57BK5|DUT_BRUAB Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|91206592|sp|Q2YRG4|DUT_BRUA2 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|23348531|gb|AAN30575.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella suis 1330] >gi|62196679|gb|AAX74979.1| Dut, deoxyuridine 5-triphosphate nucleotidohydrolase [Brucella abortus biovar 1 str. 9-941] >gi|82616564|emb|CAJ11643.1| DeoxyUTP pyrophosphatase:DeoxyUTP pyrophosphatase, subfamily 1:DeoxyUTP pyrophosphatase, subfamily 2 [Brucella melitensis biovar Abortus 2308] >gi|161336417|gb|ABX62722.1| dUTP diphosphatase [Brucella canis ATCC 23365] >gi|163675978|gb|ABY40088.1| dUTP diphosphatase [Brucella suis ATCC 23445] >gi|189020340|gb|ACD73062.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Brucella abortus S19] (157 aa)
Score = 139, Expect = 1.7e-07, Identities = 48/137 (35%), Positives = 70/137 (51%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPY----DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITEDDQASEIRN--GGFGST 160
           +E    + LP   T  SAG D  A       +V+ P +   +PTG+ + + +   + I PRS L FK  +   NT G IDSDY      G + + L N  ++  +  I++G   AQA+F   +   I E  + SE     GGFGST
  S:    16 LEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLAFKNGITCLNTPGTIDSDY-----RGEVKVLLINLGDD--DFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAGGFGST 154
>gi|94676802|ref|YP_588643.1| deoxyuridine 5''-triphosphate nucleotidohydrolase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|166918317|sp|Q1LTS1|DUT_BAUCH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|94219952|gb|ABF14111.1| deoxyuridine 5''-triphosphate nucleotidohydrolase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (150 aa)
Score = 139, Expect = 1.7e-07, Identities = 48/140 (34%), Positives = 76/140 (54%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGSTNK 162
           D  + +  +LPK AT  SAG D  A  D  + ++P +T  I TG+ V + +  +  +I+PRS LG  + + L N VG+IDSDY     +G I + L N   E     I+  +  AQ +F+      + I ++ Q S+    GFG + +
  S:    10 DSRIGDCFKLPKYATPGSAGIDLRACIDNTISLEPGETNLISTGLAVHIADTGLAGIIIPRSGLG-HHGIVLGNLVGLIDSDY-----QGSIMVSLWNRGKE--IFTIQPNERIAQIVFVQIVQVYFNIVDNFQKSKRGERGFGHSGR 149
>gi|150009759|ref|YP_001304502.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Parabacteroides distasonis ATCC 8503] >gi|149938183|gb|ABR44880.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Parabacteroides distasonis ATCC 8503] (144 aa)
Score = 139, Expect = 1.7e-07, Identities = 48/132 (36%), Positives = 67/132 (50%)
  Q:    32 LPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG-------ITEDDQASEIRNGGFGSTNKK 163
           LP  AT  SAG D  A     +V+KP +   IPTG+ + + E     + PRS L  K+ + L NT G ID+DY      G I I L N ++E     +  G+   Q +  ++         T DD  +E   GGFG T K+
  S:    13 LPGYATPLSAGMDIRANLSESVVLKPLERKLIPTGLYISLPEGYEAQMRPRSGLALKHGITLLNTPGTIDADY-----RGEIGIILVNLSSE--PFTVNDGERICQMVIAAHSHVDWEPVETLDD--TERGAGGFGHTGKE 144
>gi|167833735|gb|ACA02611.1| dUTPase [Spodoptera frugiperda MNPV] (124 aa)
Score = 139, Expect = 1.8e-07, Identities = 43/127 (33%), Positives = 67/127 (52%)
  Q:    36 ATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNG-----GFGSTNK 162
           AT  +AGYD + P D +IKP + + I T + +++ E +   I  RS    KY + +    GVID+DY      G I + L N   +N++   ++GD  AQ I  +Y     +Q  E+ +      GFGST +
  S:     2 ATAGAAGYDLYTPVDFIIKPGRQIIIDTEVSIQLPEGTYAQIASRSGNAVKYEVVV--LAGVIDNDY-----RGSIKVLLRNLGKKNRQF--QRGDRIAQLIINNYYKFSWEQVDELCDTDRGEQGFGSTGQ 124
>gi|56552087|ref|YP_162926.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Zymomonas mobilis subsp. mobilis ZM4] >gi|59802556|sp|Q9X3X5|DUT_ZYMMO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|56543661|gb|AAV89815.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Zymomonas mobilis subsp. mobilis ZM4] (146 aa)
Score = 139, Expect = 1.8e-07, Identities = 44/132 (33%), Positives = 65/132 (49%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYG------ITEDDQASEIRNGGFGST 160
           ++  P  A++ +AG D  +  D++++P Q   + TG  V +     + +  RS L  K+ +   N  G IDSDY      G + I L N  +E  E  IK+GD  AQ I  S        +T+ D      N GFGST
  S:    15 NLPFPSYASEGAAGMDVVSAEDVILQPMQRYPVKTGFAVAIPNGYEIQVRARSGLALKHGIACPNAPGTIDSDY-----RGEVKILLINLGSEAFE--IKRGDRIAQLILASVTQAVFCEVTDLDDTQRGHN-GFGST 144
>gi|38229181|ref|NP_938274.1| 17L [Yaba monkey tumor virus] >gi|56404329|sp|Q6TUZ4|DUT_YMTV Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|38000452|gb|AAR07375.1| 17L [Yaba monkey tumor virus] (143 aa)
Score = 139, Expect = 1.8e-07, Identities = 43/129 (33%), Positives = 65/129 (50%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGST 160
           +P R++K SAGYD ++ YD +++PK  V + T I + + ++    I  RS L     + +    GVID DY      G I +   N  N N    IK+GD  AQ +F      E  + S +      + GFGS+
  S:    17 IPTRSSKKSAGYDLYSAYDYLVRPKSRVLVKTDICLSIPDECYGRIASRSGLSLNNSIDIGG--GVIDGDY-----RGVIGVIFIN--NGNSPHYIKRGDRIAQIVFERLANVEIKEISNLDCTCRGDCGFGSS 141
>gi|46445902|ref|YP_007267.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Candidatus Protochlamydia amoebophila UWE25] >gi|56404375|sp|Q6MEK7|DUT_PARUW Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|46399543|emb|CAF22992.1| probable Deoxyuridine 5'-triphosphate nucleotidohydrolase [Candidatus Protochlamydia amoebophila UWE25] (150 aa)
Score = 139, Expect = 1.8e-07, Identities = 43/133 (32%), Positives = 70/133 (52%)
  Q:    28 NSIQLPKRATKHSAGYDF--FAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           N   LP   T  +AG D   +    L I P Q+  IPTG+R+ + E   + + PRS L  K+++ + NT G ID+DY      G I I L N  +     +++ G   AQ +       ++ ++E+ ++++   GGFG T
  S:    17 NEELLPFYMTPEAAGADVKAYLKESLEIPPGQSALIPTGMRLAIPEGYEIQVRPRSGLALKHQVTVLNTPGTIDADY-----RGEIKIILIN--HGTNAFIVEPGMRIAQLVLAQVLRANFVLSEELESTQRGVGGFGHT 149
>gi|154482567|ref|ZP_02025015.1| hypothetical protein EUBVEN_00234 [Eubacterium ventriosum ATCC 27560] >gi|149736592|gb|EDM52478.1| hypothetical protein EUBVEN_00234 [Eubacterium ventriosum ATCC 27560] (146 aa)
Score = 139, Expect = 1.8e-07, Identities = 49/138 (35%), Positives = 74/138 (53%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITEDDQASE-IRN-GGFGSTNK 162
           +L  +  +P   T+++AG D +A  +  + I+  +T  I TGI + + E    LI  RS L  K  L   N VGV+D+DY      G + + L N  + NK   I+  +  AQ +   FLS    + D+ S+ +R  GGFGST K
  S:     9 KLKENATIPTYGTEYAAGADLYACIEEAVTIEAGETKFIGTGIAMEIPEGYAGLIYARSGLSCKRGLAPANKVGVVDADY-----RGELTVALHN--HSNKAETIEPNERIAQVVITPFLSANFNQVDELSDTVRGVGGFGSTGK 146
>gi|118444740|ref|YP_878537.1| deoxyuridine 5triphosphate nucleotidohydrolase [Clostridium novyi NT] >gi|189027734|sp|A0Q1N5|DUT_CLONN Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|118135196|gb|ABK62240.1| deoxyuridine 5triphosphate nucleotidohydrolase [Clostridium novyi NT] (142 aa)
Score = 139, Expect = 1.9e-07, Identities = 44/129 (34%), Positives = 70/129 (54%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF---LSYGITEDDQASEIRNG--GFGST 160
           +P +A +  AG D F+  ++ +KP +   I TGI++++ +D+   I PRS L  K+ + + NT G ID  Y      G I I L N  +E  E  +++G   AQ +    L+  + E  + +E   G  GFGST
  S:    14 IPFQAHEGDAGMDLFSVEEITLKPMERKLIHTGIKIQLPKDTEAQIRPRSGLALKHGITVLNTPGTIDEGY-----RGEIGIILINLGSE--EFKVEEGMKIAQMVIKPTLTLKVEEVVELTETTRGENGFGST 140
>gi|70990380|ref|XP_750039.1| dUTPase (Dut), putaive [Aspergillus fumigatus Af293] >gi|66847671|gb|EAL88001.1| dUTPase (Dut), putaive [Aspergillus fumigatus Af293] >gi|159130517|gb|EDP55630.1| dUTPase (Dut), putaive [Aspergillus fumigatus A1163] (250 aa)
Score = 139, Expect = 2.0e-07, Identities = 43/136 (31%), Positives = 68/136 (50%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           +L  S Q P R +  +AGYD ++  + VI  K    + TG+ + + E +   + PRS L  K+   +D   GVID+DY      G + + L N +  + +  +K GD  AQ +          + E+ + S    GGFGST
  S:   117 KLTESAQAPTRGSAFAAGYDLYSAKETVIPAKGKALVDTGLAIAVPEGTYGRVAPRSGLASKHF--IDTGAGVIDADY-----RGEVKVLLFNFS--DVDFTVKVGDRIAQLVLERIYTPDVMVVEELEESVRGAGGFGST 248
>gi|46309437|ref|YP_006327.1| ORF17 [Agrotis segetum granulovirus] >gi|46200654|gb|AAS82721.1| ORF17 [Agrotis segetum granulovirus] (192 aa)
Score = 139, Expect = 2.0e-07, Identities = 47/153 (30%), Positives = 76/153 (49%)
  Q:     8 EKISLNEFNKSFENKDIELYNSIQ----LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY---------GITEDDQASEIRNGGFGST 160
           +K+SL   +   + +D   Y  ++     P R +  +AG D  +  ++ I P +   +PTG+ + +  D    I PRS L  +Y + +    GVID DY      GH+ + L N   +  E++  KGD  AQ +              ++E D+A     GGFGST
  S:    21 KKMSLKTKDTKPKARDTLFYTKLRKDAHAPVRGSVGAAGLDLASVENIQIPPGENALVPTGLSIEIPNDCYGRIAPRSGLALRYSVSVH--AGVIDPDY-----RGHLQVLLFNHGKKTMEIL--KGDRIAQLVCEKIRFPEAVEKPKLSETDRAE----GGFGST 173
>gi|169179676|ref|ZP_02840652.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Arthrobacter chlorophenolicus A6] >gi|169012791|gb|EDS59493.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Arthrobacter chlorophenolicus A6] (173 aa)
Score = 139, Expect = 2.0e-07, Identities = 34/108 (31%), Positives = 57/108 (52%)
  Q:    30 IQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI 137
           ++ P  A    AG D  A  D+ ++P +   +PTG+ + + E  V LI PRS L  K+ L + N  G +D+ Y      G I + L N T+ ++ + +++GD  AQ +
  S:    36 LEAPSYAHPGDAGADLRARQDVTLQPGERRLVPTGVAIALPEGFVALIHPRSGLATKHGLTIVNAPGTVDAGY-----RGEISVTLLN-TDVSQAIELRRGDRIAQMV 137
>gi|77919163|ref|YP_356978.1| deoxyuridinetriphosphatase [Pelobacter carbinolicus DSM 2380] >gi|91206604|sp|Q3A499|DUT_PELCD Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|77545246|gb|ABA88808.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Pelobacter carbinolicus DSM 2380] (147 aa)
Score = 139, Expect = 2.0e-07, Identities = 45/144 (31%), Positives = 69/144 (47%)
  Q:    17 KSFENKDIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGST 160
           K+   K   L++   LP   + H+AG D +A  D  +V+KP     +PTGI + +       + PRS L   + + L NT G ID+DY      G + I + N  +E  + V+  GD  AQ +            E+   ++   GGFG T
  S:     2 KTITIKVKRLHSKAMLPAYMSPHAAGMDLYACPDGEVVVKPGCRTIVPTGIALAIPVGYEGQVRPRSGLALHHGVTLVNTPGTIDADY-----RGELGIIIINHGDE--DFVVSPGDRIAQLVIAPVHRAVLETVEELDETDRNEGGFGHT 145
>gi|118618660|ref|YP_906992.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium ulcerans Agy99] >gi|166217632|sp|A0PT52|DUT_MYCUA Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|118570770|gb|ABL05521.1| deoxyuridine 5'-triphosphate nucleotidohydrolase DutT [Mycobacterium ulcerans Agy99] (154 aa)
Score = 139, Expect = 2.1e-07, Identities = 39/139 (28%), Positives = 65/139 (46%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+V+ P Q   + TG+ V +    V L+ PRS L  +  L + N+ G ID+ Y      G + + L N  +    +V+ +GD  AQ +     + E  + S     G  +T++
  S:     8 VRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPRSGLASRVGLSIVNSPGTIDAGY-----RGELKVVLIN-LDPATPIVVNRGDRIAQLLVQRVELLELVEVSSFDEAGLAATSR 140
>gi|145229243|ref|XP_001388930.1| hypothetical protein An01g05040 [Aspergillus niger] >gi|134055031|emb|CAK37038.1| unnamed protein product [Aspergillus niger] (198 aa)
Score = 139, Expect = 2.2e-07, Identities = 44/128 (34%), Positives = 68/128 (53%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQ----AIFLSYGITEDDQASEIRN-GGFGST 160
           P R +  +AGYD ++  + VI  K    + TGI + + E +   I PRS L  K+   +D   GVID+DY      G + + L N ++ + E  +K+GD  AQ     I+    +  ++ A  +R  GGFGST
  S:    73 PTRGSAFAAGYDMYSAKETVIPAKGKALVDTGIAIAVPEGTYGRIAPRSGLASKHF--IDTGAGVIDADY-----RGEVKVLLFNHSDVDFE--VKEGDRVAQLVLERIYTPEVVVVEELAESVRGAGGFGST 196
>gi|28190654|gb|AAO33139.1|AF479638_3 pol polyprotein [Ovine lentivirus] (976 aa)
Score = 138, Expect = 2.2e-07, Identities = 45/129 (34%), Positives = 65/129 (50%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIRNGGFGST 160
           LPKR  +  AGYD   P ++ I   Q  KIP  +R+ + ED   LI  +SSL  K         G+IDS Y     +G + + + N  + ++E+VI +G  FAQ I +       G     + +E    GFGST
  S:   571 LPKR--REDAGYDLICPQEVSIPAGQVKKIPIDLRLNLKEDQWALIGTKSSLASKGVFVQG---GIIDSGY-----QGQVQVVIYN--SNDREVVIPQGRKFAQLILMPLVHEELGTWGKTRKTERGKEGFGST 692
>gi|163869096|ref|YP_001610330.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bartonella tribocorum CIP 105476] >gi|161018777|emb|CAK02335.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bartonella tribocorum CIP 105476] (178 aa)
Score = 138, Expect = 2.4e-07, Identities = 49/137 (35%), Positives = 69/137 (50%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPY----DLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRN-----GGFGST 160
           +E    ++LP  AT  SAG D  A       LV+ P Q   IPTG+   ++      I PRS L  K+ +   NT G IDSDY      G + + L N   E  +  I++G   AQ +      ++    E +Q ++  N     GGFGST
  S:    32 LEHGQGLELPHYATAGSAGLDLRAALGEEETLVLAPGQRALIPTGLIFHLSPGLEAQIRPRSGLALKHGITCLNTPGTIDSDY-----RGEVKVLLINLGQE--DFSIERGMRIAQTVIAPVTQVNVCAIEPEQKNQNHNQSRGTGGFGST 175
>gi|167999518|ref|XP_001752464.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162696364|gb|EDQ82703.1| predicted protein [Physcomitrella patens subsp. patens] (166 aa)
Score = 138, Expect = 2.4e-07, Identities = 44/129 (34%), Positives = 66/129 (51%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGIT------EDDQASEIRNGGFGST 160
           LP R +  +AGYD  + YD  +  +    + T + + + + +   I PRS L +K    +D   GVID+DY      G + + L N  + + +  IK GD  AQ I L   IT      +D  A+   +GGFGST
  S:    34 LPSRGSALAAGYDLSSAYDTCVPARGKALVKTELSIAIPQGTYARIAPRSGLAWKN--SIDVGAGVIDADY-----RGPVGVILFN--HSDSDFTIKAGDRIAQLI-LELIITPDVMEVDDLDATARGDGGFGST 158
>gi|114798633|ref|YP_761940.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Hyphomonas neptunium ATCC 15444] >gi|114738807|gb|ABI76932.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Hyphomonas neptunium ATCC 15444] (151 aa)
Score = 138, Expect = 2.4e-07, Identities = 46/136 (33%), Positives = 66/136 (48%)
  Q:    27 YNSIQLPKRATKHSAGYDFFAPYD----LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGSTNK 162
           +  + LP   T  SAG D  A       +++ P Q   +PTG+ V + E   + + PRS L  K+ L   NT G IDSDY      G I + L N   E     I++G+  AQ +      L++   E    +    GGFGST +
  S:    14 FAGLDLPAYETAGSAGMDVRAAVPDREPVILAPGQRAMVPTGLSVAIPEGYEIQVRPRSGLAAKHGLTCLNTPGTIDSDY-----RGEIKVILINLGAE--PFTIQRGERIAQLVLAPVTRLAWTEVEALGETARGAGGFGSTGR 151
>gi|160872463|ref|ZP_02062595.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Rickettsiella grylli] >gi|159121262|gb|EDP46600.1| deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) [Rickettsiella grylli] (151 aa)
Score = 138, Expect = 2.4e-07, Identities = 50/138 (36%), Positives = 70/138 (50%)
  Q:    23 DIELYNSIQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEI----RNG-GFGST 160
           D  L     LP  AT+ SAG D  A     L + P QT  I TG+ + +    +  +ILPRS LG K+ + L N +G+IDSDY     +G +F+   N         I+ GD  AQ +F+    T+ +   E     R G GFG +
  S:    10 DPRLGEQYPLPHYATEGSAGLDLRACIHKPLPLMPNQTELISTGLAIYIAHTHLAAVILPRSGLGHKHGIVLGNLIGLIDSDY-----QGELFVSCWNRGQTC--FHIEPGDRIAQLVFVPVVRTQFELVQEFVETERGGHGFGHS 148
>gi|67515979|ref|XP_657875.1| hypothetical protein AN0271.2 [Aspergillus nidulans FGSC A4] >gi|40746988|gb|EAA66144.1| hypothetical protein AN0271.2 [Aspergillus nidulans FGSC A4] (208 aa)
Score = 138, Expect = 2.5e-07, Identities = 44/136 (32%), Positives = 71/136 (52%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE----DDQASEIRN-GGFGST 160
           +L ++ + P R +  +AGYD +A  + +I  K    + TG+ V + E +   + PRS L  K+   +D   GVID+DY      G + + L N +  + +  IK+GD  AQ +       E    ++ A  +R  GGFGST
  S:    74 KLTDTARAPTRGSAFAAGYDLYAAKETIIPAKGKGLVDTGLAVAVPEGTYGRVAPRSGLASKHF--IDVGAGVIDADY-----RGEVKVLLFNFS--DVDFTIKEGDRVAQLVLERIYTPEVAVVEELAESVRGAGGFGST 205
>gi|167013261|pdb|2P9O|A Chain A, Structure Of Dutpase From Arabidopsis Thaliana >gi|167013262|pdb|2P9O|B Chain B, Structure Of Dutpase From Arabidopsis Thaliana >gi|167013263|pdb|2P9O|C Chain C, Structure Of Dutpase From Arabidopsis Thaliana >gi|167744878|pdb|2PC5|A Chain A, Native Crystal Structure Analysis On Arabidopsis Dutpase >gi|167744879|pdb|2PC5|B Chain B, Native Crystal Structure Analysis On Arabidopsis Dutpase >gi|167744880|pdb|2PC5|C Chain C, Native Crystal Structure Analysis On Arabidopsis Dutpase (169 aa)
Score = 138, Expect = 2.6e-07, Identities = 45/129 (34%), Positives = 69/129 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITE-DDQASEIR-NGGFGST 160
           +P R +  SAGYD  +  D  +  +    IPT + + + E +   I PRS L +K+   +D   GVID+DY      G + + L N ++ + E  +K GD  AQ I    ++  + E DD    +R +GGFGST
  S:    43 IPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLAWKH--SIDVGAGVIDADY-----RGPVGVILFNHSDADFE--VKFGDRIAQLIIEKIVTPDVVEVDDLDETVRGDGGFGST 167
>gi|115372797|ref|ZP_01460103.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Stigmatella aurantiaca DW4/3-1] >gi|115370278|gb|EAU69207.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Stigmatella aurantiaca DW4/3-1] (152 aa)
Score = 138, Expect = 2.6e-07, Identities = 40/133 (30%), Positives = 67/133 (50%)
  Q:    30 IQLPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIR-----NGGFGSTNK 162
           + LP+  T+ +AG D  A  D   V++P + + +PTG  + +       + PRS L  K+ + L N+ G ID+DY      G + + L N + +     + +GD  AQ + +     E  + S +       GGFGST +
  S:    20 LPLPRYETELAAGMDLRADIDGGRVLEPFERLAVPTGFAIALPPGYEGQVRPRSGLALKHGITLLNSPGTIDADY-----RGEVQVILVNLSRD--PFTLSRGDRIAQLVVVPVSTVEIQEVSVLEATVRGEGGFGSTGR 152
>gi|2558898|gb|AAC59317.1| dUTPase [salmonid herpesvirus 1] (181 aa)
Score = 138, Expect = 2.6e-07, Identities = 44/128 (34%), Positives = 62/128 (48%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITE---DDQASEIR-NGGFGST 160
           PKRAT  SAG+D +   DL+I P  +  I TG    + +D V LI  RSS+     L      GVIDSDY     +G + + L       +  ++ +    AQ + + Y       +D  + IR  G FGST
  S:    61 PKRATVGSAGFDIYPAVDLIIPPHTSATINTGYAFNIPKDHVGLIAARSSM----HLCGVTVTGVIDSDY-----KGEVMVMLRTGA---ESYMVSRTRAVAQLLVVRYVAQSAHGEDAPTAIRGKGAFGST 180
>gi|15232681|ref|NP_190278.1| deoxyuridine 5'-triphosphate nucleotidohydrolase family [Arabidopsis thaliana] >gi|13878143|gb|AAK44149.1|AF370334_1 putative dUTP pyrophosphatase [Arabidopsis thaliana] >gi|5541665|emb|CAB51171.1| dUTP pyrophosphatase-like protein [Arabidopsis thaliana] >gi|17104549|gb|AAL34163.1| putative dUTP pyrophosphatase [Arabidopsis thaliana] (166 aa)
Score = 138, Expect = 2.7e-07, Identities = 45/129 (34%), Positives = 69/129 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI---FLSYGITE-DDQASEIR-NGGFGST 160
           +P R +  SAGYD  +  D  +  +    IPT + + + E +   I PRS L +K+   +D   GVID+DY      G + + L N ++ + E  +K GD  AQ I    ++  + E DD    +R +GGFGST
  S:    40 IPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLAWKH--SIDVGAGVIDADY-----RGPVGVILFNHSDADFE--VKFGDRIAQLIIEKIVTPDVVEVDDLDETVRGDGGFGST 164
>gi|12085000|ref|NP_073402.1| 17L protein [Yaba-like disease virus] >gi|157939637|ref|YP_001497009.1| dUTPase [Tanapox virus] >gi|12056176|emb|CAC21255.1| 17L protein [Yaba-like disease virus] >gi|146746353|gb|ABQ43489.1| dUTPase [Tanapox virus] >gi|146746509|gb|ABQ43644.1| dUTPase [Tanapox virus] (143 aa)
Score = 137, Expect = 2.9e-07, Identities = 39/110 (35%), Positives = 56/110 (50%)
  Q:    29 SIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           S  +P +++K SAGYD ++ YD ++ PK  + + T I + + +     I PRS L     + +    GVIDSDY      G I +   N  N N    IKKGD  AQ +F
  S:    14 SATIPTKSSKKSAGYDLYSAYDYLVCPKNRLLVKTDICLSIPDGCYGRIAPRSGLSLNSCIDIGG--GVIDSDY-----RGIIGVIFIN--NGNSPYYIKKGDRIAQIVF 114
>gi|699195|gb|AAA62960.1| cut [Mycobacterium leprae] (252 aa)
Score = 137, Expect = 2.9e-07, Identities = 40/139 (28%), Positives = 64/139 (46%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+ + P Q   + TG+ V +    V LI PRS L  +  L + N+ G +D+ Y      G I + L N  +  + LV+ +GD  AQ +     + E  + S     G   T++
  S:   106 VRLDPGLPLPSRAHDGDAGVDLYSVEDVKLAPGQRALVRTGLAVAIPFGMVGLIHPRSGLAVRVGLSIVNSPGTVDAGY-----RGEIKVALIN-LDPVEPLVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLAETSR 238
>gi|15827498|ref|NP_301761.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium leprae TN] >gi|13432131|sp|Q49992|DUT_MYCLE Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|13093048|emb|CAC31409.1| probable deoxyuridine triphosphatase [Mycobacterium leprae] (154 aa)
Score = 137, Expect = 2.9e-07, Identities = 40/139 (28%), Positives = 64/139 (46%)
  Q:    24 IELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSYGITEDDQASEIRNGGFGSTNK 162
           + L   + LP RA    AG D ++  D+ + P Q   + TG+ V +    V LI PRS L  +  L + N+ G +D+ Y      G I + L N  +  + LV+ +GD  AQ +     + E  + S     G   T++
  S:     8 VRLDPGLPLPSRAHDGDAGVDLYSVEDVKLAPGQRALVRTGLAVAIPFGMVGLIHPRSGLAVRVGLSIVNSPGTVDAGY-----RGEIKVALIN-LDPVEPLVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLAETSR 140
>gi|159045515|ref|YP_001534309.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Dinoroseobacter shibae DFL 12] >gi|157913275|gb|ABV94708.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Dinoroseobacter shibae DFL 12] (155 aa)
Score = 137, Expect = 2.9e-07, Identities = 49/134 (36%), Positives = 69/134 (51%)
  Q:    29 SIQLPKRATKHSAGYDFFA--PYDL-----VIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLS-----YGITEDDQASEIRNGGFGSTNK 162
           +I LP  AT  +AG D  A  P ++      I+P   V +PTG+RV +     + I PRS L  K+ L L NT G IDSDY      G + + LT    E   + +  GD  AQA+        +   +  + +    GGFGST +
  S:    16 AIPLPSYATVGAAGADLRANLPPEIRDQGVEIQPLCRVIVPTGLRVAIPAGYEMQIRPRSGLALKHGLSLPNTPGTIDSDY-----RGPLGVLLTVIGTE--AVTLHHGDRIAQAVIAPVVQAVFAPVDRLEETARGAGGFGSTGR 154
>gi|57545049|gb|AAW51453.1| deoxyuridine triphosphatase [Paramecium bursaria Chlorella virus SH6A] (141 aa)
Score = 137, Expect = 2.9e-07, Identities = 39/114 (34%), Positives = 59/114 (51%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF 138
           +L  +   P R ++ +AGYD  +  D+VI     V + TG+ +R+ + +   I PRS L +KY   +D   GVIDSDY      G +   L N  +  ++ +IK GD  AQ I 
  S:     8 KLVETATTPMRGSEGAAGYDISSVEDVVIPAMGRVAVSTGLSIRVPDGTYGRIAPRSGLAYKY--GIDVLAGVIDSDY-----RGELKAILYN--SGERDYIIKTGDRIAQLIL 112
>gi|160947497|ref|ZP_02094664.1| hypothetical protein PEPMIC_01431 [Peptostreptococcus micros ATCC 33270] >gi|158446631|gb|EDP23626.1| hypothetical protein PEPMIC_01431 [Peptostreptococcus micros ATCC 33270] (143 aa)
Score = 137, Expect = 3.0e-07, Identities = 46/128 (35%), Positives = 66/128 (51%)
  Q:    33 PKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY-----GITEDDQASEIRNGGFGST 160
           P  AT+ ++G+D  A  D  LVIKP +   +PTG+ + +       I  RS +  K+ + + N VG IDSDY      G I + + N +  +KE VIK  D  AQ I   Y      + E+   +    GGFG T
  S:    14 PTYATEGASGFDLRANLDEDLVIKPMERFAVPTGLFIEIPLGYEGQIRARSGMSLKHGITMANGVGTIDSDY-----RGEIKVLIVNIS--DKEYVIKNNDRIAQMIITKYERADFKLVEELSDTTRDKGGFGHT 141
>gi|119497199|ref|XP_001265362.1| dUTPase (Dut), putaive [Neosartorya fischeri NRRL 181] >gi|119413524|gb|EAW23465.1| dUTPase (Dut), putaive [Neosartorya fischeri NRRL 181] (199 aa)
Score = 137, Expect = 3.1e-07, Identities = 43/136 (31%), Positives = 68/136 (50%)
  Q:    25 ELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIF-----LSYGITEDDQASEIRNGGFGST 160
           +L  S Q P R +  +AGYD ++  + VI  K    + TG+ + + E +   + PRS L  K+   +D   GVID+DY      G + + L N +  + +  +K GD  AQ +          + E+ + S    GGFGST
  S:    66 KLTESAQAPTRGSAFAAGYDLYSAKETVIPAKGKALVDTGLAIAVPEGTYGRVAPRSGLASKHF--IDTGAGVIDADY-----RGEVKVLLFNFS--DVDFTVKVGDRIAQLVLERIYTPDVMVVEELEESVRGAGGFGST 197
>gi|34419256|ref|NP_899269.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Vibrio phage KVP40] >gi|34332937|gb|AAQ64092.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Bacteriophage KVP40] (165 aa)
Score = 137, Expect = 3.1e-07, Identities = 38/101 (37%), Positives = 63/101 (62%)
  Q:    41 AGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL----------LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY 141
           AG D  A  +  + ++P  +V IP+G+++ +    +            I PRS LGFK+ L+L NT+G+ID++Y     +G I IK+ N+ ++   L I++GD   Q IF +Y
  S:    31 AGIDLRAAIEESIELQPGDSVVIPSGVKIHIGSHPLHQQYTDLGVYGAIAPRSGLGFKHFLRLANTIGIIDANY-----QGEIMIKIRNEGDD--VLHIERGDRICQLIFHTY 136
>gi|89255664|ref|YP_513025.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Francisella tularensis subsp. holarctica] >gi|115314165|ref|YP_762888.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Francisella tularensis subsp. holarctica OSU18] >gi|156501614|ref|YP_001427679.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009895|ref|ZP_02274826.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Francisella tularensis subsp. holarctica FSC200] >gi|122325791|sp|Q0BNT3|DUT_FRATO Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|122501260|sp|Q2A5H6|DUT_FRATH Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|166217619|sp|A7N9S0|DUT_FRATF Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (dUTP pyrophosphatase) >gi|89143495|emb|CAJ78671.1| dUTP pyrophosphatase (Deoxyuridine 5'-triphosphate nucleotidohydrolase) [Francisella tularensis subsp. holarctica LVS] >gi|115129064|gb|ABI82251.1| dUTP diphosphatase [Francisella tularensis subsp. holarctica OSU18] >gi|134252881|gb|EBA51975.1| dUTP pyrophosphatase (deoxyuridine 5'-triphosphate nucleotidohydrolase) [Francisella tularensis subsp. holarctica 257] >gi|156252217|gb|ABU60723.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Francisella tularensis subsp. holarctica FTNF002-00] (148 aa)
Score = 137, Expect = 3.2e-07, Identities = 48/130 (36%), Positives = 68/130 (52%)
  Q:    31 QLPKRATKHSAGYDFFA--PYDLVIKPKQTVKIPTGIRVRM-NEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL-----SYGITEDDQASEIR-NGGFGST 160
           +LP  AT+ SA  D  A     + +K  +   I TGI + + N +   +ILPRS LG K  L L N  G+IDSDY     +G + +   N + E  E  I+    FAQ + +     ++ I ED     +R  GGFG T
  S:    15 ELPGYATEGSAAIDLRACISESIYLKSGECKLIATGIAINIANPNYAAMILPRSGLGHKKGLVLGNGTGLIDSDY-----QGELMVSCFNRSQETIE--IEPLMRFAQLVIVPVVQANFEIVEDFSQQSVRATGGFGHT 146
>gi|194666254|ref|XP_001787402.1| PREDICTED: similar to Gag-Pro-Pol-Env protein [Bos taurus] (1303 aa)
Score = 137, Expect = 3.2e-07, Identities = 49/146 (33%), Positives = 73/146 (50%)
  Q:    16 NKSFENKDIELYNSIQLPKRATKHSAGYDFFAPYDLVIKPKQ-TVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFLSY--GITEDDQASEIRNGGFGSTN 161
           N +F   D +  N ++   RAT  SAG D  +    ++ P   T+KIPTG++  +    V +IL RSSL  +    L    G+IDSDY      G I I ++  T   K   I +G   AQ + L Y   I +    +E ++ GFGS++
  S:   661 NGAFLGPDQQSGNGLRELIRATPGSAGLDLSSTTSTILTPDSPTIKIPTGVKGPLPTGLVGIILGRSSLAIQ---GLTIIPGIIDSDY-----TGEIQIMISPPT---KTFQIHQGQRIAQLLLLPYHNAIGQTATQNERQDKGFGSSD 798
>gi|71275888|ref|ZP_00652171.1| DeoxyUTP pyrophosphatase, subfamily 1 [Xylella fastidiosa Dixon] >gi|71901385|ref|ZP_00683478.1| DeoxyUTP pyrophosphatase, subfamily 1 [Xylella fastidiosa Ann-1] >gi|170729363|ref|YP_001774796.1| dUTP diphosphatase [Xylella fastidiosa M12] >gi|71163265|gb|EAO12984.1| DeoxyUTP pyrophosphatase, subfamily 1 [Xylella fastidiosa Dixon] >gi|71728844|gb|EAO30982.1| DeoxyUTP pyrophosphatase, subfamily 1 [Xylella fastidiosa Ann-1] >gi|167964156|gb|ACA11166.1| dUTP diphosphatase [Xylella fastidiosa M12] (155 aa)
Score = 137, Expect = 3.3e-07, Identities = 39/108 (36%), Positives = 58/108 (53%)
  Q:    32 LPKRATKHSAGYDFFAPYD--LVIKPKQTVKIPTGIRVRMNEDSVL-LILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAIFL 139
           LP  AT+ SAG D  A  D  + + P     + TGI + + + S+  ++LPRS LG ++ + L N  G+IDSDY     +G + + L N   E     I+ GD  AQ + L
  S:    23 LPTYATEASAGLDLRAALDAPMTLVPGDAELLSTGIAIHLVDPSLCAVVLPRSGLGHRHGIVLGNGTGLIDSDY-----QGPLLVSLWNRGRE--AFTIEPGDRIAQLVVL 126
>gi|193634343|ref|XP_001948039.1| PREDICTED: similar to AGAP010159-PA [Acyrthosiphon pisum] (155 aa)
Score = 137, Expect = 3.3e-07, Identities = 42/128 (32%), Positives = 69/128 (53%)
  Q:    33 PKRATKHSAGYDFFAPYDLVIKPKQTVKIPTGIRVRMNEDSVLLILPRSSLGFKYRLQLDNTVGVIDSDYYYSDNEGHIFIKLTNDTNENKELVIKKGDGFAQAI--------FLSYGITEDDQASEIRNGGFGST 160
           P + ++H+AGYD  + Y  V+K      I T I++++ + +   + PRS L +K    +D   GVIDSDY      G++ + L N ++E  + ++ KGD  AQ I         + +   ++    E   GGFGST
  S:    29 PTKGSEHAAGYDLRSAYSYVVKAHGKELIKTDIQIKVPQGTYGRVAPRSGLAWKNF--IDVGAGVIDSDY-----RGNVGVILYNHSDE--DFIVNKGDRVAQLICEMIVYPEVVEFKTLDETDRGE---GGFGST 152