>gi|26553554|ref|NP_757488.1| ribosomal protein S16 [Mycoplasma penetrans HF-2] >gi|31076972|sp|Q8EWV0|RS16_MYCPE 30S ribosomal protein S16 >gi|26453560|dbj|BAC43892.1| ribosomal protein S16 [Mycoplasma penetrans HF-2] (132 aa)
Score = 431, Expect = 2.3e-41, Identities = 132/132 (100%), Positives = 132/132 (100%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTVSKK 132
           MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTVSKK
  S:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTVSKK 132
>gi|31544830|ref|NP_853408.1| 30S ribosomal protein S16 [Mycoplasma gallisepticum R] >gi|31541676|gb|AAP56976.1| RpsP [Mycoplasma gallisepticum R] (91 aa)
Score = 251, Expect = 1.9e-20, Identities = 48/84 (57%), Positives = 67/84 (79%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           +VKIRL RLGRHKLP +R+VV+DSR +RDG+YIE +G  +P  G   +N  +A+ WLKKGAQP+DTVK++L ++G+WK++  SK
  S:     6 LVKIRLMRLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPINGTNKLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASK 89
>gi|15644314|ref|NP_229366.1| ribosomal protein S16 [Thermotoga maritima MSB8] >gi|148270356|ref|YP_001244816.1| ribosomal protein S16 [Thermotoga petrophila RKU-1] >gi|170289018|ref|YP_001739256.1| ribosomal protein S16 [Thermotoga sp. RQ2] >gi|166228762|sp|A5IM17|RS16_THEP1 30S ribosomal protein S16 >gi|7388157|sp|Q9X1Q2|RS16_THEMA 30S ribosomal protein S16 >gi|4982135|gb|AAD36633.1|AE001802_2 ribosomal protein S16 [Thermotoga maritima MSB8] >gi|147735900|gb|ABQ47240.1| SSU ribosomal protein S16P [Thermotoga petrophila RKU-1] >gi|170176521|gb|ACB09573.1| ribosomal protein S16 [Thermotoga sp. RQ2] (95 aa)
Score = 229, Expect = 7.1e-18, Identities = 51/93 (54%), Positives = 68/93 (73%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNA 93
           MV+IRLTR+G+   PF+RIVV+DSR RRDGAYIE +G Y P  EG + I+ E A+ W+ KGAQPSDTV+++ R+ GV K+  + K   K+E  A
  S:     1 MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEGEIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMKRVHEIKYGKKEEATA 94
>gi|33860208|sp|Q9RDV4|RS16_MYCGA 30S ribosomal protein S16 (80 aa)
Score = 228, Expect = 8.1e-18, Identities = 43/77 (55%), Positives = 61/77 (79%)
  Q:     8 RLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           RLGRHKLP +R+VV+DSR +RDG+YIE +G  +P  G   +N  +A+ WLKKGAQP+DTVK++L ++G+WK++  SK
  S:     2 RLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPINGTNKLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASK 78
>gi|6601576|gb|AAF19037.1| 30S ribosomal protein S16 [Mycoplasma gallisepticum] (80 aa)
Score = 227, Expect = 1.1e-17, Identities = 43/77 (55%), Positives = 61/77 (79%)
  Q:     8 RLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           RLGRHKLP +R+VV+DSR +RDG+YIE +G  +P  G   +N  +A+ WLKKGAQP+DTVK++L ++G+WK++  SK
  S:     2 RLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPINGANKLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASK 78
>gi|50365359|ref|YP_053784.1| 30S ribosomal protein S16 [Mesoplasma florum L1] >gi|81612874|sp|Q6F0S3|RS16_MESFL 30S ribosomal protein S16 >gi|50363915|gb|AAT75900.1| 30S ribosomal protein S16 [Mesoplasma florum L1] (89 aa)
Score = 226, Expect = 1.6e-17, Identities = 47/89 (52%), Positives = 66/89 (74%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKK 89
           MVKIRL R+G+ + PF+RIV  DSR  R+G YIE +GT++P +  V IN E+AL WL+ GAQP++TV+ LL +QGV K   ++K+ +KK
  S:     1 MVKIRLKRIGKKQAPFYRIVAADSRVNRNGQYIELIGTFDPLKSEVKINNELALKWLQNGAQPTETVRELLSQQGVMKALHEAKLANKK 89
>gi|22537505|ref|NP_688356.1| 30S ribosomal protein S16 [Streptococcus agalactiae 2603V/R] >gi|25011470|ref|NP_735865.1| 30S ribosomal protein S16 [Streptococcus agalactiae NEM316] >gi|76788217|ref|YP_329999.1| 30S ribosomal protein S16 [Streptococcus agalactiae A909] >gi|76797719|ref|ZP_00779987.1| ribosomal protein S16 [Streptococcus agalactiae 18RS21] >gi|77406391|ref|ZP_00783452.1| ribosomal protein S16 [Streptococcus agalactiae H36B] >gi|77412598|ref|ZP_00788884.1| ribosomal protein S16 [Streptococcus agalactiae CJB111] >gi|54039403|sp|P66443|RS16_STRA5 30S ribosomal protein S16 >gi|54042139|sp|P66442|RS16_STRA3 30S ribosomal protein S16 >gi|109894807|sp|Q3K0F4|RS16_STRA1 30S ribosomal protein S16 >gi|22534385|gb|AAN00229.1|AE014254_9 ribosomal protein S16 [Streptococcus agalactiae 2603V/R] >gi|24413008|emb|CAD47087.1| 30S ribosomal protein S16 [Streptococcus agalactiae NEM316] >gi|76563274|gb|ABA45858.1| ribosomal protein S16 [Streptococcus agalactiae A909] >gi|76586943|gb|EAO63433.1| ribosomal protein S16 [Streptococcus agalactiae 18RS21] >gi|77161349|gb|EAO72374.1| ribosomal protein S16 [Streptococcus agalactiae CJB111] >gi|77175015|gb|EAO77823.1| ribosomal protein S16 [Streptococcus agalactiae H36B] (90 aa)
Score = 222, Expect = 4.9e-17, Identities = 54/83 (65%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTR+G  K PF+RI V DSRA RDG +IE VGTY P   E  V I EE  L WL KGAQPSDTV+NLL + GV  KF D K
  S:     3 VKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVAENQVTIKEERVLEWLSKGAQPSDTVRNLLSKAGVMTKFHDQK 87
>gi|13358133|ref|NP_078407.1| ribosomal protein S16 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|14195206|sp|Q9PPS1|RS16_UREPA 30S ribosomal protein S16 >gi|11357038|pir||E82874 ribosomal protein S16 UU568 [imported] - Ureaplasma urealyticum >gi|6899576|gb|AAF30982.1|AE002155_4 ribosomal protein S16 [Ureaplasma parvum serovar 3 str. ATCC 700970] (101 aa)
Score = 221, Expect = 5.2e-17, Identities = 49/93 (52%), Positives = 70/93 (75%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNA 93
           +VKIRLTR+G HK PFFRIVV+D++ + +GAYIE +G Y+P  G V + +E  L+ L+ GAQPS+TVKN+L ++G+WK+F+  K  +KK   A
  S:     4 LVKIRLTRVGTHKKPFFRIVVMDAKTKANGAYIENLGHYDPVLGQVVLKKEAILAQLQNGAQPSETVKNILSQEGIWKEFIALKDANKKRKAA 96
>gi|15900669|ref|NP_345273.1| 30S ribosomal protein S16 [Streptococcus pneumoniae TIGR4] >gi|15902726|ref|NP_358276.1| 30S ribosomal protein S16 [Streptococcus pneumoniae R6] >gi|111658337|ref|ZP_01409025.1| hypothetical protein SpneT_02000477 [Streptococcus pneumoniae TIGR4] >gi|116516029|ref|YP_816168.1| 30S ribosomal protein S16 [Streptococcus pneumoniae D39] >gi|148985875|ref|ZP_01818969.1| ribosomal protein S16 [Streptococcus pneumoniae SP3-BS71] >gi|148989856|ref|ZP_01821150.1| ribosomal protein S16 [Streptococcus pneumoniae SP6-BS73] >gi|148992438|ref|ZP_01822133.1| ribosomal protein S16 [Streptococcus pneumoniae SP9-BS68] >gi|149003395|ref|ZP_01828284.1| ribosomal protein S16 [Streptococcus pneumoniae SP14-BS69] >gi|149007656|ref|ZP_01831273.1| ribosomal protein S16 [Streptococcus pneumoniae SP18-BS74] >gi|149010598|ref|ZP_01831969.1| ribosomal protein S16 [Streptococcus pneumoniae SP19-BS75] >gi|149021640|ref|ZP_01835671.1| ribosomal protein S16 [Streptococcus pneumoniae SP23-BS72] >gi|168484433|ref|ZP_02709385.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1873-00] >gi|168486213|ref|ZP_02710721.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1087-00] >gi|168488444|ref|ZP_02712643.1| ribosomal protein S16 [Streptococcus pneumoniae SP195] >gi|168490863|ref|ZP_02715006.1| ribosomal protein S16 [Streptococcus pneumoniae CDC0288-04] >gi|168492926|ref|ZP_02717069.1| ribosomal protein S16 [Streptococcus pneumoniae CDC3059-06] >gi|169832621|ref|YP_001694234.1| ribosomal protein S16 [Streptococcus pneumoniae Hungary19A-6] >gi|122278946|sp|Q04LD0|RS16_STRP2 30S ribosomal protein S16 >gi|54039404|sp|P66445|RS16_STRR6 30S ribosomal protein S16 >gi|54042140|sp|P66444|RS16_STRPN 30S ribosomal protein S16 >gi|14972250|gb|AAK74913.1| ribosomal protein S16 [Streptococcus pneumoniae TIGR4] >gi|15458270|gb|AAK99486.1| 30S Ribosomal protein S16 [Streptococcus pneumoniae R6] >gi|116076605|gb|ABJ54325.1| ribosomal protein S16 [Streptococcus pneumoniae D39] >gi|147758578|gb|EDK65576.1| ribosomal protein S16 [Streptococcus pneumoniae SP14-BS69] >gi|147760811|gb|EDK67782.1| ribosomal protein S16 [Streptococcus pneumoniae SP18-BS74] >gi|147765079|gb|EDK72008.1| ribosomal protein S16 [Streptococcus pneumoniae SP19-BS75] >gi|147922021|gb|EDK73145.1| ribosomal protein S16 [Streptococcus pneumoniae SP3-BS71] >gi|147924798|gb|EDK75882.1| ribosomal protein S16 [Streptococcus pneumoniae SP6-BS73] >gi|147928755|gb|EDK79768.1| ribosomal protein S16 [Streptococcus pneumoniae SP9-BS68] >gi|147930101|gb|EDK81087.1| ribosomal protein S16 [Streptococcus pneumoniae SP23-BS72] >gi|168995123|gb|ACA35735.1| ribosomal protein S16 [Streptococcus pneumoniae Hungary19A-6] >gi|172042337|gb|EDT50383.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1873-00] >gi|183570774|gb|EDT91302.1| ribosomal protein S16 [Streptococcus pneumoniae CDC1087-00] >gi|183573046|gb|EDT93574.1| ribosomal protein S16 [Streptococcus pneumoniae SP195] >gi|183574768|gb|EDT95296.1| ribosomal protein S16 [Streptococcus pneumoniae CDC0288-04] >gi|183576937|gb|EDT97465.1| ribosomal protein S16 [Streptococcus pneumoniae CDC3059-06] (90 aa)
Score = 221, Expect = 5.9e-17, Identities = 51/83 (61%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTR+G  K PF+RI V DSR+ RDG +IE VGTY P   E  V + E+  L+WL  GAQPSDTV+N+L ++GV KKF DSK
  S:     3 VKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSK 87
>gi|42560960|ref|NP_975411.1| 30S ribosomal protein S16 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|54039378|sp|P62233|RS16_MYCMS 30S ribosomal protein S16 >gi|42492457|emb|CAE77053.1| 30S RIBOSOMAL PROTEIN S16 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (108 aa)
Score = 219, Expect = 1.1e-16, Identities = 49/95 (51%), Positives = 65/95 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANK 95
           MVK+RL R+G+ + PF+RIVV DSR  R+G YIE VGT+ P +  V I+ E+ L WL  GAQP+DTV++LL +QG+ K   +SK  SK     NK
  S:     1 MVKLRLKRIGKKQAPFYRIVVADSRVNRNGQYIELVGTFNPLKDEVKIDNELTLKWLNNGAQPTDTVRSLLSKQGILKALHESKF-SKNTQTENK 94
>gi|116512366|ref|YP_809582.1| 30S ribosomal protein S16 [Lactococcus lactis subsp. cremoris SK11] >gi|122940068|sp|Q02Y12|RS16_LACLS 30S ribosomal protein S16 >gi|116108020|gb|ABJ73160.1| SSU ribosomal protein S16P [Lactococcus lactis subsp. cremoris SK11] (90 aa)
Score = 218, Expect = 1.2e-16, Identities = 53/84 (63%), Positives = 61/84 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV 85
           VKIRLTR+G  K PF+RI V DSRA RDG +IE VGTY P   E  V + EE  L WL  GAQPSDTV+NLL + GV KKF +SK+
  S:     3 VKIRLTRMGSKKKPFYRINVADSRAPRDGKFIETVGTYNPLLTENQVTLKEERVLEWLSNGAQPSDTVRNLLSKAGVMKKFHESKL 88
>gi|55821524|ref|YP_139966.1| 30S ribosomal protein S16 [Streptococcus thermophilus LMG 18311] >gi|55823452|ref|YP_141893.1| 30S ribosomal protein S16 [Streptococcus thermophilus CNRZ1066] >gi|116628236|ref|YP_820855.1| 30S ribosomal protein S16 [Streptococcus thermophilus LMD-9] >gi|122267168|sp|Q03JG3|RS16_STRTD 30S ribosomal protein S16 >gi|81559090|sp|Q5LYM4|RS16_STRT1 30S ribosomal protein S16 >gi|81560284|sp|Q5M387|RS16_STRT2 30S ribosomal protein S16 >gi|55737509|gb|AAV61151.1| 30S ribosomal protein S16 [Streptococcus thermophilus LMG 18311] >gi|55739437|gb|AAV63078.1| 30S ribosomal protein S16 [Streptococcus thermophilus CNRZ1066] >gi|116101513|gb|ABJ66659.1| SSU ribosomal protein S16P [Streptococcus thermophilus LMD-9] (90 aa)
Score = 217, Expect = 1.6e-16, Identities = 53/83 (63%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTR+G  K PF+RI V DSRA RDG +IE VGTY P   E  V + EE  L WL KGAQPSDTV+N+L ++GV KKF +SK
  S:     3 VKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVEENQVTLKEERVLEWLSKGAQPSDTVRNILSKEGVMKKFHESK 87
>gi|54039381|sp|P62237|RS16_SPIKU 30S ribosomal protein S16 >gi|34849436|gb|AAP58935.1| ribosomal protein S16 [Spiroplasma kunkelii] (119 aa)
Score = 217, Expect = 1.7e-16, Identities = 45/88 (51%), Positives = 61/88 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           MVK+RL R+G+ K  F+RIV  D+R +RDG YIE +GTY P  G V IN ++A  WL  GAQP+DTV+NLL ++G+  K  + K  +K
  S:     1 MVKLRLKRIGKKKAAFYRIVATDARVKRDGEYIELIGTYNPINGYVKINYDLAYKWLLTGAQPTDTVRNLLSKEGLMNKLHNEKYVAK 88
>gi|15674875|ref|NP_269049.1| 30S ribosomal protein S16 [Streptococcus pyogenes M1 GAS] >gi|19745916|ref|NP_607052.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS8232] >gi|21910103|ref|NP_664371.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS315] >gi|28896199|ref|NP_802549.1| 30S ribosomal protein S16 [Streptococcus pyogenes SSI-1] >gi|50914013|ref|YP_059985.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS10394] >gi|71903295|ref|YP_280098.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS6180] >gi|71910461|ref|YP_282011.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS5005] >gi|94988335|ref|YP_596436.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS9429] >gi|94990216|ref|YP_598316.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS10270] >gi|94992213|ref|YP_600312.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS2096] >gi|94994134|ref|YP_602232.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS10750] >gi|139473985|ref|YP_001128701.1| 30S ribosomal protein S16 [Streptococcus pyogenes str. Manfredo] >gi|123080128|sp|Q1J786|RS16_STRPF 30S ribosomal protein S16 >gi|123080415|sp|Q1JMC0|RS16_STRPC 30S ribosomal protein S16 >gi|123258028|sp|Q1JHG4|RS16_STRPD 30S ribosomal protein S16 >gi|123382321|sp|Q1JCE0|RS16_STRPB 30S ribosomal protein S16 >gi|166201640|sp|A2RF55|RS16_STRPG 30S ribosomal protein S16 >gi|54039405|sp|P66447|RS16_STRP3 30S ribosomal protein S16 >gi|54039406|sp|P66448|RS16_STRP8 30S ribosomal protein S16 >gi|54042141|sp|P66446|RS16_STRP1 30S ribosomal protein S16 >gi|73917922|sp|Q5XCR1|RS16_STRP6 30S ribosomal protein S16 >gi|109894808|sp|Q48U63|RS16_STRPM 30S ribosomal protein S16 >gi|13622012|gb|AAK33770.1| 30S ribosomal protein S16 [Streptococcus pyogenes M1 GAS] >gi|19748071|gb|AAL97551.1| 30S ribosomal protein S1 [Streptococcus pyogenes MGAS8232] >gi|21904295|gb|AAM79174.1| 30S ribosomal protein S16 [Streptococcus pyogenes MGAS315] >gi|28811450|dbj|BAC64382.1| 30S ribosomal protein S16 [Streptococcus pyogenes SSI-1] >gi|50903087|gb|AAT86802.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS10394] >gi|71802390|gb|AAX71743.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS6180] >gi|71853243|gb|AAZ51266.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS5005] >gi|94541843|gb|ABF31892.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS9429] >gi|94543724|gb|ABF33772.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS10270] >gi|94545721|gb|ABF35768.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS2096] >gi|94547642|gb|ABF37688.1| SSU ribosomal protein S16P [Streptococcus pyogenes MGAS10750] >gi|134272232|emb|CAM30484.1| 30S ribosomal protein S16 [Streptococcus pyogenes str. Manfredo] (90 aa)
Score = 217, Expect = 1.9e-16, Identities = 51/83 (61%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTR+G  K PF+RI V DSRA RDG +IE VGTY P   E  + I E+  L WL KGAQPSDTV+N+L + GV  KF D K
  S:     3 VKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVAENQITIKEDRVLEWLSKGAQPSDTVRNILSKAGVMAKFHDQK 87
>gi|15673551|ref|NP_267725.1| 30S ribosomal protein S16 [Lactococcus lactis subsp. lactis Il1403] >gi|14195195|sp|Q9CFB2|RS16_LACLA 30S ribosomal protein S16 >gi|12724572|gb|AAK05667.1|AE006387_10 30S ribosomal protein S16 [Lactococcus lactis subsp. lactis Il1403] (90 aa)
Score = 214, Expect = 3.5e-16, Identities = 54/84 (64%), Positives = 62/84 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV 85
           VKIRLTR+G  K PF+RI V DSRA RDG +IE VGTY P   E  V + EE  L WL KGAQPSDTV+NLL + GV KKF +SK+
  S:     3 VKIRLTRMGSKKKPFYRINVADSRAPRDGKFIETVGTYNPLVTEEQVTLKEERVLEWLSKGAQPSDTVRNLLSKAGVMKKFHESKL 88
>gi|73662838|ref|YP_301619.1| 30S ribosomal protein S16 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581618|sp|Q49X24|RS16_STAS1 30S ribosomal protein S16 >gi|72495353|dbj|BAE18674.1| 30S ribosomal protein S16 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (88 aa)
Score = 214, Expect = 3.9e-16, Identities = 48/83 (57%), Positives = 61/83 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE---GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VK+RLTRLG  + PF+RIV  D+RA RDG  IE++GTY P       V I+EE+AL WLK GA+P+DTV N+L  +G+ KKF D K
  S:     3 VKLRLTRLGSKRNPFYRIVAADARAPRDGRNIEQIGTYNPNNVNAAEVKIDEELALKWLKNGAKPTDTVHNILSREGILKKFDDQK 88
>gi|116495083|ref|YP_806817.1| ribosomal protein S16 [Lactobacillus casei ATCC 334] >gi|191638587|ref|YP_001987753.1| 30S ribosomal protein S16 [Lactobacillus casei] >gi|122263500|sp|Q038J7|RS16_LACC3 30S ribosomal protein S16 >gi|116105233|gb|ABJ70375.1| SSU ribosomal protein S16P [Lactobacillus casei ATCC 334] >gi|190712889|emb|CAQ66895.1| 30S ribosomal protein S16 [Lactobacillus casei BL23] (91 aa)
Score = 214, Expect = 4.1e-16, Identities = 47/87 (54%), Positives = 64/87 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN--INEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           VKIRL R+G  + PF+RIVV DSR+ RDG +IE VG Y P    V+  +NEE  L+WL+KGAQPSDTV+NLL  +G+ +K+ +++   K
  S:     3 VKIRLKRMGSKRKPFYRIVVADSRSPRDGRFIEAVGYYNPLTNPVDLKLNEEDILNWLQKGAQPSDTVRNLLGSKGIMQKYHEARFAKK 91
>gi|95930753|ref|ZP_01313486.1| ribosomal protein S16 [Desulfuromonas acetoxidans DSM 684] >gi|95133233|gb|EAT14899.1| ribosomal protein S16 [Desulfuromonas acetoxidans DSM 684] (89 aa)
Score = 213, Expect = 4.4e-16, Identities = 48/84 (57%), Positives = 60/84 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV 85
           VKIRL R G  K PF++IVV D R  RDG YIE +G Y P     +V +NEE AL+WL KGAQPS+TV+ +LR++GVW+KF    V
  S:     3 VKIRLARGGAKKKPFYQIVVADERCPRDGRYIENLGQYNPLVEPKMVALNEERALAWLNKGAQPSETVRQILRQEGVWEKFTQKPV 88
>gi|116618579|ref|YP_818950.1| SSU ribosomal protein S16P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271221|sp|Q03W45|RS16_LEUMM 30S ribosomal protein S16 >gi|116097426|gb|ABJ62577.1| SSU ribosomal protein S16P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (139 aa)
Score = 213, Expect = 5.6e-16, Identities = 54/113 (47%), Positives = 68/113 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPA 114
           VKIRL R+G  K PF+R+V+ DSR+ RDG +IE VGTY P      + ++EE  LSWL  GAQPSDTV+NLL   G+  K+ +SK   K    A   +   KKP  K   A   A
  S:     3 VKIRLKRMGAKKRPFYRVVIADSRSPRDGRFIETVGTYNPISQPAEIKLDEEKILSWLGNGAQPSDTVRNLLSNAGILAKYNESKSGKKPAKKATTKEASAKKPTDKNTVAEIKA 117
>gi|30021932|ref|NP_833563.1| 30S ribosomal protein S16 [Bacillus cereus ATCC 14579] >gi|30263847|ref|NP_846224.1| 30S ribosomal protein S16 [Bacillus anthracis str. Ames] >gi|42782936|ref|NP_980183.1| 30S ribosomal protein S16 [Bacillus cereus ATCC 10987] >gi|47529272|ref|YP_020621.1| 30S ribosomal protein S16 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186694|ref|YP_029946.1| 30S ribosomal protein S16 [Bacillus anthracis str. Sterne] >gi|49478410|ref|YP_037905.1| 30S ribosomal protein S16 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141645|ref|YP_085185.1| 30S ribosomal protein S16 [Bacillus cereus E33L] >gi|118479066|ref|YP_896217.1| 30S ribosomal protein S16 [Bacillus thuringiensis str. Al Hakam] >gi|163941582|ref|YP_001646466.1| 30S ribosomal protein S16 [Bacillus weihenstephanensis KBAB4] >gi|166234392|sp|A0RHL7|RS16_BACAH 30S ribosomal protein S16 >gi|50403616|sp|Q819W3|RS16_BACCR 30S ribosomal protein S16 >gi|50403617|sp|Q81WJ3|RS16_BACAN 30S ribosomal protein S16 >gi|54039373|sp|P62226|RS16_BACC1 30S ribosomal protein S16 >gi|81613624|sp|Q6HEX1|RS16_BACHK 30S ribosomal protein S16 >gi|81686569|sp|Q636I2|RS16_BACCZ 30S ribosomal protein S16 >gi|29897488|gb|AAP10764.1| SSU ribosomal protein S16P [Bacillus cereus ATCC 14579] >gi|30258491|gb|AAP27710.1| ribosomal protein S16 [Bacillus anthracis str. Ames] >gi|42738863|gb|AAS42791.1| ribosomal protein S16 [Bacillus cereus ATCC 10987] >gi|47504420|gb|AAT33096.1| ribosomal protein S16 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180621|gb|AAT55997.1| ribosomal protein S16 [Bacillus anthracis str. Sterne] >gi|49329966|gb|AAT60612.1| ribosomal protein S16 (30S ribosomal protein S16) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975114|gb|AAU16664.1| ribosomal protein S16 (30S ribosomal protein S16) [Bacillus cereus E33L] >gi|118418291|gb|ABK86710.1| SSU ribosomal protein S16P [Bacillus thuringiensis str. Al Hakam] >gi|163863779|gb|ABY44838.1| ribosomal protein S16 [Bacillus weihenstephanensis KBAB4] (90 aa)
Score = 212, Expect = 5.9e-16, Identities = 49/83 (59%), Positives = 60/83 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+R+VV DSR+ RDG +IE++GTY P      V INEE AL WL  GA+PSDTV+NL   QG+ +KF  SK
  S:     3 VKIRLKRMGAKKTPFYRVVVADSRSPRDGRFIEEIGTYNPVAQPAEVKINEEAALKWLGNGAKPSDTVRNLFSNQGIMEKFHLSK 87
>gi|56419732|ref|YP_147050.1| 30S ribosomal protein S16 [Geobacillus kaustophilus HTA426] >gi|81558000|sp|Q5L0P8|RS16_GEOKA 30S ribosomal protein S16 >gi|56379574|dbj|BAD75482.1| 30S ribosomal protein S16 [Geobacillus kaustophilus HTA426] (90 aa)
Score = 212, Expect = 6.8e-16, Identities = 48/83 (57%), Positives = 64/83 (77%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE +GTY+P      V I+EE+AL WL+ GA+PSDTV++LL +QG+ +KF + K
  S:     3 VKIRLKRMGTKKKPFYRIVVADSRSPRDGRFIETIGTYDPVAEPAQVKIDEELALKWLQNGAKPSDTVRSLLSKQGILEKFHNLK 87
>gi|24379319|ref|NP_721274.1| 30S ribosomal protein S16 [Streptococcus mutans UA159] >gi|31076960|sp|Q8DUN9|RS16_STRMU 30S ribosomal protein S16 >gi|24377242|gb|AAN58580.1|AE014928_1 30S ribosomal protein S16 [Streptococcus mutans UA159] (91 aa)
Score = 212, Expect = 6.8e-16, Identities = 49/87 (56%), Positives = 61/87 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           VKIRLTR+G  K PF+RI V DSRA RDG +IE VGTY P   E  V + E+  L WL  GAQPSDTV+N+L + G+ +KF ++K   K
  S:     3 VKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVTENQVTLKEDRILEWLGNGAQPSDTVRNILSKAGIMQKFHEAKYSKK 91
>gi|83319787|ref|YP_424518.1| 30S ribosomal protein S16 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|109893889|sp|Q2SRU5|RS16_MYCCT 30S ribosomal protein S16 >gi|83283673|gb|ABC01605.1| 30S ribosomal protein S16 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (108 aa)
Score = 212, Expect = 7.0e-16, Identities = 48/95 (50%), Positives = 65/95 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANK 95
           MVK+RL R+G+ + PF+RIV  DSR  R+G YIE VGT+ P +  V I++E+ L WL  GAQP+DTV++LL +QG+ K   +SK  SK     NK
  S:     1 MVKLRLKRIGKKQAPFYRIVAADSRVNRNGQYIELVGTFNPLKDEVKIDKELTLKWLNNGAQPTDTVRSLLSKQGILKALHESKF-SKNTQTENK 94
>gi|65321172|ref|ZP_00394131.1| COG0228: Ribosomal protein S16 [Bacillus anthracis str. A2012] (90 aa)
Score = 211, Expect = 7.6e-16, Identities = 49/83 (59%), Positives = 60/83 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+R+VV DSR+ RDG +IE++GTY P      V INEE AL WL  GA+PSDTV+NL   QG+ +KF  SK
  S:     3 VKIRLKRMGAKKTPFYRVVVADSRSPRDGRFIEEIGTYNPVAQPXEVKINEEAALKWLGNGAKPSDTVRNLFSNQGIMEKFHLSK 87
>gi|89098671|ref|ZP_01171553.1| ribosomal protein S16 (BS17) [Bacillus sp. NRRL B-14911] >gi|89086633|gb|EAR65752.1| ribosomal protein S16 (BS17) [Bacillus sp. NRRL B-14911] (90 aa)
Score = 211, Expect = 8.0e-16, Identities = 48/83 (57%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE VGTY P      V INEE+AL W+  GA+PSDTV+NL  ++G+ +KF ++K
  S:     3 VKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAQPAKVEINEELALKWMNDGAKPSDTVRNLFSKEGIMEKFHNAK 87
>gi|16078662|ref|NP_389481.1| 30S ribosomal protein S16 [Bacillus subtilis subsp. subtilis str. 168] >gi|585937|sp|P21474|RS16_BACSU 30S ribosomal protein S16 (BS17) >gi|2309081|dbj|BAA21692.1| 30S ribosomal protein S16 [Bacillus subtilis] >gi|2633971|emb|CAB13472.1| ribosomal protein S16 (BS17) [Bacillus subtilis subsp. subtilis str. 168] (90 aa)
Score = 211, Expect = 8.3e-16, Identities = 49/83 (59%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE VGTY P      V I+EE+AL WL+ GA+PSDTV+NL   QG+ +KF ++K
  S:     3 VKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAK 87
>gi|81428330|ref|YP_395330.1| 30S ribosomal protein S16 [Lactobacillus sakei subsp. sakei 23K] >gi|109893886|sp|Q38XR0|RS16_LACSS 30S ribosomal protein S16 >gi|78609972|emb|CAI55019.1| 30S ribosomal protein S16 [Lactobacillus sakei subsp. sakei 23K] (91 aa)
Score = 209, Expect = 1.3e-15, Identities = 45/87 (51%), Positives = 65/87 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNIN--EEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           VKIR+ R+G  K PF+RIVV DSR+ RDG +I++VG Y P    V++   EE+ + WL+KGAQPSDTV+NLL +QG+ +K+ +++   K
  S:     3 VKIRMKRMGSKKRPFYRIVVADSRSPRDGRFIQQVGYYNPLTEPVDLKLEEEVIMDWLQKGAQPSDTVRNLLSKQGIMQKYHEARFAKK 91
>gi|90961607|ref|YP_535523.1| 30S ribosomal protein S16 [Lactobacillus salivarius UCC118] >gi|123391363|sp|Q1WU95|RS16_LACS1 30S ribosomal protein S16 >gi|90820801|gb|ABD99440.1| SSU ribosomal protein S16P [Lactobacillus salivarius UCC118] (91 aa)
Score = 209, Expect = 1.3e-15, Identities = 49/87 (56%), Positives = 60/87 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE VGTY P      V + EE  ++WL  GAQPSDTV+N+L   GV KKF ++K   K
  S:     3 VKIRLKRMGSKKRPFYRIVVADSRSPRDGRFIETVGTYNPLTDPETVTLKEEKVMNWLNNGAQPSDTVRNILSRNGVMKKFHEAKFSKK 91
>gi|70726677|ref|YP_253591.1| 30S ribosomal protein S16 [Staphylococcus haemolyticus JCSC1435] >gi|82581617|sp|Q4L5U0|RS16_STAHJ 30S ribosomal protein S16 >gi|68447401|dbj|BAE04985.1| 30S ribosomal protein S16 [Staphylococcus haemolyticus JCSC1435] (91 aa)
Score = 209, Expect = 1.3e-15, Identities = 48/83 (57%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE---GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTRLG  + PF+RIVV D+R+ RDG  IE++GTY P       V I+EE+AL WLK GA+P+DTV N+L +QG+ K F + K
  S:     3 VKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPASVNAPEVKIDEELALKWLKDGAKPTDTVHNILSKQGILKTFDEQK 88
>gi|110004275|emb|CAK98613.1| 30s ribosomal protein s16 [Spiroplasma citri] (119 aa)
Score = 208, Expect = 2.0e-15, Identities = 52/112 (46%), Positives = 67/112 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASK 112
           MVK+RL R+G+ K  F+RIV  D+R +RDG YIE +GTY P  G V IN ++A  WL  GAQP+DTV+NLL ++G+  K           HN   V K  K  + K A  SK
  S:     1 MVKLRLKRIGKKKAAFYRIVATDARVKRDGEYIELIGTYNPINGDVKINHDLAYKWLLTGAQPTDTVRNLLSKEGLMTKL----------HNEKYVAKTTKSTKEKIATNSK 102
>gi|27467831|ref|NP_764468.1| 30S ribosomal protein S16 [Staphylococcus epidermidis ATCC 12228] >gi|57866689|ref|YP_188387.1| 30S ribosomal protein S16 [Staphylococcus epidermidis RP62A] >gi|31076941|sp|Q8CSV0|RS16_STAES 30S ribosomal protein S16 >gi|81674909|sp|Q5HPV3|RS16_STAEQ 30S ribosomal protein S16 >gi|27315376|gb|AAO04510.1|AE016747_7 30S ribosomal protein S16 [Staphylococcus epidermidis ATCC 12228] >gi|57637347|gb|AAW54135.1| ribosomal protein S16 [Staphylococcus epidermidis RP62A] (91 aa)
Score = 208, Expect = 2.1e-15, Identities = 47/83 (56%), Positives = 61/83 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE---GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTRLG  + PF+RIVV D+R+ RDG  IE++GTY P       V I+EE+AL WL  GA+P+DTV N+L  +G+ KKF + K
  S:     3 VKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQLGTYNPAHVNAPEVKIDEELALKWLHDGAKPTDTVHNILSREGILKKFDEQK 88
>gi|52080201|ref|YP_078992.1| 30S ribosomal protein S16 [Bacillus licheniformis ATCC 14580] >gi|52785578|ref|YP_091407.1| 30S ribosomal protein S16 [Bacillus licheniformis ATCC 14580] >gi|81609175|sp|Q65JQ0|RS16_BACLD 30S ribosomal protein S16 >gi|52003412|gb|AAU23354.1| ribosomal protein S16 (BS17) [Bacillus licheniformis ATCC 14580] >gi|52348080|gb|AAU40714.1| RpsP [Bacillus licheniformis DSM 13] (90 aa)
Score = 206, Expect = 3.3e-15, Identities = 51/87 (58%), Positives = 66/87 (75%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE VGTY P      V I+EE+AL WL+ GA+PSDTV+NL  ++G+ +KF ++K QSK
  S:     3 VKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPLAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSKEGIMEKFHNAK-QSK 90
>gi|108885115|ref|NP_073116.2| 30S ribosomal protein S16 [Mycoplasma genitalium G37] >gi|84626142|gb|AAC72466.2| ribosomal protein S16 [Mycoplasma genitalium G37] >gi|166078769|gb|ABY79387.1| ribosomal protein S16 [synthetic Mycoplasma genitalium JCVI-1.0] (95 aa)
Score = 205, Expect = 4.4e-15, Identities = 48/95 (50%), Positives = 65/95 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANK 95
           MVKIRL R+GR   P +RIV +DSR +R+G YI  +G   P   E    ++E +AL WL KGA P+DTV++L  E G+WKKF++SK  +KKE +  K
  S:     1 MVKIRLMRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESK--NKKETSPKK 95
>gi|28378334|ref|NP_785226.1| 30S ribosomal protein S16 [Lactobacillus plantarum WCFS1] >gi|31076914|sp|Q88WJ5|RS16_LACPL 30S ribosomal protein S16 >gi|28271169|emb|CAD64074.1| ribosomal protein S16 [Lactobacillus plantarum WCFS1] (90 aa)
Score = 203, Expect = 7.7e-15, Identities = 47/83 (56%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +I +VGTY P      V + EE  L WL  GAQPSDTVKN+L + G+ KK+ ++K
  S:     3 VKIRLKRMGSKKNPFYRIVVADSRSPRDGRFIAQVGTYNPLTEPAQVKLEEEDILGWLNNGAQPSDTVKNILSKAGIMKKYHEAK 87
>gi|116490845|ref|YP_810389.1| SSU ribosomal protein S16P [Oenococcus oeni PSU-1] >gi|122276973|sp|Q04FP8|RS16_OENOB 30S ribosomal protein S16 >gi|116091570|gb|ABJ56724.1| SSU ribosomal protein S16P [Oenococcus oeni PSU-1] (96 aa)
Score = 203, Expect = 8.0e-15, Identities = 46/89 (51%), Positives = 64/89 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKE 90
           VKIRL  +G  K PF+RIVV DSRARRDG +IE+VG Y P      + +N++   +WL KGAQP++TV+N L + G+ KK  ++K+ +KKE
  S:     3 VKIRLHLMGTKKRPFYRIVVADSRARRDGRFIEEVGYYNPITKPAEIKLNDDQIFNWLMKGAQPTNTVRNFLSDAGLMKKLHEAKLAAKKE 93
>gi|29376248|ref|NP_815402.1| ribosomal protein S16 [Enterococcus faecalis V583] >gi|50403619|sp|Q834F9|RS16_ENTFA 30S ribosomal protein S16 >gi|29343711|gb|AAO81472.1| ribosomal protein S16 [Enterococcus faecalis V583] (91 aa)
Score = 202, Expect = 9.7e-15, Identities = 48/83 (57%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE VGTY P +    V + E++ L WL KGAQPSDTV+N+L ++GV KK  ++K
  S:     3 VKIRLKRMGSKKSPFYRIVVADSRSPRDGRFIETVGTYNPLKDPAEVVLKEDLVLDWLSKGAQPSDTVRNILSKEGVMKKHHEAK 87
>gi|147678058|ref|YP_001212273.1| ribosomal protein S16 [Pelotomaculum thermopropionicum SI] >gi|189029606|sp|A5D1G1|RS16_PELTS 30S ribosomal protein S16 >gi|146274155|dbj|BAF59904.1| ribosomal protein S16 [Pelotomaculum thermopropionicum SI] (88 aa)
Score = 202, Expect = 1.0e-14, Identities = 48/78 (61%), Positives = 59/78 (75%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE++G Y+P +   V+N+N E AL WLKKGAQ SDT K LL + GV KK
  S:     3 VKIRLRRMGAKKAPFYRIVVADSRSPRDGRFIEEIGYYDPLKKPAVINVNAERALDWLKKGAQLSDTAKALLTKAGVLKK 82
>gi|116333582|ref|YP_795109.1| 30S ribosomal protein S16 [Lactobacillus brevis ATCC 367] >gi|122269731|sp|Q03RU4|RS16_LACBA 30S ribosomal protein S16 >gi|116098929|gb|ABJ64078.1| SSU ribosomal protein S16P [Lactobacillus brevis ATCC 367] (91 aa)
Score = 201, Expect = 1.2e-14, Identities = 47/87 (54%), Positives = 60/87 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           VKIRL R+G  K PF+R+VV DSR+ RDG +IE+VGTY P      V + EE  L+WL  GAQPSDTVK LL   G+ K++ ++K   K
  S:     3 VKIRLKRMGSKKRPFYRVVVADSRSPRDGRFIEQVGTYNPVTEPAQVTLKEESILNWLNNGAQPSDTVKTLLSNAGIMKQYHEAKYTKK 91
>gi|39995749|ref|NP_951700.1| 30S ribosomal protein S16 [Geobacter sulfurreducens PCA] >gi|50403605|sp|P62230|RS16_GEOSL 30S ribosomal protein S16 >gi|39982513|gb|AAR33973.1| ribosomal protein S16 [Geobacter sulfurreducens PCA] (95 aa)
Score = 199, Expect = 1.9e-14, Identities = 44/83 (53%), Positives = 58/83 (69%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV 85
           KIRL R G  K PF++I+V D R+RRDG +IE VGTY+P +    V   E   L WL KGAQP+DTVK +L++ G+W+KF+   V
  S:    11 KIRLARAGAKKKPFYQIIVADVRSRRDGRFIENVGTYDPNQNPAAVKFEEAKTLEWLGKGAQPTDTVKQILKKAGIWEKFVAKSV 95
>gi|16800977|ref|NP_471245.1| 30S ribosomal protein S16 [Listeria innocua Clip11262] >gi|20140100|sp|Q92AL1|RS16_LISIN 30S ribosomal protein S16 >gi|16414412|emb|CAC97141.1| ribosomal protein S16 [Listeria innocua] (90 aa)
Score = 199, Expect = 2.2e-14, Identities = 46/84 (54%), Positives = 58/84 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV 85
           VKIRL R+G  K PF+RIVV DSR  RDG  IE +GTY P      V I+EE  L W+  GA+PSDTV+NLL  +G+ +KF + K+
  S:     3 VKIRLKRMGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQKL 88
>gi|16803837|ref|NP_465322.1| 30S ribosomal protein S16 [Listeria monocytogenes EGD-e] >gi|46908029|ref|YP_014418.1| 30S ribosomal protein S16 [Listeria monocytogenes str. 4b F2365] >gi|116873232|ref|YP_850013.1| 30S ribosomal protein S16 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153175004|ref|ZP_01930425.1| ribosomal protein S16 [Listeria monocytogenes FSL N3-165] >gi|153179821|ref|ZP_01933011.1| ribosomal protein S16 [Listeria monocytogenes F6900] >gi|153186698|ref|ZP_01936903.1| ribosomal protein S16 [Listeria monocytogenes J0161] >gi|153191279|ref|ZP_01938527.1| ribosomal protein S16 [Listeria monocytogenes J2818] >gi|153198553|ref|ZP_01942524.1| ribosomal protein S16 [Listeria monocytogenes 10403S] >gi|153202771|ref|ZP_01944234.1| ribosomal protein S16 [Listeria monocytogenes HPB2262] >gi|167014982|ref|ZP_02277515.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J1-194] >gi|167212545|ref|ZP_02282852.1| 30S ribosomal protein S16 [Listeria monocytogenes LO28] >gi|167214679|ref|ZP_02284986.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL R2-503] >gi|167217808|ref|ZP_02287444.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J1-175] >gi|167404736|ref|ZP_02309515.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J2-003] >gi|167454367|ref|ZP_02320590.1| 30S ribosomal protein S16 [Listeria monocytogenes FSL J2-064] >gi|123461191|sp|A0AJQ2|RS16_LISW6 30S ribosomal protein S16 >gi|20140051|sp|Q8Y699|RS16_LISMO 30S ribosomal protein S16 >gi|67461451|sp|Q71YL9|RS16_LISMF 30S ribosomal protein S16 >gi|16411251|emb|CAC99875.1| ribosomal protein S16 [Listeria monocytogenes] >gi|46881299|gb|AAT04595.1| ribosomal protein S16 [Listeria monocytogenes str. 4b F2365] >gi|116742110|emb|CAK21234.1| rpsP [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126940985|gb|EBA18888.1| ribosomal protein S16 [Listeria monocytogenes J0161] >gi|127631932|gb|EBA21657.1| ribosomal protein S16 [Listeria monocytogenes 10403S] >gi|127765316|gb|EBA25665.1| ribosomal protein S16 [Listeria monocytogenes J2818] >gi|133729787|gb|EBA31485.1| ribosomal protein S16 [Listeria monocytogenes FSL N3-165] >gi|133732555|gb|EBA34253.1| ribosomal protein S16 [Listeria monocytogenes F6900] >gi|133735089|gb|EBA36787.1| ribosomal protein S16 [Listeria monocytogenes HPB2262] (90 aa)
Score = 198, Expect = 2.4e-14, Identities = 46/84 (54%), Positives = 58/84 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV 85
           VKIRL R+G  K PF+RIVV DSR  RDG  IE +GTY P      V I+EE  L W+  GA+PSDTV+NLL  +G+ +KF + K+
  S:     3 VKIRLKRIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQKL 88
>gi|77919818|ref|YP_357633.1| 30S ribosomal protein S16 [Pelobacter carbinolicus DSM 2380] >gi|109894779|sp|Q3A2E4|RS16_PELCD 30S ribosomal protein S16 >gi|77545901|gb|ABA89463.1| SSU ribosomal protein S16P [Pelobacter carbinolicus DSM 2380] (86 aa)
Score = 198, Expect = 2.8e-14, Identities = 44/79 (55%), Positives = 57/79 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKIRL R G  K PF+++VV D R  RDG +IE++G Y+P +   +V + E+  L WL KGAQP+DTV+ LLR QGVW KF
  S:     3 VKIRLARGGAKKKPFYQVVVADERFPRDGRFIEQLGQYDPRQNPSMVTLKEDKTLEWLNKGAQPTDTVRRLLRTQGVWAKF 83
>gi|89895344|ref|YP_518831.1| 30S ribosomal protein S16 [Desulfitobacterium hafniense Y51] >gi|109645689|ref|ZP_01369609.1| ribosomal protein S16 [Desulfitobacterium hafniense DCB-2] >gi|123279902|sp|Q24UA5|RS16_DESHY 30S ribosomal protein S16 >gi|89334792|dbj|BAE84387.1| 30S ribosomal protein S16 [Desulfitobacterium hafniense Y51] >gi|109643638|gb|EAT53191.1| ribosomal protein S16 [Desulfitobacterium hafniense DCB-2] (88 aa)
Score = 197, Expect = 3.2e-14, Identities = 46/82 (56%), Positives = 62/82 (75%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           KIRL R+G  K PF+R++V DS A RDG +IE++G Y+P +   V+NI+EE A+ WL  GAQPSDT K+LLR+ GV  K+ +SK
  S:     4 KIRLRRMGAKKNPFYRLIVADSNAPRDGRFIEEIGFYDPTKQPEVLNIDEEKAMKWLATGAQPSDTAKSLLRKAGVLAKYHESK 87
>gi|78224067|ref|YP_385814.1| 30S ribosomal protein S16 [Geobacter metallireducens GS-15] >gi|109893883|sp|Q39RN5|RS16_GEOMG 30S ribosomal protein S16 >gi|78195322|gb|ABB33089.1| SSU ribosomal protein S16P [Geobacter metallireducens GS-15] (88 aa)
Score = 197, Expect = 3.9e-14, Identities = 43/79 (54%), Positives = 57/79 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           +K+RL R G  K PF++IV+ D R+RRDG +IE VGTY+P +    V   E  AL WL KGAQP+DTVK +L+  G+W+KF
  S:     3 IKMRLARAGAKKKPFYQIVIADVRSRRDGRFIENVGTYDPNQNPAAVKFEEGKALEWLGKGAQPTDTVKQMLKTAGLWEKF 83
>gi|23098987|ref|NP_692453.1| 30S ribosomal protein S16 [Oceanobacillus iheyensis HTE831] >gi|31076969|sp|Q8ER01|RS16_OCEIH 30S ribosomal protein S16 >gi|22777215|dbj|BAC13488.1| 30S ribosomal protein S16 [Oceanobacillus iheyensis HTE831] (90 aa)
Score = 196, Expect = 4.2e-14, Identities = 47/83 (56%), Positives = 60/83 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  + PF+RIVV DSR+ RDG  IE++GTY P      V I+EE AL W+ KGA+PSDTV+NL   +G+ KKF + K
  S:     3 VKIRLKRMGSKRNPFYRIVVADSRSPRDGRSIEQIGTYNPVVNPVEVKIDEEKALDWMSKGAKPSDTVRNLFSNEGIMKKFHEQK 87
>gi|15924228|ref|NP_371762.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926821|ref|NP_374354.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus N315] >gi|21282850|ref|NP_645938.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MW2] >gi|49483401|ref|YP_040625.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486077|ref|YP_043298.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651807|ref|YP_186113.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus COL] >gi|82750842|ref|YP_416583.1| 30S ribosomal protein S16 [Staphylococcus aureus RF122] >gi|87161596|ref|YP_493828.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus USA300] >gi|88194945|ref|YP_499745.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267729|ref|YP_001246672.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus JH9] >gi|150393787|ref|YP_001316462.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus JH1] >gi|151221360|ref|YP_001332182.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979559|ref|YP_001441818.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu3] >gi|168727449|ref|ZP_02759726.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123291812|sp|Q2FZ45|RS16_STAA8 30S ribosomal protein S16 >gi|166201639|sp|A7X1K6|RS16_STAA1 30S ribosomal protein S16 >gi|172048856|sp|A6QGD8|RS16_STAAE 30S ribosomal protein S16 >gi|189029620|sp|A6U157|RS16_STAA2 30S ribosomal protein S16 >gi|189029621|sp|A5ISC3|RS16_STAA9 30S ribosomal protein S16 >gi|54039401|sp|P66440|RS16_STAAN 30S ribosomal protein S16 >gi|54039402|sp|P66441|RS16_STAAW 30S ribosomal protein S16 >gi|54042138|sp|P66439|RS16_STAAM 30S ribosomal protein S16 >gi|73917919|sp|Q5HGJ4|RS16_STAAC 30S ribosomal protein S16 >gi|73917920|sp|Q6GHJ7|RS16_STAAR 30S ribosomal protein S16 >gi|73917921|sp|Q6G9X5|RS16_STAAS 30S ribosomal protein S16 >gi|109894805|sp|Q2FHK0|RS16_STAA3 30S ribosomal protein S16 >gi|109894806|sp|Q2YXH8|RS16_STAAB 30S ribosomal protein S16 >gi|13701038|dbj|BAB42333.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus N315] >gi|14247008|dbj|BAB57400.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu50] >gi|21204289|dbj|BAB94986.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MW2] >gi|49241530|emb|CAG40216.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244520|emb|CAG42949.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285993|gb|AAW38087.1| ribosomal protein S16 [Staphylococcus aureus subsp. aureus COL] >gi|82656373|emb|CAI80791.1| 30S ribosomal protein S16 [Staphylococcus aureus RF122] >gi|87127570|gb|ABD22084.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202503|gb|ABD30313.1| ribosomal protein S16 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740798|gb|ABQ49096.1| SSU ribosomal protein S16P [Staphylococcus aureus subsp. aureus JH9] >gi|149946239|gb|ABR52175.1| ribosomal protein S16 [Staphylococcus aureus subsp. aureus JH1] >gi|150374160|dbj|BAF67420.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721694|dbj|BAF78111.1| 30S ribosomal protein S16 [Staphylococcus aureus subsp. aureus Mu3] (91 aa)
Score = 196, Expect = 4.7e-14, Identities = 44/83 (53%), Positives = 61/83 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG---VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRLTRLG  + PF+RIVV D+R+ RDG  IE++GTY P       + ++E +AL WL  GA+P+DTV N+L ++G+ KKF + K
  S:     3 VKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQK 88
>gi|116492614|ref|YP_804349.1| 30S ribosomal protein S16 [Pediococcus pentosaceus ATCC 25745] >gi|122265922|sp|Q03FW5|RS16_PEDPA 30S ribosomal protein S16 >gi|116102764|gb|ABJ67907.1| SSU ribosomal protein S16P [Pediococcus pentosaceus ATCC 25745] (90 aa)
Score = 196, Expect = 5.1e-14, Identities = 45/83 (54%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+R+VV DSR+ RDG +I +VGTY P      V + EE  L+WL  GAQPSDTVKN+  + G+ KK+ ++K
  S:     3 VKIRLKRMGSKKRPFYRVVVADSRSPRDGRFIAQVGTYNPLTEPASVKLEEEEILNWLNNGAQPSDTVKNIFSKAGIMKKYHEAK 87
>gi|56964058|ref|YP_175789.1| 30S ribosomal protein S16 [Bacillus clausii KSM-K16] >gi|81600844|sp|Q5WFN2|RS16_BACSK 30S ribosomal protein S16 >gi|56910301|dbj|BAD64828.1| 30S ribosomal protein S16 [Bacillus clausii KSM-K16] (90 aa)
Score = 192, Expect = 1.3e-13, Identities = 45/83 (54%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+R+VV DSR  RDG +IE++GTY P      VNI E+ AL W+KKGA+PSDTV++L    G+ +K  + K
  S:     3 VKIRLKRMGSKKAPFYRVVVADSRFPRDGRFIEEIGTYNPIAQPAQVNIKEDKALEWMKKGAKPSDTVRSLFSNAGLMEKLHNEK 87
>gi|42519387|ref|NP_965317.1| 30S ribosomal protein S16 [Lactobacillus johnsonii NCC 533] >gi|116629443|ref|YP_814615.1| 30S ribosomal protein S16 [Lactobacillus gasseri ATCC 33323] >gi|122273619|sp|Q044E5|RS16_LACGA 30S ribosomal protein S16 >gi|54039376|sp|P62231|RS16_LACJO 30S ribosomal protein S16 >gi|41583675|gb|AAS09283.1| 30S ribosomal protein S16 [Lactobacillus johnsonii NCC 533] >gi|116095025|gb|ABJ60177.1| SSU ribosomal protein S16P [Lactobacillus gasseri ATCC 33323] (90 aa)
Score = 191, Expect = 1.7e-13, Identities = 42/83 (50%), Positives = 58/83 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIR+ R+G  + PF+RIVV DSR  RDG +IE+VG Y P      V + E+    WL+KGAQPSDTV++LL + G+  ++ D+K
  S:     3 VKIRMRRMGSKRKPFYRIVVADSRMPRDGRFIEEVGYYNPLTNPDEVKLEEDKIFEWLEKGAQPSDTVRSLLSKAGLMTRYHDAK 87
>gi|18272398|sp|P81290|RS16_BACST 30S ribosomal protein S16 (BS15) (89 aa)
Score = 190, Expect = 2.1e-13, Identities = 46/83 (55%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE +GTY P      + I+EE+AL WL+ GA+PSDT ++LL +QG+ +KF + K
  S:     3 VKIRLKRMGAKKKPFYRIVVADSRSPRDGRFIETIGTYNPVAEPAEIKIDEELALKWLQNGAKPSDT-RSLLSKQGLLEKFHNLK 86
>gi|51246652|ref|YP_066536.1| 30S ribosomal protein S16 [Desulfotalea psychrophila LSv54] >gi|81641227|sp|Q6AJF1|RS16_DESPS 30S ribosomal protein S16 >gi|50877689|emb|CAG37529.1| probable 30S ribosomal protein S16 [Desulfotalea psychrophila LSv54] (81 aa)
Score = 190, Expect = 2.1e-13, Identities = 39/72 (54%), Positives = 57/72 (79%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           V+IRLTRLGR K+PF+R+VV DS A+RDG +++ VGTY+P +   V+ IN+E    W+ +GA P+ TVK+LL++
  S:     3 VRIRLTRLGRKKMPFYRLVVADSEAKRDGKFLDIVGTYDPMQDPAVITINDEKLQDWVGRGALPTTTVKSLLKK 76
>gi|243177|gb|AAB21088.1| ribosomal protein S16 [Bacillus stearothermophilus, Peptide, 88 aa] (88 aa)
Score = 189, Expect = 2.9e-13, Identities = 46/83 (55%), Positives = 62/83 (74%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE +GTY P      + I+EE+AL WL+ GA+PSDT ++LL +QG+ +KF + K
  S:     2 VKIRLKRMGAKKKPFYRIVVADSRSPRDGRFIETIGTYNPVAEPAEIKIDEELALKWLQNGAKPSDT-RSLLSKQGLLEKFHNLK 85
>gi|118579531|ref|YP_900781.1| 30S ribosomal protein S16 [Pelobacter propionicus DSM 2379] >gi|166201329|sp|A1AN03|RS16_PELPD 30S ribosomal protein S16 >gi|118502241|gb|ABK98723.1| SSU ribosomal protein S16P [Pelobacter propionicus DSM 2379] (85 aa)
Score = 188, Expect = 3.7e-13, Identities = 42/77 (54%), Positives = 57/77 (74%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           KIRL R G  K PF+++VV D R+RRDG +IE +GTY+P +   V  +NEE  L+WL KGAQP+DTV+ LL++ G+  K
  S:     4 KIRLARAGAKKRPFYQVVVADERSRRDGRFIENMGTYDPTKNPAVFKLNEEKILAWLSKGAQPTDTVRQLLKKAGILDK 82
>gi|14195200|sp|Q9L9C8|RS16_THIFE 30S ribosomal protein S16 >gi|7769072|gb|AAF69243.1|AF173880_6 30S ribosomal protein S16-like protein [Acidithiobacillus ferrooxidans] (86 aa)
Score = 188, Expect = 4.3e-13, Identities = 42/78 (53%), Positives = 55/78 (70%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MV IR+ R G  K PF+ IVV DSR+RRDG +IE++G Y P   V  + I++E A  WL +GAQPSDTV   L+++GV K
  S:     1 MVVIRMARGGAKKRPFYHIVVADSRSRRDGRFIERLGFYNPIGAVAELRIDKERAAYWLSQGAQPSDTVAGFLKKEGVSK 80
>gi|15615046|ref|NP_243349.1| 30S ribosomal protein S16 [Bacillus halodurans C-125] >gi|14195198|sp|Q9KA11|RS16_BACHD 30S ribosomal protein S16 >gi|10175103|dbj|BAB06202.1| 30S ribosomal protein S16 [Bacillus halodurans C-125] (90 aa)
Score = 187, Expect = 4.6e-13, Identities = 43/83 (51%), Positives = 60/83 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G  K PF+R+VV DSR+ RDG +IE++GTY P      V + E+ AL W+ KGA+PSDTV+NL  + G+ +K  ++K
  S:     3 VKIRLKRMGSKKAPFYRVVVADSRSPRDGRFIEEIGTYNPLTQPAKVELKEDRALDWMLKGAKPSDTVRNLFSKAGLMEKLHNAK 87
>gi|57234655|ref|YP_181311.1| 30S ribosomal protein S16 [Dehalococcoides ethenogenes 195] >gi|109893877|sp|Q3Z8Y8|RS16_DEHE1 30S ribosomal protein S16 >gi|57225103|gb|AAW40160.1| ribosomal protein S16 [Dehalococcoides ethenogenes 195] (82 aa)
Score = 186, Expect = 7.1e-13, Identities = 41/76 (53%), Positives = 53/76 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+KIRLTR+G  K P +RI+V ++R+ RD  Y + VGTY P      V IN E AL W+ KGAQP+DTV  LL++ GV
  S:     1 MLKIRLTRIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTNPETVVINAEKALYWIGKGAQPTDTVARLLKKAGV 78
>gi|83589816|ref|YP_429825.1| SSU ribosomal protein S16P [Moorella thermoacetica ATCC 39073] >gi|109893888|sp|Q2RJV7|RS16_MOOTA 30S ribosomal protein S16 >gi|83572730|gb|ABC19282.1| SSU ribosomal protein S16P [Moorella thermoacetica ATCC 39073] (90 aa)
Score = 186, Expect = 7.4e-13, Identities = 43/82 (52%), Positives = 61/82 (74%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNI--NEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           KIRL R+G  K PF+R+VV DSR+ RDG  +E++G Y P +  V I  +EE AL WL  GAQPS+TV+ LL++ GVW+K++ ++
  S:     4 KIRLKRMGAKKAPFYRLVVADSRSPRDGRVVEEIGYYNPVKQPVEIKVDEEKALHWLTTGAQPSETVRALLKKAGVWQKYIAAR 87
>gi|60682204|ref|YP_212348.1| 30S ribosomal protein S16 [Bacteroides fragilis NCTC 9343] >gi|81314733|sp|Q5LBU1|RS16_BACFN 30S ribosomal protein S16 >gi|60493638|emb|CAH08427.1| putative 30S ribosomal protein S16 [Bacteroides fragilis NCTC 9343] (181 aa)
Score = 186, Expect = 7.5e-13, Identities = 41/77 (53%), Positives = 53/77 (68%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +IRL R GR    F+ IV+ DSRA RDG + EK+GTY P      V++N E AL W+  GAQPSDTV+N+L  +GV+ K
  S:     4 RIRLQRHGRKSYAFYSIVIADSRAPRDGKFTEKIGTYNPNTNPATVDLNFERALHWVLVGAQPSDTVRNILSREGVYMK 82
>gi|53714008|ref|YP_100000.1| 30S ribosomal protein S16 [Bacteroides fragilis YCH46] >gi|81608409|sp|Q64SR3|RS16_BACFR 30S ribosomal protein S16 >gi|52216873|dbj|BAD49466.1| 30S ribosomal protein S16 [Bacteroides fragilis YCH46] (181 aa)
Score = 186, Expect = 7.5e-13, Identities = 41/77 (53%), Positives = 53/77 (68%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +IRL R GR    F+ IV+ DSRA RDG + EK+GTY P      V++N E AL W+  GAQPSDTV+N+L  +GV+ K
  S:     4 RIRLQRHGRKSYAFYSIVIADSRAPRDGKFTEKIGTYNPNTNPATVDLNFERALHWVLVGAQPSDTVRNILSREGVYMK 82
>gi|51892604|ref|YP_075295.1| 30S ribosomal protein S16 [Symbiobacterium thermophilum IAM 14863] >gi|81610544|sp|Q67PE2|RS16_SYMTH 30S ribosomal protein S16 >gi|51856293|dbj|BAD40451.1| 30S ribosomal protein S16 [Symbiobacterium thermophilum IAM 14863] (88 aa)
Score = 185, Expect = 8.9e-13, Identities = 40/83 (48%), Positives = 63/83 (75%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           +KIRL R+G  K PF+R+VV ++ + RDG ++E++G Y+P +   V+NI+EE AL+WL KGA P++T + LL + GV KKF +++
  S:     3 LKIRLKRMGMKKTPFYRLVVTEATSPRDGRFVEEIGYYDPTKNPVVLNIDEEKALNWLLKGATPTETTRALLSKAGVLKKFDEAR 87
>gi|94267669|ref|ZP_01290955.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] >gi|94270961|ref|ZP_01291862.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] >gi|93450605|gb|EAT01726.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] >gi|93451907|gb|EAT02635.1| Ribosomal protein S16 [delta proteobacterium MLMS-1] (82 aa)
Score = 184, Expect = 1.2e-12, Identities = 39/74 (52%), Positives = 56/74 (75%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           V+IRLTR+GR K P++RIVV DS A+RDG Y+E VGTY+P +    V +  +    WL +GA+P+DTV++LL++ G
  S:     3 VRIRLTRMGRKKQPYYRIVVADSEAKRDGRYLEIVGTYDPMQKPAAVTLKRDRVDDWLARGAKPTDTVRSLLKQSG 78
>gi|94985583|ref|YP_604947.1| 30S ribosomal protein S16 [Deinococcus geothermalis DSM 11300] >gi|123381889|sp|Q1IYA6|RS16_DEIGD 30S ribosomal protein S16 >gi|94555864|gb|ABF45778.1| ribosomal protein S16 [Deinococcus geothermalis DSM 11300] (82 aa)
Score = 183, Expect = 1.4e-12, Identities = 42/76 (55%), Positives = 50/76 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP---FEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVKIRL+R G    P +RIVV DSR  RDG YIE +G Y+P    E  + IN E A  WL  GAQP+ T + LL+ QGV
  S:     1 MVKIRLSRFGSTHNPHYRIVVTDSRRPRDGGYIENLGHYDPRKTTENYLKINAERAAYWLSVGAQPTQTARRLLKAQGV 79
>gi|15828940|ref|NP_326300.1| 30S ribosomal protein S16 [Mycoplasma pulmonis UAB CTIP] >gi|20140193|sp|Q98Q97|RS16_MYCPU 30S ribosomal protein S16 >gi|14089883|emb|CAC13642.1| 30S RIBOSOMAL PROTEIN S16 [Mycoplasma pulmonis] (88 aa)
Score = 183, Expect = 1.4e-12, Identities = 42/84 (50%), Positives = 57/84 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           MVKIRL R+G+     ++IVV DSRA RDG +IE+VG Y P    +N+ +E  +SWL +G +PSDTVK LL  + VW++F   K
  S:     1 MVKIRLKRVGKKFNVIYKIVVADSRAPRDGRFIEEVGNYNPHSKSLNLKKEAIISWLNQGVKPSDTVKRLLTREKVWEEFTSLK 84
>gi|29346681|ref|NP_810184.1| 30S ribosomal protein S16 [Bacteroides thetaiotaomicron VPI-5482] >gi|14195208|sp|Q9RQ15|RS16_BACTN 30S ribosomal protein S16 >gi|6015979|gb|AAF01482.1|AF137263_1 30S ribosomal protein S16-like protein [Bacteroides thetaiotaomicron] >gi|29338578|gb|AAO76378.1| 30S ribosomal protein S16 [Bacteroides thetaiotaomicron VPI-5482] (184 aa)
Score = 183, Expect = 1.7e-12, Identities = 42/77 (54%), Positives = 56/77 (72%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +IRL R GR    F+ IV+ DSRA RDG +IEK+GTY P      V++N + AL+W+ KGAQPSDTV+N+L  +GV+ K
  S:     4 RIRLQRHGRKSYAFYSIVIADSRAPRDGKFIEKIGTYNPNTNPATVDLNFDAALAWVLKGAQPSDTVRNILSREGVYMK 82
>gi|145954977|ref|ZP_01803981.1| hypothetical protein CdifQ_04001385 [Clostridium difficile QCD-32g58] (93 aa)
Score = 182, Expect = 1.7e-12, Identities = 47/83 (56%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G +K PF+RIVV DSRA RDG +IE++G Y P      V IN+E A+ WL  GAQP++ VK LL + GV +KF  SK
  S:     6 VKIRLKRMGANKKPFYRIVVADSRAPRDGKFIEEIGYYNPISEPKQVRINDEKAIKWLATGAQPTEVVKKLLVKNGVIEKFEASK 90
>gi|18310694|ref|NP_562628.1| 30S ribosomal protein S16 [Clostridium perfringens str. 13] >gi|110799336|ref|YP_696399.1| 30S ribosomal protein S16 [Clostridium perfringens ATCC 13124] >gi|110801993|ref|YP_698999.1| 30S ribosomal protein S16 [Clostridium perfringens SM101] >gi|168207937|ref|ZP_02633942.1| ribosomal protein S16 [Clostridium perfringens E str. JGS1987] >gi|168210655|ref|ZP_02636280.1| ribosomal protein S16 [Clostridium perfringens B str. ATCC 3626] >gi|168214189|ref|ZP_02639814.1| ribosomal protein S16 [Clostridium perfringens CPE str. F4969] >gi|168216999|ref|ZP_02642624.1| ribosomal protein S16 [Clostridium perfringens NCTC 8239] >gi|169342746|ref|ZP_02863786.1| ribosomal protein S16 [Clostridium perfringens C str. JGS1495] >gi|182625869|ref|ZP_02953635.1| ribosomal protein S16 [Clostridium perfringens D str. JGS1721] >gi|122958813|sp|Q0TPP1|RS16_CLOP1 30S ribosomal protein S16 >gi|123146051|sp|Q0SSA8|RS16_CLOPS 30S ribosomal protein S16 >gi|20140042|sp|Q8XJP4|RS16_CLOPE 30S ribosomal protein S16 >gi|18145375|dbj|BAB81418.1| 30S ribosomal protein S16 [Clostridium perfringens str. 13] >gi|110673983|gb|ABG82970.1| ribosomal protein S16 [Clostridium perfringens ATCC 13124] >gi|110682494|gb|ABG85864.1| ribosomal protein S16 [Clostridium perfringens SM101] >gi|169299252|gb|EDS81322.1| ribosomal protein S16 [Clostridium perfringens C str. JGS1495] >gi|170660753|gb|EDT13436.1| ribosomal protein S16 [Clostridium perfringens E str. JGS1987] >gi|170711268|gb|EDT23450.1| ribosomal protein S16 [Clostridium perfringens B str. ATCC 3626] >gi|170714276|gb|EDT26458.1| ribosomal protein S16 [Clostridium perfringens CPE str. F4969] >gi|177908903|gb|EDT71395.1| ribosomal protein S16 [Clostridium perfringens D str. JGS1721] >gi|182380891|gb|EDT78370.1| ribosomal protein S16 [Clostridium perfringens NCTC 8239] (81 aa)
Score = 182, Expect = 1.8e-12, Identities = 41/75 (54%), Positives = 52/75 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF---EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           VKIRL R+G HK PF+R+VV DSR+ RDG +IE++G Y P    E  V I+ E A  WL  GAQP+D VK L  + G+
  S:     3 VKIRLRRMGAHKAPFYRVVVADSRSPRDGRFIEEIGYYNPIAKPEAEVKIDAEKAAKWLGNGAQPTDIVKKLFNQAGI 80
>gi|73748407|ref|YP_307646.1| 30S ribosomal protein S16 [Dehalococcoides sp. CBDB1] >gi|147669187|ref|YP_001214005.1| 30S ribosomal protein S16 [Dehalococcoides sp. BAV1] >gi|189044378|sp|A5FRP7|RS16_DEHSB 30S ribosomal protein S16 >gi|109893878|sp|Q3ZWY8|RS16_DEHSC 30S ribosomal protein S16 >gi|73660123|emb|CAI82730.1| ribosomal protein S16 [Dehalococcoides sp. CBDB1] >gi|146270135|gb|ABQ17127.1| ribosomal protein S16 [Dehalococcoides sp. BAV1] (82 aa)
Score = 182, Expect = 1.8e-12, Identities = 39/76 (51%), Positives = 52/76 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+KIRLTR+G  K P +RI+V ++R+ RD  Y + VGTY P      V IN E  L W+ KGAQP+DTV  LL++ G+
  S:     1 MLKIRLTRIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTNPETVIINAEKVLYWIGKGAQPTDTVARLLKKAGI 78
>gi|114567017|ref|YP_754171.1| 30S ribosomal protein S16 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317984|sp|Q0AWV4|RS16_SYNWW 30S ribosomal protein S16 >gi|114337952|gb|ABI68800.1| SSU ribosomal protein S16P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (88 aa)
Score = 182, Expect = 2.0e-12, Identities = 41/80 (51%), Positives = 57/80 (71%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMD 82
           +IRL R+G  K PF+R+VV DSR  RDG +IE++G Y P      V I+EE AL WL  GA+PSDT ++LL++QG+  +F +
  S:     4 RIRLRRMGAKKSPFYRLVVADSRYPRDGRFIEELGYYNPSTTPATVKIDEEKALKWLASGAKPSDTARSLLQKQGIMARFAE 85
>gi|104774248|ref|YP_619228.1| 30S ribosomal protein S16 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514338|ref|YP_813244.1| 30S ribosomal protein S16 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274930|sp|Q049R6|RS16_LACDB 30S ribosomal protein S16 >gi|122983929|sp|Q1G9L2|RS16_LACDA 30S ribosomal protein S16 >gi|103423329|emb|CAI98172.1| 30S ribosomal protein S16 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093653|gb|ABJ58806.1| SSU ribosomal protein S16P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (90 aa)
Score = 182, Expect = 2.2e-12, Identities = 43/83 (51%), Positives = 56/83 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIR+ R+G  + PF+RIVV DSRA RDG +IE+VG Y P      + ++E+    WLKKGAQPSDTV++ L   G+  K  D K
  S:     3 VKIRMRRMGAKRKPFYRIVVADSRAPRDGRFIEEVGYYNPVSQPKELKLDEDKIFEWLKKGAQPSDTVRSFLSSAGLMAKLHDEK 87
>gi|119025227|ref|YP_909072.1| 30S ribosomal protein S16 [Bifidobacterium adolescentis ATCC 15703] >gi|166234395|sp|A0ZZV7|RS16_BIFAA 30S ribosomal protein S16 >gi|118764811|dbj|BAF38990.1| 30S ribosomal protein S16 [Bifidobacterium adolescentis ATCC 15703] (149 aa)
Score = 182, Expect = 2.2e-12, Identities = 40/78 (51%), Positives = 54/78 (69%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           KIRL R+G+    F+R+V++DSR +RDG  IE++GTY P      +NIN E A  WL  GAQP++ V NLL+  G W+KF
  S:     4 KIRLKRMGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQPSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKF 83
>gi|54020035|ref|YP_115608.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 232] >gi|71893634|ref|YP_279080.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae J] >gi|72080625|ref|YP_287683.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 7448] >gi|81603674|sp|Q601V7|RS16_MYCH2 30S ribosomal protein S16 >gi|109894771|sp|Q4A879|RS16_MYCH7 30S ribosomal protein S16 >gi|109894772|sp|Q4AA52|RS16_MYCHJ 30S ribosomal protein S16 >gi|53987208|gb|AAV27409.1| 30s ribosomal protein S16 [Mycoplasma hyopneumoniae 232] >gi|71851761|gb|AAZ44369.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae J] >gi|71913749|gb|AAZ53660.1| 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 7448] (88 aa)
Score = 181, Expect = 2.7e-12, Identities = 38/84 (45%), Positives = 55/84 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           MV+IRL R+G    PF++IVV D+RA RDG +IE +G Y P +    +N E    WL  GAQ + TV+N+  ++GV+K F++ K
  S:     1 MVRIRLQRMGSKFNPFYKIVVADARAPRDGRFIEALGYYNPQQKFAKVNLEKTYRWLHIGAQVTQTVRNIFSKKGVFKNFLEQK 84
>gi|1350943|sp|P47684|RS16_MYCGE 30S ribosomal protein S16 (89 aa)
Score = 181, Expect = 2.9e-12, Identities = 42/88 (47%), Positives = 59/88 (67%)
  Q:     8 RLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANK 95
           R+GR   P +RIV +DSR +R+G YI  +G   P   E    ++E +AL WL KGA P+DTV++L  E G+WKKF++SK  +KKE +  K
  S:     2 RMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESK--NKKETSPKK 89
>gi|154249333|ref|YP_001410158.1| ribosomal protein S16 [Fervidobacterium nodosum Rt17-B1] >gi|171769330|sp|A7HKR8|RS16_FERNB 30S ribosomal protein S16 >gi|154153269|gb|ABS60501.1| ribosomal protein S16 [Fervidobacterium nodosum Rt17-B1] (90 aa)
Score = 180, Expect = 3.1e-12, Identities = 41/84 (48%), Positives = 62/84 (73%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           MV+IRLTR+G+ K PF+RIVV+D + +RDGAY+E +G Y P +    +  +I  A+ W+ KGAQPS+TV  LL + G+++K  ++K
  S:     1 MVRIRLTRMGKKKQPFYRIVVVDQKKKRDGAYVESLGYYNPLKEPYEVKVDIDRAVEWMLKGAQPSETVSKLLGKLGLYEKLEEAK 86
>gi|58337565|ref|YP_194150.1| 30S ribosomal protein S16 [Lactobacillus acidophilus NCFM] >gi|75432900|sp|Q5FJK5|RS16_LACAC 30S ribosomal protein S16 >gi|58254882|gb|AAV43119.1| 30S ribosomal protein S16 [Lactobacillus acidophilus NCFM] (90 aa)
Score = 180, Expect = 3.2e-12, Identities = 42/83 (50%), Positives = 56/83 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIR+ R G  + PF+RIVV DSR  RDG +IE+VG Y P      + ++E+    WL+KGAQPSDTV++LL   G+  K  D+K
  S:     3 VKIRMHRAGAKRKPFYRIVVADSRMPRDGRFIEQVGYYNPVSQPKELKLDEDKIFEWLQKGAQPSDTVRSLLSGAGLMAKLHDAK 87
>gi|34811544|pdb|1PNS|P Chain P, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. >gi|34811600|pdb|1PNX|P Chain P, Crystal Structure Of The Wild Type Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx, Contains Only Molecules Of The 30s Ribosomal Subunit. The 50s Subunit Is In The Pdb File 1pny. >gi|56966338|pdb|1VOQ|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966391|pdb|1VOS|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966444|pdb|1VOV|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966497|pdb|1VOX|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966550|pdb|1VOZ|P Chain P, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. (83 aa)
Score = 180, Expect = 3.2e-12, Identities = 40/79 (50%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV---VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVKIRL R G    P +RIVV D+R +RDG YIEK+G Y+P +     + ++ E A  WL  GAQP+DT + LLR+ GV+++
  S:     1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|126698850|ref|YP_001087747.1| 30S ribosomal protein S16 [Clostridium difficile 630] >gi|168696417|ref|ZP_02728694.1| 30S ribosomal protein S16 [Clostridium difficile QCD-37x79] >gi|168714821|ref|ZP_02747098.1| 30S ribosomal protein S16 [Clostridium difficile QCD-63q42] >gi|168725093|ref|ZP_02757370.1| 30S ribosomal protein S16 [Clostridium difficile QCD-76w55] >gi|168730848|ref|ZP_02763125.1| 30S ribosomal protein S16 [Clostridium difficile QCD-97b34] >gi|196127299|ref|ZP_03119048.1| 30S ribosomal protein S16 [Clostridium difficile ATCC 43255] >gi|196160760|ref|ZP_03121321.1| 30S ribosomal protein S16 [Clostridium difficile CIP 107932] >gi|196165603|ref|ZP_03126134.1| 30S ribosomal protein S16 [Clostridium difficile QCD-23m63] >gi|122974132|sp|Q18BB8|RS16_CLOD6 30S ribosomal protein S16 >gi|115250287|emb|CAJ68109.1| 30S ribosomal protein S16 [Clostridium difficile 630] (90 aa)
Score = 180, Expect = 3.4e-12, Identities = 47/83 (56%), Positives = 59/83 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G +K PF+RIVV DSRA RDG +IE++G Y P      V IN+E A+ WL  GAQP++ VK LL + GV +KF  SK
  S:     3 VKIRLKRMGANKKPFYRIVVADSRAPRDGKFIEEIGYYNPISEPKQVRINDEKAIKWLATGAQPTEVVKKLLVKNGVIEKFEASK 87
>gi|118726867|ref|ZP_01575483.1| ribosomal protein S16 [Clostridium cellulolyticum H10] >gi|118663759|gb|EAV70404.1| ribosomal protein S16 [Clostridium cellulolyticum H10] (81 aa)
Score = 180, Expect = 3.8e-12, Identities = 42/75 (56%), Positives = 55/75 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN--INEEIALSWLKKGAQPSDTVKNLLREQGV 76
           VKIRL R+G  K PF+R+VV DSR  RDG +IE++GTY P    V   I+ E    W+K GAQP+DTVK+LL++QG+
  S:     3 VKIRLKRMGAKKNPFYRVVVADSRYPRDGRFIEEIGTYNPIVEPVQFKIDAEKVQKWIKNGAQPTDTVKSLLKKQGI 79
>gi|46198981|ref|YP_004648.1| 30S ribosomal protein S16 [Thermus thermophilus HB27] >gi|55981004|ref|YP_144301.1| 30S ribosomal protein S16 [Thermus thermophilus HB8] >gi|50403623|sp|P62238|RS16_THET2 30S ribosomal protein S16 >gi|62900937|sp|Q5SJH3|RS16_THET8 30S ribosomal protein S16 >gi|10120996|pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus >gi|10835600|pdb|1FJG|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin >gi|13096409|pdb|1HR0|P Chain P, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit >gi|13399807|pdb|1HNW|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline >gi|13399829|pdb|1HNX|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin >gi|13399851|pdb|1HNZ|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B >gi|14278071|pdb|1IBK|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin >gi|14278092|pdb|1IBL|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin >gi|14278116|pdb|1IBM|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site >gi|14278545|pdb|1I94|P Chain P, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 >gi|14278566|pdb|1I95|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine >gi|14278587|pdb|1I96|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) >gi|14278609|pdb|1I97|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline >gi|20663901|pdb|1J5E|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit >gi|27065891|pdb|1N32|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin >gi|27065918|pdb|1N33|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin >gi|27065945|pdb|1N34|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position >gi|27065971|pdb|1N36|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position >gi|58177415|pdb|1XMO|P Chain P, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center >gi|58177438|pdb|1XMQ|P Chain P, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center >gi|58177479|pdb|1XNQ|P Chain P, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center >gi|58177502|pdb|1XNR|P Chain P, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center >gi|66361069|pdb|1YL4|S Chain S, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. 30s Subunit. The Coordinates For The 50s Subunit Are In The Pdb Entry 1yl3 >gi|88192251|pdb|2B64|P Chain P, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf1 And Is Described In Remark 400. >gi|88192314|pdb|2B9M|P Chain P, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf2 And Is Described In Remark 400. >gi|88192370|pdb|2B9O|P Chain P, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site. This File Contains The 30s Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site And Is Described In Remark 400. >gi|110591338|pdb|2F4V|P Chain P, 30s Ribosome + Designer Antibiotic >gi|116667669|pdb|2HHH|P Chain P, Crystal Structure Of Kasugamycin Bound To The 30s Ribosomal Subunit >gi|116668212|pdb|2J00|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, A-, P- And E- Site Trnas And Paromomycin For Molecule I. >gi|116668273|pdb|2J02|P Chain P, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4) This File Contains The 30s Subunit, Mrna, A-, P- And E- Site Trnas And Paromomycin For Molecule Ii. >gi|119389727|pdb|2HGI|S Chain S, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgj. >gi|119389784|pdb|2HGP|S Chain S, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgq. >gi|119389840|pdb|2HGR|S Chain S, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgu. >gi|149241290|pdb|2E5L|P Chain P, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction >gi|149242723|pdb|2OW8|QQ Chain q, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 2ow8, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsa. >gi|149243633|pdb|2UU9|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Gug-Codon In The A-Site And Paromomycin. >gi|149243660|pdb|2UUA|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guc-Codon In The A-Site And Paromomycin. >gi|149243687|pdb|2UUB|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guu-Codon In The A-Site And Paromomycin. >gi|149243714|pdb|2UUC|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Gua-Codon In The A-Site And Paromomycin. >gi|149243853|pdb|2UXC|P Chain P, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Ucgu In The Context Of The Thermus Thermophilus 30s Subunit. >gi|157836423|pdb|2UXB|P Chain P, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Gggu In The Context Of The Thermus Thermophilus 30s Subunit. >gi|157836500|pdb|2V46|P Chain P, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 1. >gi|157836556|pdb|2V48|P Chain P, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 3 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 2. >gi|158430915|pdb|2UXD|P Chain P, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Cggg In The Context Of The Thermus Thermophilus 30s Subunit. >gi|160285954|pdb|2QNH|QQ Chain q, Interactions And Dynamics Of The Shine-Dalgarno Helix In The 70s Ribosome. This File, 2qnh, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsp. >gi|186972864|pdb|2VQE|P Chain P, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding >gi|186972887|pdb|2VQF|P Chain P, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding >gi|46196605|gb|AAS81021.1| SSU ribosomal protein S16P [Thermus thermophilus HB27] >gi|55772417|dbj|BAD70858.1| 30S ribosomal protein S16 [Thermus thermophilus HB8] (88 aa)
Score = 179, Expect = 4.5e-12, Identities = 40/79 (50%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV---VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVKIRL R G    P +RIVV D+R +RDG YIEK+G Y+P +     + ++ E A  WL  GAQP+DT + LLR+ GV+++
  S:     1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|117928768|ref|YP_873319.1| SSU ribosomal protein S16P [Acidothermus cellulolyticus 11B] >gi|166234383|sp|A0LV73|RS16_ACIC1 30S ribosomal protein S16 >gi|117649231|gb|ABK53333.1| SSU ribosomal protein S16P [Acidothermus cellulolyticus 11B] (174 aa)
Score = 178, Expect = 5.3e-12, Identities = 48/125 (38%), Positives = 74/125 (59%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQK 126
           VKIRLTR+G+ + P++RIVV D+R +RDG  IE++G Y+P +   ++ +N E    WL  GAQP++ VK LL+  G W++F         +    K  K+     A K AA +P ++ + S+  S K
  S:     3 VKIRLTRMGKIRAPYYRIVVADARTKRDGRAIEEIGQYDPKQEPSLIRVNSERVAYWLSVGAQPTEPVKALLKVTGDWQRFTGEPAPPPMKTAPPKPDKKALFEAAAKEAAGEPRAEATTSRKRSGK 129
>gi|108796845|ref|YP_636455.1| ribosomal protein S16 [Staurastrum punctulatum] >gi|122233025|sp|Q32RS1|RR16_STAPU Chloroplast 30S ribosomal protein S16 >gi|61393613|gb|AAX45754.1| ribosomal protein S16 [Staurastrum punctulatum] (79 aa)
Score = 178, Expect = 6.2e-12, Identities = 36/79 (45%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR + P +RI+ ID R RRDG  +++VG Y+P +    +N    L+ L+ GAQP+DTV ++L++ GV++K
  S:     1 MVKLRLKRYGRKQQPTYRIIAIDVRCRRDGKALKEVGFYDPLKDKTQLNVPAILTLLQHGAQPTDTVSHILQKAGVFEK 79
>gi|78044705|ref|YP_360265.1| ribosomal protein S16 [Carboxydothermus hydrogenoformans Z-2901] >gi|109893870|sp|Q3AC69|RS16_CARHZ 30S ribosomal protein S16 >gi|77996820|gb|ABB15719.1| ribosomal protein S16 [Carboxydothermus hydrogenoformans Z-2901] (86 aa)
Score = 178, Expect = 6.2e-12, Identities = 42/79 (53%), Positives = 57/79 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKIRL R+G    PF+R+VV D+R+ RDG  I+++G Y+P +    V INEE AL WLKKGAQ ++T + L R+ GV +KF
  S:     3 VKIRLKRMGAKNNPFYRVVVADARSPRDGRVIDEIGYYDPVKQPAAVVINEEKALDWLKKGAQLTETARALFRKAGVLQKF 83
>gi|15806312|ref|NP_295018.1| 30S ribosomal protein S16 [Deinococcus radiodurans R1] >gi|14195209|sp|Q9RUT7|RS16_DEIRA 30S ribosomal protein S16 >gi|6459040|gb|AAF10863.1|AE001976_6 ribosomal protein S16 [Deinococcus radiodurans R1] (84 aa)
Score = 177, Expect = 8.2e-12, Identities = 41/76 (53%), Positives = 51/76 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP---FEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVKIRL+R G    P +RIVV D R  RDG YIE +G Y+P    E  + I+ E A  W+ +GAQP+DT + LLR QGV
  S:     1 MVKIRLSRFGSAHNPHYRIVVADVRRPRDGGYIESLGHYDPRKTSENFLKIDVERANHWIAQGAQPTDTARRLLRSQGV 79
>gi|38234109|ref|NP_939876.1| 30S ribosomal protein S16 [Corynebacterium diphtheriae NCTC 13129] >gi|54039375|sp|P62228|RS16_CORDI 30S ribosomal protein S16 >gi|38200371|emb|CAE50058.1| 30S ribosomal protein S16 [Corynebacterium diphtheriae] (157 aa)
Score = 176, Expect = 9.0e-12, Identities = 40/79 (50%), Positives = 54/79 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L RLG+ + P +R+VV D+R RRDG  IE +G YEP +   V+ I+ E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLQRLGKIRTPHYRVVVADARTRRDGKVIENIGIYEPKQDPSVIKIDSERAQYWLGVGAQPTEPVLALLKVTGDWQKF 83
>gi|116750419|ref|YP_847106.1| ribosomal protein S16 [Syntrophobacter fumaroxidans MPOB] >gi|116750461|ref|YP_847148.1| ribosomal protein S16 [Syntrophobacter fumaroxidans MPOB] >gi|116699483|gb|ABK18671.1| SSU ribosomal protein S16P [Syntrophobacter fumaroxidans MPOB] >gi|116699525|gb|ABK18713.1| SSU ribosomal protein S16P [Syntrophobacter fumaroxidans MPOB] (86 aa)
Score = 176, Expect = 9.6e-12, Identities = 38/74 (51%), Positives = 53/74 (71%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           V+IRL R GR K PF+RIVV  S A RDG +IE++GTY P      V I+ +    WL++GA+P+DTV+NL+++ G
  S:     3 VRIRLARGGRKKRPFYRIVVASSEAPRDGRFIERIGTYNPLPDTAEVKIDSDRLQYWLQQGAKPTDTVRNLIQKYG 78
>gi|25028516|ref|NP_738570.1| 30S ribosomal protein S16 [Corynebacterium efficiens YS-314] >gi|31076975|sp|Q8FP30|RS16_COREF 30S ribosomal protein S16 >gi|23493801|dbj|BAC18770.1| putative 30S ribosomal protein S16 [Corynebacterium efficiens YS-314] (168 aa)
Score = 176, Expect = 1.0e-11, Identities = 39/79 (49%), Positives = 55/79 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L RLG+ + P +R+VV D+R +RDG  IE +G YEP +   V+ I+ E A  WL  GAQP+++V  LL+  G W+KF
  S:     3 VKIKLQRLGKIRTPHYRVVVADARTKRDGKVIENIGIYEPKQDPSVIKIDSERAQYWLSVGAQPTESVAALLKVTGDWQKF 83
>gi|11466392|ref|NP_038395.1| ribosomal protein S16 [Mesostigma viride] >gi|13633852|sp|Q9MUR5|RR16_MESVI Chloroplast 30S ribosomal protein S16 >gi|7259535|gb|AAF43836.1|AF166114_48 ribosomal protein S16 [Mesostigma viride] (84 aa)
Score = 176, Expect = 1.0e-11, Identities = 36/80 (45%), Positives = 54/80 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR K PF+R++ IDSR RRDG  ++++G Y+P  G   ++    + +LK GAQ S+TV NLL++  V+ + 
  S:     1 MVKLRLKRYGRKKRPFYRVIAIDSRCRRDGKALKELGFYDPIAGKTQLDVPNIIFYLKAGAQTSETVGNLLQKAKVFNQL 80
>gi|37138275|sp|O07348|RS16_THEAQ 30S ribosomal protein S16 (88 aa)
Score = 176, Expect = 1.0e-11, Identities = 39/79 (49%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV---VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVKI ++R G    P +RIVV D R +RDGAYIEK+G Y+P +     + ++ E A  WL  GAQP+DT + LLR+ GV+++
  S:     1 MVKISVSRFGSKHNPHYRIVVTDVRRKRDGAYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 82
>gi|2500467|sp|P75131|RS16_MYCPN 30S ribosomal protein S16 >gi|1673845|gb|AAB95830.1| ribosomal protein S16 [Mycoplasma pneumoniae M129] (88 aa)
Score = 176, Expect = 1.1e-11, Identities = 39/77 (50%), Positives = 54/77 (70%)
  Q:     8 RLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           R+GR   P +RIV +DSR +RDG YI  +G   P   E    I+E +AL WL KGA+P+DTV++L  + G+WKKF++SK
  S:     2 RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESK 80
>gi|83944831|ref|ZP_00957197.1| ribosomal protein S16 [Oceanicaulis alexandrii HTCC2633] >gi|83851613|gb|EAP89468.1| ribosomal protein S16 [Oceanicaulis alexandrii HTCC2633] (140 aa)
Score = 176, Expect = 1.1e-11, Identities = 41/77 (53%), Positives = 54/77 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           VKIRL R G  K P++RIVV DSR  RDG +IEK+G Y P      E  ++++ E A  W+KKGAQPSD V   L++ GV++
  S:     3 VKIRLARGGAKKRPYYRIVVTDSRMPRDGRFIEKIGHYNPMLPKDHENRISVDTEKAAEWIKKGAQPSDRVARFLKDAGVYE 84
>gi|20807908|ref|NP_623079.1| 30S ribosomal protein S16 [Thermoanaerobacter tengcongensis MB4] >gi|22096103|sp|Q8R9X1|RS16_THETN 30S ribosomal protein S16 >gi|20516475|gb|AAM24683.1| Ribosomal protein S16 [Thermoanaerobacter tengcongensis MB4] (82 aa)
Score = 175, Expect = 1.4e-11, Identities = 40/75 (53%), Positives = 53/75 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           V+IRL R G  K PF+RIVV DSR+ RDG +I+++G Y P      + I+ E A  WL  GAQPSDTVK+L R++G+
  S:     3 VRIRLKRFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAEPAEIKIDVEKAKKWLSVGAQPSDTVKSLFRKEGI 79
>gi|118443168|ref|YP_878285.1| 30S ribosomal protein S16 [Clostridium novyi NT] >gi|166234415|sp|A0Q0Y3|RS16_CLONN 30S ribosomal protein S16 >gi|118133624|gb|ABK60668.1| ribosomal protein S16 [Clostridium novyi NT] (85 aa)
Score = 175, Expect = 1.4e-11, Identities = 40/79 (50%), Positives = 56/79 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKIRL R+G  K PF+R+VV DSR+ RDG ++E++G Y P      + I+EE A+ W+K GAQP+D VK L +E G+ +K 
  S:     3 VKIRLRRMGAKKAPFYRVVVADSRSPRDGRFVEEIGYYNPISEPKAIKIDEEKAIKWVKNGAQPTDVVKRLFKEAGIDEKL 83
>gi|108798933|ref|YP_639130.1| SSU ribosomal protein S16P [Mycobacterium sp. MCS] >gi|108769352|gb|ABG08074.1| SSU ribosomal protein S16P [Mycobacterium sp. MCS] (210 aa)
Score = 173, Expect = 1.9e-11, Identities = 41/79 (51%), Positives = 54/79 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +RIVV D+R RRDG  IE +G Y P E   ++ +N E A  WL  GAQP++ V  LL+  G W+KF
  S:    45 VKIKLTRLGKIRNPQYRIVVADARTRRDGRSIEVIGRYHPKEEPSLIELNSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 125
>gi|28493428|ref|NP_787589.1| 30S ribosomal protein S16 [Tropheryma whipplei str. Twist] >gi|54039443|sp|Q83G64|RS16_TROWT 30S ribosomal protein S16 >gi|28476469|gb|AAO44558.1| 30S ribosomal protein S16 [Tropheryma whipplei str. Twist] (148 aa)
Score = 173, Expect = 2.4e-11, Identities = 47/123 (38%), Positives = 69/123 (56%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSAS 124
           V+IRL R+G+ K PF+RIVV DSR +RDG  IE+VG Y P +    + I+   A  WL  GA+P+     LL+  G W +F        +E+  ++V++ V     K A  S+  S P A+  A+
  S:     3 VRIRLKRIGKVKRPFYRIVVADSRTKRDGKVIEQVGKYHPVQNPSFIEIDSPRAQYWLSVGAKPTQQALALLKLTGDWARF------CGEENPVSRVEQPVSIEAGKSAPKSRRRSAPVAAGEAT 121
>gi|108804226|ref|YP_644163.1| SSU ribosomal protein S16P [Rubrobacter xylanophilus DSM 9941] >gi|123177378|sp|Q1AW77|RS16_RUBXD 30S ribosomal protein S16 >gi|108765469|gb|ABG04351.1| ribosomal protein S16 [Rubrobacter xylanophilus DSM 9941] (85 aa)
Score = 172, Expect = 2.5e-11, Identities = 41/75 (54%), Positives = 55/75 (73%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           VKIRL R G    PF+RIVV D+R+ RDG +I++VGTY+P +    + ++ E A  WL+KGAQP+D V+NLLR  GV
  S:     3 VKIRLARHGAKGKPFYRIVVADARSPRDGKFIDRVGTYDPRKEPSEIKVDAEKAREWLRKGAQPTDQVRNLLRISGV 79
>gi|24982932|gb|AAN67084.1|AE016337_7 ribosomal protein S16 [Pseudomonas putida KT2440] (109 aa)
Score = 171, Expect = 3.3e-11, Identities = 34/73 (46%), Positives = 48/73 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V +SR  RDG ++E+VG + P     E  +++N+E    WL +GAQPS+ V  LL+E
  S:    27 MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERVGFFNPIAAGAEVKLSVNQERVTYWLSQGAQPSERVAQLLKE 103
>gi|119717484|ref|YP_924449.1| SSU ribosomal protein S16P [Nocardioides sp. JS614] >gi|119538145|gb|ABL82762.1| SSU ribosomal protein S16P [Nocardioides sp. JS614] (465 aa)
Score = 171, Expect = 3.4e-11, Identities = 45/112 (40%), Positives = 69/112 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKK-PEAKKAAASKP 113
           VKIRL RLG+ ++P +RIVV+D+R +RDG  IE++G Y P E    +++  + A  WL  GAQP++ V  +L+  G  +KF  +  Q      A   + +++   EA K AAS+P
  S:   285 VKIRLKRLGKVRVPQYRIVVVDARQKRDGRVIEEIGKYHPKEHPSYIDVVSDRAQYWLGVGAQPTEAVAKILKITGDLQKFKGTSGQEGTLKVAEPKRDKLEIFNEALKEAASEP 399
>gi|161484950|ref|NP_712572.2| 30S ribosomal protein S16 [Leptospira interrogans serovar Lai str. 56601] >gi|161621775|ref|YP_001514.2| 30S ribosomal protein S16 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|31076973|sp|Q8F3L1|RS16_LEPIN 30S ribosomal protein S16 >gi|54039377|sp|P62232|RS16_LEPIC 30S ribosomal protein S16 (88 aa)
Score = 171, Expect = 3.5e-11, Identities = 37/80 (46%), Positives = 51/80 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP--FEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R G    P +RIV  DSR+ RDG +++ VG Y P   +     N+E  L+WLK GAQP+ TV NL +  G+W ++
  S:     1 MVKLRLQRTGTKHDPHYRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFNKEKILTWLKNGAQPTGTVLNLFKNAGIWAEY 82
>gi|28572460|ref|NP_789240.1| 30S ribosomal protein S16 [Tropheryma whipplei TW08/27] >gi|54039444|sp|Q83I06|RS16_TROW8 30S ribosomal protein S16 >gi|28410592|emb|CAD66978.1| 30s ribosomal protein S16 [Tropheryma whipplei TW08/27] (148 aa)
Score = 171, Expect = 4.1e-11, Identities = 47/123 (38%), Positives = 68/123 (55%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSAS 124
           V+IRL R+G+ K PF+RIVV DSR +RDG  IE+VG Y P +    + I+   A  WL  GA+P+     LL+  G W +F        +E+  ++V++ V     K A  S   S P A+  A+
  S:     3 VRIRLKRIGKVKRPFYRIVVADSRTKRDGKVIEQVGKYHPVQNPSFIEIDSPRAQYWLSVGAKPTQQALALLKLTGDWARF------CGEENPVSRVEQPVSIEAGKSAPKSCRRSAPVAAGEAT 121
>gi|24196149|gb|AAN49590.1|AE011407_13 ribosomal protein S16 [Leptospira interrogans serovar Lai str. 56601] >gi|45600667|gb|AAS70151.1| 30S ribosomal protein S16 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (114 aa)
Score = 170, Expect = 4.9e-11, Identities = 36/80 (45%), Positives = 51/80 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP--FEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           +VK+RL R G    P +RIV  DSR+ RDG +++ VG Y P   +     N+E  L+WLK GAQP+ TV NL +  G+W ++
  S:    27 LVKLRLQRTGTKHDPHYRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFNKEKILTWLKNGAQPTGTVLNLFKNAGIWAEY 108
>gi|118467618|ref|YP_886775.1| 30S ribosomal protein S16 [Mycobacterium smegmatis str. MC2 155] >gi|166201317|sp|A0QV37|RS16_MYCS2 30S ribosomal protein S16 >gi|118168905|gb|ABK69801.1| 30S ribosomal protein S16 [Mycobacterium smegmatis str. MC2 155] (156 aa)
Score = 170, Expect = 5.1e-11, Identities = 40/79 (50%), Positives = 54/79 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +RI+V D+R RRDG  IE +G Y P E   ++ I+ E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRIIVADARTRRDGRAIEVIGRYHPKEEPSLIQIDSERAQYWLGVGAQPTEPVLALLKITGDWQKF 83
>gi|86606915|ref|YP_475678.1| ribosomal protein S16 [Synechococcus sp. JA-3-3Ab] >gi|109894810|sp|Q2JSG0|RS16_SYNJA 30S ribosomal protein S16 >gi|86555457|gb|ABD00415.1| ribosomal protein S16 [Synechococcus sp. JA-3-3Ab] (155 aa)
Score = 170, Expect = 5.3e-11, Identities = 43/124 (34%), Positives = 66/124 (53%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSAS 124
           MVK+RL R G+ + P +RIV I+S+ARR+G  +E++G Y P      +     L WL+ GAQP+DTV +LLR+ G+++           +     V   ++ P   K  A  P   PS  + A+
  S:     1 MVKLRLKRYGKRRQPTYRIVAIESKARREGRPLEELGYYNPRTKETVLETAGLLKWLRCGAQPTDTVDSLLRKAGIYEML---------KAGEGGVVAAIRIPAIAKPEAGIPDPAPSTEEPAA 115
>gi|15610046|ref|NP_217425.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Rv] >gi|15842452|ref|NP_337489.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis CDC1551] >gi|31794085|ref|NP_856578.1| 30S ribosomal protein S16 [Mycobacterium bovis AF2122/97] >gi|121638790|ref|YP_979014.1| 30S ribosomal protein S16 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662753|ref|YP_001284276.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Ra] >gi|148824098|ref|YP_001288852.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis F11] >gi|167969538|ref|ZP_02551815.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Ra] >gi|194545052|ref|YP_002080081.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis C] >gi|166201316|sp|A1KMQ3|RS16_MYCBP 30S ribosomal protein S16 >gi|166201320|sp|A5U6R4|RS16_MYCTA 30S ribosomal protein S16 >gi|54039399|sp|P66436|RS16_MYCBO 30S ribosomal protein S16 >gi|54042136|sp|P66435|RS16_MYCTU 30S ribosomal protein S16 >gi|1403431|emb|CAA98346.1| PROBABLE 30S RIBOSOMAL PROTEIN S16 RPSP [Mycobacterium tuberculosis H37Rv] >gi|13882756|gb|AAK47303.1| ribosomal protein S16 [Mycobacterium tuberculosis CDC1551] >gi|31619680|emb|CAD96620.1| PROBABLE 30S RIBOSOMAL PROTEIN S16 RPSP [Mycobacterium bovis AF2122/97] >gi|121494438|emb|CAL72919.1| Probable 30S ribosomal protein S16 rpsP [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124602059|gb|EAY61069.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis C] >gi|134151061|gb|EBA43106.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis str. Haarlem] >gi|148506905|gb|ABQ74714.1| 30S ribosomal protein S16 [Mycobacterium tuberculosis H37Ra] >gi|148722625|gb|ABR07250.1| 30S ribosomal protein S16 rpsP [Mycobacterium tuberculosis F11] (162 aa)
Score = 170, Expect = 5.3e-11, Identities = 40/79 (50%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +R+ V D+R RRDG  IE +G Y P E   ++ IN E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|119368481|ref|YP_913169.1| ribosomal protein S16 [Gossypium barbadense] >gi|125987689|sp|A0ZZ17|RR16_GOSBA Chloroplast 30S ribosomal protein S16 >gi|119224843|dbj|BAF41229.1| ribosomal protein S16 [Gossypium barbadense] (88 aa)
Score = 170, Expect = 5.4e-11, Identities = 36/80 (45%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIVVID R+RR+G  + KVG Y+P      +N    L +L+KGAQP+ TV ++L++ GV+ + 
  S:     1 MVKLRLKRCGRKQRAVYRIVVIDVRSRREGRDLRKVGFYDPINNQTYLNVPAILYFLEKGAQPTATVHDILKKAGVFTEL 80
>gi|167040349|ref|YP_001663334.1| 30S ribosomal protein S16 [Thermoanaerobacter sp. X514] >gi|166854589|gb|ABY92998.1| ribosomal protein S16 [Thermoanaerobacter sp. X514] (86 aa)
Score = 170, Expect = 5.4e-11, Identities = 39/75 (52%), Positives = 53/75 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           V+IRL R G  K PF+RIVV DSR+ RDG +I+++G Y P      + I+ E A  WL  GAQPSDTVK+L +++G+
  S:     3 VRIRLKRFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAQPAEIKIDVEKAKKWLSVGAQPSDTVKSLFKKEGI 79
>gi|62906872|sp|P80379|RS16_THETH 30S ribosomal protein S16 >gi|14278025|pdb|1GIX|S Chain S, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826135|pdb|1JGO|S Chain S, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826160|pdb|1JGP|S Chain S, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826185|pdb|1JGQ|S Chain S, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|28373714|pdb|1ML5|S Chain S, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 >gi|12056104|emb|CAC21226.1| ribosomal protein S16 [Thermus thermophilus] (91 aa)
Score = 169, Expect = 5.5e-11, Identities = 41/79 (51%), Positives = 57/79 (72%)
  Q:     1 MVKIRLTRLG-RHK--LPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV---VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVKIRL R G +H    P +RIVV D+R +RDG YIEK+G Y+P +     + ++ E A  WL  GAQP+DT + LLR+ GV+++
  S:     1 MVKIRLARFGSKHNPHYPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQ 85
>gi|88802685|ref|ZP_01118212.1| 30S ribosomal protein S16 [Polaribacter irgensii 23-P] >gi|88781543|gb|EAR12721.1| 30S ribosomal protein S16 [Polaribacter irgensii 23-P] (180 aa)
Score = 169, Expect = 5.6e-11, Identities = 40/78 (51%), Positives = 55/78 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R G+   PF+ IV  D+RA+RDG Y+EK+GTY P     V+++N + A+ WL+ GA P+DTVKN+L  +G   K
  S:     3 VKIRLQRHGKKGKPFYWIVAADARAKRDGKYLEKIGTYNPNTNPAVIDLNIDKAVEWLQNGALPTDTVKNILSYKGAMLK 82
>gi|150390507|ref|YP_001320556.1| 30S ribosomal protein S16 [Alkaliphilus metalliredigens QYMF] >gi|167011162|sp|A6TRS9|RS16_ALKMQ 30S ribosomal protein S16 >gi|149950369|gb|ABR48897.1| ribosomal protein S16 [Alkaliphilus metalliredigens QYMF] (81 aa)
Score = 169, Expect = 6.3e-11, Identities = 41/77 (53%), Positives = 53/77 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           VKIRL R+G  K PF+RIVV D+RA RDG +IE++G Y P      + I+ E A  WL  GAQP+DTVK L ++ G+ K
  S:     3 VKIRLKRMGAKKRPFYRIVVADARAPRDGRFIEEIGYYNPVSEPKEIKIDGEKAEKWLGNGAQPTDTVKYLFKKNGIIK 81
>gi|15895032|ref|NP_348381.1| ribosomal protein S16 [Clostridium acetobutylicum ATCC 824] >gi|20140172|sp|Q97I97|RS16_CLOAB 30S ribosomal protein S16 >gi|15024724|gb|AAK79721.1|AE007684_9 Ribosomal protein S16 [Clostridium acetobutylicum ATCC 824] (81 aa)
Score = 169, Expect = 6.5e-11, Identities = 42/79 (53%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN--INEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVKIRL R+G  K PF+RIVV DSR+ RDG +IE++G Y P    V   ++ +   +W+K GAQPS+TVK LL + GV  K
  S:     1 MVKIRLKRMGAKKAPFYRIVVADSRSPRDGKFIEELGYYNPTTEPVTFKVDADKVNAWMKNGAQPSETVKKLLDKSGVTTK 81
>gi|118463389|ref|YP_882936.1| 30S ribosomal protein S16 [Mycobacterium avium 104] >gi|166201315|sp|A0QJ48|RS16_MYCA1 30S ribosomal protein S16 >gi|118164676|gb|ABK65573.1| 30S ribosomal protein S16 [Mycobacterium avium 104] (170 aa)
Score = 169, Expect = 6.7e-11, Identities = 41/79 (51%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +RI V D+R RRDG  IE +G Y P E   ++ IN E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRIAVADARTRRDGRSIEIIGRYHPKEDPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|189346908|ref|YP_001943437.1| ribosomal protein S16 [Chlorobium limicola DSM 245] >gi|189341055|gb|ACD90458.1| ribosomal protein S16 [Chlorobium limicola DSM 245] (133 aa)
Score = 168, Expect = 7.2e-11, Identities = 40/76 (52%), Positives = 54/76 (71%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVKIRL R GR KLPF++IV  DSRA RDG ++E VG Y+P      V I ++    W++ GAQP+DTV++L+R  G+
  S:     1 MVKIRLKRTGRKKLPFYQIVAADSRAPRDGKFLEIVGHYQPTAKPHAVTIKKDRVSYWMQTGAQPTDTVRSLIRSTGL 78
>gi|41409075|ref|NP_961911.1| 30S ribosomal protein S16 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|54039379|sp|P62234|RS16_MYCPA 30S ribosomal protein S16 >gi|41397434|gb|AAS05294.1| RpsP [Mycobacterium avium subsp. paratuberculosis K-10] (171 aa)
Score = 168, Expect = 7.5e-11, Identities = 41/79 (51%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +RI V D+R RRDG  IE +G Y P E   ++ IN E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRIAVADARTRRDGRSIEIIGRYHPKEDPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|50842922|ref|YP_056149.1| 30S ribosomal protein S16 [Propionibacterium acnes KPA171202] >gi|81611485|sp|Q6A7S4|RS16_PROAC 30S ribosomal protein S16 >gi|50840524|gb|AAT83191.1| 30S ribosomal protein S16 [Propionibacterium acnes KPA171202] (147 aa)
Score = 168, Expect = 8.3e-11, Identities = 47/126 (37%), Positives = 70/126 (55%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKT 128
           KIRL RLG+ + P +R+VV+DSRA+RDG  IE++G Y P     V+ I+ E    WL  GAQP++ V  LL+  G W+KF         + + + VK + ++P       +  A    A + A  KK+
  S:     4 KIRLKRLGKIRTPHYRVVVMDSRAKRDGRAIEEIGQYHPKADPSVIVIDSERVQYWLGVGAQPTEAVVALLKRTGDWQKFTG-------DTSPSGVKPQPERPNKDDLFNAALAEADEAPREAITKKS 124
>gi|114804247|ref|YP_762243.1| ribosomal protein S16 [Morus indica] >gi|122166823|sp|Q09X35|RR16_MORIN Chloroplast 30S ribosomal protein S16 >gi|78100299|gb|ABB20940.1| ribosomal protein S16 [Morus indica] (89 aa)
Score = 168, Expect = 9.2e-11, Identities = 37/92 (40%), Positives = 59/92 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHN 92
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N  + L +L+KGAQP+ TV ++ ++ GV   FM+ ++  + + N
  S:     1 MVKLRLKRCGRRQRAIYRIVAIDVRSRREGRALRKVGFYDPIKNQTYLNVPVILYFLEKGAQPTGTVHDISKKAGV---FMELRLNHQTKFN 89
>gi|34763934|ref|ZP_00144832.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886291|gb|EAA23569.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (87 aa)
Score = 167, Expect = 1.0e-10, Identities = 41/84 (48%), Positives = 59/84 (70%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE-GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           M+K+RLTRLG  K P +RIV +++ ++RDG  +  +G Y P E   V + EE  L++LK GAQP+ TVK++L + GVW KF +SK
  S:     1 MLKLRLTRLGDKKRPSYRIVAMEALSKRDGGAVAYLGNYFPLEDSRVVLKEEEILNFLKNGAQPTRTVKSILVKAGVWAKFEESK 85
>gi|19704724|ref|NP_604286.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22096106|sp|Q8RDV8|RS16_FUSNN 30S ribosomal protein S16 >gi|19715044|gb|AAL95585.1| SSU ribosomal protein S16P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (87 aa)
Score = 167, Expect = 1.1e-10, Identities = 41/84 (48%), Positives = 59/84 (70%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE-GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           M+K+RLTRLG  K P +RIV +++ ++RDG  I  +G Y P E   V + EE  L++LK GAQP+ TVK++L + G+W KF +SK
  S:     1 MLKLRLTRLGDKKRPSYRIVAMEALSKRDGGAIAYLGNYFPLEDSKVVLKEEEILNYLKNGAQPTRTVKSILVKAGLWAKFEESK 85
>gi|34541696|ref|NP_906175.1| 30S ribosomal protein S16 [Porphyromonas gingivalis W83] >gi|50403610|sp|Q7MT66|RS16_PORGI 30S ribosomal protein S16 >gi|34398014|gb|AAQ67074.1| ribosomal protein S16 [Porphyromonas gingivalis W83] (192 aa)
Score = 167, Expect = 1.1e-10, Identities = 38/74 (51%), Positives = 52/74 (70%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           KIRL R GR    F++IVV DSRA RDG +IE++G+Y P      +++N E AL W+  GAQP+DT +N+L  +GV
  S:     4 KIRLQRHGRKGYAFYKIVVADSRAPRDGKFIERIGSYNPNTNPATIDLNFERALYWIGVGAQPTDTARNILSREGV 79
>gi|11497506|ref|NP_054914.1| ribosomal protein S16 [Spinacia oleracea] >gi|19857926|sp|P28807|RR16_SPIOL Chloroplast 30S ribosomal protein S16 >gi|188036217|pdb|3BBN|P Chain P, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. >gi|7636087|emb|CAB88707.1| ribosomal protein S16 [Spinacia oleracea] (88 aa)
Score = 166, Expect = 1.3e-10, Identities = 36/80 (45%), Positives = 55/80 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  ++KVG Y+P +    +N    L +L+KGAQP++TV ++L+   V+K+F
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLQKVGFYDPIKSQTYLNVPAILDFLEKGAQPTETVYDILKRAEVFKEF 80
>gi|134299901|ref|YP_001113397.1| ribosomal protein S16 [Desulfotomaculum reducens MI-1] >gi|172044315|sp|A4J669|RS16_DESRM 30S ribosomal protein S16 >gi|134052601|gb|ABO50572.1| SSU ribosomal protein S16P [Desulfotomaculum reducens MI-1] (89 aa)
Score = 166, Expect = 1.3e-10, Identities = 42/75 (56%), Positives = 54/75 (72%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           VKIRL R+G  K PF+RIVV DSR+ RDG +IE++G Y+P +    V I+E  A  WLKKGAQ SDT K+L  + G+
  S:     3 VKIRLRRMGAKKNPFYRIVVADSRSPRDGRFIEEIGYYDPIKKPAEVKIDEAKAQDWLKKGAQLSDTAKSLFVKAGI 79
>gi|54026128|ref|YP_120370.1| 30S ribosomal protein S16 [Nocardia farcinica IFM 10152] >gi|81602540|sp|Q5YS35|RS16_NOCFA 30S ribosomal protein S16 >gi|54017636|dbj|BAD59006.1| putative ribosomal protein S16 [Nocardia farcinica IFM 10152] (144 aa)
Score = 166, Expect = 1.3e-10, Identities = 38/79 (48%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           V+I+LTRLG+ + P +R+VV D+R RRDG  IE +G Y P E   ++ I+ E    WL  GAQP++ V+ LL   G W+KF
  S:     3 VRIKLTRLGKIRNPQYRVVVADARTRRDGRAIESIGKYHPKEEPSLIEIDSERVQYWLSVGAQPTEPVQRLLEITGDWQKF 83
>gi|116671029|ref|YP_831962.1| SSU ribosomal protein S16P [Arthrobacter sp. FB24] >gi|116611138|gb|ABK03862.1| SSU ribosomal protein S16P [Arthrobacter sp. FB24] (157 aa)
Score = 166, Expect = 1.4e-10, Identities = 37/79 (46%), Positives = 55/79 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKIRL R G+ + P++RIVV+D+R++RDG  IE++G Y P E    + ++ + A  WL  GAQPS+ V  +L+  G W+KF
  S:    20 VKIRLKRFGKMRAPYYRIVVMDARSKRDGRAIEEIGKYHPTEEPSYIEVDTDRAQYWLGVGAQPSEQVAAILKITGDWQKF 100
>gi|118617621|ref|YP_905953.1| 30S ribosomal protein S16 RpsP [Mycobacterium ulcerans Agy99] >gi|183981812|ref|YP_001850103.1| 30S ribosomal protein S16 RpsP [Mycobacterium marinum M] >gi|166201321|sp|A0PQ63|RS16_MYCUA 30S ribosomal protein S16 >gi|118569731|gb|ABL04482.1| 30S ribosomal protein S16 RpsP [Mycobacterium ulcerans Agy99] >gi|183175138|gb|ACC40248.1| 30S ribosomal protein S16 RpsP [Mycobacterium marinum M] (161 aa)
Score = 166, Expect = 1.4e-10, Identities = 41/79 (51%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +RI V D+R RRDG  IE +G Y P E   ++ IN E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRIAVADARTRRDGRSIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKF 83
>gi|111023494|ref|YP_706466.1| 30S ribosomal protein S16 [Rhodococcus sp. RHA1] >gi|123045452|sp|Q0S2C8|RS16_RHOSR 30S ribosomal protein S16 >gi|110823024|gb|ABG98308.1| 30S ribosomal protein S16 [Rhodococcus sp. RHA1] (153 aa)
Score = 166, Expect = 1.4e-10, Identities = 39/79 (49%), Positives = 55/79 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +RIVV DSR RR+G  IE +G Y P E   ++ ++ E A  WL  GAQP++ V+ +L+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRIVVADSRTRRNGRAIETIGKYHPKEEPSLIEVDSERAQYWLGVGAQPTEPVEAILKITGDWQKF 83
>gi|29829186|ref|NP_823820.1| 30S ribosomal protein S16 [Streptomyces avermitilis MA-4680] >gi|54039441|sp|Q82JW0|RS16_STRAW 30S ribosomal protein S16 >gi|29606292|dbj|BAC70355.1| putative ribosomal protein S16 [Streptomyces avermitilis MA-4680] (142 aa)
Score = 166, Expect = 1.4e-10, Identities = 37/79 (46%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L RLG+ + P +RIVV DSR RRDG  IE++G Y P +    + ++ E    WL  GAQP++ V  +L++ G W+KF
  S:     3 VKIKLKRLGKIRSPHYRIVVADSRTRRDGRAIEEIGLYHPVQNPSRMEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKF 83
>gi|115531896|ref|YP_784052.1| ribosomal protein S16 [Pelargonium x hortorum] >gi|122164298|sp|Q06FX9|RR16_PELHO Chloroplast 30S ribosomal protein S16 >gi|112382050|gb|ABI17243.1| ribosomal protein S16 [Pelargonium x hortorum] (91 aa)
Score = 166, Expect = 1.5e-10, Identities = 36/78 (46%), Positives = 52/78 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R GR K   +RIV ID R+RR+G  + KVG Y+P     ++N    L ++++GAQP+ TV +LL++ GV K
  S:     1 MVKLRLKRCGRKKRAVYRIVAIDVRSRREGRDLRKVGLYDPINNKTHLNVPAILYFIERGAQPTRTVNDLLKKAGVLK 78
>gi|68164785|ref|YP_247581.1| ribosomal protein S16 [Cucumis sativus] >gi|67511380|emb|CAJ00740.1| ribosomal protein S16 [Cucumis sativus] >gi|115432787|gb|ABI97400.1| ribosomal protein S16 [Cucumis sativus] (84 aa)
Score = 166, Expect = 1.5e-10, Identities = 34/80 (42%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RI+ ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++L++ GV+ + 
  S:     1 MVKLRLKRCGRKQRAVYRIIAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDILKKAGVFTEL 80
>gi|19553255|ref|NP_601257.1| 30S ribosomal protein S16 [Corynebacterium glutamicum ATCC 13032] >gi|62390891|ref|YP_226293.1| 30S ribosomal protein S16 [Corynebacterium glutamicum ATCC 13032] >gi|145296018|ref|YP_001138839.1| 30S ribosomal protein S16 [Corynebacterium glutamicum R] >gi|166234417|sp|A4QFC1|RS16_CORGB 30S ribosomal protein S16 >gi|23822126|sp|Q8NNX3|RS16_CORGL 30S ribosomal protein S16 >gi|21324824|dbj|BAB99447.1| Ribosomal protein S16 [Corynebacterium glutamicum ATCC 13032] >gi|41326230|emb|CAF20392.1| 30S RIBOSOMAL PROTEIN S16 [Corynebacterium glutamicum ATCC 13032] >gi|140845938|dbj|BAF54937.1| hypothetical protein [Corynebacterium glutamicum R] (165 aa)
Score = 166, Expect = 1.5e-10, Identities = 49/126 (38%), Positives = 69/126 (54%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKK 127
           VKI+L RLG+ + P +R+V+ D+R +RDG  IE +G YEP     V+ IN E A  WL  GAQP++ V  LL+  G W+KF   K     E      + +  K E    A S+  + P+A     +KK
  S:     3 VKIKLQRLGKIRTPHYRVVIADARTKRDGKVIENIGIYEPKAEPSVIKINSERAQHWLSVGAQPTEAVAALLKVTGDWQKF---KGIEGAEGTLRVAEPKPSKLELFNQALSEANNGPTAEAITEKKK 127
>gi|116617090|ref|YP_817464.1| ribosomal protein S16 [Coffea arabica] >gi|122153603|sp|A0A317|RR16_COFAR Chloroplast 30S ribosomal protein S16 >gi|116242146|gb|ABJ89661.1| ribosomal protein S16 [Coffea arabica] (88 aa)
Score = 166, Expect = 1.5e-10, Identities = 34/86 (39%), Positives = 59/86 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQ 86
           M+K+RL R GR +   FRIV ID R+RR+G  ++KVG Y+P +    +N    L +L++GAQP+ TV+++ ++ GV+K+   ++++
  S:     1 MLKLRLKRCGRKQRAVFRIVAIDVRSRREGKDLQKVGFYDPIKNQTYLNVTAILYFLEQGAQPTGTVQDIFKKAGVFKELRPNQMK 86
>gi|56416411|ref|YP_153485.1| 30S ribosomal protein S16 [Anaplasma marginale str. St. Maries] >gi|81599208|sp|Q5PBU9|RS16_ANAMM 30S ribosomal protein S16 >gi|56387643|gb|AAV86230.1| 30S ribosomal protein S16 [Anaplasma marginale str. St. Maries] (89 aa)
Score = 165, Expect = 1.8e-10, Identities = 37/72 (51%), Positives = 48/72 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           VKIRL RLG  K PF+R+VV DSR +RDG +IE VG Y+P       G + I+ E    WL  GAQP+D V   +++
  S:     3 VKIRLMRLGAKKKPFYRVVVSDSRVQRDGKFIEHVGFYDPMVPCGEPGFLKIDAERLSYWLGVGAQPTDRVSWFIKK 79
>gi|91208884|ref|YP_538917.1| ribosomal protein S16 [Gossypium hirsutum] >gi|122245017|sp|Q2L8Y7|RR16_GOSHI Chloroplast 30S ribosomal protein S16 >gi|85687398|gb|ABC73610.1| ribosomal protein S16 [Gossypium hirsutum] (88 aa)
Score = 165, Expect = 1.8e-10, Identities = 35/80 (43%), Positives = 52/80 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P      +N    L +L+KGAQP+ TV ++L++ GV+ + 
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPINNQTYLNVPAILYFLEKGAQPTATVHDILKKAGVFTEL 80
>gi|75755641|ref|YP_319747.1| ribosomal protein S16 [Acorus calamus] >gi|161622292|ref|YP_001586164.1| ribosomal protein S16 [Acorus americanus] >gi|74381691|emb|CAI53776.1| ribosomal protein S16 [Acorus calamus] >gi|156573655|gb|ABU85161.1| ribosomal protein S16 [Acorus americanus] >gi|160369835|gb|ABX38726.1| ribosomal protein S16 [Acorus americanus] (86 aa)
Score = 165, Expect = 1.8e-10, Identities = 35/86 (40%), Positives = 59/86 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQ 86
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N  + L++L+KGAQP++TV ++L++  V+K+   ++ +
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSRREGRDLCKVGFYDPIKNQTYLNVPVILNFLEKGAQPTETVHDILKKAEVFKELQGNQTK 86
>gi|110636543|ref|YP_676750.1| 30S ribosomal protein S16 [Cytophaga hutchinsonii ATCC 33406] >gi|123059068|sp|Q11YV6|RS16_CYTH3 30S ribosomal protein S16 >gi|110279224|gb|ABG57410.1| SSU ribosomal protein S16P [Cytophaga hutchinsonii ATCC 33406] (175 aa)
Score = 165, Expect = 2.0e-10, Identities = 50/131 (38%), Positives = 76/131 (58%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVW-KKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTVSKK 132
           V+IRL++ GR KL  + IVV DSR+ RDG +I+K+GTY P      V +N+E+   W+ KGA P+DT + +L E+GV  KK +   V      +   + +EV   +     ++K ASK S + +   KK   +K
  S:     3 VRIRLSKRGRRKLALYDIVVSDSRSPRDGKFIQKLGTYNPNTNPATVVLNDELTFDWVMKGALPTDTARTILSERGVMLKKHLQVGV------DKGAITQEVADQKFSAWVSNKEASKTSNANALVSKKEADRK 130
>gi|108802625|ref|YP_636281.1| ribosomal protein S16 [Eucalyptus globulus subsp. globulus] >gi|122233508|sp|Q49L16|RR16_EUCGG Chloroplast 30S ribosomal protein S16 >gi|60460791|gb|AAX21011.1| ribosomal protein S16 [Eucalyptus globulus subsp. globulus] (77 aa)
Score = 164, Expect = 2.3e-10, Identities = 37/76 (48%), Positives = 51/76 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVK+RL R GR K P +RIV ID R+RR+G  + KVG Y+P      +N    L +L+KGAQP+ TV ++L++ GV
  S:     1 MVKLRLKRCGR-KQPVYRIVAIDVRSRREGRDLRKVGFYDPINNQTYLNIPAILFFLEKGAQPTGTVYDILKKAGV 75
>gi|154486609|ref|ZP_02028016.1| hypothetical protein BIFADO_00426 [Bifidobacterium adolescentis L2-32] >gi|154084472|gb|EDN83517.1| hypothetical protein BIFADO_00426 [Bifidobacterium adolescentis L2-32] (140 aa)
Score = 164, Expect = 2.4e-10, Identities = 35/72 (48%), Positives = 49/72 (68%)
  Q:     9 LGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           +G+    F+R+V++DSR +RDG  IE++GTY P      +NIN E A  WL  GAQP++ V NLL+  G W+KF
  S:     1 MGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQPSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKF 74
>gi|21223946|ref|NP_629725.1| 30S ribosomal protein S16 [Streptomyces coelicolor A3(2)] >gi|6094159|sp|O69879|RS16_STRCO 30S ribosomal protein S16 >gi|3191984|emb|CAA19383.1| 30S ribosomal protein S16 [Streptomyces coelicolor A3(2)] (139 aa)
Score = 164, Expect = 2.4e-10, Identities = 38/79 (48%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L RLG+ + P +RIVV DSR RRDG  IE++G Y P     V+ ++ E    WL  GAQP++ V  +L++ G W+KF
  S:     3 VKIKLKRLGKIRSPHYRIVVADSRTRRDGRAIEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKF 83
>gi|15827853|ref|NP_302116.1| 30S ribosomal protein S16 [Mycobacterium leprae TN] >gi|3122810|sp|O33014|RS16_MYCLE 30S ribosomal protein S16 >gi|2251155|emb|CAB10626.1| 30s ribosomal protein s16 [Mycobacterium leprae] >gi|13093405|emb|CAC30569.1| 30S ribosomal protein S16 [Mycobacterium leprae] (160 aa)
Score = 164, Expect = 2.6e-10, Identities = 38/79 (48%), Positives = 54/79 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+LTRLG+ + P +R++V D+R RRDG  IE +G Y P E   +++IN E    WL  GA+P++ V  LL+  G W+KF
  S:     3 VKIKLTRLGKIRNPQYRVIVADARTRRDGRSIEVIGRYHPKEEPSLIDINSERTQYWLSVGAKPTEPVLKLLKITGDWQKF 83
>gi|62422971|ref|ZP_00378146.1| COG0228: Ribosomal protein S16 [Brevibacterium linens BL2] (136 aa)
Score = 163, Expect = 3.0e-10, Identities = 35/71 (49%), Positives = 48/71 (67%)
  Q:     9 LGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +G+ + PF+R+VV DSR RRDG  IE++G Y P     V+ I+ E A  WL  GAQP+D V+ LL+  G W+K
  S:     1 MGKIRAPFYRVVVADSRTRRDGKAIEQIGIYHPTRNPSVIEIDSERAQHWLSVGAQPTDQVRTLLKLTGDWQK 73
>gi|116328323|ref|YP_798043.1| 30S ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331049|ref|YP_800767.1| 30S ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281201|sp|Q04SW1|RS16_LEPBJ 30S ribosomal protein S16 >gi|122283888|sp|Q050Y5|RS16_LEPBL 30S ribosomal protein S16 >gi|116121067|gb|ABJ79110.1| 30S Ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124738|gb|ABJ76009.1| 30S Ribosomal protein S16 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (88 aa)
Score = 163, Expect = 3.1e-10, Identities = 35/80 (43%), Positives = 51/80 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP--FEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R G    P +RIV  D RA RDG +++ VG Y P   +     ++E  L+WLK GA+P++TV NL +  G+W ++
  S:     1 MVKLRLQRTGTKHDPHYRIVAADGRAPRDGKFVDIVGHYHPAQIKEQTTFHKEKILTWLKNGARPTETVLNLFKSAGIWAEY 82
>gi|68053015|sp|Q589B0|RR16_SILLA Chloroplast 30S ribosomal protein S16 >gi|62149325|dbj|BAD93467.1| ribosomal protein S16 [Silene latifolia] (88 aa)
Score = 163, Expect = 3.4e-10, Identities = 35/80 (43%), Positives = 55/80 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  ++KVG Y+P +    +N    L +++KGAQP++TV ++L+   V+K+F
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPAILDFIQKGAQPTETVYDILKRAEVFKEF 80
>gi|86130778|ref|ZP_01049377.1| 30S ribosomal protein S16 [Cellulophaga sp. MED134] >gi|85818189|gb|EAQ39349.1| 30S ribosomal protein S16 [Dokdonia donghaensis MED134] (172 aa)
Score = 162, Expect = 4.0e-10, Identities = 51/125 (40%), Positives = 79/125 (63%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQGVW---------KKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQK 126
           VKIRL R G+   PF+ IV  D+RA+RDG Y+EK+GTY P      I+ ++  A++WL+ GAQP++T K LL  +G           +K   ++ Q++++ NA  ++++  K  AKK   SK   K  A   A++K
  S:     3 VKIRLQRHGKKGKPFYWIVAADARAKRDGKYLEKIGTYNPNTNPAQIDLDVDGAVTWLQNGAQPTETAKRLLSYKGAMLKNHLAGGVRKGALTEEQAEEKFNA-WLEEKASKVAAKKGDLSKAEEKAKADALAAEK 137
>gi|85860174|ref|YP_462376.1| SSU ribosomal protein S16P [Syntrophus aciditrophicus SB] >gi|109894809|sp|Q2LVU9|RS16_SYNAS 30S ribosomal protein S16 >gi|85723265|gb|ABC78208.1| SSU ribosomal protein S16P [Syntrophus aciditrophicus SB] (83 aa)
Score = 162, Expect = 4.1e-10, Identities = 39/75 (52%), Positives = 53/75 (70%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           VKIRL R+G  K PF+RIVV DS + RDG ++E VG Y+P +    VN+ E   L WL KGA+P+ TV  LL+++G+
  S:     3 VKIRLARMGAKKKPFYRIVVSDSESPRDGRFLEIVGNYDPGKDPAEVNVKESRLLEWLSKGAKPTLTVSQLLQKKGI 79
>gi|114329638|ref|YP_740457.1| ribosomal protein S16 [Citrus sinensis] >gi|122166201|sp|Q09MJ6|RR16_CITSI Chloroplast 30S ribosomal protein S16 >gi|113952604|gb|ABI49002.1| ribosomal protein S16 [Citrus sinensis] (88 aa)
Score = 162, Expect = 4.6e-10, Identities = 34/79 (43%), Positives = 51/79 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P     ++N    L +L KGAQP+ TV ++ ++ GV+ +
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDGRSRREGRDLRKVGFYDPINNQTHLNVPAILYFLAKGAQPTGTVHDISQKAGVFTE 79
>gi|146297159|ref|YP_001180930.1| ribosomal protein S16 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166234405|sp|A4XLF4|RS16_CALS8 30S ribosomal protein S16 >gi|145410735|gb|ABP67739.1| SSU ribosomal protein S16P [Caldicellulosiruptor saccharolyticus DSM 8903] (81 aa)
Score = 161, Expect = 5.1e-10, Identities = 38/75 (50%), Positives = 52/75 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQGV 76
           V+IRL R+G    PF+RIVV DSR+ RDG  I+++G Y P +   +I  ++  A  WL  GAQP+DTVK LL++ GV
  S:     3 VRIRLKRMGAKNNPFYRIVVADSRSPRDGKTIDEIGYYNPLKNPADIKVDVEKAKKWLSNGAQPTDTVKILLKKVGV 79
>gi|88606858|ref|YP_504687.1| 30S ribosomal protein S16 [Anaplasma phagocytophilum HZ] >gi|109893861|sp|Q2GLR4|RS16_ANAPZ 30S ribosomal protein S16 >gi|88597921|gb|ABD43391.1| ribosomal protein S16 [Anaplasma phagocytophilum HZ] (96 aa)
Score = 161, Expect = 5.2e-10, Identities = 37/72 (51%), Positives = 47/72 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           VKIRL RLG  K PF+RIVV DSR +RDG  IE++G Y P       G + +N E    WL  GAQP+D V   +++
  S:     3 VKIRLMRLGAKKKPFYRIVVADSRVQRDGKCIEQIGFYNPMVECGAPGFLKVNAERLGYWLGVGAQPTDRVSWFIKK 79
>gi|108796743|ref|YP_636478.1| ribosomal protein S16 [Zygnema circumcarinatum] >gi|122233022|sp|Q32RP8|RR16_ZYGCR Chloroplast 30S ribosomal protein S16 >gi|61393727|gb|AAX45869.1| ribosomal protein S16 [Zygnema circumcarinatum] (87 aa)
Score = 161, Expect = 5.8e-10, Identities = 30/79 (37%), Positives = 56/79 (70%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR + P +RI+ ID ++RR G  +++VG Y+P +   +++    ++++++GAQP+DTV ++L   GV+++
  S:     1 MVKLRLKRYGRKQQPTYRIIAIDVKSRRQGRALKEVGFYDPRKDQTHLDVATIITFIQQGAQPTDTVSHILNRAGVFEQ 79
>gi|120403179|ref|YP_953008.1| ribosomal protein S16 [Mycobacterium vanbaalenii PYR-1] >gi|166201322|sp|A1T752|RS16_MYCVP 30S ribosomal protein S16 >gi|119955997|gb|ABM13002.1| SSU ribosomal protein S16P [Mycobacterium vanbaalenii PYR-1] (158 aa)
Score = 161, Expect = 6.0e-10, Identities = 39/79 (49%), Positives = 51/79 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L R G+ + P +RI V D+R RRDG  IE +G Y P E   V+ I+ E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLARFGKIRNPQYRIAVADARNRRDGRAIEVIGRYHPKEEPSVIEIDSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 83
>gi|32480825|ref|NP_862736.1| ribosomal protein S16 [Calycanthus floridus var. glaucus] >gi|51338663|sp|Q7YJY6|RR16_CALFE Chloroplast 30S ribosomal protein S16 >gi|32399361|emb|CAD28703.1| ribosomal protein S16 [Calycanthus floridus var. glaucus] (88 aa)
Score = 160, Expect = 7.1e-10, Identities = 36/87 (41%), Positives = 57/87 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQS 87
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P      +N  + L +L+KGAQP+ TV ++L++  V+K+   ++ +S
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSRREGRDLRKVGFYDPINNQTYLNVPLILYFLEKGAQPTGTVYDILKKAEVFKELQINQKKS 87
>gi|81176232|ref|YP_398311.1| ribosomal protein S16 [Lactuca sativa] >gi|122239160|sp|Q332Z6|RR16_LACSA Chloroplast 30S ribosomal protein S16 >gi|78675150|dbj|BAE47576.1| ribosomal protein S16 [Lactuca sativa] (88 aa)
Score = 160, Expect = 7.1e-10, Identities = 35/86 (40%), Positives = 57/86 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQ 86
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K+   ++ +
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKELCPNQTK 86
>gi|21673992|ref|NP_662057.1| 30S ribosomal protein S16 [Chlorobium tepidum TLS] >gi|25009176|sp|Q8KD88|RS16_CHLTE 30S ribosomal protein S16 >gi|21647138|gb|AAM72399.1| ribosomal protein S16 [Chlorobium tepidum TLS] (134 aa)
Score = 160, Expect = 7.4e-10, Identities = 38/76 (50%), Positives = 50/76 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVKIRL R GR K+PF++IV  D RA RDG ++E +G Y P      V I ++    WL  GAQP+DTV +L+R  G+
  S:     1 MVKIRLKRAGRKKMPFYQIVAADGRAPRDGKFLEVLGHYNPTAKPHTVTIEKDRVAYWLNVGAQPTDTVHSLIRGTGL 78
>gi|89280617|ref|YP_514834.1| ribosomal protein S16 [Solanum lycopersicum] >gi|91208970|ref|YP_538830.1| ribosomal protein S16 [Solanum bulbocastanum] >gi|108773112|ref|YP_635621.1| ribosomal protein S16 [Solanum tuberosum] >gi|93141307|sp|P32087|RR16_SOLTU Chloroplast 30S ribosomal protein S16 >gi|122245045|sp|Q2MIK5|RR16_SOLBU Chloroplast 30S ribosomal protein S16 >gi|122248452|sp|Q2MIB8|RR16_SOLLC Chloroplast 30S ribosomal protein S16 >gi|516564|gb|AAA74421.1| ribosomal protein S16 >gi|84371877|gb|ABC56195.1| ribosomal protein S16 [Solanum bulbocastanum] >gi|84371965|gb|ABC56282.1| ribosomal protein S16 [Lycopersicon esculentum] >gi|88656786|gb|ABD47039.1| ribosomal protein S16 [Solanum tuberosum] >gi|89241653|emb|CAJ32375.1| ribosomal protein S16 [Solanum lycopersicum] (88 aa)
Score = 160, Expect = 7.6e-10, Identities = 35/80 (43%), Positives = 56/80 (70%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  ++KVG Y+P +    +N    L +L+KGAQP++TV+++L++  V+K+ 
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLQKVGFYDPIKNQTYLNVPAILYFLEKGAQPTETVQDILKKAEVFKEL 80
>gi|145224754|ref|YP_001135432.1| ribosomal protein S16 [Mycobacterium gilvum PYR-GCK] >gi|189029604|sp|A4TE69|RS16_MYCGI 30S ribosomal protein S16 >gi|145217240|gb|ABP46644.1| SSU ribosomal protein S16P [Mycobacterium gilvum PYR-GCK] (170 aa)
Score = 160, Expect = 7.6e-10, Identities = 38/79 (48%), Positives = 51/79 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L R G+ + P +RI V D+R RRDG  IE +G Y P E   ++ I+ E A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLARFGKIRNPQYRISVADARNRRDGRAIEVIGRYHPKEDPSIIEIDSERAQYWLGVGAQPTEPVLQLLKITGDWQKF 83
>gi|83816028|ref|YP_445749.1| ribosomal protein S16 [Salinibacter ruber DSM 13855] >gi|109894800|sp|Q2S232|RS16_SALRD 30S ribosomal protein S16 >gi|83757422|gb|ABC45535.1| ribosomal protein S16 [Salinibacter ruber DSM 13855] (205 aa)
Score = 159, Expect = 8.2e-10, Identities = 36/69 (52%), Positives = 47/69 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNL 70
           VK+RL R+GR K+P + IV  D R  RDG YIE +G Y P      V + E+ AL WL+ GAQPSDTV+++
  S:     3 VKLRLRRIGRKKIPVYSIVAADQRNARDGRYIEDIGRYFPLREPAEVRLEEDRALYWLENGAQPSDTVRSI 73
>gi|86135391|ref|ZP_01053972.1| 30S ribosomal protein S16 [Tenacibaculum sp. MED152] >gi|85819564|gb|EAQ40721.1| 30S ribosomal protein S16 [Polaribacter dokdonensis MED152] (187 aa)
Score = 159, Expect = 8.2e-10, Identities = 39/78 (50%), Positives = 52/78 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R G+   PF+ IV  D+RA+RDG Y+EK+GTY P      IN ++  A+ WL+ GAQP+DT K +L  +G   K
  S:     3 VKIRLQRHGKKGKPFYWIVAADARAKRDGRYLEKIGTYNPNVNPAEINLDVDGAVKWLQNGAQPTDTAKAILSYKGAMLK 82
>gi|146299061|ref|YP_001193652.1| 30S ribosomal protein S16 [Flavobacterium johnsoniae UW101] >gi|189044381|sp|A5FKD9|RS16_FLAJO 30S ribosomal protein S16 >gi|146153479|gb|ABQ04333.1| SSU ribosomal protein S16P [Flavobacterium johnsoniae UW101] (188 aa)
Score = 159, Expect = 1.0e-09, Identities = 36/78 (46%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R G+   PF+ +V  D+R++RDG Y+EK+GTY P      V +N + A+ WL  GAQP+DT + +L  +G   K
  S:     3 VKIRLQRHGKKGKPFYWVVAADARSKRDGKYLEKIGTYNPNTNPATVELNLDSAVKWLHNGAQPTDTARAILSYKGALLK 82
>gi|13518301|ref|NP_084660.1| ribosomal protein S16 [Oenothera elata subsp. hookeri] >gi|169142692|ref|YP_001687119.1| ribosomal protein S16 [Oenothera argillicola] >gi|169142842|ref|YP_001687265.1| ribosomal protein S16 [Oenothera glazioviana] >gi|169142927|ref|YP_001687349.1| ribosomal protein S16 [Oenothera biennis] >gi|169143013|ref|YP_001687433.1| ribosomal protein S16 [Oenothera parviflora] >gi|22654088|sp|Q9MTQ0|RR16_OENHO Chloroplast 30S ribosomal protein S16 >gi|6723716|emb|CAB67125.1| ribosomal protein S16 [Oenothera elata subsp. hookeri] >gi|159792930|gb|ABW98686.1| ribosomal protein S16 [Oenothera argillicola] >gi|159793100|gb|ABW98854.1| ribosomal protein S16 [Oenothera biennis] >gi|159895454|gb|ABX10019.1| ribosomal protein S16 [Oenothera glazioviana] >gi|159895539|gb|ABX10103.1| ribosomal protein S16 [Oenothera parviflora] (88 aa)
Score = 159, Expect = 1.0e-09, Identities = 34/80 (42%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R G+ +   +RIV ID R+RR+G  + KVG Y+P      ++    L +L+KGAQP+ TV ++L++ GV+ +F
  S:     1 MVKLRLKRCGKKQRAVYRIVAIDVRSRREGRDLWKVGFYDPINNKTYLDIPGILYFLEKGAQPTGTVYDILKKAGVFTEF 80
>gi|72161066|ref|YP_288723.1| SSU ribosomal protein S16P [Thermobifida fusca YX] >gi|109894815|sp|Q47S67|RS16_THEFY 30S ribosomal protein S16 >gi|71914798|gb|AAZ54700.1| SSU ribosomal protein S16P [Thermobifida fusca YX] (146 aa)
Score = 159, Expect = 1.0e-09, Identities = 52/126 (41%), Positives = 80/126 (63%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF------------MDSKVQSKKEHNANKVKKEVKKPEAK-KAAASKPASKPSASKSASQKK 127
           VKI+L R+G+ + P +RIVV D+RA+RDG  IE++G Y P E   ++ +N E    WL  GAQP+D V+++L+  G W+KF             + K +  +E     V KE+  P ++ K   SK A + SA K+A + +
  S:     3 VKIKLKRMGKVRTPQYRIVVADARAKRDGKAIEEIGKYHPKEEPSLIEVNSERVQYWLSVGAQPTDPVRHILKLTGDWQKFKGLPAPTKPLKVAEPKDKEAQEAAFQAVLKELVLPGSENKGGKSKKAEEKSAEKTAEKSE 143
>gi|50955115|ref|YP_062403.1| 30S ribosomal protein S16 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|71649418|sp|Q6AE98|RS16_LEIXX 30S ribosomal protein S16 >gi|50951597|gb|AAT89298.1| 30S ribosomal protein S16 [Leifsonia xyli subsp. xyli str. CTCB07] (153 aa)
Score = 158, Expect = 1.1e-09, Identities = 46/102 (45%), Positives = 62/102 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK--VQSKKEHNANK--VKKEVKKP 103
           VKIRL RLG+ + P +RIVV DSR +RDG  IE++G Y P E    + ++ + A  WL  G+QP++ V  LL+  G W  F   K  V + K   A +  V  E KKP
  S:     3 VKIRLKRLGKIRAPHYRIVVADSRTKRDGRVIEEIGLYHPTEEPSRIEVDSDRAQYWLGVGSQPTEQVLVLLKLTGDWGTFKGDKNAVSTVKVAGAKEAFVADEKKKP 110
>gi|47459265|ref|YP_016127.1| 30S ribosomal protein S16 [Mycoplasma mobile 163K] >gi|81614201|sp|Q6KHL4|RS16_MYCMO 30S ribosomal protein S16 >gi|47458594|gb|AAT27916.1| 30S ribosomal protein s16 [Mycoplasma mobile 163K] (87 aa)
Score = 158, Expect = 1.2e-09, Identities = 33/84 (39%), Positives = 54/84 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           MVK+RL R+G     F+RIV  D+RA RDG +IE++G Y PF   + I +E+   WL  GA+P++T K L +++ + +++   +
  S:     1 MVKLRLKRMGSKFNAFYRIVAADARAPRDGRFIEELGYYNPFSKDLKIEKELVFKWLDLGAKPTETTKTLFKKEKIMEQYHQKR 84
>gi|89889426|ref|ZP_01200937.1| putative 30S ribosomal protein S16 (rpsP) [Flavobacteria bacterium BBFL7] >gi|89517699|gb|EAS20355.1| putative 30S ribosomal protein S16 (rpsP) [Flavobacteria bacterium BBFL7] (165 aa)
Score = 158, Expect = 1.2e-09, Identities = 37/78 (47%), Positives = 53/78 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R G+   PF+ IV  D+R++RDG Y++K+GTY P      IN ++  A+ WL+ GAQP+DT + +L  +GV  K
  S:     3 VKIRLQRHGKKGKPFYWIVAADARSKRDGKYLDKIGTYNPNTNPATINLDVDGAVKWLENGAQPTDTARAILGYKGVMLK 82
>gi|78103234|ref|YP_358558.1| ribosomal protein S16 [Phalaenopsis aphrodite subsp. formosana] >gi|122245681|sp|Q3BAR0|RR16_PHAAO Chloroplast 30S ribosomal protein S16 >gi|58802764|gb|AAW82484.1| ribosomal protein S16 [Phalaenopsis aphrodite subsp. formosana] (94 aa)
Score = 158, Expect = 1.2e-09, Identities = 39/90 (43%), Positives = 59/90 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKE 90
           MVK+RL R GR +   +RIV ID R+RR+G  ++KVG Y+P +     N    L +L+KGAQP++TV ++LR+   +K+F  S  + +KE
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYSNVPAILYFLEKGAQPTETVYDILRKTEFFKEFRISFDKKRKE 90
>gi|15236166|ref|NP_195188.1| SSR16 (ribosomal protein S16); structural constituent of ribosome [Arabidopsis thaliana] >gi|15724282|gb|AAL06534.1|AF412081_1 AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|3096931|emb|CAA18841.1| putative ribosomal protein S16 [Arabidopsis thaliana] >gi|7270412|emb|CAB80179.1| putative ribosomal protein S16 [Arabidopsis thaliana] >gi|15010612|gb|AAK73965.1| AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|15081652|gb|AAK82481.1| AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|15529192|gb|AAK97690.1| AT4g34620/T4L20_200 [Arabidopsis thaliana] >gi|21592570|gb|AAM64519.1| putative ribosomal protein S16 [Arabidopsis thaliana] >gi|23505749|gb|AAN28734.1| At4g34620/T4L20_200 [Arabidopsis thaliana] (113 aa)
Score = 158, Expect = 1.3e-09, Identities = 36/75 (48%), Positives = 51/75 (68%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           VKIRL RLG    PF+R+VV D ++RRDG  IE +G Y+P +G      V++  +    WL  GAQP+DTV+++L   G+
  S:     3 VKIRLARLGCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDADRVSLKFDRIKYWLSVGAQPTDTVESMLFRAGL 82
>gi|148655436|ref|YP_001275641.1| ribosomal protein S16 [Roseiflexus sp. RS-1] >gi|166201347|sp|A5UST8|RS16_ROSS1 30S ribosomal protein S16 >gi|148567546|gb|ABQ89691.1| SSU ribosomal protein S16P [Roseiflexus sp. RS-1] (95 aa)
Score = 157, Expect = 1.5e-09, Identities = 38/76 (50%), Positives = 50/76 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MV IRL R+G+ K P +R+VV DSRA RDG +IE VG Y P      +++  +    WL  GAQPS+TV  LL++ GV
  S:     1 MVTIRLRRMGKTKQPSYRLVVADSRAPRDGKFIEIVGHYNPVRQPKELHVKADRVRYWLSVGAQPSETVVRLLKQVGV 78
>gi|85708914|ref|ZP_01039980.1| ribosomal protein S16 [Erythrobacter sp. NAP1] >gi|85690448|gb|EAQ30451.1| ribosomal protein S16 [Erythrobacter sp. NAP1] (168 aa)
Score = 157, Expect = 1.5e-09, Identities = 39/78 (50%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL+R G  K P++RIVV DSR+ RDG Y+E++GTY P      E  V +NE+ A  WL  GA PSD V   L   G+ ++
  S:     3 VAIRLSRGGAKKRPYYRIVVSDSRSPRDGKYLEQIGTYNPLLAKDDENRVKLNEDRAKYWLGVGATPSDRVMRFLDAAGIMER 85
>gi|156741647|ref|YP_001431776.1| ribosomal protein S16 [Roseiflexus castenholzii DSM 13941] >gi|189029611|sp|A7NJT8|RS16_ROSCS 30S ribosomal protein S16 >gi|156232975|gb|ABU57758.1| ribosomal protein S16 [Roseiflexus castenholzii DSM 13941] (93 aa)
Score = 157, Expect = 1.6e-09, Identities = 39/76 (51%), Positives = 49/76 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MV IRL R G+ K P +R+VV DSRA RDG +IE VG Y P      +N+  +    WL  GAQPS+TV  LL++ GV
  S:     1 MVTIRLRRTGKTKKPSYRLVVADSRAPRDGRFIEIVGHYNPVRQPKELNVKADRVRYWLGVGAQPSETVVRLLKQVGV 78
>gi|13518446|ref|NP_084806.1| ribosomal protein S16 [Lotus japonicus] >gi|14195185|sp|P58125|RR16_LOTJA Chloroplast 30S ribosomal protein S16 >gi|13358987|dbj|BAB33204.1| ribosomal protein S16 [Lotus japonicus] (80 aa)
Score = 157, Expect = 1.6e-09, Identities = 34/82 (41%), Positives = 55/82 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMD 82
           MVK+RL R G+ +   +RIV ID R+RR+G  + KVG Y+P +    +N  + L++L++GAQP+ TV+++ ++ G    FMD
  S:     1 MVKLRLKRCGKKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNIPVILNFLEQGAQPTGTVQDISKKAGF---FMD 79
>gi|6094160|sp|O86868|RS16_STRLI 30S ribosomal protein S16 >gi|3336919|emb|CAB06804.1| 30S ribosomal protein S16 [Streptomyces lividans] (139 aa)
Score = 157, Expect = 1.7e-09, Identities = 38/79 (48%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L RLG+ + P +RIVV DSR RRDG  IE++G Y P     V+ ++ E    WL  GAQP++ V  +L++ G W+KF
  S:     3 VKIKLKRLGKIRSPHYRIVVADSRTRRDGRAIEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKF 83
>gi|154245410|ref|YP_001416368.1| ribosomal protein S16 [Xanthobacter autotrophicus Py2] >gi|154159495|gb|ABS66711.1| ribosomal protein S16 [Xanthobacter autotrophicus Py2] (122 aa)
Score = 157, Expect = 1.7e-09, Identities = 41/88 (46%), Positives = 59/88 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKK 89
           +KIRL R G  K P++RIV+ D+R+ RDG +IEK+GT+ P      E  V ++ + A +WL+KGAQP+D V   L   G+ K+  D+K   KK
  S:     3 LKIRLARGGAKKRPYYRIVIADARSPRDGRFIEKIGTFNPLLAKDAENRVVLDADKAKAWLEKGAQPTDRVARFLDAAGLMKR--DAKNNPKK 93
>gi|114329950|ref|YP_740632.1| ribosomal protein S16 [Nandina domestica] >gi|114054452|gb|ABI49845.1| ribosomal protein S16 [Nandina domestica] (83 aa)
Score = 157, Expect = 1.7e-09, Identities = 34/80 (42%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  ++KVG Y+P +     N    L +L+KGAQP+ TV ++L++  ++K+ 
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYSNVPAILYFLEKGAQPTGTVHDILKKAEIFKEL 80
>gi|122232616|sp|Q2QDA6|RR16_CUCSA Chloroplast 30S ribosomal protein S16 >gi|74027084|gb|AAZ94634.1| ribosomal protein S16 [Cucumis sativus] (85 aa)
Score = 156, Expect = 1.9e-09, Identities = 34/80 (42%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGR-HKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR  +   +RI+ ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++L++ GV+ + 
  S:     1 MVKLRLKRCGRKQRAAVYRIIAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDILKKAGVFTEL 81
>gi|133812|sp|P10359|RR16_SINAL Chloroplast 30S ribosomal protein S16 >gi|12217|emb|CAA31944.1| 16S ribosomal protein [Sinapis alba] (88 aa)
Score = 156, Expect = 1.9e-09, Identities = 35/86 (40%), Positives = 54/86 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQ 86
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P      +N    L +LKKGAQP+ TV ++ ++ G++ +   +K +
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPITNQTYLNLPAILDFLKKGAQPTRTVHDISKKAGIFTELNLNKTK 86
>gi|119357326|ref|YP_911970.1| 30S ribosomal protein S16 [Chlorobium phaeobacteroides DSM 266] >gi|166234410|sp|A1BGL9|RS16_CHLPD 30S ribosomal protein S16 >gi|119354675|gb|ABL65546.1| SSU ribosomal protein S16P [Chlorobium phaeobacteroides DSM 266] (135 aa)
Score = 156, Expect = 2.0e-09, Identities = 39/98 (39%), Positives = 63/98 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKK 98
           MVKIRL R GR KLP ++IV  D+R+ RDG ++E +G Y+P      V I ++    W++ GAQP+DTV++L+R  G+  +    K+   +E   ++++K
  S:     1 MVKIRLKRTGRKKLPIYQIVAADARSPRDGKFLEVIGHYQPTAKPHAVTIKKDRVAYWMQTGAQPTDTVRSLIRSTGLLYEMRLKKMGRSEEEIVSEMEK 100
>gi|91214151|ref|YP_538773.1| ribosomal protein S16 [Glycine max] >gi|122238709|sp|Q2PMS5|RR16_SOYBN Chloroplast 30S ribosomal protein S16 >gi|83595752|gb|ABC25133.1| ribosomal protein S16 [Glycine max] (89 aa)
Score = 156, Expect = 2.1e-09, Identities = 35/88 (39%), Positives = 58/88 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           MVK+RL R G+ +   +RIV ID R+RR+G  + KVG Y+P +    +N  + L +L++GAQP+ TV+++ +  GV+ + + S  Q+K
  S:     1 MVKLRLKRCGKKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQDISKRAGVFME-LSSNQQTK 87
>gi|118045751|ref|ZP_01514408.1| ribosomal protein S16 [Chloroflexus aggregans DSM 9485] >gi|117997763|gb|EAV11947.1| ribosomal protein S16 [Chloroflexus aggregans DSM 9485] (89 aa)
Score = 156, Expect = 2.3e-09, Identities = 38/72 (52%), Positives = 48/72 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MVKIRL R G+ K P +RIVV DSR+ RDG +IE +G Y P     V+ +N + A  WL  GAQP+D V  LL+
  S:     1 MVKIRLRRTGKTKQPSYRIVVADSRSPRDGKFIETIGYYLPTRQPKVLEVNADRARYWLGVGAQPTDVVVKLLK 74
>gi|82754611|gb|ABB90025.1| ribosomal protein S16 [Solanum tuberosum] (88 aa)
Score = 155, Expect = 2.4e-09, Identities = 34/80 (42%), Positives = 55/80 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RI  ID R+RR+G  ++KVG Y+P +    +N    L +L+KGAQP++TV+++L++  V+K+ 
  S:     1 MVKLRLKRCGRKQRAVYRIAAIDVRSRREGKDLQKVGFYDPIKNQTYLNVPAILYFLEKGAQPTETVQDILKKAEVFKEL 80
>gi|114107115|ref|YP_740099.1| ribosomal protein S16 [Daucus carota] >gi|122221314|sp|Q0G9Y0|RR16_DAUCA Chloroplast 30S ribosomal protein S16 >gi|113200890|gb|ABI32406.1| ribosomal protein S16 [Daucus carota] >gi|156597919|gb|ABU85227.1| ribosomal protein S16 [Anethum graveolens] (78 aa)
Score = 155, Expect = 2.5e-09, Identities = 35/78 (44%), Positives = 52/78 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R GR +   +RIV ID R+RR+G  +  VG Y+P +    +N    L +L+KGAQP+ TV++LL++  V+K
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRNVGFYDPIKNQSYLNVPAILYFLEKGAQPTGTVRDLLKKAEVFK 78
>gi|28261699|ref|NP_783214.1| ribosomal protein S16 [Atropa belladonna] >gi|75248032|sp|Q8S8Y5|RR16_ATRBE Chloroplast 30S ribosomal protein S16 >gi|20068313|emb|CAC88026.1| ribosomal protein S16 [Atropa belladonna] (88 aa)
Score = 155, Expect = 2.5e-09, Identities = 35/80 (43%), Positives = 54/80 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K+ 
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKEL 80
>gi|42526393|ref|NP_971491.1| ribosomal protein S16 [Treponema denticola ATCC 35405] >gi|54039382|sp|P62239|RS16_TREDE 30S ribosomal protein S16 >gi|41816586|gb|AAS11372.1| ribosomal protein S16 [Treponema denticola ATCC 35405] (81 aa)
Score = 155, Expect = 2.5e-09, Identities = 37/74 (50%), Positives = 51/74 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV---VNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           MVKIRL RLG  K P++RIVV D R  R+G  I++VG Y P E     ++ + +   +WL KGAQP+DTV+ LL ++
  S:     1 MVKIRLKRLGTKKRPYYRIVVQDVREPRNGKTIDEVGIYHPIETAEKQISFDADKVRNWLGKGAQPTDTVRRLLNKK 77
>gi|11465937|ref|NP_054479.1| ribosomal protein S16 [Nicotiana tabacum] >gi|78102512|ref|YP_358653.1| ribosomal protein S16 [Nicotiana sylvestris] >gi|81301543|ref|YP_398840.1| ribosomal protein S16 [Nicotiana tomentosiformis] >gi|133814|sp|P06374|RR16_TOBAC Chloroplast 30S ribosomal protein S16 >gi|122226810|sp|Q33C57|RR16_NICTO Chloroplast 30S ribosomal protein S16 >gi|122226848|sp|Q3C1G1|RR16_NICSY Chloroplast 30S ribosomal protein S16 >gi|11806|emb|CAA27149.1| ribosomal protein S16 [Nicotiana tabacum] >gi|435266|emb|CAA77340.1| ribosomal protein S16 [Nicotiana tabacum] >gi|77799539|dbj|BAE46628.1| ribosomal protein S16 [Nicotiana sylvestris] >gi|80750902|dbj|BAE47978.1| ribosomal protein S16 [Nicotiana tomentosiformis] >gi|225241|prf||1211235C ribosomal protein S16 (85 aa)
Score = 155, Expect = 2.5e-09, Identities = 35/80 (43%), Positives = 54/80 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K+ 
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKEL 80
>gi|52220792|ref|YP_086948.1| ribosomal protein S16 [Panax ginseng] >gi|68053102|sp|Q68S24|RR16_PANGI Chloroplast 30S ribosomal protein S16 >gi|51235295|gb|AAT98491.1| ribosomal protein S16 [Panax ginseng] (78 aa)
Score = 155, Expect = 2.6e-09, Identities = 35/78 (44%), Positives = 53/78 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQSCLNVPAILYFLEKGAQPTGTVRDILKKAEVFK 78
>gi|71891960|ref|YP_277690.1| 30S ribosomal protein S16 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|109893864|sp|Q493M3|RS16_BLOPB 30S ribosomal protein S16 >gi|71796066|gb|AAZ40817.1| 30S ribosomal subunit protein S16 [Candidatus Blochmannia pennsylvanicus str. BPEN] (80 aa)
Score = 155, Expect = 2.6e-09, Identities = 36/72 (50%), Positives = 49/72 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE-----GV-VNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV+IRL R G  K PF+ IV+ DSR+ RDG +IE+VG + P +     G+ + +N E    WL KGA PSD V  L++
  S:     1 MVRIRLARGGHKKTPFYHIVITDSRSARDGRFIERVGFFSPIKFSNRTGLGLRVNLERVKYWLYKGASPSDRVLKLIK 78
>gi|88855267|ref|ZP_01129932.1| 30S ribosomal protein S16 [marine actinobacterium PHSC20C1] >gi|88815795|gb|EAR25652.1| 30S ribosomal protein S16 [marine actinobacterium PHSC20C1] (148 aa)
Score = 155, Expect = 2.7e-09, Identities = 38/83 (45%), Positives = 52/83 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           VKIRL R+G+ + P++RIV+ DSR +RDG  IE++G Y P E    + +  E A  WL  GAQPS  V+ +L+  G W  F   K
  S:     3 VKIRLKRMGKIRAPYYRIVIADSRKKRDGRVIEEIGKYHPTEEPSFIEVESERAQYWLGVGAQPSPQVEAILKLTGDWGIFKGDK 87
>gi|68536270|ref|YP_250975.1| 30S ribosomal protein S16 [Corynebacterium jeikeium K411] >gi|109893875|sp|Q4JV00|RS16_CORJK 30S ribosomal protein S16 >gi|68263869|emb|CAI37357.1| 30S ribosomal protein S16 [Corynebacterium jeikeium K411] (172 aa)
Score = 155, Expect = 2.7e-09, Identities = 35/79 (44%), Positives = 53/79 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           VKI+L RLG+ + P +R+VV D+R +R G  IE +G Y+P +   ++ I+ + A  WL  GAQP++ V  LL+  G W+KF
  S:     3 VKIKLQRLGKIRTPEYRVVVQDARTKRSGKVIENLGIYQPTQEPSLIQIDSDRAQYWLGVGAQPTEPVLALLKITGDWQKF 83
>gi|114329728|ref|YP_740547.1| ribosomal protein S16 [Platanus occidentalis] >gi|114054366|gb|ABI49760.1| ribosomal protein S16 [Platanus occidentalis] (88 aa)
Score = 155, Expect = 2.8e-09, Identities = 35/87 (40%), Positives = 57/87 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQS 87
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N  + L +L+KGAQP+ TV ++ ++  V+K+   ++ +S
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPVILYFLEKGAQPTGTVHDISKKAEVFKELRINQTKS 87
>gi|146308420|ref|YP_001188885.1| 30S ribosomal protein S16 [Pseudomonas mendocina ymp] >gi|166201337|sp|A4XXT7|RS16_PSEMY 30S ribosomal protein S16 >gi|145576621|gb|ABP86153.1| SSU ribosomal protein S16P [Pseudomonas mendocina ymp] (83 aa)
Score = 155, Expect = 3.0e-09, Identities = 33/73 (45%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V +SR  RDG ++E++G + P     E  +++++E A  WL +GAQPS+ V  LL+E
  S:     1 MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERIGFFNPIAAGGEVRLSVDQERATYWLGQGAQPSERVAQLLKE 77
>gi|118430284|ref|YP_874718.1| ribosomal protein S16 [Agrostis stolonifera] >gi|125987688|sp|A1E9Z0|RR16_AGRST Chloroplast 30S ribosomal protein S16 >gi|118201193|gb|ABK79562.1| ribosomal protein S16 [Agrostis stolonifera] (85 aa)
Score = 154, Expect = 3.1e-09, Identities = 35/79 (44%), Positives = 53/79 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++LR+  ++K+
  S:     1 MVKLRLKRCGRKQQAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAELFKE 79
>gi|11467173|ref|NP_043006.1| ribosomal protein S16 [Zea mays] >gi|48478756|ref|YP_024364.1| ribosomal protein S16 [Saccharum hybrid cultivar SP-80-3280] >gi|50812507|ref|YP_054610.1| ribosomal protein S16 [Saccharum officinarum] >gi|118614474|ref|YP_899389.1| ribosomal protein S16 [Sorghum bicolor] >gi|133809|sp|P27723|RR16_MAIZE Chloroplast 30S ribosomal protein S16 >gi|68053154|sp|Q6ENY4|RR16_SACOF Chloroplast 30S ribosomal protein S16 >gi|75261502|sp|Q6L3B4|RR16_SACHY Chloroplast 30S ribosomal protein S16 >gi|125987690|sp|A1E9Q6|RR16_SORBI Chloroplast 30S ribosomal protein S16 >gi|14292|emb|CAA43215.1| ribosomal protein S16 [Zea mays] >gi|902203|emb|CAA60267.1| ribosomal protein S16 [Zea mays] >gi|48478658|gb|AAT44678.1| ribosomal protein S16 [Saccharum hybrid cultivar SP-80-3280] >gi|49659491|dbj|BAD27272.1| ribosomal protein S16 [Saccharum officinarum] >gi|118201108|gb|ABK79478.1| ribosomal protein S16 [Sorghum bicolor] (85 aa)
Score = 154, Expect = 3.3e-09, Identities = 35/78 (44%), Positives = 51/78 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++LR+   +K
  S:     1 MVKLRLKRCGRKQQAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK 78
>gi|94502309|ref|ZP_01308786.1| 30S ribosomal protein S16 [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|161833804|ref|YP_001598000.1| 30S ribosomal subunit protein S16 [Candidatus Sulcia muelleri GWSS] >gi|189029623|sp|A8Z653|RS16_SULMW 30S ribosomal protein S16 >gi|94451136|gb|EAT14084.1| 30S ribosomal protein S16 [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|152206294|gb|ABS30604.1| 30S ribosomal subunit protein S16 [Candidatus Sulcia muelleri GWSS] (112 aa)
Score = 154, Expect = 3.4e-09, Identities = 42/96 (43%), Positives = 65/96 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGV-WKKFMDSKVQSKKEHNANKVK 97
           +KIRL R GR K  F+ IVV +SR+ R+G ++EK+G Y P      ++IN + A++WL KGAQP+ TVK+   ++G+ +KK++ S V+  K     K+K
  S:     3 IKIRLQRKGRKKKAFYTIVVSNSRSPRNGKFLEKIGFYNPNTNPYTISINVDKAVNWLIKGAQPTCTVKSFFLKEGIYYKKYLLSGVKISKSEIEQKLK 101
>gi|46579252|ref|YP_010060.1| 30S ribosomal protein S16 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603185|ref|YP_967585.1| 30S ribosomal protein S16 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166234418|sp|A1VFE2|RS16_DESVV 30S ribosomal protein S16 >gi|50403604|sp|P62229|RS16_DESVH 30S ribosomal protein S16 >gi|46448666|gb|AAS95319.1| ribosomal protein S16 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563414|gb|ABM29158.1| SSU ribosomal protein S16P [Desulfovibrio vulgaris subsp. vulgaris DP4] (79 aa)
Score = 154, Expect = 3.5e-09, Identities = 35/73 (47%), Positives = 49/73 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           VK+RLTR+G  K  F+RIV ++S  RRDG  +E +G Y P      V I+ E    WL  GA+P+DTV+NL+++Q
  S:     3 VKLRLTRMGNKKRAFYRIVAVNSETRRDGRPLEYIGFYNPMVDPAEVKIDAEKVQKWLALGAEPTDTVRNLIKKQ 77
>gi|158313000|ref|YP_001505508.1| ribosomal protein S16 [Frankia sp. EAN1pec] >gi|158108405|gb|ABW10602.1| ribosomal protein S16 [Frankia sp. EAN1pec] (161 aa)
Score = 154, Expect = 3.5e-09, Identities = 33/78 (42%), Positives = 50/78 (64%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           KI+L RLG+ + P +RIVV D+R +RDG  IE +G Y P     ++ ++ +    WL  GAQP++ V  +L+  G W+KF
  S:    19 KIKLQRLGKMREPHYRIVVADARTKRDGRVIEAIGQYHPKSDPSIIKVDPDRVGHWLSVGAQPTEPVLAILKVTGDWQKF 98
>gi|46190758|ref|ZP_00121059.2| COG0228: Ribosomal protein S16 [Bifidobacterium longum DJO10A] >gi|189439915|ref|YP_001954996.1| Ribosomal protein S16 [Bifidobacterium longum DJO10A] >gi|189428350|gb|ACD98498.1| Ribosomal protein S16 [Bifidobacterium longum DJO10A] (153 aa)
Score = 154, Expect = 3.8e-09, Identities = 37/78 (47%), Positives = 49/78 (62%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           KIRL R G+    F+R+VV+DSR +RDG  IE++GTY P      + I  + A  WL  GAQPS+ V  LL   G W+K+
  S:     4 KIRLKRQGKKFYAFYRVVVVDSRKKRDGKVIEEIGTYNPNTQPSTIQIKSDRAQYWLGVGAQPSEPVFKLLNITGDWQKY 83
>gi|71842288|ref|YP_277376.1| ribosomal protein S16 [Emiliania huxleyi] >gi|122239713|sp|Q4G391|RR16_EMIHU Chloroplast 30S ribosomal protein S16 >gi|60101531|gb|AAX13875.1| ribosomal protein S16 [Emiliania huxleyi] (81 aa)
Score = 153, Expect = 4.0e-09, Identities = 34/77 (44%), Positives = 48/77 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVW 77
           M+KIRL R GR   P +RIVV DSR +RDG  +E+VG Y P     ++     +  LK GAQP++TV+N+  +  V+
  S:     1 MLKIRLKRFGRKAQPCYRIVVTDSRVKRDGKALEEVGFYNPLTDETHLKFNRIVERLKTGAQPTETVRNIFLKAKVF 77
>gi|23464906|ref|NP_695509.1| 30S ribosomal protein S16 [Bifidobacterium longum NCC2705] >gi|31076979|sp|Q8G7G1|RS16_BIFLO 30S ribosomal protein S16 >gi|23325498|gb|AAN24145.1| 30S ribosomal protein S16 [Bifidobacterium longum NCC2705] (153 aa)
Score = 153, Expect = 4.0e-09, Identities = 37/78 (47%), Positives = 49/78 (62%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           KIRL R G+    F+R+VV+DSR +RDG  IE++GTY P      + I  + A  WL  GAQPS+ V  LL   G W+K+
  S:     4 KIRLKRQGKKFYAFYRVVVVDSRKKRDGKVIEEIGTYNPNTQPSTIQIKSDRAQYWLGVGAQPSEPVFKLLNITGDWQKY 83
>gi|115605004|ref|YP_784455.1| ribosomal protein S16 [Piper cenocladum] >gi|122164380|sp|Q06GS8|RR16_PIPCE Chloroplast 30S ribosomal protein S16 >gi|112253733|gb|ABI14454.1| ribosomal protein S16 [Piper cenocladum] (97 aa)
Score = 153, Expect = 4.3e-09, Identities = 33/80 (41%), Positives = 52/80 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  ++KVG Y+P +    +N    L +L KGAQP+ TV ++ ++  ++K+ 
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVPAVLYFLGKGAQPTGTVHDISKKAEIFKEL 80
>gi|76881060|gb|ABA56166.1| Rps16 [Oenanthe millefolia] >gi|76881064|gb|ABA56169.1| Rps16 [Oenanthe foucaudii] >gi|76881068|gb|ABA56172.1| Rps16 [Oenanthe lachenalii] >gi|76881072|gb|ABA56175.1| Rps16 [Oenanthe aquatica] >gi|76881076|gb|ABA56178.1| Rps16 [Oenanthe sarmentosa] >gi|76881080|gb|ABA56181.1| Rps16 [Oenanthe fistulosa] >gi|76881084|gb|ABA56184.1| Rps16 [Oenanthe fistulosa] >gi|76881088|gb|ABA56187.1| Rps16 [Oenanthe pimpinelloides] >gi|76881092|gb|ABA56190.1| Rps16 [Oenanthe pimpinelloides] >gi|76881096|gb|ABA56193.1| Rps16 [Oenanthe divaricata] >gi|76881100|gb|ABA56196.1| Rps16 [Oenanthe crocata] >gi|76881104|gb|ABA56199.1| Rps16 [Oenanthe crocata] >gi|76881108|gb|ABA56202.1| Rps16 [Oenanthe banatica] >gi|76881112|gb|ABA56205.1| Rps16 [Oenanthe peucedanifolia] >gi|76881116|gb|ABA56208.1| Rps16 [Oenanthe silaifolia] >gi|76881120|gb|ABA56211.1| Rps16 [Oenanthe silaifolia] >gi|76881124|gb|ABA56214.1| Rps16 [Cicuta bulbifera] >gi|76881128|gb|ABA56217.1| Rps16 [Cicuta bulbifera] >gi|76881132|gb|ABA56220.1| Rps16 [Cicuta bulbifera] >gi|76881136|gb|ABA56223.1| Rps16 [Cicuta douglasii] >gi|76881140|gb|ABA56226.1| Rps16 [Cicuta douglasii] >gi|76881144|gb|ABA56229.1| Rps16 [Cicuta douglasii] >gi|76881148|gb|ABA56232.1| Rps16 [Cicuta maculata var. angustifolia] >gi|76881152|gb|ABA56235.1| Rps16 [Cicuta maculata var. angustifolia] >gi|76881156|gb|ABA56238.1| Rps16 [Cicuta maculata var. bolanderi] >gi|76881160|gb|ABA56241.1| Rps16 [Cicuta maculata var. bolanderi] >gi|76881164|gb|ABA56244.1| Rps16 [Cicuta maculata var. maculata] >gi|76881168|gb|ABA56247.1| Rps16 [Cicuta maculata var. maculata] >gi|76881172|gb|ABA56250.1| Rps16 [Cicuta maculata var. maculata] >gi|76881176|gb|ABA56253.1| Rps16 [Cicuta maculata var. maculata] >gi|76881180|gb|ABA56256.1| Rps16 [Cicuta maculata var. victorinii] >gi|76881184|gb|ABA56259.1| Rps16 [Cicuta virosa] >gi|76881188|gb|ABA56262.1| Rps16 [Cicuta virosa] >gi|76881192|gb|ABA56265.1| Rps16 [Cicuta virosa] >gi|76881196|gb|ABA56268.1| Rps16 [Cicuta virosa] >gi|76881200|gb|ABA56271.1| Rps16 [Cicuta virosa] >gi|76881204|gb|ABA56274.1| Rps16 [Cicuta virosa] >gi|76881208|gb|ABA56277.1| Rps16 [Cicuta virosa] (78 aa)
Score = 153, Expect = 4.8e-09, Identities = 34/78 (43%), Positives = 52/78 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R GR +   +RIV ID R+RR+G  +  VG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRNVGFYDPIKNQSYLNVPAILYFLEKGAQPTGTVRDILKKAEVFK 78
>gi|91787572|ref|YP_548524.1| SSU ribosomal protein S16P [Polaromonas sp. JS666] >gi|122967981|sp|Q12CW6|RS16_POLSJ 30S ribosomal protein S16 >gi|91696797|gb|ABE43626.1| SSU ribosomal protein S16P [Polaromonas sp. JS666] (83 aa)
Score = 153, Expect = 5.0e-09, Identities = 36/73 (49%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G    PFF IVV D R RRDG +IE++G Y P     E  + I ++    WL  GAQPS TV+ L+++
  S:     1 MVVIRLARGGSKHRPFFNIVVADKRVRRDGRFIERIGFYNPIAKGGEEGLRIAQDRLTHWLGVGAQPSPTVERLVKQ 77
>gi|118430370|ref|YP_874635.1| ribosomal protein S16 [Hordeum vulgare subsp. vulgare] >gi|133806|sp|P25875|RR16_HORVU Chloroplast 30S ribosomal protein S16 >gi|11603|emb|CAA36973.1| ribosomal protein rps16 [Hordeum vulgare] >gi|118201024|gb|ABK79395.1| ribosomal protein S16 [Hordeum vulgare subsp. vulgare] (85 aa)
Score = 153, Expect = 5.1e-09, Identities = 35/79 (44%), Positives = 52/79 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++LR+   +K+
  S:     1 MVKLRLKRCGRKQQAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 79
>gi|148549465|ref|YP_001269567.1| 30S ribosomal protein S16 [Pseudomonas putida F1] >gi|161378134|ref|NP_743620.2| 30S ribosomal protein S16 [Pseudomonas putida KT2440] >gi|167032080|ref|YP_001667311.1| 30S ribosomal protein S16 [Pseudomonas putida GB-1] >gi|166201338|sp|A5W8C3|RS16_PSEP1 30S ribosomal protein S16 >gi|189029609|sp|B0KRI1|RS16_PSEPG 30S ribosomal protein S16 >gi|31076913|sp|Q88MV6|RS16_PSEPK 30S ribosomal protein S16 >gi|148513523|gb|ABQ80383.1| SSU ribosomal protein S16P [Pseudomonas putida F1] >gi|166858568|gb|ABY96975.1| ribosomal protein S16 [Pseudomonas putida GB-1] (83 aa)
Score = 152, Expect = 5.6e-09, Identities = 34/73 (46%), Positives = 48/73 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V +SR  RDG ++E+VG + P     E  +++N+E    WL +GAQPS+ V  LL+E
  S:     1 MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERVGFFNPIAAGAEVKLSVNQERVTYWLSQGAQPSERVAQLLKE 77
>gi|62257556|gb|AAX77723.1| unknown protein [synthetic construct] (117 aa)
Score = 152, Expect = 5.7e-09, Identities = 37/73 (50%), Positives = 50/73 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IR+ R G  K PF+RIVV D R+ RDG +IEK+G + P     E  + ++   A +WL KGAQPSD V +L++E
  S:    27 MVVIRMARGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKE 103
>gi|83856349|ref|ZP_00949878.1| ribosomal protein S16 [Croceibacter atlanticus HTCC2559] >gi|83850149|gb|EAP88017.1| ribosomal protein S16 [Croceibacter atlanticus HTCC2559] (191 aa)
Score = 152, Expect = 5.7e-09, Identities = 45/128 (35%), Positives = 72/128 (56%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVW-KKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTV 129
           VKIRL R G+   PF+ IV  DSR++RDG Y+EK+GTY P     +++++ + +++WL  GAQP+DT + +L  +GV  K  +   V+          KK     E K++  +    K S    A ++K +
  S:     3 VKIRLQRHGKKGKPFYWIVAADSRSKRDGRYLEKLGTYNPNTNPAIIDLDIDTSVTWLNNGAQPTDTARAILSYKGVMLKHHLAGGVRKGALTEEQAEKKFAAWLEEKESKVNAKKDKVSKDAEAEKQKAL 133
>gi|114771308|ref|ZP_01448728.1| ribosomal protein S16 [alpha proteobacterium HTCC2255] >gi|114548233|gb|EAU51120.1| ribosomal protein S16 [alpha proteobacterium HTCC2255] (168 aa)
Score = 152, Expect = 5.8e-09, Identities = 39/78 (50%), Positives = 49/78 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+R+V  DSR  RDG Y+EK+GTY P      E  V +N E    WL +GAQP++ V   L   GV +K
  S:     3 MKIRLARGGSKKRPFYRVVAADSRMPRDGRYVEKLGTYNPLLAKDSEDRVQLNMERVNYWLGQGAQPTERVVRFLEAAGVMEK 85
>gi|104783233|ref|YP_609731.1| 30S ribosomal protein S16 [Pseudomonas entomophila L48] >gi|122985776|sp|Q1I5Y8|RS16_PSEE4 30S ribosomal protein S16 >gi|95112220|emb|CAK16947.1| 30S ribosomal subunit protein S16 [Pseudomonas entomophila L48] (83 aa)
Score = 152, Expect = 5.9e-09, Identities = 34/73 (46%), Positives = 48/73 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V +SR  RDG ++E+VG + P     E  +++N+E    WL +GAQPS+ V  LL+E
  S:     1 MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERVGFFNPIASGAEVKLSVNQERVTYWLSQGAQPSERVAQLLKE 77
>gi|85374322|ref|YP_458384.1| ribosomal protein S16 [Erythrobacter litoralis HTCC2594] >gi|84787405|gb|ABC63587.1| ribosomal protein S16 [Erythrobacter litoralis HTCC2594] (206 aa)
Score = 152, Expect = 5.9e-09, Identities = 37/78 (47%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL+R G  K P++RIVV D R+ RDG Y+E++G Y P      EG V ++E+ A  WL  GA+PSD V   L   G+ ++
  S:     3 VAIRLSRGGAKKRPYYRIVVADERSPRDGKYLEQIGIYNPMLPKDDEGRVKLDEDRARHWLGVGAKPSDRVLRFLDAAGIMER 85
>gi|67156468|ref|ZP_00418061.1| Ribosomal protein S16 [Azotobacter vinelandii AvOP] >gi|67086227|gb|EAM05697.1| Ribosomal protein S16 [Azotobacter vinelandii AvOP] (83 aa)
Score = 152, Expect = 5.9e-09, Identities = 34/73 (46%), Positives = 50/73 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V DSR  RDG ++E++G + P     E  +++++E A  WL +GAQPS+ V +LL+E
  S:     1 MVTIRLARGGSKKRPFYHLTVTDSRNARDGRFVERIGFFNPVASGAEVKLSVDQERAAYWLGQGAQPSERVAHLLKE 77
>gi|111225151|ref|YP_715945.1| 30S ribosomal protein S16 [Frankia alni ACN14a] >gi|123338088|sp|Q0RDP2|RS16_FRAAA 30S ribosomal protein S16 >gi|111152683|emb|CAJ64424.1| 30S ribosomal protein S16 [Frankia alni ACN14a] (148 aa)
Score = 152, Expect = 6.2e-09, Identities = 35/78 (44%), Positives = 51/78 (65%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           KI+L RLG+ + P +RIVV D+R +RDG  IE +G Y P     ++ ++ E A  WL  GAQP++ V  +L+  G W+KF
  S:     4 KIKLQRLGKMREPHYRIVVADARTKRDGRVIEAIGQYHPKSDPSIIKVDAERAQHWLSVGAQPTEPVLAILKVTGDWQKF 83
>gi|91776686|ref|YP_546442.1| SSU ribosomal protein S16P [Methylobacillus flagellatus KT] >gi|123253977|sp|Q1GYT6|RS16_METFK 30S ribosomal protein S16 >gi|91710673|gb|ABE50601.1| SSU ribosomal protein S16P [Methylobacillus flagellatus KT] (82 aa)
Score = 151, Expect = 6.8e-09, Identities = 40/73 (54%), Positives = 48/73 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ +VV DSR RRDG +IE+VG Y P      EG+   NE IA  W   GAQ SDTV  L+++
  S:     1 MVIIRLARGGAKKTPFYSVVVADSRNRRDGRFIERVGFYNPLAKEGQEGLRLNNERIA-HWRDNGAQLSDTVARLVKQ 77
>gi|33519644|ref|NP_878476.1| 30S ribosomal protein S16 [Candidatus Blochmannia floridanus] >gi|54039440|sp|Q7VQG0|RS16_BLOFL 30S ribosomal protein S16 >gi|33517307|emb|CAD83692.1| 30S ribosomal subunit protein S16 [Candidatus Blochmannia floridanus] (82 aa)
Score = 151, Expect = 7.8e-09, Identities = 35/72 (48%), Positives = 46/72 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE----GVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV+IRL R G  K PF+ IVV DSR  RDG +IE++G + P E      + +N +    WL  GAQPSD V  L++
  S:     1 MVRIRLARGGCKKSPFYYIVVTDSRNSRDGRFIERIGFFNPVELDIKKRLRVNLDRVRYWLSNGAQPSDRVFVLIK 76
>gi|14017554|ref|NP_114241.1| ribosomal protein S16 [Triticum aestivum] >gi|22654087|sp|Q95H63|RR16_WHEAT Chloroplast 30S ribosomal protein S16 >gi|13928187|dbj|BAB47016.1| ribosomal protein s16 [Triticum aestivum] (85 aa)
Score = 151, Expect = 7.8e-09, Identities = 34/79 (43%), Positives = 52/79 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++LR+   +K+
  S:     1 MLKLRLKRCGRKQQAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 79
>gi|145219742|ref|YP_001130451.1| 30S ribosomal protein S16 [Prosthecochloris vibrioformis DSM 265] >gi|145205906|gb|ABP36949.1| SSU ribosomal protein S16P [Prosthecochloris vibrioformis DSM 265] (217 aa)
Score = 151, Expect = 8.0e-09, Identities = 39/76 (51%), Positives = 52/76 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVKIRL R GR KLP ++IV  DSRA RDG ++E VG Y+P      V I+ E    W++ GAQP+ TV++L+R  G+
  S:     1 MVKIRLRRAGRKKLPVYQIVAADSRAPRDGKFLEVVGHYQPTAKPHTVTIDRERVAYWMQTGAQPTATVRSLIRMTGL 78
>gi|59800630|ref|YP_207342.1| 30S ribosomal protein S16 [Neisseria gonorrhoeae FA 1090] >gi|194097808|ref|YP_002000851.1| 30S ribosomal protein S16 [Neisseria gonorrhoeae NCCP11945] >gi|75432591|sp|Q5FA57|RS16_NEIG1 30S ribosomal protein S16 >gi|59717525|gb|AAW88930.1| putative ribosomal protein S16 [Neisseria gonorrhoeae FA 1090] >gi|193933098|gb|ACF28922.1| 30S ribosomal protein S16 [Neisseria gonorrhoeae NCCP11945] (81 aa)
Score = 151, Expect = 8.0e-09, Identities = 35/74 (47%), Positives = 49/74 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           MV IRL R G    PF+ ++V DSR+RRDG +IE+VG Y P     +  V +N +    W+ +GAQ SD+V  L++EQ
  S:     1 MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANEKQERVRLNADRLNHWIAQGAQVSDSVAKLIKEQ 78
>gi|157163973|ref|YP_001466988.1| ribosomal protein S16 [Campylobacter concisus 13826] >gi|112800907|gb|EAT98251.1| ribosomal protein S16 [Campylobacter concisus 13826] (100 aa)
Score = 151, Expect = 8.2e-09, Identities = 34/69 (49%), Positives = 44/69 (63%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           +RLTR+GR K PF+RIVV DSR RRD  +IE +G Y P     V+N N+E    W   GA+ SD V  + +
  S:    30 VRLTRMGRKKRPFYRIVVTDSRKRRDSGWIESIGYYNPMVEPNVINFNKERLDYWKSVGAKLSDRVAQITK 100
>gi|121604367|ref|YP_981696.1| ribosomal protein S16 [Polaromonas naphthalenivorans CJ2] >gi|166201330|sp|A1VM97|RS16_POLNA 30S ribosomal protein S16 >gi|120593336|gb|ABM36775.1| SSU ribosomal protein S16P [Polaromonas naphthalenivorans CJ2] (91 aa)
Score = 151, Expect = 8.7e-09, Identities = 35/75 (46%), Positives = 46/75 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           MV IRL+R G    PFF IVV D R RRDG +IE++G Y P     E  + I ++    W+  GAQ S TV  L+++ G
  S:     1 MVVIRLSRGGSKHRPFFNIVVADKRVRRDGRFIERIGFYNPIAKGGEEGLRIVQDRLTHWIGVGAQASPTVLRLIKQGG 79
>gi|78186828|ref|YP_374871.1| 30S ribosomal protein S16 [Pelodictyon luteolum DSM 273] >gi|109894780|sp|Q3B4A3|RS16_PELLD 30S ribosomal protein S16 >gi|78166730|gb|ABB23828.1| SSU ribosomal protein S16P [Pelodictyon luteolum DSM 273] (195 aa)
Score = 150, Expect = 9.2e-09, Identities = 45/126 (35%), Positives = 76/126 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKK-EVKKPEAKKAAASKPASKPSASKSASQK 126
           MVKIRL R GR KLP ++IV  D+RA RDG ++E VG Y+P     VV ++ E    W++ GAQP+ TV++L+++ G+  +    K+   +   A +++K + K+ E ++   +  + +    K A+ K
  S:     1 MVKIRLRRAGRKKLPVYQIVAADARAPRDGKFLEVVGHYQPTAKPHVVTLDRERVAYWMQTGAQPTSTVRSLIQKTGLLYELRLKKLGRSEAEVAEEMEKWQEKQAERRQKRLNVKSRRRQLKKEAAAK 129
>gi|94309693|ref|YP_582903.1| SSU ribosomal protein S16P [Ralstonia metallidurans CH34] >gi|93353545|gb|ABF07634.1| SSU ribosomal protein S16P [Ralstonia metallidurans CH34] (109 aa)
Score = 150, Expect = 9.4e-09, Identities = 37/75 (49%), Positives = 47/75 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           MV IRL R G  K PFF IV  DSR RRDG +IE++G Y P      EG+  + + +A  W   GAQ S TV  L+++ G
  S:    27 MVVIRLARGGSKKRPFFNIVATDSRNRRDGRFIERIGFYNPLASEKEEGLRVVQDRLAY-WQGVGAQLSPTVARLVKQAG 105
>gi|15836712|ref|NP_297400.1| 30S ribosomal protein S16 [Xylella fastidiosa 9a5c] >gi|14195201|sp|Q9PH39|RS16_XYLFA 30S ribosomal protein S16 >gi|9104887|gb|AAF82920.1|AE003864_8 30S ribosomal protein S16 [Xylella fastidiosa 9a5c] (86 aa)
Score = 150, Expect = 9.7e-09, Identities = 39/73 (53%), Positives = 50/73 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF++I+V DSR +RDG  IE+VG Y P     E  V +N      W+K GAQ +D V++LL+E
  S:     1 MVKIRLTRGGAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNMARVEHWVKNGAQLTDKVRSLLKE 77
>gi|77165723|ref|YP_344248.1| ribosomal protein S16 [Nitrosococcus oceani ATCC 19707] >gi|109894776|sp|Q3J8X8|RS16_NITOC 30S ribosomal protein S16 >gi|76884037|gb|ABA58718.1| SSU ribosomal protein S16P [Nitrosococcus oceani ATCC 19707] (80 aa)
Score = 150, Expect = 9.9e-09, Identities = 36/72 (50%), Positives = 47/72 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+ IVV D R++RDG YIE++G + P     E  + I+ E A  WL +GAQPS+ V  L +
  S:     1 MVIIRLARGGAKKRPFYSIVVADKRSKRDGRYIEQLGFFNPIAAGGEVPLRIDMERANYWLSQGAQPSERVAQLFK 76
>gi|15676497|ref|NP_273636.1| 30S ribosomal protein S16 [Neisseria meningitidis MC58] >gi|15793769|ref|NP_283591.1| 30S ribosomal protein S16 [Neisseria meningitidis Z2491] >gi|121634387|ref|YP_974632.1| 30S ribosomal protein S16 [Neisseria meningitidis FAM18] >gi|161869524|ref|YP_001598691.1| 30S ribosomal protein S16 [Neisseria meningitidis 053442] >gi|166201323|sp|A1KSK1|RS16_NEIMF 30S ribosomal protein S16 >gi|189029605|sp|A9M2D3|RS16_NEIM0 30S ribosomal protein S16 >gi|54039400|sp|P66438|RS16_NEIMB 30S ribosomal protein S16 >gi|54042137|sp|P66437|RS16_NEIMA 30S ribosomal protein S16 >gi|7225822|gb|AAF41020.1| 30S ribosomal protein S16 [Neisseria meningitidis MC58] >gi|120866093|emb|CAM09831.1| putative 30S ribosomal protein S16 [Neisseria meningitidis FAM18] >gi|121051737|emb|CAM08041.1| putative 30S ribosomal protein S16 [Neisseria meningitidis Z2491] >gi|161595077|gb|ABX72737.1| 30S ribosomal protein S16 [Neisseria meningitidis 053442] (81 aa)
Score = 150, Expect = 1.0e-08, Identities = 35/74 (47%), Positives = 49/74 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           MV IRL R G    PF+ ++V DSR+RRDG +IE+VG Y P     +  V +N +    W+ +GAQ SD+V  L++EQ
  S:     1 MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANEKQERVRLNADRLNHWIAQGAQVSDSVAKLIKEQ 78
>gi|88811738|ref|ZP_01126992.1| Ribosomal protein S16 [Nitrococcus mobilis Nb-231] >gi|88791129|gb|EAR22242.1| Ribosomal protein S16 [Nitrococcus mobilis Nb-231] (89 aa)
Score = 150, Expect = 1.1e-08, Identities = 33/71 (46%), Positives = 48/71 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           MV IRL R G  K PF+ +VV + R+RRDG +IE++G + P     E  + ++ E A  WLK+GAQPS++   L+
  S:     1 MVTIRLARGGAKKRPFYHVVVANVRSRRDGRFIERLGFFNPIAAGNEIPLQLDLERAEYWLKQGAQPSESAAQLI 75
>gi|28198018|ref|NP_778332.1| 30S ribosomal protein S16 [Xylella fastidiosa Temecula1] >gi|71899240|ref|ZP_00681402.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|182680644|ref|YP_001828804.1| ribosomal protein S16 [Xylella fastidiosa M23] >gi|31076886|sp|Q87F56|RS16_XYLFT 30S ribosomal protein S16 >gi|28056078|gb|AAO27981.1| 30S ribosomal protein S16 [Xylella fastidiosa Temecula1] >gi|71730973|gb|EAO33042.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|182630754|gb|ACB91530.1| ribosomal protein S16 [Xylella fastidiosa M23] (86 aa)
Score = 150, Expect = 1.1e-08, Identities = 38/73 (52%), Positives = 50/73 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF++I+V DSR +RDG  IE+VG Y P     E  V +N      W++ GAQ +D V++LL+E
  S:     1 MVKIRLTRGGAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNMARVEHWVRNGAQLTDKVRSLLKE 77
>gi|84683442|ref|ZP_01011345.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2654] >gi|84668185|gb|EAQ14652.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2654] (130 aa)
Score = 150, Expect = 1.1e-08, Identities = 40/78 (51%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ +   +WL KGAQP+D V  +L   GV +K
  S:     1 MKIRLARGGTKKRPFYRIVAADSRMARDGRFIEKLGTYNPLLPKDSEERVKMDLDAVKAWLDKGAQPTDRVARMLEAAGVLEK 83
>gi|14195683|sp|P12151|RR16_ORYSJ Chloroplast 30S ribosomal protein S16 >gi|68053143|sp|Q6ENJ5|RR16_ORYNI Chloroplast 30S ribosomal protein S16 >gi|148839655|sp|P0C474|RR16_ORYSI Chloroplast 30S ribosomal protein S16 >gi|148897903|sp|P0C473|RR16_ORYSA Chloroplast 30S ribosomal protein S16 (85 aa)
Score = 150, Expect = 1.1e-08, Identities = 34/79 (43%), Positives = 52/79 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++LR+   +K+
  S:     1 MLKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVSDILRKAEFFKE 79
>gi|114320045|ref|YP_741728.1| SSU ribosomal protein S16P [Alkalilimnicola ehrlichei MLHE-1] >gi|114226439|gb|ABI56238.1| SSU ribosomal protein S16P [Alkalilimnicola ehrlichei MLHE-1] (117 aa)
Score = 149, Expect = 1.2e-08, Identities = 36/73 (49%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE++G + P     E  + ++ E A  WL KGA+PS+    LLR+
  S:    30 MVTIRLARTGAKKRPFYHIVVTDSRNPRDGRFIERLGFFNPIAAGKEEPLRVDVERARHWLDKGARPSERAAQLLRK 106
>gi|189500234|ref|YP_001959704.1| ribosomal protein S16 [Chlorobium phaeobacteroides BS1] >gi|189495675|gb|ACE04223.1| ribosomal protein S16 [Chlorobium phaeobacteroides BS1] (134 aa)
Score = 149, Expect = 1.3e-08, Identities = 44/123 (35%), Positives = 72/123 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF-MDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSA 123
           MVKIRL R GR KLP ++IV  D+RA RDG ++E +G Y+P      + +++E    WL  GAQP+ T  +L+R  G+  +  M  K +S++E  A   + + ++ E ++   +    +  A K+A
  S:     1 MVKIRLRRAGRKKLPVYQIVAADARAPRDGKFLEVIGHYQPTAKPHAITLDKERVAYWLGVGAQPTTTAHSLIRATGLLHEMNMKRKGRSEEEIAAEMEQWQARQNERREKRLAIKTRRRQAKKAA 126
>gi|7525015|ref|NP_051041.1| ribosomal protein S16 [Arabidopsis thaliana] >gi|6685910|sp|P56806|RR16_ARATH Chloroplast 30S ribosomal protein S16 >gi|5881676|dbj|BAA84367.1| ribosomal protein S16 [Arabidopsis thaliana] (79 aa)
Score = 149, Expect = 1.4e-08, Identities = 32/79 (40%), Positives = 49/79 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR +   +RI+ ID R RR+G  + KVG Y+P      +N    L +LKKGAQP+ T  ++ ++ G++ +
  S:     1 MVKLRLKRCGRKQRAVYRILAIDVRYRREGRDLSKVGFYDPITNQTFLNLSAILDFLKKGAQPTRTAHDISKKAGIFTE 79
>gi|114777207|ref|ZP_01452218.1| 30S ribosomal protein S16 [Mariprofundus ferrooxydans PV-1] >gi|114552352|gb|EAU54835.1| 30S ribosomal protein S16 [Mariprofundus ferrooxydans PV-1] (79 aa)
Score = 149, Expect = 1.4e-08, Identities = 33/68 (48%), Positives = 49/68 (72%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLL 71
           IRL+R GR K PF+ +VV+D R RRDGA+IEK+G ++P +   V+ ++ E   +W  +GAQ SD V +L+
  S:     5 IRLSRGGRKKRPFYSVVVMDGRKRRDGAFIEKLGYFDPCKDPEVIQLDLERVKAWTDQGAQVSDRVASLI 74
>gi|167648843|ref|YP_001686506.1| ribosomal protein S16 [Caulobacter sp. K31] >gi|189044370|sp|B0T562|RS16_CAUSK 30S ribosomal protein S16 >gi|167351273|gb|ABZ74008.1| ribosomal protein S16 [Caulobacter sp. K31] (185 aa)
Score = 149, Expect = 1.4e-08, Identities = 49/125 (39%), Positives = 63/125 (50%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQ 125
           M+KIRL R G  K P++ IVV DS + RDG +IEKVGTY P         V +  E   +WL KGAQP+D V   L  QG+        VQ    +N  K K   K  E       + A + +A   A +
  S:     1 MLKIRLARGGAKKRPYYSIVVADSHSPRDGRFIEKVGTYNPLLKKDDAARVTLKVESIQAWLAKGAQPTDRVARFLAAQGL--------VQWTHGNNPEKAKPGKKAQERDAERTQRDADRVAAEAQAKE 122
>gi|71275922|ref|ZP_00652205.1| Ribosomal protein S16 [Xylella fastidiosa Dixon] >gi|71900008|ref|ZP_00682153.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|170729324|ref|YP_001774757.1| 30S ribosomal protein S16 [Xylella fastidiosa M12] >gi|71163299|gb|EAO13018.1| Ribosomal protein S16 [Xylella fastidiosa Dixon] >gi|71730218|gb|EAO32304.1| Ribosomal protein S16 [Xylella fastidiosa Ann-1] >gi|167964117|gb|ACA11127.1| 30S ribosomal protein S16 [Xylella fastidiosa M12] (86 aa)
Score = 149, Expect = 1.5e-08, Identities = 38/73 (52%), Positives = 50/73 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF++I+V DSR +RDG  IE+VG Y P     E  V +N      W++ GAQ +D V++LL+E
  S:     1 MVKIRLTRGGAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNVARVEHWVRNGAQLTDKVRSLLKE 77
>gi|15792059|ref|NP_281882.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237012|ref|YP_178814.1| 30S ribosomal protein S16 [Campylobacter jejuni RM1221] >gi|86149903|ref|ZP_01068132.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151659|ref|ZP_01069873.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153527|ref|ZP_01071731.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596904|ref|ZP_01100140.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612199|ref|YP_001000406.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926675|ref|ZP_01810356.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CG8486] >gi|153952325|ref|YP_001398345.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. doylei 269.97] >gi|157414997|ref|YP_001482253.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005348|ref|ZP_02271106.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81-176] >gi|166234408|sp|A7H4B5|RS16_CAMJD 30S ribosomal protein S16 >gi|166234409|sp|A1VZ65|RS16_CAMJJ 30S ribosomal protein S16 >gi|172047103|sp|A8FLD9|RS16_CAMJ8 30S ribosomal protein S16 >gi|14195205|sp|Q9PPJ7|RS16_CAMJE 30S ribosomal protein S16 >gi|81557523|sp|Q5HV71|RS16_CAMJR 30S ribosomal protein S16 >gi|57165816|gb|AAW34595.1| ribosomal protein S16 [Campylobacter jejuni RM1221] >gi|85839721|gb|EAQ56981.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841288|gb|EAQ58536.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843253|gb|EAQ60464.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249405|gb|EAQ72365.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190593|gb|EAQ94566.1| ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 84-25] >gi|107784832|gb|ABF83907.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. doylei] >gi|112360055|emb|CAL34847.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145845194|gb|EDK22289.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni CG8486] >gi|152939771|gb|ABS44512.1| ribosomal protein S16 [Campylobacter jejuni subsp. doylei 269.97] >gi|157385961|gb|ABV52276.1| 30S ribosomal protein S16 [Campylobacter jejuni subsp. jejuni 81116] (75 aa)
Score = 148, Expect = 1.5e-08, Identities = 35/70 (50%), Positives = 45/70 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+RIVV DSR RRDG +IE +G Y P     V+ ++ E    W   GA+ SD V ++
  S:     1 MTVIRLTRMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEPEVIKVDAERLAYWKSVGAKLSDKVASI 72
>gi|15639890|ref|NP_219340.1| ribosomal protein S16 (rpsP) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026128|ref|YP_001933900.1| ribosomal protein S16 [Treponema pallidum subsp. pallidum SS14] >gi|6094161|sp|O83875|RS16_TREPA 30S ribosomal protein S16 >gi|3323218|gb|AAC65857.1| ribosomal protein S16 (rpsP) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018703|gb|ACD71321.1| ribosomal protein S16 [Treponema pallidum subsp. pallidum SS14] (123 aa)
Score = 148, Expect = 1.6e-08, Identities = 35/73 (47%), Positives = 51/73 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE---GVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           ++IRL +LG  K P++RIVV D+R  RDG  IE++G Y+P       V+   + A  WL++GAQPSDTV+ LL+ +
  S:     3 LRIRLKKLGSKKRPYYRIVVQDAREPRDGRAIEELGIYQPIAPKGTEVSFRLDRARFWLERGAQPSDTVRRLLQSR 78
>gi|84501323|ref|ZP_00999528.1| ribosomal protein S16 [Oceanicola batsensis HTCC2597] >gi|84390614|gb|EAQ03102.1| ribosomal protein S16 [Oceanicola batsensis HTCC2597] (131 aa)
Score = 148, Expect = 1.7e-08, Identities = 40/78 (51%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ +   +WL KGAQP+D V   L   GV +K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDIDKIKAWLDKGAQPTDRVSRFLEAAGVIEK 85
>gi|57167722|ref|ZP_00366862.1| ribosomal protein S16 [Campylobacter coli RM2228] >gi|57020844|gb|EAL57508.1| ribosomal protein S16 [Campylobacter coli RM2228] (75 aa)
Score = 148, Expect = 1.7e-08, Identities = 36/70 (51%), Positives = 44/70 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+RIVV DSR RRDG +IE +G Y P     VV  + E    W   GA+ SD V ++
  S:     1 MTVIRLTRMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEPEVVKFDSERLAYWKSVGAKLSDKVASI 72
>gi|16127882|ref|NP_422446.1| ribosomal protein S16 [Caulobacter crescentus CB15] >gi|14195192|sp|P58122|RS16_CAUCR 30S ribosomal protein S16 >gi|13425408|gb|AAK25614.1| ribosomal protein S16 [Caulobacter crescentus CB15] (165 aa)
Score = 148, Expect = 1.8e-08, Identities = 40/76 (52%), Positives = 48/76 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+KIRL R G  K P++ IVV DS + RDG +IEKVGTY P         V +  E    WLKKGAQP+D V   L  QG+
  S:     1 MLKIRLARGGAKKRPYYSIVVADSHSPRDGRFIEKVGTYNPLLKKDDANRVTLKVESIQEWLKKGAQPTDRVARFLAAQGL 81
>gi|15598940|ref|NP_252434.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa PAO1] >gi|107103260|ref|ZP_01367178.1| hypothetical protein PaerPA_01004329 [Pseudomonas aeruginosa PACS2] >gi|152985539|ref|YP_001346758.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa PA7] >gi|194547639|ref|YP_002082667.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa C3719] >gi|194553421|ref|YP_002088448.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa 2192] >gi|166201336|sp|A6V123|RS16_PSEA7 30S ribosomal protein S16 >gi|14195196|sp|Q9HXP9|RS16_PSEAE 30S ribosomal protein S16 >gi|9949913|gb|AAG07132.1|AE004793_9 30S ribosomal protein S16 [Pseudomonas aeruginosa PAO1] >gi|126168585|gb|EAZ54096.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa C3719] >gi|126195814|gb|EAZ59877.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa 2192] >gi|150960697|gb|ABR82722.1| ribosomal protein S16 [Pseudomonas aeruginosa PA7] (83 aa)
Score = 148, Expect = 1.8e-08, Identities = 32/73 (43%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V +SR  RDG ++E++G + P     E  +++++E A  WL +GAQPS+ V  LL++
  S:     1 MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERIGFFNPVATGGEVRLSVDQERATYWLGQGAQPSERVAQLLKD 77
>gi|57242692|ref|ZP_00370629.1| ribosomal protein S16 [Campylobacter upsaliensis RM3195] >gi|57016621|gb|EAL53405.1| ribosomal protein S16 [Campylobacter upsaliensis RM3195] (75 aa)
Score = 148, Expect = 1.9e-08, Identities = 36/70 (51%), Positives = 44/70 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+RIVV DSR RRDG +IE +G Y P     VV  + E    W   GA+ SD V ++
  S:     1 MTVIRLTRMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEPEVVKFDAERLAYWKSVGAKLSDKVASI 72
>gi|116051743|ref|YP_789418.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa UCBPP-PA14] >gi|122260886|sp|Q02RL8|RS16_PSEAB 30S ribosomal protein S16 >gi|115586964|gb|ABJ12979.1| 30S ribosomal protein S16 [Pseudomonas aeruginosa UCBPP-PA14] (83 aa)
Score = 147, Expect = 2.0e-08, Identities = 32/73 (43%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V +SR  RDG ++E++G + P     E  +++++E A  WL +GAQPS+ V  LL++
  S:     1 MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERIGFFNPVATGGEVRLSVDQERATYWLAQGAQPSERVAQLLKD 77
>gi|82701703|ref|YP_411269.1| 30S ribosomal protein S16 [Nitrosospira multiformis ATCC 25196] >gi|109894775|sp|Q2YBJ4|RS16_NITMU 30S ribosomal protein S16 >gi|82409768|gb|ABB73877.1| SSU ribosomal protein S16P [Nitrosospira multiformis ATCC 25196] (87 aa)
Score = 147, Expect = 2.0e-08, Identities = 38/73 (52%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PFF +VV DSR  RDG +IE+VG Y P     E  + +  +    W  KGAQPSDTVK L+++
  S:     1 MVIIRLARGGAKKRPFFNMVVADSRNARDGKFIERVGFYNPRAAEGEESLRVKLDRVTYWQSKGAQPSDTVKKLIKQ 77
>gi|91214929|ref|ZP_01251901.1| 30S ribosomal protein S16 [Psychroflexus torquis ATCC 700755] >gi|91186534|gb|EAS72905.1| 30S ribosomal protein S16 [Psychroflexus torquis ATCC 700755] (183 aa)
Score = 147, Expect = 2.1e-08, Identities = 37/78 (47%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R G+   PFF IV  D+RA+RDG Y+EK+G Y P      + +N + ++ WL+ GAQP+DT K +L  +G   K
  S:     3 VKIRLQRHGKKGKPFFWIVAADARAKRDGKYLEKLGIYNPVTQPATIELNVDSSVKWLRNGAQPTDTAKRILSYKGAMMK 82
>gi|56698085|ref|YP_168456.1| 30S ribosomal protein S16 [Silicibacter pomeroyi DSS-3] >gi|81558324|sp|Q5LNF2|RS16_SILPO 30S ribosomal protein S16 >gi|56679822|gb|AAV96488.1| ribosomal protein S16 [Silicibacter pomeroyi DSS-3] (121 aa)
Score = 147, Expect = 2.2e-08, Identities = 39/78 (50%), Positives = 48/78 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    WL +GAQ +D V  +L   GV  K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDVERVQYWLSQGAQTTDRVARMLEAAGVVGK 85
>gi|50346764|ref|YP_053137.1| ribosomal protein S16 [Nymphaea alba] >gi|68053166|sp|Q6EW66|RR16_NYMAL Chloroplast 30S ribosomal protein S16 >gi|50250309|emb|CAF28575.1| ribosomal protein S16 [Nymphaea alba] (86 aa)
Score = 147, Expect = 2.5e-08, Identities = 33/80 (41%), Positives = 52/80 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RI+ ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV ++ ++  V+K+ 
  S:     1 MVKLRLKRCGRRQRATYRIIAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKAEVFKEL 80
>gi|78188775|ref|YP_379113.1| 30S ribosomal protein S16 [Chlorobium chlorochromatii CaD3] >gi|109893871|sp|Q3ASF5|RS16_CHLCH 30S ribosomal protein S16 >gi|78170974|gb|ABB28070.1| SSU ribosomal protein S16P [Chlorobium chlorochromatii CaD3] (136 aa)
Score = 146, Expect = 2.7e-08, Identities = 38/98 (38%), Positives = 60/98 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKK 98
           MVKIRL R GR K+P ++IVV DSR+ RDG ++E VG Y+P      + + ++    W+  GAQP+ TV +L+R  G+  +    K+   +   A +++K
  S:     1 MVKIRLKRAGRKKMPVYQIVVADSRSPRDGKFLEVVGHYQPTLKPHSITLKKDRVEYWMHCGAQPTATVNSLIRATGLLYELRMKKLGRSEADIATEMEK 100
>gi|34500896|ref|NP_904081.1| ribosomal protein S16 [Amborella trichopoda] >gi|68053180|sp|Q70Y15|RR16_AMBTC Chloroplast 30S ribosomal protein S16 >gi|34481611|emb|CAD45091.1| ribosomal protein S16 [Amborella trichopoda] (78 aa)
Score = 146, Expect = 2.7e-08, Identities = 35/78 (44%), Positives = 50/78 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R GR +   +RIV ID R+RRDG  + KVG Y+P +     N    L +L+KGAQP+ TV ++ ++  V+K
  S:     1 MVKLRLKRCGRKQRVIYRIVAIDVRSRRDGRALRKVGFYDPIKNQTYSNVPAILYFLEKGAQPTVTVHDISKKAEVFK 78
>gi|78356146|ref|YP_387595.1| 30S ribosomal protein S16 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|109893879|sp|Q313J6|RS16_DESDG 30S ribosomal protein S16 >gi|78218551|gb|ABB37900.1| SSU ribosomal protein S16P [Desulfovibrio desulfuricans G20] (79 aa)
Score = 146, Expect = 2.8e-08, Identities = 33/74 (44%), Positives = 50/74 (67%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           VK+RLTR+G  K  F+RI+ I+S ARR+G  ++ +G Y P      V I+ E    WL++GA+P+DTV+ LL++  
  S:     3 VKLRLTRMGNKKRAFYRIIAINSEARREGRPLDYIGYYNPMVDPAEVKIDTEKVQKWLERGAEPTDTVRALLKKNA 78
>gi|118591422|ref|ZP_01548820.1| probable 30s ribosomal protein s16 [Stappia aggregata IAM 12614] >gi|118436094|gb|EAV42737.1| probable 30s ribosomal protein s16 [Stappia aggregata IAM 12614] (132 aa)
Score = 146, Expect = 2.8e-08, Identities = 43/99 (43%), Positives = 58/99 (58%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVK 101
           KIRL R G  K P++RIVV D R+ RDG +IEKVG+Y+P      E  V +N E    WL  GA+P+D V   L   G+ K+  + +   KK     K K+ V+
  S:     4 KIRLARGGSKKRPYYRIVVADIRSPRDGRFIEKVGSYDPMLPKDSENRVTLNVERIQHWLDNGAKPTDRVHRFLDAAGLLKR--EPRHNPKKAELGAKAKERVE 105
>gi|34499130|ref|NP_903345.1| 30S ribosomal protein S16 [Chromobacterium violaceum ATCC 12472] >gi|54039435|sp|Q7NRV5|RS16_CHRVO 30S ribosomal protein S16 >gi|34104981|gb|AAQ61337.1| 30S ribosomal protein S16 [Chromobacterium violaceum ATCC 12472] (83 aa)
Score = 146, Expect = 2.9e-08, Identities = 38/76 (50%), Positives = 46/76 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MV IRL R G    PF+ IVV DSR RRDG +IE+VG Y P     +  V    +    W+  GAQ SD+V  LL+EQ V
  S:     1 MVVIRLARGGAKNRPFYNIVVTDSRNRRDGRFIERVGFYNPVANEKQERVRFTMDRLNYWVGVGAQLSDSVAKLLKEQKV 80
>gi|115477302|ref|NP_001062247.1| Os08g0517900 [Oryza sativa (japonica cultivar-group)] >gi|28411847|dbj|BAC57322.1| 30S ribosomal protein S16-like [Oryza sativa Japonica Group] >gi|113624216|dbj|BAF24161.1| Os08g0517900 [Oryza sativa (japonica cultivar-group)] >gi|125562195|gb|EAZ07643.1| hypothetical protein OsI_028875 [Oryza sativa (indica cultivar-group)] >gi|125604019|gb|EAZ43344.1| hypothetical protein OsJ_026827 [Oryza sativa (japonica cultivar-group)] (137 aa)
Score = 146, Expect = 2.9e-08, Identities = 31/76 (40%), Positives = 47/76 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           +V+IRL R G    PF+R++  DSR+ RDG ++E +G Y+P  G      + +  +    WL  GAQPSD V+ +L   G+
  S:     2 VVRIRLARFGCRNRPFYRLMAADSRSPRDGKHLEVLGYYDPLPGKDGGKRMGLKFDRVKYWLSVGAQPSDPVERILYRAGI 82
>gi|99082447|ref|YP_614601.1| 30S ribosomal protein S16 [Silicibacter sp. TM1040] >gi|123378659|sp|Q1GDC7|RS16_SILST 30S ribosomal protein S16 >gi|99038727|gb|ABF65339.1| SSU ribosomal protein S16P [Silicibacter sp. TM1040] (121 aa)
Score = 146, Expect = 2.9e-08, Identities = 41/78 (52%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E   +WL KGAQP+D V  +L   GV +K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDIEKIQAWLDKGAQPTDRVARMLEAAGVREK 85
>gi|58425542|gb|AAW74579.1| 30S ribosomal protein S16 [Xanthomonas oryzae pv. oryzae KACC10331] (128 aa)
Score = 146, Expect = 3.0e-08, Identities = 36/73 (49%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF+ I+V D R+ RDG  IE++G Y P     E  V ++      W+  GAQ +D V+NL RE
  S:    44 MVKIRLTRGGAKKRPFYHIIVTDVRSARDGRNIERLGYYNPVAQGAEPRVVLDTARVDHWVGNGAQLTDKVRNLYRE 120
>gi|71066573|ref|YP_265300.1| 30S ribosomal protein S16 [Psychrobacter arcticus 273-4] >gi|93007146|ref|YP_581583.1| 30S ribosomal protein S16 [Psychrobacter cryohalolentis K5] >gi|109894788|sp|Q4FQ42|RS16_PSYA2 30S ribosomal protein S16 >gi|109894789|sp|Q1Q8A4|RS16_PSYCK 30S ribosomal protein S16 >gi|71039558|gb|AAZ19866.1| SSU ribosomal protein S16P [Psychrobacter arcticus 273-4] >gi|92394824|gb|ABE76099.1| SSU ribosomal protein S16P [Psychrobacter cryohalolentis K5] (89 aa)
Score = 146, Expect = 3.3e-08, Identities = 36/72 (50%), Positives = 46/72 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+++VV D R  RDG YIE +G + P     E  V +N E   +W+ KGAQPSD V +L +
  S:     1 MVVIRLARGGAKKRPFYQVVVADQRRARDGRYIENIGFFNPLAKDSEEAVRLNMEAYNAWVAKGAQPSDRVASLAK 76
>gi|110678634|ref|YP_681641.1| 30S ribosomal protein S16 [Roseobacter denitrificans OCh 114] >gi|122972957|sp|Q16AN8|RS16_ROSDO 30S ribosomal protein S16 >gi|109454750|gb|ABG30955.1| ribosomal protein S16 [Roseobacter denitrificans OCh 114] (122 aa)
Score = 145, Expect = 3.4e-08, Identities = 39/78 (50%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    WL +GAQP+D V  +L   G+ +K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDAERVQYWLGQGAQPTDRVARMLEAAGLREK 85
>gi|88656965|gb|ABD47215.1| ribosomal protein S16 [Lactuca sativa] (84 aa)
Score = 145, Expect = 3.4e-08, Identities = 35/86 (40%), Positives = 56/86 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQ 86
           MVK+RL R GR +    RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K+   ++ +
  S:     1 MVKLRLKRCGRKQ----RIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKELCPNQTK 82
>gi|34556967|ref|NP_906782.1| 30S ribosomal protein S16 [Wolinella succinogenes DSM 1740] >gi|54039432|sp|Q7MSD9|RS16_WOLSU 30S ribosomal protein S16 >gi|34482682|emb|CAE09682.1| 30S ribosomal protein S16 , WSU0548 [Wolinella succinogenes] (77 aa)
Score = 145, Expect = 3.4e-08, Identities = 35/67 (52%), Positives = 43/67 (64%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNL 70
           IRLTRLGR K PF+R+VV DSR RRDG ++E +G Y P     VV  + E    W+  GA+ SD V  L
  S:     5 IRLTRLGRKKKPFYRMVVTDSRKRRDGGWVEAIGYYNPLAETPVVKFDAERLKYWVSVGAKMSDRVATL 73
>gi|37522207|ref|NP_925584.1| 30S ribosomal protein S16 [Gloeobacter violaceus PCC 7421] >gi|54039434|sp|Q7NH99|RS16_GLOVI 30S ribosomal protein S16 >gi|35213207|dbj|BAC90579.1| 30S ribosomal protein S16 [Gloeobacter violaceus PCC 7421] (89 aa)
Score = 145, Expect = 3.5e-08, Identities = 35/72 (48%), Positives = 49/72 (68%)
  Q:     6 LTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV------VNINEEIALSWLKKGAQPSDTVKNLLREQGVW 77
           + R+G  K P +RIVV DSR+RRDGA IE++G Y+P          V ++ E A  WL  GA+PS+TV+ LL+   V+
  S:     1 MKRIGAKKKPVYRIVVTDSRSRRDGAVIEEIGFYDPRANTEKGLPEVTLDVEAARRWLSHGARPSETVQGLLKRAQVY 78
>gi|78776652|ref|YP_392967.1| 30S ribosomal protein S16 [Sulfurimonas denitrificans DSM 1251] >gi|109894817|sp|Q30TE9|RS16_THIDN 30S ribosomal protein S16 >gi|78497192|gb|ABB43732.1| SSU ribosomal protein S16P [Sulfurimonas denitrificans DSM 1251] (76 aa)
Score = 145, Expect = 3.7e-08, Identities = 34/67 (50%), Positives = 43/67 (64%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNL 70
           IRLTR+GR K PF+RI V DSR RRDG +IE +G + P   E    ++ E    WL  GA+ SD VK +
  S:     5 IRLTRMGRKKQPFYRIAVTDSRKRRDGGWIELIGHHNPMVAEKTTVVDNERLDYWLSVGAKMSDRVKKI 73
>gi|114799489|ref|YP_758772.1| ribosomal protein S16 [Hyphomonas neptunium ATCC 15444] >gi|123129271|sp|Q0C671|RS16_HYPNA 30S ribosomal protein S16 >gi|114739663|gb|ABI77788.1| ribosomal protein S16 [Hyphomonas neptunium ATCC 15444] (147 aa)
Score = 145, Expect = 3.8e-08, Identities = 48/107 (44%), Positives = 60/107 (56%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKA 108
           +KIRL R G  K PF+ IVV D+RA RDG +IEK+GTY+P         V +N E A  W+KKGAQP+D V   L +  V     D K      H  N  K E  K   ++A
  S:     3 LKIRLARGGSKKRPFYSIVVADARAPRDGRFIEKIGTYDPRLAKDSGDRVKVNAEKAAEWIKKGAQPTDRVARFLSKVEV-----DGKAVVAWTHGNNPKKAEPGKKAQERA 109
>gi|163847610|ref|YP_001635654.1| ribosomal protein S16 [Chloroflexus aurantiacus J-10-fl] >gi|187599130|ref|ZP_02985364.1| ribosomal protein S16 [Chloroflexus sp. Y-400-fl] >gi|189044371|sp|A9WEK3|RS16_CHLAA 30S ribosomal protein S16 >gi|163668899|gb|ABY35265.1| ribosomal protein S16 [Chloroflexus aurantiacus J-10-fl] >gi|187488562|gb|EDU26529.1| ribosomal protein S16 [Chloroflexus sp. Y-400-fl] (89 aa)
Score = 145, Expect = 3.8e-08, Identities = 38/76 (50%), Positives = 48/76 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MVKIRL R G+ K P +RIVV DSR+ RDG +IE +G Y P     V+ I  + A  WL  GAQP++ V  LL+   V
  S:     1 MVKIRLRRTGKTKQPSYRIVVADSRSPRDGKFIETIGYYLPTRQPKVLEIKADRARYWLGVGAQPTEVVVKLLKRVNV 78
>gi|83951194|ref|ZP_00959927.1| ribosomal protein S16 [Roseovarius nubinhibens ISM] >gi|83839093|gb|EAP78389.1| ribosomal protein S16 [Roseovarius nubinhibens ISM] (134 aa)
Score = 145, Expect = 4.1e-08, Identities = 40/78 (51%), Positives = 49/78 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    WL +GAQP+D V   L   GV +K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDMERVQYWLGQGAQPTDRVSRFLEAAGVVEK 85
>gi|85706776|ref|ZP_01037868.1| ribosomal protein S16 [Roseovarius sp. 217] >gi|85668834|gb|EAQ23703.1| ribosomal protein S16 [Roseovarius sp. 217] (132 aa)
Score = 145, Expect = 4.2e-08, Identities = 39/78 (50%), Positives = 49/78 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    WL +GAQP+D +  +L   GV  K
  S:     1 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDVERIQHWLAQGAQPTDRISRMLETAGVVAK 83
>gi|86742275|ref|YP_482675.1| SSU ribosomal protein S16P [Frankia sp. CcI3] >gi|109893882|sp|Q2J6Z6|RS16_FRASC 30S ribosomal protein S16 >gi|86569137|gb|ABD12946.1| SSU ribosomal protein S16P [Frankia sp. CcI3] (148 aa)
Score = 145, Expect = 4.3e-08, Identities = 43/121 (35%), Positives = 66/121 (54%)
  Q:     3 KIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKV---QSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSA 123
           KI+L RLG+ + P +RIVV D+R +RDG  IE +G Y P     ++ ++ E    WL  GAQP++ V  +L+  G W+KF +          E  A+K +       A   A  +PA+ P  +K +
  S:     4 KIKLQRLGKMREPHYRIVVADARTKRDGRVIESIGQYHPKSDPSIIKVDAERVGHWLSVGAQPTEPVLAILKVTGDWQKFKNLPAPPPMKVAEPKADKREIFQAAARAAAGAEDRPATTPKKAKKS 129
>gi|84622876|ref|YP_450248.1| 30S ribosomal protein S16 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|161899006|ref|YP_199964.2| 30S ribosomal protein S16 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|166713048|ref|ZP_02244255.1| 30S ribosomal protein S16 [Xanthomonas oryzae pv. oryzicola BLS256] >gi|188578073|ref|YP_001915002.1| ribosomal protein S16 [Xanthomonas oryzae pv. oryzae PXO99A] >gi|109894820|sp|Q5H392|RS16_XANOR 30S ribosomal protein S16 >gi|109894819|sp|Q2P653|RS16_XANOM 30S ribosomal protein S16 >gi|84366816|dbj|BAE67974.1| 30S ribosomal protein S16 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188522525|gb|ACD60470.1| ribosomal protein S16 [Xanthomonas oryzae pv. oryzae PXO99A] (85 aa)
Score = 145, Expect = 4.3e-08, Identities = 36/73 (49%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF+ I+V D R+ RDG  IE++G Y P     E  V ++      W+  GAQ +D V+NL RE
  S:     1 MVKIRLTRGGAKKRPFYHIIVTDVRSARDGRNIERLGYYNPVAQGAEPRVVLDTARVDHWVGNGAQLTDKVRNLYRE 77
>gi|11465818|ref|NP_053962.1| ribosomal protein S16 [Porphyra purpurea] >gi|1710695|sp|P51352|RR16_PORPU Chloroplast 30S ribosomal protein S16 >gi|1276818|gb|AAC08238.1| 30S ribosomal protein S16 [Porphyra purpurea] (82 aa)
Score = 145, Expect = 4.3e-08, Identities = 37/79 (46%), Positives = 50/79 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR + P +RIV +DSR++RDG  IE++G Y P      I+    L  LK+GAQ + TVKN+L E  +  K
  S:     1 MVKLRLKRYGRKQQPSYRIVAMDSRSKRDGKAIEELGFYNPITNETRIDIAKILKRLKQGAQTTRTVKNILNEAQIIAK 79
>gi|148652016|ref|YP_001279109.1| 30S ribosomal protein S16 [Psychrobacter sp. PRwf-1] >gi|172048452|sp|A5WBW8|RS16_PSYWF 30S ribosomal protein S16 >gi|148571100|gb|ABQ93159.1| SSU ribosomal protein S16P [Psychrobacter sp. PRwf-1] (87 aa)
Score = 144, Expect = 4.8e-08, Identities = 35/72 (48%), Positives = 47/72 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+++VV D R  RDG YIE +G Y P     E  + ++ +   +W++KGAQPSD VK L +
  S:     1 MVVIRLARGGAKKRPFYQVVVADQRRSRDGRYIENLGFYNPLAKGQEVELRLDMDAYNAWIEKGAQPSDRVKALAK 76
>gi|52840644|ref|YP_094443.1| 30S ribosomal protein S16 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54293393|ref|YP_125808.1| 30S ribosomal protein S16 [Legionella pneumophila str. Lens] >gi|54296435|ref|YP_122804.1| 30S ribosomal protein S16 [Legionella pneumophila str. Paris] >gi|148360984|ref|YP_001252191.1| 30S ribosomal protein S16 [Legionella pneumophila str. Corby] >gi|166199866|sp|A5IHJ5|RS16_LEGPC 30S ribosomal protein S16 >gi|81601536|sp|Q5WZE0|RS16_LEGPL 30S ribosomal protein S16 >gi|81602016|sp|Q5X7Y9|RS16_LEGPA 30S ribosomal protein S16 >gi|81603544|sp|Q5ZYH3|RS16_LEGPH 30S ribosomal protein S16 >gi|52627755|gb|AAU26496.1| 30S ribosomal protein S16 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53750220|emb|CAH11614.1| hypothetical protein [Legionella pneumophila str. Paris] >gi|53753225|emb|CAH14672.1| hypothetical protein [Legionella pneumophila str. Lens] >gi|148282757|gb|ABQ56845.1| 30S ribosomal protein S16 [Legionella pneumophila str. Corby] (86 aa)
Score = 144, Expect = 4.8e-08, Identities = 37/74 (50%), Positives = 48/74 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           MV IRL+R G  K PF+ +VV DSR RRDG YIE++G + P     E  ++I+ +    W K GAQ SD V  LL+E 
  S:     1 MVVIRLSRAGAKKRPFYHMVVTDSRKRRDGNYIERIGYFNPVARGQEVKLHIDMDKMTHWQKVGAQLSDRVSALLKEH 78
>gi|22711968|ref|NP_683784.1| ribosomal protein S16 [Chaetosphaeridium globosum] >gi|25009147|sp|Q8MA02|RR16_CHAGL Chloroplast 30S ribosomal protein S16 >gi|22416972|gb|AAM96572.1| ribosomal protein S16 [Chaetosphaeridium globosum] (83 aa)
Score = 144, Expect = 5.1e-08, Identities = 29/79 (36%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR + P +RI+ ID++ RR+G  ++++G Y P +  + ++ +  + +LK GA+P+DTV ++L +  V+++
  S:     1 MVKLRLKRYGRKQQPTYRIIAIDAKNRREGKALKELGFYNPIKNSIQLDVQNIILFLKNGAKPTDTVFDILNKHQVFEQ 79
>gi|94502473|ref|YP_588099.1| ribosomal protein S16 [Helianthus annuus] >gi|122237667|sp|Q1KXX7|RR16_HELAN Chloroplast 30S ribosomal protein S16 >gi|88656877|gb|ABD47128.1| ribosomal protein S16 [Helianthus annuus] (84 aa)
Score = 144, Expect = 5.3e-08, Identities = 35/80 (43%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +    RIV ID R+RR+G  + KVG Y+P +    +N    L +L+KGAQP+ TV+++L++  V+K+ 
  S:     1 MVKLRLKRCGRKQ----RIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKEL 76
>gi|83313162|ref|YP_423426.1| 30S ribosomal protein S16 [Magnetospirillum magneticum AMB-1] >gi|109893887|sp|Q2VZV8|RS16_MAGMM 30S ribosomal protein S16 >gi|82948003|dbj|BAE52867.1| Ribosomal protein S16 [Magnetospirillum magneticum AMB-1] (123 aa)
Score = 144, Expect = 5.5e-08, Identities = 41/100 (41%), Positives = 62/100 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN-----INEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVK 101
           +KIRL+R G  K PF++IVV D+RA RDG +IEKVGTY P     N     ++E+    WL  GAQP+D +     ++G+  K + ++ Q+K+     K ++  K
  S:     3 LKIRLSRGGAKKRPFYKIVVADARAPRDGRFIEKVGTYNPMLPNDNGQRWILDEDRVKHWLSVGAQPTDRLVRFFADKGLVAKPVRAE-QTKQPQPKAKAQQRAK 106
>gi|90994543|ref|YP_537033.1| 30S ribosomal protein S16 [Porphyra yezoensis] >gi|122232137|sp|Q1XDD5|RR16_PORYE Chloroplast 30S ribosomal protein S16 >gi|90819107|dbj|BAE92476.1| 30S ribosomal protein S16 [Porphyra yezoensis] (82 aa)
Score = 143, Expect = 5.9e-08, Identities = 36/73 (49%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVK+RL R GR K P +RIVV+DSR +RDG  IE++G Y P      +N    L  L +GAQ + TVKN+L +
  S:     1 MVKLRLKRYGRKKQPSYRIVVMDSRNKRDGKAIEELGFYNPINNETRVNISKILQRLSQGAQATKTVKNILNK 73
>gi|88711236|ref|ZP_01105324.1| 30S ribosomal protein S16 [Flavobacteriales bacterium HTCC2170] >gi|88710177|gb|EAR02409.1| 30S ribosomal protein S16 [Flavobacteriales bacterium HTCC2170] (212 aa)
Score = 143, Expect = 6.0e-08, Identities = 48/131 (36%), Positives = 79/131 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQGVW---------KKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTVSKK 132
           VKIRL R G+   PF+ IV  DSRA+RDG ++EK+G Y P      I  ++  ++ WL  GAQP+DT + +L  +GV          +K   ++ Q++++ NA  V+KE  K  A K +    A   + + + + +K +++K
  S:     3 VKIRLQRHGKKGKPFYWIVAADSRAKRDGKFLEKLGIYNPNTNPATIEVKVDNSVEWLNNGAQPTDTARAILSYKGVLLKHHLMGGVRKGALTEEQAEEKFNAWMVEKE--KAVASKVSGLDKAKADAKAVALAAEKEINEK 142
>gi|114328349|ref|YP_745506.1| 30S ribosomal protein S16 [Granulibacter bethesdensis CGDNIH1] >gi|114316523|gb|ABI62583.1| SSU ribosomal protein S16P [Granulibacter bethesdensis CGDNIH1] (155 aa)
Score = 143, Expect = 6.2e-08, Identities = 35/77 (45%), Positives = 48/77 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           +KIRL R G  K P++ IVV DSRA RDG +IEK+G+Y P         V + E+  + WL +GA  +D V   L + G+ K
  S:    44 LKIRLARAGAKKRPYYHIVVADSRAPRDGRFIEKLGSYNPMLPAEHAERVRLFEDRIMHWLTEGAIATDRVARFLGKAGLTK 125
>gi|21230656|ref|NP_636573.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769349|ref|YP_244111.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. campestris str. 8004] >gi|188992535|ref|YP_001904545.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. campestris] >gi|23822131|sp|Q8PBC3|RS16_XANCP 30S ribosomal protein S16 >gi|81304694|sp|Q4US82|RS16_XANC8 30S ribosomal protein S16 >gi|21112242|gb|AAM40497.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66574681|gb|AAY50091.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. campestris str. 8004] >gi|167734295|emb|CAP52505.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. campestris] (86 aa)
Score = 143, Expect = 6.2e-08, Identities = 36/73 (49%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF+ I+V D R+ RDG  IE++G Y P     E  V ++      W+ +GAQ +D V+NL RE
  S:     1 MVKIRLTRGGAKKRPFYHIIVTDVRSARDGRNIERLGYYNPVAQGAEPRVVLDVARVDHWVGQGAQLTDKVRNLYRE 77
>gi|86141704|ref|ZP_01060228.1| 30S ribosomal protein S16 [Flavobacterium sp. MED217] >gi|85831267|gb|EAQ49723.1| 30S ribosomal protein S16 [Leeuwenhoekiella blandensis MED217] (180 aa)
Score = 143, Expect = 6.2e-08, Identities = 46/125 (36%), Positives = 76/125 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVW---------KKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQK 126
           VKIRL R G+   PF+ +V  D+RA+RDG ++ K+G Y P      ++I+ + ++ WL+ GAQP++T K LL   GV          +K   ++ Q++++ NA   +++  K EAKK   +K   K      A++K
  S:     3 VKIRLQRHGKKGKPFYWVVAADARAKRDGKFLAKLGVYNPTTNPATIDIDVDSSVKWLQNGAQPTETAKRLLSYTGVLLKNHLAGGVRKGALTEEQAEEKFNA-WAEEKASKVEAKKEGLTKAEEKARQEALAAEK 137
>gi|114107028|ref|YP_740184.1| ribosomal protein L16 [Liriodendron tulipifera] >gi|122239954|sp|Q0G9N7|RR16_LIRTU Chloroplast 30S ribosomal protein S16 >gi|113200976|gb|ABI32491.1| ribosomal protein L16 [Liriodendron tulipifera] (86 aa)
Score = 143, Expect = 6.3e-08, Identities = 34/80 (42%), Positives = 51/80 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL R GR +   +RIV ID R+RR+G  + KVG Y+P +     N    L +L+KGAQP+ TV ++ ++  V+K+ 
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYSNVPAILYFLEKGAQPTGTVHDISKKAEVFKEL 80
>gi|115604916|ref|YP_784368.1| ribosomal protein S16 [Drimys granadensis] >gi|122164459|sp|Q06H15|RR16_DRIGR Chloroplast 30S ribosomal protein S16 >gi|112032644|gb|ABH88279.1| ribosomal protein S16 [Drimys granadensis] (89 aa)
Score = 143, Expect = 6.3e-08, Identities = 35/89 (39%), Positives = 56/89 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKK 89
           MVK+RL R GR +   +RIV ID R++R+G  + KVG Y+P +     N    L +L+KGAQP+ TV ++ ++  V+K+   ++ +S K
  S:     1 MVKLRLKRCGRKQRAIYRIVAIDVRSQREGRDLRKVGFYDPIKNQTYSNVPAILYFLEKGAQPTGTVHDISKKAEVFKELRINQTKSNK 89
>gi|110597445|ref|ZP_01385732.1| ribosomal protein S16 [Chlorobium ferrooxidans DSM 13031] >gi|110340989|gb|EAT59460.1| ribosomal protein S16 [Chlorobium ferrooxidans DSM 13031] (136 aa)
Score = 143, Expect = 6.7e-08, Identities = 41/107 (38%), Positives = 65/107 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF-MDSKVQSKKEHNANKVKKEVKKPEAKK 107
           MVKIRL R GR KLP ++IV  D+R+ RDG ++E +GTY+P      V + ++    W+  GAQP+ TV++L+R  G+  +  + S+ +S+ E      + +  K E  K
  S:     1 MVKIRLKRAGRKKLPVYQIVASDARSPRDGKFLEVIGTYQPTAKPHAVTLKKDRVEYWMGVGAQPTATVRSLIRTTGLLHELRLKSRGRSEAEITVEMEQWQASKVERSK 110
>gi|113460439|ref|YP_718501.1| 30S ribosomal protein S16 [Haemophilus somnus 129PT] >gi|122945159|sp|Q0I1K0|RS16_HAES1 30S ribosomal protein S16 >gi|112822482|gb|ABI24571.1| SSU ribosomal protein S16P [Haemophilus somnus 129PT] (82 aa)
Score = 143, Expect = 6.8e-08, Identities = 35/73 (47%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR+ RDG +IE+VG + P        V IN +    W+  GA  SD V +L++E
  S:     1 MVTIRLSRGGSKKRPFYQIVVADSRSPRDGRFIERVGFFNPLASGNVERVRINLDRVNHWIGNGASLSDRVASLVKE 77
>gi|170717918|ref|YP_001783518.1| ribosomal protein S16 [Haemophilus somnus 2336] >gi|189029601|sp|B0UVM6|RS16_HAES2 30S ribosomal protein S16 >gi|168826047|gb|ACA31418.1| ribosomal protein S16 [Haemophilus somnus 2336] (82 aa)
Score = 143, Expect = 6.8e-08, Identities = 35/73 (47%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR+ RDG +IE+VG + P        V IN +    W+  GA  SD V +L++E
  S:     1 MVTIRLSRGGSKKRPFYQIVVADSRSPRDGRFIERVGFFNPLASGNVERVRINLDRVNHWIGHGASLSDRVASLVKE 77
>gi|110833659|ref|YP_692518.1| 30S ribosomal protein S16. [Alcanivorax borkumensis SK2] >gi|122959603|sp|Q0VRF2|RS16_ALCBS 30S ribosomal protein S16 >gi|110646770|emb|CAL16246.1| 30S ribosomal protein S16. [Alcanivorax borkumensis SK2] (82 aa)
Score = 143, Expect = 6.9e-08, Identities = 37/73 (50%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE++G Y P     E  + +N E   +W+ KGAQ SD VK L ++
  S:     1 MVVIRLARGGSKKRPFYSIVVADSRYARDGRFIEQLGFYNPIARGGEIPLKLNLESLDAWVAKGAQLSDRVKTLAKQ 77
>gi|83941586|ref|ZP_00954048.1| ribosomal protein S16 [Sulfitobacter sp. EE-36] >gi|83847406|gb|EAP85281.1| ribosomal protein S16 [Sulfitobacter sp. EE-36] (128 aa)
Score = 143, Expect = 7.1e-08, Identities = 39/78 (50%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    W+ +GAQP+D V  +L   GV +K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLAKDSEERVKMDVERVQYWISQGAQPTDRVARMLEAAGVKEK 85
>gi|148261144|ref|YP_001235271.1| 30S ribosomal protein S16 [Acidiphilium cryptum JF-5] >gi|166234384|sp|A5G0H0|RS16_ACICJ 30S ribosomal protein S16 >gi|146402825|gb|ABQ31352.1| SSU ribosomal protein S16P [Acidiphilium cryptum JF-5] (114 aa)
Score = 143, Expect = 7.3e-08, Identities = 38/92 (41%), Positives = 54/92 (58%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV--WKKFMDSKVQSKKEHNA 93
           +KIRL R G  K PF+ IVV DSR+ RDG +IE++GTY P      E  + +  +    WL +GAQ +D V   + + G+     F +  VQS  +  A
  S:     3 LKIRLARAGAKKRPFYHIVVADSRSPRDGKFIERIGTYNPMLPADHEDRIRLVTDRVTHWLSQGAQATDRVARFIGKAGLAPMPAFREQPVQSAPKKKA 101
>gi|91983974|ref|YP_567058.1| ribosomal protein S16 [Vitis vinifera] >gi|122236502|sp|Q0ZJ38|RR16_VITVI Chloroplast 30S ribosomal protein S16 >gi|91701632|gb|ABE47516.1| ribosomal protein S16 [Vitis vinifera] (91 aa)
Score = 142, Expect = 7.5e-08, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSK 88
           MVK+RL R GR +   +RIV ID+R+RR+G  + KVG Y+P +     N    L +L+KGAQP+ TV ++ ++  V+ +   ++ + K
  S:     1 MVKLRLKRCGRKQRAVYRIVAIDARSRREGRDLRKVGFYDPIKNQTYSNVPAILYFLEKGAQPTGTVHDISKKAEVFTELRLNQTKFK 88
>gi|120437355|ref|YP_863041.1| 30S ribosomal protein S16 [Gramella forsetii KT0803] >gi|117579505|emb|CAL67974.1| 30S ribosomal protein S16 [Gramella forsetii KT0803] (198 aa)
Score = 142, Expect = 7.6e-08, Identities = 50/131 (38%), Positives = 80/131 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEI--ALSWLKKGAQPSDTVKNLLREQG-VWKKFMDSKV--------QSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQKKTVSKK 132
           VKIRL R G+   PFF IV  D+RA+RDG +++K+G Y P      I  ++  A+ WL+ GAQP+DT + +L  +G + KK + + V        Q++++ NA   +KE  K +AKK +  K   +  A    ++K   +K+
  S:     3 VKIRLQRHGKKGKPFFWIVAADTRAKRDGKFLDKLGIYNPNTNPATIELDVDGAVKWLQNGAQPTDTARAILSYKGALLKKHLAAGVAKGALTEEQAEEKFNAWMEEKE-GKVDAKKDSLGKAKDEEKAKALQAEKDANAKR 143
>gi|21242045|ref|NP_641627.1| 30S ribosomal protein S16 [Xanthomonas axonopodis pv. citri str. 306] >gi|78046898|ref|YP_363073.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|23822136|sp|Q8PMY3|RS16_XANAC 30S ribosomal protein S16 >gi|109894818|sp|Q3BVZ0|RS16_XANC5 30S ribosomal protein S16 >gi|21107447|gb|AAM36163.1| 30S ribosomal protein S16 [Xanthomonas axonopodis pv. citri str. 306] >gi|78035328|emb|CAJ22973.1| 30S ribosomal protein S16 [Xanthomonas campestris pv. vesicatoria str. 85-10] (85 aa)
Score = 142, Expect = 7.9e-08, Identities = 35/73 (47%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRLTR G  K PF+ I+V D R+ RDG  IE++G Y P     E  + ++      W+  GAQ +D V+NL RE
  S:     1 MVKIRLTRGGAKKRPFYHIIVTDVRSARDGRNIERLGYYNPVAQGAEPRIVLDVARVDHWVGNGAQLTDKVRNLYRE 77
>gi|116060926|emb|CAL57404.1| 30S ribosomal protein S16-like (ISS) [Ostreococcus tauri] (105 aa)
Score = 142, Expect = 8.2e-08, Identities = 34/75 (45%), Positives = 45/75 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           V+IRL R G    P +R+ V DSRA RDG ++E VG Y+P         V +  +    WL  GAQPS+TV  LL + G+
  S:     3 VRIRLARFGTKNRPHYRLHVCDSRAPRDGKHLEIVGHYDPIAQKDGHKHVGLRIDRIKYWLSCGAQPSETVARLLGQAGI 82
>gi|91201021|emb|CAJ74079.1| strongly similar to 30S ribosomal protein S16 [Candidatus Kuenenia stuttgartiensis] (85 aa)
Score = 142, Expect = 8.2e-08, Identities = 31/75 (41%), Positives = 47/75 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           V+IR+ R+GR   PF+RI   D+   RDG  IE +GTY+P E      V +  E    WL  GA+P++TV ++ ++ G+
  S:     3 VRIRMMRMGRKNRPFYRIGAFDAHEERDGMSIENLGTYDPMESNNEKQVTLKRERVDYWLSVGAKPTETVASIFKKLGI 81
>gi|83855063|ref|ZP_00948593.1| ribosomal protein S16 [Sulfitobacter sp. NAS-14.1] >gi|83842906|gb|EAP82073.1| ribosomal protein S16 [Sulfitobacter sp. NAS-14.1] (126 aa)
Score = 142, Expect = 8.7e-08, Identities = 39/78 (50%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    W+ +GAQP+D V  +L   GV +K
  S:     1 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLAKDSEERVKMDVERVQYWISQGAQPTDRVARMLEAAGVKEK 83
>gi|115391884|ref|YP_778472.1| ribosomal protein S16 [Jasminum nudiflorum] >gi|122164991|sp|Q06RE9|RR16_JASNU Chloroplast 30S ribosomal protein S16 >gi|110456205|gb|ABG74610.1| ribosomal protein S16 [Jasminum nudiflorum] (88 aa)
Score = 142, Expect = 8.9e-08, Identities = 31/86 (36%), Positives = 56/86 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQ 86
           M+K+RL R GR +   ++IV ID R+ R+G  + KVG Y+P +   ++N    L +L+KGAQP+ TV+++L++  + K+   ++ +
  S:     1 MIKLRLKRCGRKQRAVYQIVAIDVRSPREGKALRKVGFYDPIKNQTDLNVRAILYFLEKGAQPTGTVQDILKKAEIDKELRPNQTK 86
>gi|30249635|ref|NP_841705.1| 30S ribosomal protein S16 [Nitrosomonas europaea ATCC 19718] >gi|50403618|sp|Q82U38|RS16_NITEU 30S ribosomal protein S16 >gi|30138998|emb|CAD85582.1| Ribosomal protein S16 [Nitrosomonas europaea ATCC 19718] (89 aa)
Score = 142, Expect = 9.0e-08, Identities = 38/79 (48%), Positives = 49/79 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MV +RL R G  K PF+ +VV DSR RRDG +IE+VG Y P     E  + I  +    W  KGAQ SDTV  L+++ G  +K
  S:     1 MVVVRLARGGAKKRPFYSMVVADSRNRRDGKFIERVGFYNPRATGGEESLRIQMDRLTYWQSKGAQLSDTVSRLVKQFGRQQK 83
>gi|53802420|ref|YP_112923.1| ribosomal protein S16 [Methylococcus capsulatus str. Bath] >gi|81682949|sp|Q60BS3|RS16_METCA 30S ribosomal protein S16 >gi|53756181|gb|AAU90472.1| ribosomal protein S16 [Methylococcus capsulatus str. Bath] (84 aa)
Score = 142, Expect = 9.1e-08, Identities = 34/73 (46%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ +VV +SR++RDG YIE+VG + P     E  + ++E     W+  GA+PSD V +L++E
  S:     1 MVSIRLARGGAKKRPFYHVVVAESRSKRDGRYIERVGFFNPIARGQEERLRLDESRIAYWIGTGAKPSDRVVSLIKE 77
>gi|115479941|ref|NP_001063564.1| Os09g0498100 [Oryza sativa (japonica cultivar-group)] >gi|113631797|dbj|BAF25478.1| Os09g0498100 [Oryza sativa (japonica cultivar-group)] >gi|125564238|gb|EAZ09618.1| hypothetical protein OsI_030850 [Oryza sativa (indica cultivar-group)] (136 aa)
Score = 141, Expect = 1.0e-07, Identities = 31/76 (40%), Positives = 46/76 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           +V+IRL R G    PF+R++  DSR+ RDG ++E +G Y P  G      + +  +    WL  GAQPSD V+ +L   G+
  S:     2 VVRIRLARFGCRNRPFYRVMAADSRSPRDGKHLEVLGYYNPLPGKDGGKRMGLKFDRVKYWLSVGAQPSDPVQRILFRAGL 82
>gi|86158339|ref|YP_465124.1| SSU ribosomal protein S16P [Anaeromyxobacter dehalogenans 2CP-C] >gi|167456795|ref|ZP_02323012.1| ribosomal protein S16 [Anaeromyxobacter dehalogenans 2CP-1] >gi|109893860|sp|Q2IJ60|RS16_ANADE 30S ribosomal protein S16 >gi|85774850|gb|ABC81687.1| SSU ribosomal protein S16P [Anaeromyxobacter dehalogenans 2CP-C] >gi|167417085|gb|EDR83794.1| ribosomal protein S16 [Anaeromyxobacter dehalogenans 2CP-1] (88 aa)
Score = 141, Expect = 1.0e-07, Identities = 33/71 (46%), Positives = 45/71 (63%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           V +RL+R G HK PF+ +V  DSR  RDG Y+E VG Y+P +    + +  E    WLK GA+PS TV  +L+
  S:     3 VVLRLSRAGTHKAPFYHVVATDSRNARDGKYLEDVGIYDPTKRPERIELKVERIEHWLKAGAKPSQTVAMILK 75
>gi|56707320|ref|YP_169216.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669790|ref|YP_666347.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis FSC198] >gi|118498130|ref|YP_899180.1| 30S ribosomal protein S16 [Francisella tularensis subsp. novicida U112] >gi|134301359|ref|YP_001121327.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931089|ref|YP_001891073.1| 30S ribosomal protein S16 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194323357|ref|ZP_03057141.1| ribosomal protein S16 [Francisella tularensis subsp. novicida FTE] >gi|123169671|sp|Q14JS9|RS16_FRAT1 30S ribosomal protein S16 >gi|166234421|sp|A0Q861|RS16_FRATN 30S ribosomal protein S16 >gi|166234422|sp|A4IWA5|RS16_FRATW 30S ribosomal protein S16 >gi|81598033|sp|Q5NIC6|RS16_FRATT 30S ribosomal protein S16 >gi|54114499|gb|AAV29883.1| NT02FT0285 [synthetic construct] >gi|56603812|emb|CAG44783.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320123|emb|CAL08166.1| 30S ribosomal protein S16 [Francisella tularensis subsp. tularensis FSC 198] >gi|118424036|gb|ABK90426.1| 30S ribosomal protein S16 [Francisella tularensis subsp. novicida U112] >gi|134049136|gb|ABO46207.1| ribosomal protein S16 [Francisella tularensis subsp. tularensis WY96-3418] >gi|151571207|gb|EDN36861.1| ribosomal protein S16 [Francisella tularensis subsp. novicida GA99-3549] >gi|187711998|gb|ACD30295.1| 30S ribosomal protein S16 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194322721|gb|EDX20201.1| ribosomal protein S16 [Francisella tularensis subsp. novicida FTE] (82 aa)
Score = 141, Expect = 1.0e-07, Identities = 37/73 (50%), Positives = 50/73 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IR+ R G  K PF+RIVV D R+ RDG +IEK+G + P     E  + ++   A +WL KGAQPSD V +L++E
  S:     1 MVVIRMARGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKE 77
>gi|89053240|ref|YP_508691.1| 30S ribosomal protein S16 [Jannaschia sp. CCS1] >gi|109893885|sp|Q28UE6|RS16_JANSC 30S ribosomal protein S16 >gi|88862789|gb|ABD53666.1| SSU ribosomal protein S16P [Jannaschia sp. CCS1] (130 aa)
Score = 141, Expect = 1.1e-07, Identities = 37/74 (50%), Positives = 46/74 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    WL +GAQP+D +   L   G
  S:     3 MKIRLARGGSKKRPFYRIVASDSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDMERVQHWLDQGAQPTDRISRFLEAAG 81
>gi|87199426|ref|YP_496683.1| 30S ribosomal protein S16 [Novosphingobium aromaticivorans DSM 12444] >gi|109894778|sp|Q2G8H4|RS16_NOVAD 30S ribosomal protein S16 >gi|87135107|gb|ABD25849.1| SSU ribosomal protein S16P [Novosphingobium aromaticivorans DSM 12444] (145 aa)
Score = 141, Expect = 1.1e-07, Identities = 35/75 (46%), Positives = 50/75 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           V +RL+R G  K P+++IVV +SRA RDG Y+E+VGTY P      E  V + E+    W+  GAQP+D V  +L + G+
  S:     3 VSMRLSRGGSKKRPYYKIVVSNSRAPRDGKYLEQVGTYNPLLAKDDENRVRLIEDRVRYWIGVGAQPTDRVARMLDKAGI 82
>gi|86607943|ref|YP_476705.1| ribosomal protein S16 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|109894811|sp|Q2JP53|RS16_SYNJB 30S ribosomal protein S16 >gi|86556485|gb|ABD01442.1| ribosomal protein S16 [Synechococcus sp. JA-2-3B'a(2-13)] (159 aa)
Score = 141, Expect = 1.2e-07, Identities = 30/78 (38%), Positives = 52/78 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWK 78
           MVK+RL R G+ + P +RI+ I+S++RR+   +E++G Y P      +     L WL+ GAQP++TV +LL++ G+++
  S:     1 MVKLRLKRYGKKRQPSYRIIAIESKSRREARPLEELGYYNPRTKETVLQTAGLLKWLRCGAQPTETVDSLLKKAGIYE 78
>gi|121601853|ref|YP_988407.1| 30S ribosomal protein S16 [Bartonella bacilliformis KC583] >gi|166234394|sp|A1UR04|RS16_BARBK 30S ribosomal protein S16 >gi|120614030|gb|ABM44631.1| ribosomal protein S16 [Bartonella bacilliformis KC583] (120 aa)
Score = 141, Expect = 1.2e-07, Identities = 34/78 (43%), Positives = 52/78 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL+R G  K P++ IVV D+R+ RDG ++E+VG ++P     +  V +NE+    WL +GAQP+D V   L   G+ K+
  S:     3 LKIRLSRGGSKKRPYYHIVVADARSPRDGRFLERVGAWDPMLPKDKPRVKLNEDRIQHWLNQGAQPTDRVLRFLDAAGLKKR 84
>gi|160872008|ref|ZP_02062140.1| ribosomal protein S16 [Rickettsiella grylli] >gi|159120807|gb|EDP46145.1| ribosomal protein S16 [Rickettsiella grylli] (103 aa)
Score = 141, Expect = 1.2e-07, Identities = 37/73 (50%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R GR + PF+ IVV D R  RDG YIE++G Y P     E V+ I E     WL +GAQ S+ V +LL++
  S:     1 MVTIRLARGGRTERPFYHIVVTDRRKPRDGRYIERLGFYNPIASGKEVVLKITENRVSYWLSQGAQLSEQVYSLLKK 77
>gi|49476254|ref|YP_034295.1| 30S ribosomal protein S16 [Bartonella henselae str. Houston-1] >gi|81648469|sp|Q6G5S7|RS16_BARHE 30S ribosomal protein S16 >gi|49239062|emb|CAF28365.1| 30S ribosomal protein s16 [Bartonella henselae str. Houston-1] (127 aa)
Score = 141, Expect = 1.2e-07, Identities = 34/78 (43%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL+R G  K P++ I+V D+R+ RDG ++E+VG ++P        V +NEE    WL +GAQP+D V   L   G+ K+
  S:     3 LKIRLSRGGSKKRPYYHIIVADARSPRDGRFLERVGAWDPMLPKDGPRVKLNEERIQYWLGQGAQPTDRVLRFLDAAGLKKR 84
>gi|23014874|ref|ZP_00054670.1| COG0228: Ribosomal protein S16 [Magnetospirillum magnetotacticum MS-1] (123 aa)
Score = 141, Expect = 1.3e-07, Identities = 41/100 (41%), Positives = 62/100 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN-----INEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVK 101
           +KIRL+R G  K PF++IVV D+RA RDG +IEKVGTY P     N     ++E+    WL  GAQP+D +     ++G+  K + ++ Q+K+     K ++  K
  S:     3 LKIRLSRGGAKKRPFYKIVVADARAPRDGRFIEKVGTYNPMLPNDNGQRWILDEDRVKHWLSVGAQPTDRLVRFFADKGLVAKPVRAE-QTKQPKPKAKAQQRAK 106
>gi|56551972|ref|YP_162811.1| 30S ribosomal protein S16 [Zymomonas mobilis subsp. mobilis ZM4] >gi|81598239|sp|Q5NNL0|RS16_ZYMMO 30S ribosomal protein S16 >gi|56543546|gb|AAV89700.1| ribosomal protein S16 [Zymomonas mobilis subsp. mobilis ZM4] (143 aa)
Score = 140, Expect = 1.4e-07, Identities = 35/78 (44%), Positives = 52/78 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP-----FEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL+R G  + PF+RIV+ +SR+ RDG++IEK+G+Y P      E  V ++ + A  WL  GAQP+D V   L   G+ ++
  S:     3 VSIRLSRGGAKRRPFYRIVIANSRSPRDGSFIEKIGSYNPQLPKDNENRVIVDLDRARHWLSVGAQPTDRVARFLDAAGLLER 85
>gi|119946972|ref|YP_944652.1| ribosomal protein S16 [Psychromonas ingrahamii 37] >gi|166201340|sp|A1SZY8|RS16_PSYIN 30S ribosomal protein S16 >gi|119865576|gb|ABM05053.1| SSU ribosomal protein S16P [Psychromonas ingrahamii 37] (82 aa)
Score = 140, Expect = 1.4e-07, Identities = 33/76 (43%), Positives = 48/76 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           MV IRLTR G  K PF+++VV DSR+ RDG ++EKVG + P        + ++ +    W+  GAQ SD V  L+++  V
  S:     1 MVTIRLTRGGVKKRPFYQVVVTDSRSPRDGCFLEKVGFFNPTAQGQAERLRLDTDRINHWVGLGAQLSDRVAKLVKDNAV 80
>gi|21554119|gb|AAM63199.1| 30S ribosomal protein S16 [Arabidopsis thaliana] (135 aa)
Score = 140, Expect = 1.5e-07, Identities = 32/76 (42%), Positives = 47/76 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           +V+IRL+R G    PFFR++  DSR+ RDG ++E +G + P  G      + +  +    WL  GAQPSD V+ LL   G+
  S:     2 VVRIRLSRFGCKNRPFFRVMAADSRSPRDGKHLEVLGYFNPLPGQDGGKRMGLKFDRIKYWLSVGAQPSDPVQRLLFRSGL 82
>gi|52424495|ref|YP_087632.1| 30S ribosomal protein S16 [Mannheimia succiniciproducens MBEL55E] >gi|81609643|sp|Q65VG3|RS16_MANSM 30S ribosomal protein S16 >gi|52306547|gb|AAU37047.1| RpsP protein [Mannheimia succiniciproducens MBEL55E] (82 aa)
Score = 140, Expect = 1.5e-07, Identities = 35/73 (47%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR  RDG +IE+VG + P        + I  +   +WL+KGA  SD V  L++E
  S:     1 MVTIRLSRGGAKKRPFYQIVVADSRCPRDGRFIERVGFFNPLAAGNAERLRIQLDRVNAWLEKGASLSDRVAALVKE 77
>gi|57240407|ref|ZP_00368356.1| ribosomal protein S16 [Campylobacter lari RM2100] >gi|57018748|gb|EAL55521.1| ribosomal protein S16 [Campylobacter lari RM2100] (75 aa)
Score = 140, Expect = 1.5e-07, Identities = 35/67 (52%), Positives = 43/67 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTV 67
           M  IRLT++GR K PF+RIVV DSR RRDG++IE +G Y P     VV  + E    W   GA+ SD V
  S:     1 MTVIRLTKMGRKKRPFYRIVVTDSRKRRDGSWIESIGYYNPMVEPEVVKFDAERLAYWKSVGAKLSDRV 69
>gi|32477732|ref|NP_870726.1| 30S ribosomal protein S16 [Rhodopirellula baltica SH 1] >gi|54039436|sp|Q7UI12|RS16_RHOBA 30S ribosomal protein S16 >gi|32448286|emb|CAD77803.1| probable 30S ribosomal protein S16 [Rhodopirellula baltica SH 1] (146 aa)
Score = 140, Expect = 1.5e-07, Identities = 30/74 (40%), Positives = 46/74 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           V+IR+ ++GR   PFFR+  +D R  RDG  IE++GTY+P     +    +  +    W+  GAQPSD V  L+++ G
  S:     3 VRIRMKKMGRTHRPFFRVCAVDQRNPRDGRVIEELGTYDPMCPETDARTTLKADRVDYWIGVGAQPSDKVAVLIKKYG 80
>gi|150398291|ref|YP_001328758.1| 30S ribosomal protein S16 [Sinorhizobium medicae WSM419] >gi|166201637|sp|A6UE43|RS16_SINMW 30S ribosomal protein S16 >gi|150029806|gb|ABR61923.1| ribosomal protein S16 [Sinorhizobium medicae WSM419] (124 aa)
Score = 140, Expect = 1.5e-07, Identities = 33/78 (42%), Positives = 52/78 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P+++IVV D+R+ RDG ++EK+G++ P      E  + +N E    W+ +GAQP+D V   L + G+ K+
  S:     3 LKIRLARGGSKKRPYYQIVVADARSPRDGRFLEKLGSWNPMLAKDDEKRIELNAERVQHWIDQGAQPTDRVLRFLDQAGLAKR 85
>gi|120610564|ref|YP_970242.1| SSU ribosomal protein S16P [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166234381|sp|A1TND0|RS16_ACIAC 30S ribosomal protein S16 >gi|120589028|gb|ABM32468.1| SSU ribosomal protein S16P [Acidovorax avenae subsp. citrulli AAC00-1] (85 aa)
Score = 140, Expect = 1.5e-07, Identities = 35/71 (49%), Positives = 44/71 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           MV IRL+R G    PFF IVV D R RRDG +IE++G Y P     E  + I ++    W   GAQ SDTV+ L+
  S:     1 MVVIRLSRGGSKGRPFFNIVVADKRVRRDGRFIERLGFYNPTAKEGEEGLRIAQDRLTYWKSVGAQVSDTVERLI 75
>gi|86747478|ref|YP_483974.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris HaA2] >gi|109894793|sp|Q2J397|RS16_RHOP2 30S ribosomal protein S16 >gi|86570506|gb|ABD05063.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris HaA2] (110 aa)
Score = 140, Expect = 1.6e-07, Identities = 36/78 (46%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL R G  K PF+ +VV DSR  RDG +IE++G + P      E  + ++ +    WL KGAQPSD V   L   GV K+
  S:     3 VVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDITGVKKR 85
>gi|148555569|ref|YP_001263151.1| 30S ribosomal protein S16 [Sphingomonas wittichii RW1] >gi|166201638|sp|A5V9P7|RS16_SPHWW 30S ribosomal protein S16 >gi|148500759|gb|ABQ69013.1| SSU ribosomal protein S16P [Sphingomonas wittichii RW1] (154 aa)
Score = 140, Expect = 1.6e-07, Identities = 37/78 (47%), Positives = 49/78 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL R G  K P++RIVV D+R+ RDGA+IEK+G Y P         V ++ + A  WL  GAQP+D V   L   GV ++
  S:     3 VSIRLARGGAKKRPYYRIVVADARSPRDGAFIEKIGAYNPLLAKDDPKRVVLDTDRAKHWLSVGAQPTDRVARFLDAAGVQER 85
>gi|83644606|ref|YP_433041.1| ribosomal protein S16 [Hahella chejuensis KCTC 2396] >gi|83632649|gb|ABC28616.1| ribosomal protein S16 [Hahella chejuensis KCTC 2396] (117 aa)
Score = 140, Expect = 1.6e-07, Identities = 31/72 (43%), Positives = 47/72 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+ + V DSR  RDG +IE+VG + P     +  + ++ E    W+++GAQ SD V++L++
  S:    39 MVTIRLARGGSKKRPFYHLNVTDSRNARDGRFIERVGFFNPTARGNDERIRVDAERLQFWVERGAQMSDRVRDLVK 114
>gi|73542225|ref|YP_296745.1| 30S ribosomal protein S16 [Ralstonia eutropha JMP134] >gi|109894790|sp|Q46Y82|RS16_RALEJ 30S ribosomal protein S16 >gi|72119638|gb|AAZ61901.1| SSU ribosomal protein S16P [Ralstonia eutropha JMP134] (84 aa)
Score = 140, Expect = 1.6e-07, Identities = 37/75 (49%), Positives = 46/75 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           MV IRL R G  K PFF IV  DSR RRDG +IE+VG Y P      EG+  + + +A  W   GAQ S TV  L+++  
  S:     1 MVVIRLARGGSKKRPFFNIVATDSRNRRDGRFIERVGFYNPLASEGEEGLRVVADRLAY-WQGVGAQLSPTVARLVKQNA 79
>gi|2149138|gb|AAB58503.1| ribosomal protein S16 [Thermus aquaticus] (67 aa)
Score = 139, Expect = 1.7e-07, Identities = 32/64 (50%), Positives = 43/64 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV---VNINEEIALSWLKKGAQPS 64
           MVKI ++R G    P +RIVV D R +RDGAYIEK+G Y+P +     + ++ E A  WL  GAQP+
  S:     1 MVKISVSRFGSKHNPHYRIVVTDVRRKRDGAYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPT 67
>gi|108759661|ref|YP_631738.1| ribosomal protein S16 [Myxococcus xanthus DK 1622] >gi|123247731|sp|Q1D6I5|RS16_MYXXD 30S ribosomal protein S16 >gi|108463541|gb|ABF88726.1| ribosomal protein S16 [Myxococcus xanthus DK 1622] (86 aa)
Score = 139, Expect = 1.8e-07, Identities = 35/74 (47%), Positives = 46/74 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           V +RL R G  K P++ +V  DSR  RDG +IE VG Y+P +    V  NEE    WLK GA PS+TV +L++  G
  S:     3 VVLRLARAGVKKKPYYHVVATDSRNPRDGKFIEAVGAYDPNQEPPKVEFNEERLNYWLKTGATPSETVADLIKVAG 78
>gi|15241991|ref|NP_200504.1| ribosomal protein S16 family protein [Arabidopsis thaliana] >gi|8777434|dbj|BAA97024.1| 30S ribosomal protein S16 [Arabidopsis thaliana] >gi|14334472|gb|AAK59434.1| putative 30S ribosomal protein S16 [Arabidopsis thaliana] >gi|16323518|gb|AAL15253.1| putative 30S ribosomal protein S16 [Arabidopsis thaliana] (135 aa)
Score = 139, Expect = 1.9e-07, Identities = 32/76 (42%), Positives = 47/76 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           +V+IRL+R G    PFFR++  DSR+ RDG ++E +G + P  G      + +  +    WL  GAQPSD V+ LL   G+
  S:     2 VVRIRLSRFGCKNRPFFRVMAADSRSPRDGKHLEVLGYFNPLPGQDGGKRMGLKFDRIKYWLSVGAQPSDPVQRLLFRSGL 82
>gi|187478842|ref|YP_786866.1| 30S ribosomal protein S16 [Bordetella avium 197N] >gi|109893865|sp|Q2KY79|RS16_BORA1 30S ribosomal protein S16 >gi|115423428|emb|CAJ49962.1| 30S ribosomal protein S16 [Bordetella avium 197N] (86 aa)
Score = 139, Expect = 1.9e-07, Identities = 35/74 (47%), Positives = 45/74 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLREQ 74
           MV IRL R G  K PF+ +V  DSR RRDG ++E+VG Y P     + N  IAL     W+  GAQ S  V+ L++E 
  S:     1 MVVIRLARGGSKKRPFYNLVATDSRNRRDGRFVERVGFYNPVGSEGSENLRIALDRVKYWVDNGAQLSPAVERLVKEH 78
>gi|86137218|ref|ZP_01055796.1| ribosomal protein S16 [Roseobacter sp. MED193] >gi|85826542|gb|EAQ46739.1| ribosomal protein S16 [Roseobacter sp. MED193] (119 aa)
Score = 139, Expect = 2.1e-07, Identities = 36/78 (46%), Positives = 49/78 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +K+RL R G  K PF+RIV  DSR  RDG ++EK+GTY P      E  V ++ E    WL +GAQ +D +  +L   GV +K
  S:     3 IKLRLARGGSKKRPFYRIVAADSRMPRDGRFVEKLGTYNPLLPKDSEERVKMDMERVQYWLDQGAQVTDRIARMLEAAGVREK 85
>gi|69933276|ref|ZP_00628478.1| Ribosomal protein S16 [Paracoccus denitrificans PD1222] >gi|119386588|ref|YP_917643.1| 30S ribosomal protein S16 [Paracoccus denitrificans PD1222] >gi|166201328|sp|A1B8V3|RS16_PARDP 30S ribosomal protein S16 >gi|119377183|gb|ABL71947.1| SSU ribosomal protein S16P [Paracoccus denitrificans PD1222] (124 aa)
Score = 139, Expect = 2.1e-07, Identities = 38/78 (48%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P + IV  DSR  RDG +IEK+GTY P      E  + +N E    WL +GAQP+D V   L   GV +K
  S:     3 MKIRLARGGSKKRPHYAIVASDSRMPRDGRFIEKLGTYNPLLPKDSEDRIKMNLERVQYWLGQGAQPTDRVARFLEAAGVKEK 85
>gi|16272167|ref|NP_438373.1| 30S ribosomal protein S16 [Haemophilus influenzae Rd KW20] >gi|42629128|ref|ZP_00154677.1| COG0228: Ribosomal protein S16 [Haemophilus influenzae R2846] >gi|68248809|ref|YP_247921.1| 30S ribosomal protein S16 [Haemophilus influenzae 86-028NP] >gi|145631331|ref|ZP_01787103.1| 30S ribosomal protein S16 [Haemophilus influenzae 22.4-21] >gi|145633787|ref|ZP_01789511.1| 30S ribosomal protein S16 [Haemophilus influenzae 3655] >gi|145635640|ref|ZP_01791337.1| 30S ribosomal protein S16 [Haemophilus influenzae PittAA] >gi|145637368|ref|ZP_01793028.1| 30S ribosomal protein S16 [Haemophilus influenzae PittHH] >gi|145641543|ref|ZP_01797121.1| 30S ribosomal protein S16 [Haemophilus influenzae R3021] >gi|148825532|ref|YP_001290285.1| 30S ribosomal protein S16 [Haemophilus influenzae PittEE] >gi|148827342|ref|YP_001292095.1| 30S ribosomal protein S16 [Haemophilus influenzae PittGG] >gi|166234424|sp|A5UAV1|RS16_HAEIE 30S ribosomal protein S16 >gi|166234425|sp|A5UG06|RS16_HAEIG 30S ribosomal protein S16 >gi|1173210|sp|P44382|RS16_HAEIN 30S ribosomal protein S16 >gi|81336777|sp|Q4QNY6|RS16_HAEI8 30S ribosomal protein S16 >gi|1573164|gb|AAC21873.1| ribosomal protein S16 (rpS16) [Haemophilus influenzae Rd KW20] >gi|68057008|gb|AAX87261.1| 30S ribosomal protein S16 [Haemophilus influenzae 86-028NP] >gi|144983116|gb|EDJ90616.1| 30S ribosomal protein S16 [Haemophilus influenzae R3021] >gi|144985358|gb|EDJ92188.1| 30S ribosomal protein S16 [Haemophilus influenzae 3655] >gi|145267113|gb|EDK07120.1| 30S ribosomal protein S16 [Haemophilus influenzae PittAA] >gi|145269460|gb|EDK09403.1| 30S ribosomal protein S16 [Haemophilus influenzae PittHH] >gi|145273834|gb|EDK13702.1| 30S ribosomal protein S16 [Haemophilus influenzae 22.4-21] >gi|148715692|gb|ABQ97902.1| 30S ribosomal protein S16 [Haemophilus influenzae PittEE] >gi|148718584|gb|ABQ99711.1| 30S ribosomal protein S16 [Haemophilus influenzae PittGG] (82 aa)
Score = 138, Expect = 2.2e-07, Identities = 35/73 (47%), Positives = 48/73 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR+ RDG +IE+VG + P        + IN E    W+ +GA  SD V +L++E
  S:     1 MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPIAQGNAERLRINLERVNHWVAQGASLSDRVASLVKE 77
>gi|118475183|ref|YP_892202.1| 30S ribosomal protein S16 [Campylobacter fetus subsp. fetus 82-40] >gi|166234406|sp|A0RPR9|RS16_CAMFF 30S ribosomal protein S16 >gi|118414409|gb|ABK82829.1| ribosomal protein S16 [Campylobacter fetus subsp. fetus 82-40] (75 aa)
Score = 138, Expect = 2.3e-07, Identities = 32/69 (46%), Positives = 44/69 (63%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF--EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           +RLTR+GR+K PF+RIVV DSR RRD  +IE +G Y P     VV ++ +    W   GA+ SD V  + +
  S:     5 VRLTRMGRNKRPFYRIVVTDSRKRRDSGWIESIGYYNPMVEPEVVKVDADRLAYWKSVGAKLSDRVARITK 75
>gi|83592521|ref|YP_426273.1| 30S ribosomal protein S16 [Rhodospirillum rubrum ATCC 11170] >gi|109894795|sp|Q2RV59|RS16_RHORT 30S ribosomal protein S16 >gi|83575435|gb|ABC21986.1| SSU ribosomal protein S16P [Rhodospirillum rubrum ATCC 11170] (124 aa)
Score = 138, Expect = 2.4e-07, Identities = 37/75 (49%), Positives = 48/75 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           ++IRL R G  K PF+RIVV DSR+ RDG +IEK+GT++P      E  V + +E    WL  GA PSD V   L   G+
  S:     3 LRIRLARGGAKKRPFYRIVVADSRSPRDGRFIEKLGTFDPMLPRDHERRVVLKDERVKYWLGVGALPSDRVARFLGLSGL 82
>gi|115377069|ref|ZP_01464285.1| ribosomal protein S16 [Stigmatella aurantiaca DW4/3-1] >gi|115365908|gb|EAU64927.1| ribosomal protein S16 [Stigmatella aurantiaca DW4/3-1] (94 aa)
Score = 138, Expect = 2.4e-07, Identities = 33/71 (46%), Positives = 45/71 (63%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG--VVNINEEIALSWLKKGAQPSDTVKNLLR 72
           V +RL R G  K P++ +V  DSR  RDG +IE VG Y+P E    V  ++E    WLK GA PS+TV +L++
  S:    12 VVLRLARAGAKKKPYYHVVATDSRNPRDGKFIEAVGAYDPNESPPKVLFDQERLQYWLKTGALPSETVADLIK 84
>gi|113866919|ref|YP_725408.1| 30S ribosomal protein S16 [Ralstonia eutropha H16] >gi|123033187|sp|Q0KD81|RS16_RALEH 30S ribosomal protein S16 >gi|113525695|emb|CAJ92040.1| SSU ribosomal protein S16 [Ralstonia eutropha H16] (84 aa)
Score = 138, Expect = 2.4e-07, Identities = 37/73 (50%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PFF IV  DSR RRDG +IE+VG Y P      EG+    + +A  W   GAQ S TV  L+++
  S:     1 MVVIRLARGGSKKRPFFNIVATDSRNRRDGRFIERVGFYNPLATEGEEGLRLAQDRLAY-WQGVGAQLSPTVARLVKQ 77
>gi|15966995|ref|NP_387348.1| 30S ribosomal protein S16 [Sinorhizobium meliloti 1021] >gi|20140123|sp|Q92L43|RS16_RHIME 30S ribosomal protein S16 >gi|15076268|emb|CAC47821.1| Probable 30S ribosomal protein S16 [Sinorhizobium meliloti 1021] (124 aa)
Score = 138, Expect = 2.4e-07, Identities = 33/78 (42%), Positives = 52/78 (66%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P+++IVV D+R+ RDG ++EK+G++ P      E  + +N E    W+ +GAQP+D V   L + G+ K+
  S:     3 LKIRLARGGSKKRPYYQIVVADARSPRDGRFLEKLGSWNPMLAKDDEKRIELNAERVQHWIAQGAQPTDRVMRFLDQAGLAKR 85
>gi|87311716|ref|ZP_01093832.1| probable 30S ribosomal protein S16 [Blastopirellula marina DSM 3645] >gi|87285610|gb|EAQ77528.1| probable 30S ribosomal protein S16 [Blastopirellula marina DSM 3645] (146 aa)
Score = 138, Expect = 2.4e-07, Identities = 34/79 (43%), Positives = 48/79 (60%)
  Q:     6 LTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSK 84
           + R+GR   PF+RI  +DSR+ RDG  IE +GTY+PF    +  V++  E    WL  GAQ S  V  LLR+ G     +D++
  S:     1 MKRMGRTHRPFYRICAMDSRSPRDGKAIEYLGTYDPFVPEKDARVSLKRERVDYWLGVGAQASPKVAVLLRKYGTGGTHLDAQ 83
>gi|84702191|ref|ZP_01016766.1| probable 30s ribosomal protein s16 [Parvularcula bermudensis HTCC2503] >gi|84691437|gb|EAQ17277.1| probable 30s ribosomal protein s16 [Parvularcula bermudensis HTCC2503] (139 aa)
Score = 138, Expect = 2.4e-07, Identities = 35/70 (50%), Positives = 46/70 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           +KIRL R G  K P++ IVV D+R  RDG +IEK+G Y P      E  V ++ E A  WL+KGAQP++ V   L
  S:     3 LKIRLARGGAKKRPYYFIVVADARMPRDGRFIEKIGAYNPLLAKDNEMRVQVDAERAQYWLEKGAQPTERVARFL 77
>gi|114763700|ref|ZP_01443094.1| 30S ribosomal protein S16 [Roseovarius sp. HTCC2601] >gi|114543701|gb|EAU46714.1| 30S ribosomal protein S16 [Roseovarius sp. HTCC2601] (124 aa)
Score = 138, Expect = 2.4e-07, Identities = 42/96 (43%), Positives = 53/96 (55%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVK 97
           +KIRL R G  K P + IV  DSR  RDG ++EK+GTY P      E  V ++ E    WL +GAQP+D V   L   GV +K        K  +N NK K
  S:     3 IKIRLARGGSKKRPHYAIVASDSRMPRDGRFVEKLGTYNPLLAKDDERRVVMDLERVQYWLGQGAQPTDRVARFLESAGVAEK--------KTRNNPNKAK 95
>gi|91974989|ref|YP_567648.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris BisB5] >gi|123722181|sp|Q13DU2|RS16_RHOPS 30S ribosomal protein S16 >gi|91681445|gb|ABE37747.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris BisB5] (107 aa)
Score = 138, Expect = 2.5e-07, Identities = 44/111 (39%), Positives = 57/111 (51%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASK 112
           V IRL R G  K PF+ +VV DSR  RDG +IE++G + P      E  + ++ +    WL KGAQPSD V   L   G+           KK    N  +K V + E K A A K
  S:     3 VVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGI-----------KKREARNNPEKAVPRKERKAAEAGK 107
>gi|94495532|ref|ZP_01302112.1| ribosomal protein S16 [Sphingomonas sp. SKA58] >gi|94424920|gb|EAT09941.1| ribosomal protein S16 [Sphingomonas sp. SKA58] (149 aa)
Score = 138, Expect = 2.6e-07, Identities = 37/73 (50%), Positives = 48/73 (65%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           IRL+R G  K P++RIVV DSRA RDG +IE++G+Y P      E  V ++ E A  W+  GAQP+D V   L   GV
  S:     5 IRLSRGGSKKRPYYRIVVADSRAPRDGKFIERIGSYNPVLPKGDEKRVVLDIERAKHWVAAGAQPTDRVARFLDAAGV 82
>gi|28202162|ref|NP_777403.1| ribosomal protein S16 [Anthoceros formosae] >gi|41688687|sp|Q85CF2|RR16_ANTFO Chloroplast 30S ribosomal protein S16 >gi|27807864|dbj|BAC55339.1| ribosomal protein S16 [Anthoceros formosae] >gi|27807971|dbj|BAC55430.1| ribosomal protein S16 [Anthoceros formosae] (84 aa)
Score = 138, Expect = 2.6e-07, Identities = 29/79 (36%), Positives = 55/79 (69%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL R GR +   +RIV ID+++RR+G  +E+VG Y   +    ++    ++ +++GAQP++TV ++LR+ G++++
  S:     1 MVKLRLKRYGRKQQNTYRIVAIDAQSRREGRALEEVGFYNLRKDQTQLDILAIVNLIREGAQPTETVYDILRKAGIFER 79
>gi|49474774|ref|YP_032816.1| 30S ribosomal protein S16 [Bartonella quintana str. Toulouse] >gi|81646742|sp|Q6FYF9|RS16_BARQU 30S ribosomal protein S16 >gi|49240278|emb|CAF26751.1| 30s ribosomal protein s16 [Bartonella quintana str. Toulouse] (117 aa)
Score = 138, Expect = 2.6e-07, Identities = 40/112 (35%), Positives = 62/112 (55%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKP 113
           +KIRL+R G  K P++ IVV D+R+ RDG ++E+VG ++P        V +NEE    WL +GAQP+D V   L   G+ K+   ++    K     K ++ +   +    A S P
  S:     3 LKIRLSRGGSKKRPYYHIVVADARSPRDGRFLERVGAWDPMLPKDGPRVKLNEERIQYWLGQGAQPTDRVLRFLDAVGLKKR--PNRNNPHKGQPGKKAQERISAAKQVAEAESAP 116
>gi|118411184|ref|YP_874578.1| 30S ribosomal protein S16 [Thalassiosira pseudonana] >gi|125987691|sp|A0T0W6|RR16_THAPS Chloroplast 30S ribosomal protein S16 >gi|116739931|gb|ABK20801.1| 30S ribosomal protein S16 [Thalassiosira pseudonana] (79 aa)
Score = 138, Expect = 2.6e-07, Identities = 29/76 (38%), Positives = 48/76 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+K+RL R GR + P +R+V+++S  RR+G  +++VG Y P       N+E  + WL  G QP++TV  LL++  +
  S:     1 MLKLRLKRNGRKRQPAYRLVIMESTTRRNGRPVDEVGYYNPITKESYFNKEKIVKWLSYGVQPTETVFQLLKKSNL 76
>gi|146276237|ref|YP_001166396.1| 30S ribosomal protein S16 [Rhodobacter sphaeroides ATCC 17025] >gi|166201342|sp|A4WNX7|RS16_RHOS5 30S ribosomal protein S16 >gi|145554478|gb|ABP69091.1| SSU ribosomal protein S16P [Rhodobacter sphaeroides ATCC 17025] (116 aa)
Score = 137, Expect = 2.9e-07, Identities = 36/78 (46%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P + IV  DSR  RDG ++EK+GTY P      E  + +N E    WL +GAQP+D V   L   G+ +K
  S:     3 MKIRLARGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNVERVQYWLSQGAQPTDRVARFLEAAGLKEK 85
>gi|42520636|ref|NP_966551.1| 30S ribosomal protein S16 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58699673|ref|ZP_00374348.1| ribosomal protein S16 [Wolbachia endosymbiont of Drosophila ananassae] >gi|99034259|ref|ZP_01314317.1| hypothetical protein Wendoof_01000885 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|54039383|sp|P62240|RS16_WOLPM 30S ribosomal protein S16 >gi|42410375|gb|AAS14485.1| ribosomal protein S16 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58533811|gb|EAL58135.1| ribosomal protein S16 [Wolbachia endosymbiont of Drosophila ananassae] (106 aa)
Score = 137, Expect = 2.9e-07, Identities = 35/66 (53%), Positives = 43/66 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS-----WLKKGAQPSDTV 67
           VKIRL R G  K PF+RIVV DSRA RDG +IEK+G Y+P     N N  +  +     WL  GAQ ++ V
  S:     3 VKIRLARFGAKKRPFYRIVVADSRAPRDGRFIEKIGQYDPMLPKDNKNRVVVKADRLKHWLSVGAQATERV 73
>gi|159042904|ref|YP_001531698.1| 30S ribosomal protein S16 [Dinoroseobacter shibae DFL 12] >gi|189044379|sp|A8LMC0|RS16_DINSH 30S ribosomal protein S16 >gi|157910664|gb|ABV92097.1| ribosomal protein S16 [Dinoroseobacter shibae DFL 12] (130 aa)
Score = 137, Expect = 3.0e-07, Identities = 38/78 (48%), Positives = 48/78 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+RIV  DSR  RDG +IEK+GTY P      E  V ++ E    WL +GA+P+D V  +L    V  K
  S:     3 MKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDLERVQYWLGEGAKPTDRVARMLEAAEVLPK 85
>gi|86359539|ref|YP_471431.1| 30S ribosomal protein S16 [Rhizobium etli CFN 42] >gi|109894791|sp|Q2K382|RS16_RHIEC 30S ribosomal protein S16 >gi|86283641|gb|ABC92704.1| 30S ribosomal protein S16 [Rhizobium etli CFN 42] (122 aa)
Score = 137, Expect = 3.2e-07, Identities = 34/78 (43%), Positives = 49/78 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P++ +V+ D+R+ RDG ++E +G++ P      E  V +N E    WL  GAQP+D V   L E GV K+
  S:     3 LKIRLARGGSKKRPYYHVVLADARSPRDGRFLENLGSWNPMLAKDDEKRVQLNAERIKHWLDNGAQPTDRVLRFLNEAGVAKR 85
>gi|77464629|ref|YP_354133.1| 30S ribosomal protein S16 [Rhodobacter sphaeroides 2.4.1] >gi|126463469|ref|YP_001044583.1| 30S ribosomal protein S16 [Rhodobacter sphaeroides ATCC 17029] >gi|166201341|sp|A3PN95|RS16_RHOS1 30S ribosomal protein S16 >gi|109894796|sp|Q3IZ02|RS16_RHOS4 30S ribosomal protein S16 >gi|77389047|gb|ABA80232.1| SSU ribosomal protein S16P [Rhodobacter sphaeroides 2.4.1] >gi|126105133|gb|ABN77811.1| SSU ribosomal protein S16P [Rhodobacter sphaeroides ATCC 17029] (116 aa)
Score = 137, Expect = 3.3e-07, Identities = 36/78 (46%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P + IV  DSR  RDG ++EK+GTY P      E  + +N E    WL +GAQP+D V   L   G+ +K
  S:     3 MKIRLARGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNLERVQYWLAQGAQPTDRVARFLEAAGLKEK 85
>gi|121595657|ref|YP_987553.1| SSU ribosomal protein S16P [Acidovorax sp. JS42] >gi|166234385|sp|A1WB52|RS16_ACISJ 30S ribosomal protein S16 >gi|120607737|gb|ABM43477.1| SSU ribosomal protein S16P [Acidovorax sp. JS42] (83 aa)
Score = 136, Expect = 4.1e-07, Identities = 35/73 (47%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G    PFF IVV D R RRDG +IE++G Y P     E  + I ++    W   GAQPS TV  L+++
  S:     1 MVVIRLSRGGSKGRPFFNIVVADKRVRRDGRFIERLGFYNPSAKEGEEGLRIAQDRLTYWKGVGAQPSPTVDRLIKQ 77
>gi|42630507|ref|ZP_00156046.1| COG0228: Ribosomal protein S16 [Haemophilus influenzae R2866] >gi|145628511|ref|ZP_01784311.1| 30S ribosomal protein S16 [Haemophilus influenzae 22.1-21] >gi|145639737|ref|ZP_01795339.1| 30S ribosomal protein S16 [Haemophilus influenzae PittII] >gi|144978981|gb|EDJ88667.1| 30S ribosomal protein S16 [Haemophilus influenzae 22.1-21] >gi|145271105|gb|EDK11020.1| 30S ribosomal protein S16 [Haemophilus influenzae PittII] (82 aa)
Score = 136, Expect = 4.2e-07, Identities = 35/73 (47%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR+ RDG +IE VG + P        + IN E    W+ +GA  SD V +L++E
  S:     1 MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIEPVGFFNPIAQGNAERLRINLERVNHWVAQGASLSDRVASLVKE 77
>gi|71894035|ref|YP_278143.1| 30S ribosomal protein S16 [Mycoplasma synoviae 53] >gi|109894773|sp|Q4A739|RS16_MYCS5 30S ribosomal protein S16 >gi|71850823|gb|AAZ43432.1| 30S ribosomal protein S16 [Mycoplasma synoviae 53] (84 aa)
Score = 136, Expect = 4.3e-07, Identities = 33/72 (45%), Positives = 44/72 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MVKIRL R+G    P ++IVV D+RA RDG +IE +G Y P      ++ E    WL  GA+P+ TV NL +
  S:     1 MVKIRLKRMGSKFRPVYKIVVADARAPRDGKFIEALGHYNPSNKDFVLDSEKTAKWLANGAKPTVTVWNLFK 72
>gi|84515966|ref|ZP_01003327.1| ribosomal protein S16 [Loktanella vestfoldensis SKA53] >gi|84510408|gb|EAQ06864.1| ribosomal protein S16 [Loktanella vestfoldensis SKA53] (126 aa)
Score = 136, Expect = 4.3e-07, Identities = 37/78 (47%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P + IV  DSR  RDG +IEK+GTY P      E  V ++ +    WL +GAQP+D V  +L   GV  K
  S:     1 MKIRLARGGSKKRPHYAIVAADSRMPRDGRFIEKLGTYAPMLPKDSEDRVRMDMDRIQYWLGQGAQPTDRVARMLEAAGVMPK 83
>gi|15605706|ref|NP_213083.1| ribosomal protein S16 [Aquifex aeolicus VF5] >gi|7388141|sp|O66523|RS16_AQUAE 30S ribosomal protein S16 >gi|189096163|pdb|3BN0|A Chain A, The Ribosomal Protein S16 From Aquifex Aeolicus >gi|2982872|gb|AAC06492.1| ribosomal protein S16 [Aquifex aeolicus VF5] (112 aa)
Score = 136, Expect = 4.5e-07, Identities = 38/108 (35%), Positives = 63/108 (58%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKV-KKEVKKPEAKKAA 109
           V+IRL + GR   P +RIVV+D+++ R+G YI+ +GTY+P   V +N+  E    W+ KG + S   K +L   G+ K+ +    + K+  +     K+E KK +  +AA
  S:     3 VRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPKRKVLINVYPEKVKEWVLKGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEKRESKKSKGGEAA 112
>gi|30468118|ref|NP_849005.1| 30S ribosomal protein S16 [Cyanidioschyzon merolae strain 10D] >gi|51703311|sp|Q85G24|RR16_CYAME Chloroplast 30S ribosomal protein S16 >gi|30409218|dbj|BAC76167.1| 30S ribosomal protein S16 [Cyanidioschyzon merolae strain 10D] (75 aa)
Score = 135, Expect = 5.0e-07, Identities = 33/70 (47%), Positives = 45/70 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNL 70
           M+KIRL R+GR  +P +R+VV+ S+ RRDG  IE +G Y P      IN+E     L +GAQ ++TVK L
  S:     1 MLKIRLKRIGRRGMPSYRVVVMRSQTRRDGKAIEDLGFYNPISKQCVINKERIKVRLSQGAQMTETVKYL 70
>gi|33573850|emb|CAE38159.1| 30S ribosomal protein S16 [Bordetella parapertussis] (101 aa)
Score = 135, Expect = 5.0e-07, Identities = 33/73 (45%), Positives = 42/73 (57%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           M+ IRL R G  K PF+ +V  DSR RRDG ++E+VG Y P       N  IAL     W   GA  S  V+ L++E
  S:    16 MLVIRLARGGSKKRPFYNLVATDSRNRRDGRFVERVGFYNPVAAEGTENLRIALGRVQYWTGNGALLSPAVERLVKE 92
>gi|39933321|ref|NP_945597.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris CGA009] >gi|192288676|ref|YP_001989281.1| ribosomal protein S16 [Rhodopseudomonas palustris TIE-1] >gi|50403606|sp|P62236|RS16_RHOPA 30S ribosomal protein S16 (RRP-S16) >gi|39652946|emb|CAE25688.1| ribosomal protein S16 [Rhodopseudomonas palustris CGA009] >gi|192282425|gb|ACE98805.1| ribosomal protein S16 [Rhodopseudomonas palustris TIE-1] (106 aa)
Score = 135, Expect = 5.0e-07, Identities = 36/78 (46%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL R G  K PF+ +VV DSR  RDG +IE++G + P      E  + ++ +    WL KGAQPSD V   L   GV K+
  S:     3 VVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGVRKR 85
>gi|118411051|ref|YP_874446.1| 30S ribosomal protein S16 [Phaeodactylum tricornutum] >gi|68053020|sp|Q5D704|RR16_PHATR Chloroplast 30S ribosomal protein S16 >gi|60202593|gb|AAX14685.1| putative 30S ribosomal protein S16 [Phaeodactylum tricornutum] >gi|116739798|gb|ABK20669.1| 30S ribosomal protein S16 [Phaeodactylum tricornutum] (78 aa)
Score = 135, Expect = 5.3e-07, Identities = 31/73 (42%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           M+K+RL R GR + P +R+VV+++ ARRDG  IE++G Y P       + E    WL  G +P++TV +LLR+
  S:     1 MLKLRLKRTGRKRSPSYRLVVMENTARRDGRPIEELGYYSPITKQYKFDVEKIKKWLDFGVKPTETVSSLLRK 73
>gi|56479499|ref|YP_161088.1| 30S ribosomal protein S16 [Azoarcus sp. EbN1] >gi|81598441|sp|Q5NXM7|RS16_AZOSE 30S ribosomal protein S16 >gi|56315542|emb|CAI10187.1| 30S ribosomal protein S16 [Azoarcus sp. EbN1] (83 aa)
Score = 135, Expect = 5.3e-07, Identities = 36/70 (51%), Positives = 42/70 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNL 70
           MV IRL R G  K PF+ IV  DSR RRDG +IE+VG Y P     E  + +N E    W + GAQ S TV  L
  S:     1 MVVIRLARGGAKKRPFYNIVAADSRNRRDGRFIERVGFYNPMAAESEKGLVVNAERLEYWKQHGAQLSPTVLRL 74
>gi|33576602|emb|CAE33680.1| 30S ribosomal protein S16 [Bordetella bronchiseptica RB50] (101 aa)
Score = 135, Expect = 5.4e-07, Identities = 33/73 (45%), Positives = 42/73 (57%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           M+ IRL R G  K PF+ +V  DSR RRDG ++E+VG Y P       N  IAL     W   GA  S  V+ L++E
  S:    16 MLVIRLARGGSKKRPFYNLVATDSRNRRDGRFVERVGFYNPVAAEGTENLRIALDRVQYWTGNGALLSPAVERLVKE 92
>gi|70728476|ref|YP_258225.1| 30S ribosomal protein S16 [Pseudomonas fluorescens Pf-5] >gi|109894785|sp|Q4KHQ8|RS16_PSEF5 30S ribosomal protein S16 >gi|68342775|gb|AAY90381.1| ribosomal protein S16 [Pseudomonas fluorescens Pf-5] (83 aa)
Score = 135, Expect = 5.5e-07, Identities = 33/75 (44%), Positives = 46/75 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           M+ IRL   G  K PF+ + V DSR  RDG++ E+VG + P     E  +++N+E    WL  GAQPS+ V  LL+E  
  S:     1 MLTIRLALGGSKKRPFYHLTVTDSRNPRDGSHKEQVGFFNPIARGQEVRLSVNQERVAYWLSVGAQPSERVAQLLKESA 79
>gi|73666762|ref|YP_302778.1| 30S ribosomal protein S16 [Ehrlichia canis str. Jake] >gi|109893880|sp|Q3YSX5|RS16_EHRCJ 30S ribosomal protein S16 >gi|72393903|gb|AAZ68180.1| SSU ribosomal protein S16P [Ehrlichia canis str. Jake] (87 aa)
Score = 135, Expect = 5.9e-07, Identities = 33/72 (45%), Positives = 43/72 (59%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           VKIRL R G  K PF+R+VV DSR  RDG +IE +G Y P      E  V +  +    WL  GAQ +D V   +++
  S:     3 VKIRLARFGAKKRPFYRVVVADSRVSRDGKFIESLGFYNPMLPKEHELFVKVKVDRLKYWLSVGAQATDRVAWFIKK 79
>gi|117923818|ref|YP_864435.1| SSU ribosomal protein S16P [Magnetococcus sp. MC-1] >gi|166201312|sp|A0L4Y6|RS16_MAGSM 30S ribosomal protein S16 >gi|117607574|gb|ABK43029.1| SSU ribosomal protein S16P [Magnetococcus sp. MC-1] (83 aa)
Score = 135, Expect = 6.1e-07, Identities = 33/73 (45%), Positives = 47/73 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           V IRL R G+ K P + +VV D R  RDG ++EK+G Y P +  G   IN+E    W+ +GA+PS+TV  L+ +Q
  S:     3 VCIRLARGGKKKKPVYSVVVADKRMARDGRFLEKLGQYIPMKEGGTFAINQERYAHWISQGAKPSETVGKLVAKQ 77
>gi|110635667|ref|YP_675875.1| 30S ribosomal protein S16 [Mesorhizobium sp. BNC1] >gi|123353130|sp|Q11D15|RS16_MESSB 30S ribosomal protein S16 >gi|110286651|gb|ABG64710.1| SSU ribosomal protein S16P [Mesorhizobium sp. BNC1] (134 aa)
Score = 135, Expect = 6.1e-07, Identities = 35/78 (44%), Positives = 48/78 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P++ IVV D RA RDG +IE++G++ P        V +NEE    WL  GA P+D V   L + G+ K+
  S:     3 LKIRLARAGSKKRPYYHIVVADVRAPRDGRFIEQIGSWNPMLPKDSERVKLNEERIKHWLANGALPTDRVLRFLDQAGLAKR 84
>gi|67920635|ref|ZP_00514155.1| Ribosomal protein S16 [Crocosphaera watsonii WH 8501] >gi|67858119|gb|EAM53358.1| Ribosomal protein S16 [Crocosphaera watsonii WH 8501] (82 aa)
Score = 135, Expect = 6.2e-07, Identities = 32/79 (40%), Positives = 53/79 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MVK+RL + G+ +   +RIV I+S +RRDG  +E++G Y P      +N    ++ LK+GAQPSDTV+++L +  V+++
  S:     1 MVKLRLKKYGKKREVSYRIVAINSASRRDGRPLEELGFYNPRTDETRLNVPAIVTRLKQGAQPSDTVRSILEKAKVFEQ 79
>gi|186475534|ref|YP_001857004.1| ribosomal protein S16 [Burkholderia phymatum STM815] >gi|184191993|gb|ACC69958.1| ribosomal protein S16 [Burkholderia phymatum STM815] (84 aa)
Score = 134, Expect = 6.6e-07, Identities = 35/73 (47%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG---VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IV  DSR+RRDG +IE+VG Y P       + I ++    W   GAQ S TV+ L++E
  S:     1 MVIIRLARGGSKKRPFYNIVATDSRSRRDGRFIERVGFYNPVATKGESLRIAQDRLTYWQGVGAQLSPTVQRLVKE 76
>gi|115522356|ref|YP_779267.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris BisA53] >gi|122297960|sp|Q07UU7|RS16_RHOP5 30S ribosomal protein S16 >gi|115516303|gb|ABJ04287.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris BisA53] (110 aa)
Score = 134, Expect = 6.7e-07, Identities = 34/78 (43%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL R G  K P + +VV DSR  RDG +IE++G + P      E  + ++ +   +W+ KGAQPSD V   L   GV K+
  S:     3 VVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGHFNPLLPKDNEARLKLDLDKVKAWVAKGAQPSDRVARFLDAAGVMKR 85
>gi|161525404|ref|YP_001580416.1| 30S ribosomal protein S16 [Burkholderia multivorans ATCC 17616] >gi|189349859|ref|YP_001945487.1| small subunit ribosomal protein S16 [Burkholderia multivorans ATCC 17616] >gi|160342833|gb|ABX15919.1| ribosomal protein S16 [Burkholderia multivorans ATCC 17616] >gi|189333881|dbj|BAG42951.1| small subunit ribosomal protein S16 [Burkholderia multivorans ATCC 17616] (84 aa)
Score = 134, Expect = 6.7e-07, Identities = 35/73 (47%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG---VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IV  DSR RRDG +IE+VG Y P       + I ++    W   GAQ S TV+ L++E
  S:     1 MVIIRLARGGSKKRPFYNIVATDSRNRRDGRFIERVGFYNPVATKGEALRIAQDRLTYWQGVGAQLSPTVQRLVKE 76
>gi|88608585|ref|YP_506023.1| ribosomal protein S16 [Neorickettsia sennetsu str. Miyayama] >gi|109894774|sp|Q2GES3|RS16_NEOSM 30S ribosomal protein S16 >gi|88600754|gb|ABD46222.1| ribosomal protein S16 [Neorickettsia sennetsu str. Miyayama] (85 aa)
Score = 134, Expect = 6.9e-07, Identities = 29/71 (40%), Positives = 46/71 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLL 71
           M+KIRL R GR K P+++IVV +S + RDG ++E+VG+Y+P         V ++ E    W   GA+P++ V   +
  S:     7 MLKIRLARFGRKKRPYYKIVVANSSSPRDGKFLEQVGSYDPLLSKDDPLRVCLDIERIRYWTSVGAKPTERVAKFV 82
>gi|88797968|ref|ZP_01113555.1| Ribosomal protein S16 [Reinekea sp. MED297] >gi|88779165|gb|EAR10353.1| Ribosomal protein S16 [Reinekea sp. MED297] (83 aa)
Score = 134, Expect = 7.0e-07, Identities = 34/73 (46%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF+ + V DSR  RDG +IE+VG + P     E  + ++ +    W+ KGAQ SD V  LL+E
  S:     1 MVVIRLSRGGSKKRPFYHLTVADSRNARDGRFIERVGFFNPIARGQEERLRVSLDRVDYWVSKGAQTSDRVAQLLKE 77
>gi|85057586|ref|YP_456502.1| 30S ribosomal protein S16 [Aster yellows witches'-broom phytoplasma AYWB] >gi|109893863|sp|Q2NJH0|RS16_AYWBP 30S ribosomal protein S16 >gi|84789691|gb|ABC65423.1| SSU ribosomal protien S16P [Aster yellows witches'-broom phytoplasma AYWB] (87 aa)
Score = 134, Expect = 7.0e-07, Identities = 27/62 (43%), Positives = 40/62 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQP 63
           +K+RL R G HK PF+R+V  +S+  RDG ++E +GTY+    +V ++   A  WL  GAQP
  S:     3 IKMRLQRFGVHKRPFYRVVASESKNARDGKFLEILGTYDTILDIVELDHNKAQKWLSNGAQP 64
>gi|32034692|ref|ZP_00134830.1| COG0228: Ribosomal protein S16 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209250|ref|YP_001054475.1| 30S ribosomal protein S16 [Actinobacillus pleuropneumoniae L20] >gi|165977223|ref|YP_001652816.1| 30S ribosomal protein S16 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190151141|ref|YP_001969666.1| 30S ribosomal protein S16 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166234386|sp|A3N384|RS16_ACTP2 30S ribosomal protein S16 >gi|126098042|gb|ABN74870.1| 30S ribosomal protein S16 [Actinobacillus pleuropneumoniae L20] >gi|165877324|gb|ABY70372.1| 30S ribosomal protein S16 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916272|gb|ACE62524.1| 30S ribosomal protein S16 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (82 aa)
Score = 134, Expect = 7.0e-07, Identities = 33/73 (45%), Positives = 48/73 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRLTR G  K PF++IVV DSR+ RDG +IE++G + P        + ++     +W+ KGA  SD V +L++E
  S:     1 MVTIRLTRGGAKKRPFYQIVVADSRSPRDGRFIERIGFFNPLAAGQAERLRLDVAKVDAWVAKGADLSDRVASLVKE 77
>gi|15893282|ref|NP_360996.1| 30S ribosomal protein S16 [Rickettsia conorii str. Malish 7] >gi|34581052|ref|ZP_00142532.1| 30S ribosomal protein S16 [Rickettsia sibirica 246] >gi|157829197|ref|YP_001495439.1| 30S ribosomal protein S16 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933922|ref|YP_001650711.1| 30S ribosomal protein S16 [Rickettsia rickettsii str. Iowa] >gi|167472478|ref|ZP_02337182.1| SSU ribosomal protein S16P [Rickettsia africae ESF-5] >gi|166201346|sp|A8GU56|RS16_RICRS 30S ribosomal protein S16 >gi|189029610|sp|B0BVP5|RS16_RICRO 30S ribosomal protein S16 >gi|20140104|sp|Q92FW8|RS16_RICCN 30S ribosomal protein S16 >gi|15620503|gb|AAL03897.1| 30S ribosomal protein S16 [Rickettsia conorii str. Malish 7] >gi|28262437|gb|EAA25941.1| 30S ribosomal protein S16 [Rickettsia sibirica 246] >gi|157801678|gb|ABV76931.1| 30S ribosomal protein S16 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165909009|gb|ABY73305.1| SSU ribosomal protein S16P [Rickettsia rickettsii str. Iowa] (111 aa)
Score = 134, Expect = 7.0e-07, Identities = 45/107 (42%), Positives = 64/107 (59%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKA 108
           VKIRL R G  K PF+R+VV ++ A RDG ++EKVGTY+P     N +E + L       WL  GA+P++ V   + + GV    +  KV+ + E  A   K  + K EAK+A
  S:     3 VKIRLARGGAKKRPFYRVVVANATAPRDGDFLEKVGTYDPMLASDN-SERVVLKKDRIEYWLGTGAKPTERVAKFIEQAGV---TLPEKVKKEMEVKAKNRKARLSKKEAKEA 111
>gi|90421128|ref|ZP_01229030.1| ribosomal protein S16 [Aurantimonas sp. SI85-9A1] >gi|90334620|gb|EAS48400.1| ribosomal protein S16 [Aurantimonas sp. SI85-9A1] (140 aa)
Score = 134, Expect = 7.2e-07, Identities = 31/78 (39%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +K+RL R G  K P++ +VV D+R+ RDG ++E++G++ P        V +NEE    WL +GAQP+D V   L + G+  +
  S:     3 LKMRLARAGSKKRPYYHVVVADARSPRDGRFVEQLGSWNPMLPKDAQRVTLNEERIKHWLAEGAQPTDRVLRFLDQAGIMSR 84
>gi|17545652|ref|NP_519054.1| 30S ribosomal protein S16 [Ralstonia solanacearum GMI1000] >gi|20140049|sp|Q8Y0W0|RS16_RALSO 30S ribosomal protein S16 >gi|17427945|emb|CAD14635.1| probable 30s ribosomal protein s16. [Ralstonia solanacearum] (84 aa)
Score = 134, Expect = 7.3e-07, Identities = 35/73 (47%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G    PFF IV  DSR RRDG +IE+VG Y P     E  + I ++    W   GAQ S TV  L+++
  S:     1 MVVIRLARGGSKNRPFFNIVATDSRNRRDGRFIERVGFYNPLATEGEEGLRIAQDRLSYWQGVGAQLSPTVARLVKQ 77
>gi|15603880|ref|NP_246232.1| 30S ribosomal protein S16 [Pasteurella multocida subsp. multocida str. Pm70] >gi|14195193|sp|P58123|RS16_PASMU 30S ribosomal protein S16 (82 aa)
Score = 134, Expect = 7.3e-07, Identities = 33/73 (45%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR+ RDG +IE+VG + P        + ++ +   +W++KGA  SD V  L++E
  S:     1 MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPLATGNAERLRLDLDRVNAWVEKGASLSDRVSALVKE 77
>gi|114705072|ref|ZP_01437980.1| 30s ribosomal protein s16 [Fulvimarina pelagi HTCC2506] >gi|114539857|gb|EAU42977.1| 30s ribosomal protein s16 [Fulvimarina pelagi HTCC2506] (145 aa)
Score = 134, Expect = 7.4e-07, Identities = 41/107 (38%), Positives = 58/107 (54%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKA 108
           VKIRL R G  K P++ IV  D+R  RDG +IE++G + P        V +NEE    WL +GAQP+D V   L + G         + S+ E N  K  +  KK + ++A
  S:     3 VKIRLARAGSKKRPYYHIVAADTRTPRDGRFIEQLGAWNPMLPKDGQRVTLNEERIKYWLSEGAQPTDRVLRFLDQAG---------IASRPERNNPKKAQPGKKAQEREA 104
>gi|84498355|ref|ZP_00997152.1| 30s ribosomal protein s16 [Janibacter sp. HTCC2649] >gi|84381855|gb|EAP97738.1| 30s ribosomal protein s16 [Janibacter sp. HTCC2649] (227 aa)
Score = 134, Expect = 7.4e-07, Identities = 32/71 (45%), Positives = 49/71 (69%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           VKIRL R+G+ +   +R+VV+DSR +RDG  IE++G Y+P +   ++ I+ E A  W   GAQP++ V  LL+
  S:     3 VKIRLKRMGKIRTAIYRVVVMDSRTKRDGRAIEEIGKYDPNQEPSLIEIDMERANHWRSLGAQPTEAVAALLK 75
>gi|77457246|ref|YP_346751.1| 30S ribosomal protein S16 [Pseudomonas fluorescens PfO-1] >gi|109894787|sp|Q3KHJ4|RS16_PSEPF 30S ribosomal protein S16 >gi|77381249|gb|ABA72762.1| SSU ribosomal protein S16P [Pseudomonas fluorescens PfO-1] (83 aa)
Score = 134, Expect = 7.6e-07, Identities = 33/75 (44%), Positives = 46/75 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           M+ IRL   G  K PF+ + V DSR  RDG++ E+VG + P     E  +++N+E    WL  GAQPS+ V  LL+E  
  S:     1 MLTIRLALGGSKKRPFYHLTVTDSRNPRDGSHKEQVGFFNPVARGQEIRLSVNQERVAYWLSVGAQPSERVAQLLKESA 79
>gi|108773276|ref|YP_635736.1| ribosomal protein S16 [Chara vulgaris] >gi|122224966|sp|Q1ACL1|RR16_CHAVU Chloroplast 30S ribosomal protein S16 >gi|77157932|gb|ABA61973.1| ribosomal protein S16 [Chara vulgaris] (78 aa)
Score = 134, Expect = 7.7e-07, Identities = 32/71 (45%), Positives = 44/71 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           MVK+RL R G+ + P +RIV I+S  RR+G   ++VG Y P      +N    +  LK GAQP+ TVKN+L
  S:     1 MVKLRLKRYGKKQQPTYRIVAIESSFRREGRAFKEVGIYIPKYNKTQLNVPAIIELLKNGAQPTSTVKNIL 71
>gi|89069751|ref|ZP_01157087.1| ribosomal protein S16 [Oceanicola granulosus HTCC2516] >gi|89044697|gb|EAR50808.1| ribosomal protein S16 [Oceanicola granulosus HTCC2516] (130 aa)
Score = 134, Expect = 8.0e-07, Identities = 37/78 (47%), Positives = 45/78 (57%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K PF+ IV  DSR  RDG +IEK+GTY P      E  V ++      WL  GAQP+D V   L   G+  K
  S:     3 MKIRLARGGSKKRPFYSIVASDSRMPRDGRFIEKLGTYSPLLPKDSEDRVKMDTARVQHWLDAGAQPTDRVSRFLEAAGLVAK 85
>gi|89257007|ref|YP_514369.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica] >gi|115315367|ref|YP_764090.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica OSU18] >gi|167009387|ref|ZP_02274318.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica FSC200] >gi|169656745|ref|YP_001429272.2| ribosomal protein S16 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|122324646|sp|Q0BKD1|RS16_FRATO 30S ribosomal protein S16 >gi|123401546|sp|Q2A1N3|RS16_FRATH 30S ribosomal protein S16 >gi|189044385|sp|A7NEB3|RS16_FRATF 30S ribosomal protein S16 >gi|89144838|emb|CAJ80177.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica LVS] >gi|115130266|gb|ABI83453.1| ribosomal protein S16 [Francisella tularensis subsp. holarctica OSU18] >gi|134254070|gb|EBA53164.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica 257] >gi|157122816|gb|EDO66945.1| 30S ribosomal protein S16 [Francisella tularensis subsp. holarctica FSC022] >gi|164551813|gb|ABU62316.2| ribosomal protein S16 [Francisella tularensis subsp. holarctica FTNF002-00] (82 aa)
Score = 133, Expect = 8.4e-07, Identities = 36/73 (49%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IR+ R G  K  F+RIVV D R+ RDG +IEK+G + P     E  + ++   A +WL KGAQPSD V +L++E
  S:     1 MVVIRMARGGAKKRSFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKE 77
>gi|109893884|sp|Q2SL58|RS16_HAHCH 30S ribosomal protein S16 (79 aa)
Score = 133, Expect = 8.5e-07, Identities = 31/72 (43%), Positives = 47/72 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+ + V DSR  RDG +IE+VG + P     +  + ++ E    W+++GAQ SD V++L++
  S:     1 MVTIRLARGGSKKRPFYHLNVTDSRNARDGRFIERVGFFNPTARGNDERIRVDAERLQFWVERGAQMSDRVRDLVK 76
>gi|15612143|ref|NP_223795.1| 30S ribosomal protein S16 [Helicobacter pylori J99] >gi|7388165|sp|Q9ZK63|RS16_HELPJ 30S ribosomal protein S16 >gi|4155672|gb|AAD06658.1| 30S RIBOSOMAL PROTEIN S16 [Helicobacter pylori J99] (76 aa)
Score = 133, Expect = 8.9e-07, Identities = 35/70 (50%), Positives = 45/70 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+R+VV DSR RRDG +IE +G Y P      V I++E    W   GA+ S+ V+ L
  S:     1 MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSEPKDVRIDKERLNYWKGVGAKMSERVEKL 72
>gi|68171428|ref|ZP_00544818.1| Ribosomal protein S16 [Ehrlichia chaffeensis str. Sapulpa] >gi|88658509|ref|YP_507016.1| 30S ribosomal protein S16 [Ehrlichia chaffeensis str. Arkansas] >gi|109893881|sp|Q2GHR7|RS16_EHRCR 30S ribosomal protein S16 >gi|67999148|gb|EAM85808.1| Ribosomal protein S16 [Ehrlichia chaffeensis str. Sapulpa] >gi|88599966|gb|ABD45435.1| ribosomal protein S16 [Ehrlichia chaffeensis str. Arkansas] (87 aa)
Score = 133, Expect = 9.0e-07, Identities = 32/72 (44%), Positives = 43/72 (59%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           VKIRL R G  K PF+R+VV DSR  RDG +IE +G Y P      E  V +  +    WL  GAQ +D +   +++
  S:     3 VKIRLARFGAKKRPFYRVVVADSRVARDGKFIESLGFYNPMLPKEHELFVKVKVDRLKYWLSVGAQATDRISWFIKK 79
>gi|17229445|ref|NP_485993.1| 30S ribosomal protein S16 [Nostoc sp. PCC 7120] >gi|75910554|ref|YP_324850.1| 30S ribosomal protein S16 [Anabaena variabilis ATCC 29413] >gi|20140066|sp|Q8YVM2|RS16_ANASP 30S ribosomal protein S16 >gi|109893862|sp|Q3M4Y1|RS16_ANAVT 30S ribosomal protein S16 >gi|17131043|dbj|BAB73652.1| 30S ribosomal protein S16 [Nostoc sp. PCC 7120] >gi|75704279|gb|ABA23955.1| SSU ribosomal protein S16P [Anabaena variabilis ATCC 29413] (86 aa)
Score = 133, Expect = 9.6e-07, Identities = 29/79 (36%), Positives = 54/79 (68%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   +RIV +++ +RRDG  +E++G Y P    V ++    +  L++GAQP+DTV+ +L++Q V+++
  S:     1 MIKLRLKRFGKKREASYRIVAMNNLSRRDGRPLEELGYYNPRTDEVRLDVPGIVKRLQQGAQPTDTVRRILQKQNVFEQ 79
>gi|27904845|ref|NP_777971.1| 30S ribosomal protein S16 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|31076924|sp|Q89AE3|RS16_BUCBP 30S ribosomal protein S16 >gi|27904243|gb|AAO27076.1| 30S ribosomal protein S16 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (87 aa)
Score = 133, Expect = 1.0e-06, Identities = 34/72 (47%), Positives = 47/72 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLR 72
           MVKIRL RLG  K PF++IV+ DSR  R+G +IEK+G ++P   +     + IN      W+K GA  S  VK L++
  S:     1 MVKIRLVRLGAKKRPFYKIVIADSRYPRNGKFIEKIGFFKPLLSIKHPPQICINTLRITHWIKNGAIMSKRVKKLVK 77
>gi|39938958|ref|NP_950724.1| 30S ribosomal protein S16 [Onion yellows phytoplasma OY-M] >gi|54039380|sp|P62235|RS16_ONYPE 30S ribosomal protein S16 >gi|39722067|dbj|BAD04557.1| ribosomal protein S16 [Onion yellows phytoplasma OY-M] (87 aa)
Score = 133, Expect = 1.0e-06, Identities = 26/62 (41%), Positives = 39/62 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQP 63
           +K+RL R G HK PF+R+V  +S+  RDG ++E +GTY+    +V ++      WL  GAQP
  S:     3 IKMRLQRFGVHKRPFYRVVASESKNARDGKFLEILGTYDTILDIVELDHNKVQKWLSNGAQP 64
>gi|15595040|ref|NP_212829.1| 30S ribosomal protein S16 [Borrelia burgdorferi B31] >gi|167933450|ref|ZP_02520525.1| 30S ribosomal protein S16 [Borrelia burgdorferi ZS7] >gi|167943629|ref|ZP_02530703.1| 30S ribosomal protein S16 [Borrelia burgdorferi Bol26] >gi|168526078|ref|ZP_02719717.1| 30S ribosomal protein S16 [Borrelia burgdorferi 118a] >gi|168579735|ref|ZP_02723731.1| 30S ribosomal protein S16 [Borrelia burgdorferi 72a] >gi|168692333|ref|ZP_02725125.1| 30S ribosomal protein S16 [Borrelia burgdorferi 94a] >gi|195941514|ref|ZP_03086896.1| 30S ribosomal protein S16 [Borrelia burgdorferi 80a] >gi|195949027|ref|ZP_03090127.1| 30S ribosomal protein S16 [Borrelia burgdorferi WI91-23] >gi|195950989|ref|ZP_03092086.1| 30S ribosomal protein S16 [Borrelia burgdorferi 29805] >gi|195960433|ref|ZP_03096638.1| 30S ribosomal protein S16 [Borrelia burgdorferi 64b] >gi|3914890|sp|O51638|RS16_BORBU 30S ribosomal protein S16 >gi|2688633|gb|AAC67048.1| ribosomal protein S16 (rpsP) [Borrelia burgdorferi B31] (86 aa)
Score = 133, Expect = 1.0e-06, Identities = 36/78 (46%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R+G  K P++R+VV++S + RDG  IE++G Y P E    + I E+    W+ KGA  SDTVK LL +  +  K
  S:     3 VKIRLKRMGAKKRPYYRVVVMNSTSPRDGRAIEELGYYHPVEKQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAK 82
>gi|60117204|ref|YP_209538.1| ribosomal protein S16 [Huperzia lucidula] >gi|68053051|sp|Q5SCW6|RR16_HUPLU Chloroplast 30S ribosomal protein S16 >gi|50660012|gb|AAT80734.1| ribosomal protein S16 [Huperzia lucidula] (84 aa)
Score = 133, Expect = 1.0e-06, Identities = 28/80 (35%), Positives = 53/80 (66%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           MVK+RL + G  +   +RIV ID+R+R  G  I++VG+Y+P +     N    + ++++GAQP++TVK++L++  ++ + 
  S:     1 MVKLRLKQYGGKQQATYRIVAIDARSRGXGRAIQEVGSYDPIKDQTQXNMPTIVYFIERGAQPTETVKDILQKAEIFAQL 80
>gi|78065655|ref|YP_368424.1| 30S ribosomal protein S16 [Burkholderia sp. 383] >gi|107022147|ref|YP_620474.1| 30S ribosomal protein S16 [Burkholderia cenocepacia AU 1054] >gi|115350999|ref|YP_772838.1| 30S ribosomal protein S16 [Burkholderia ambifaria AMMD] >gi|116689092|ref|YP_834715.1| 30S ribosomal protein S16 [Burkholderia cenocepacia HI2424] >gi|170700970|ref|ZP_02891952.1| ribosomal protein S16 [Burkholderia ambifaria IOP40-10] >gi|170732380|ref|YP_001764327.1| ribosomal protein S16 [Burkholderia cenocepacia MC0-3] >gi|171321193|ref|ZP_02910164.1| ribosomal protein S16 [Burkholderia ambifaria MEX-5] >gi|172060004|ref|YP_001807656.1| ribosomal protein S16 [Burkholderia ambifaria MC40-6] >gi|194556954|ref|YP_002091980.1| Ribosomal protein S16 [Burkholderia cenocepacia PC184] >gi|194563890|ref|YP_002098913.1| Ribosomal protein S16 [Burkholderia dolosa AUO158] >gi|122323708|sp|Q0BH69|RS16_BURCM 30S ribosomal protein S16 >gi|123072312|sp|Q1BY04|RS16_BURCA 30S ribosomal protein S16 >gi|166234399|sp|A0K5P5|RS16_BURCH 30S ribosomal protein S16 >gi|109893868|sp|Q39ID6|RS16_BURS3 30S ribosomal protein S16 >gi|77966400|gb|ABB07780.1| SSU ribosomal protein S16P [Burkholderia sp. 383] >gi|105892336|gb|ABF75501.1| SSU ribosomal protein S16P [Burkholderia cenocepacia AU 1054] >gi|115280987|gb|ABI86504.1| SSU ribosomal protein S16P [Burkholderia ambifaria AMMD] >gi|116647181|gb|ABK07822.1| SSU ribosomal protein S16P [Burkholderia cenocepacia HI2424] >gi|124870745|gb|EAY62461.1| Ribosomal protein S16 [Burkholderia cenocepacia PC184] >gi|124895514|gb|EAY69394.1| Ribosomal protein S16 [Burkholderia dolosa AUO158] >gi|169815622|gb|ACA90205.1| ribosomal protein S16 [Burkholderia cenocepacia MC0-3] >gi|170134110|gb|EDT02456.1| ribosomal protein S16 [Burkholderia ambifaria IOP40-10] >gi|171093531|gb|EDT38699.1| ribosomal protein S16 [Burkholderia ambifaria MEX-5] >gi|171992521|gb|ACB63440.1| ribosomal protein S16 [Burkholderia ambifaria MC40-6] (84 aa)
Score = 133, Expect = 1.1e-06, Identities = 35/73 (47%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG---VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IV  DSR RRDG +IE+VG Y P       + I ++    W   GAQ S TV+ L++E
  S:     1 MVIIRLARGGSKKRPFYNIVATDSRNRRDGRFIERVGFYNPVATKGESLRIAQDRLTYWQGVGAQLSPTVQRLVKE 76
>gi|17986511|ref|NP_539145.1| 30S ribosomal protein S16 [Brucella melitensis 16M] >gi|23502677|ref|NP_698804.1| 30S ribosomal protein S16 [Brucella suis 1330] >gi|148560221|ref|YP_001259661.1| 30S ribosomal protein S16 [Brucella ovis ATCC 25840] >gi|161619744|ref|YP_001593631.1| 30S ribosomal protein S16 [Brucella canis ATCC 23365] >gi|166234398|sp|A5VSG4|RS16_BRUO2 30S ribosomal protein S16 >gi|189044368|sp|A9M862|RS16_BRUC2 30S ribosomal protein S16 >gi|54039398|sp|P66434|RS16_BRUSU 30S ribosomal protein S16 >gi|54042135|sp|P66433|RS16_BRUME 30S ribosomal protein S16 >gi|17982114|gb|AAL51409.1| SSU ribosomal protein S16P [Brucella melitensis 16M] >gi|23348688|gb|AAN30719.1| ribosomal protein S16 [Brucella suis 1330] >gi|148371478|gb|ABQ61457.1| 30S ribosomal protein S16 [Brucella ovis ATCC 25840] >gi|161336555|gb|ABX62860.1| ribosomal protein S16 [Brucella canis ATCC 23365] (134 aa)
Score = 132, Expect = 1.1e-06, Identities = 33/78 (42%), Positives = 48/78 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P++ +VV D RA RDG +IE VG++ P        V ++ E    W+ +GAQP+D V   L + G+ K+
  S:     3 LKIRLARAGSKKRPYYHVVVADVRAPRDGRFIETVGSWNPVLPKDAERVKLDAERIQHWIAQGAQPTDRVLRFLDQAGIAKR 84
>gi|91784787|ref|YP_559993.1| 30S ribosomal protein S16 [Burkholderia xenovorans LB400] >gi|187924953|ref|YP_001896595.1| ribosomal protein S16 [Burkholderia phytofirmans PsJN] >gi|123358556|sp|Q13VE8|RS16_BURXL 30S ribosomal protein S16 >gi|91688741|gb|ABE31941.1| SSU ribosomal protein S16P [Burkholderia xenovorans LB400] >gi|187716147|gb|ACD17371.1| ribosomal protein S16 [Burkholderia phytofirmans PsJN] (84 aa)
Score = 132, Expect = 1.1e-06, Identities = 35/73 (47%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG---VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IV  DSR RRDG +IE+VG Y P       + I ++    W   GAQ S TV+ L++E
  S:     1 MVIIRLARGGSKKRPFYNIVATDSRNRRDGRFIERVGFYNPVATKGESLRIAQDRLTYWQGVGAQLSPTVERLVKE 76
>gi|91762615|ref|ZP_01264580.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1002] >gi|91718417|gb|EAS85067.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1002] (134 aa)
Score = 132, Expect = 1.2e-06, Identities = 42/117 (35%), Positives = 62/117 (52%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKP 117
           M+KIRL+R G  K P +++V+ DSR  RDG +IEKVG + P      +  V +  E    WL +GAQP+  V  +L E G+          +   + +N  K   KK   K+   + PA+ P
  S:     1 MIKIRLSRGGTKKRPVYKVVIADSRRARDGRFIEKVGFFNPLLPKDKKERVGLEAERIKYWLGQGAQPTTRVARILGENGII---------AMPANGSNPSKAIPKKERKKEGDEAAPAAAP 113
>gi|89900195|ref|YP_522666.1| ribosomal protein S16 [Rhodoferax ferrireducens T118] >gi|109894792|sp|Q21YL8|RS16_RHOFD 30S ribosomal protein S16 >gi|89344932|gb|ABD69135.1| SSU ribosomal protein S16P [Rhodoferax ferrireducens T118] (83 aa)
Score = 132, Expect = 1.2e-06, Identities = 34/73 (46%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G    PFF IVV D R RRDG +IE++G Y P     E  + I ++    W   GAQ S TV+ L+ +
  S:     1 MVVIRLARGGAKARPFFNIVVADKRTRRDGRFIERLGFYNPIATANEESIRIAQDRLTYWRSVGAQASPTVERLISQ 77
>gi|90416162|ref|ZP_01224094.1| ribosomal protein S16 [marine gamma proteobacterium HTCC2207] >gi|90331887|gb|EAS47101.1| ribosomal protein S16 [marine gamma proteobacterium HTCC2207] (86 aa)
Score = 132, Expect = 1.2e-06, Identities = 34/73 (46%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ I V DSR  RD  YIE+VG + P     E  + ++ +    W  +GAQ SD VK+L++E
  S:     1 MVTIRLARGGAKKRPFYHITVSDSRNARDARYIERVGFFNPVARGAEERLRMDMDRVSYWQGQGAQVSDRVKSLIKE 77
>gi|62290687|ref|YP_222480.1| 30S ribosomal protein S16 [Brucella abortus bv. 1 str. 9-941] >gi|82700602|ref|YP_415176.1| 30S ribosomal protein S16 [Brucella melitensis biovar Abortus 2308] >gi|189024901|ref|YP_001935669.1| Antifreeze protein, type I [Brucella abortus S19] >gi|75496262|sp|Q57B65|RS16_BRUAB 30S ribosomal protein S16 >gi|109893866|sp|Q2YLK6|RS16_BRUA2 30S ribosomal protein S16 >gi|62196819|gb|AAX75119.1| RpsP, ribosomal protein S16 [Brucella abortus biovar 1 str. 9-941] >gi|82616703|emb|CAJ11788.1| Antifreeze protein, type I:Ribosomal protein S16 [Brucella melitensis biovar Abortus 2308] >gi|189020473|gb|ACD73195.1| Antifreeze protein, type I [Brucella abortus S19] (134 aa)
Score = 132, Expect = 1.3e-06, Identities = 33/78 (42%), Positives = 48/78 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P++ +VV D RA RDG +IE VG++ P        V ++ E    W+ +GAQP+D V   L + G+ K+
  S:     3 LKIRLARAGSKKRPYYHVVVADVRAPRDGRFIETVGSWNPVLPKDAERVKLDAERIQHWIAQGAQPTDRVLRFLDQAGIAKR 84
>gi|40063301|gb|AAR38119.1| ribosomal protein S16, putative [uncultured marine bacterium 578] (255 aa)
Score = 132, Expect = 1.3e-06, Identities = 36/73 (49%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRL R G  K PF+ IV  DSR RRD  YIE++G + P     E  + + E+    W+ +GAQ SD VK L++E
  S:     1 MVKIRLARGGAKKKPFYSIVATDSRKRRDSGYIERIGYFNPVARGQEVRLQLEEDRLSYWISQGAQISDRVKQLVKE 77
>gi|118602952|ref|YP_904167.1| SSU ribosomal protein S16P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166201348|sp|A1AXN9|RS16_RUTMC 30S ribosomal protein S16 >gi|118567891|gb|ABL02696.1| SSU ribosomal protein S16P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (91 aa)
Score = 132, Expect = 1.3e-06, Identities = 38/73 (52%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRD-GAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MVKIRL R G  K PF+ IV  DSR RRD G YIE++G + P     E  + I ++    W  KGAQ SD VK L++E
  S:     1 MVKIRLARGGAKKKPFYLIVATDSRKRRDSGYYIERLGYFNPVAHGQEVRLTIEKDRFAYWTSKGAQISDRVKQLVKE 78
>gi|152978201|ref|YP_001343830.1| 30S ribosomal protein S16 [Actinobacillus succinogenes 130Z] >gi|171704184|sp|A6VLP8|RS16_ACTSZ 30S ribosomal protein S16 >gi|150839924|gb|ABR73895.1| ribosomal protein S16 [Actinobacillus succinogenes 130Z] (82 aa)
Score = 132, Expect = 1.3e-06, Identities = 33/73 (45%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF++IVV DSR+ RDG +IE+VG + P        + ++ +   +W++KGA  SD V  L++E
  S:     1 MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPLATGKAERLRLDLDRVNAWVEKGASLSDRVSALVKE 77
>gi|109947828|ref|YP_665056.1| 30S ribosomal protein S16 [Helicobacter acinonychis str. Sheeba] >gi|123066155|sp|Q17WB9|RS16_HELAH 30S ribosomal protein S16 >gi|109715049|emb|CAK00057.1| 30S ribosomal protein S16 [Helicobacter acinonychis str. Sheeba] (76 aa)
Score = 132, Expect = 1.3e-06, Identities = 34/70 (48%), Positives = 45/70 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+R+VV DSR RRDG +IE +G Y P      + I++E    W   GA+ S+ V+ L
  S:     1 MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSEPKDIKIDKERLDYWKGVGAKMSERVEKL 72
>gi|121997331|ref|YP_001002118.1| ribosomal protein S16 [Halorhodospira halophila SL1] >gi|166234426|sp|A1WUF4|RS16_HALHL 30S ribosomal protein S16 >gi|121588736|gb|ABM61316.1| SSU ribosomal protein S16P [Halorhodospira halophila SL1] (86 aa)
Score = 132, Expect = 1.3e-06, Identities = 31/73 (42%), Positives = 49/73 (67%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV +++  RDGA+IE++G + P     E  + ++ E + +W+ KGAQP++    L+R+
  S:     1 MVTIRLARAGAKKRPFYHIVVTEAKKPRDGAFIERLGYFNPVASGQEAPLKLDVERSKAWIAKGAQPTERAAQLIRQ 77
>gi|91206193|ref|YP_538548.1| 30S ribosomal protein S16 [Rickettsia bellii RML369-C] >gi|157827802|ref|YP_001496866.1| 30S ribosomal protein S16 [Rickettsia bellii OSU 85-389] >gi|166201344|sp|A8GY79|RS16_RICB8 30S ribosomal protein S16 >gi|109894797|sp|Q1RGQ5|RS16_RICBR 30S ribosomal protein S16 >gi|91069737|gb|ABE05459.1| 30S ribosomal protein S16 [Rickettsia bellii RML369-C] >gi|157803106|gb|ABV79829.1| 30S ribosomal protein S16 [Rickettsia bellii OSU 85-389] (111 aa)
Score = 132, Expect = 1.3e-06, Identities = 44/98 (44%), Positives = 63/98 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGVW-----KKFMDSKVQSKKEHNANKVKKE 99
           VKIRL R G  K PF+R+VV ++ A RDG ++EKVGTY P     + NE + L       WLK GA+P+D V   + + G+      KK M+ K++++K   + K  KE
  S:     3 VKIRLARGGAKKRPFYRVVVANATAPRDGDFLEKVGTYNPMLA-KDSNERVVLKADRVEYWLKSGAKPTDRVARFIEQAGIALPEKVKKEMEVKLKNRKAKPSKKEAKE 110
>gi|161610388|ref|NP_885066.2| 30S ribosomal protein S16 [Bordetella parapertussis 12822] >gi|50403614|sp|Q7W6N6|RS16_BORPA 30S ribosomal protein S16 (86 aa)
Score = 132, Expect = 1.4e-06, Identities = 33/73 (45%), Positives = 42/73 (57%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           M+ IRL R G  K PF+ +V  DSR RRDG ++E+VG Y P       N  IAL     W   GA  S  V+ L++E
  S:     1 MLVIRLARGGSKKRPFYNLVATDSRNRRDGRFVERVGFYNPVAAEGTENLRIALGRVQYWTGNGALLSPAVERLVKE 77
>gi|58584788|ref|YP_198361.1| 30S ribosomal protein S16 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75497779|sp|Q5GSA5|RS16_WOLTR 30S ribosomal protein S16 >gi|58419104|gb|AAW71119.1| Ribosomal protein S16 [Wolbachia endosymbiont strain TRS of Brugia malayi] (106 aa)
Score = 131, Expect = 1.4e-06, Identities = 41/99 (41%), Positives = 58/99 (58%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS-----WLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEV 100
           VKIRL R G  K PF+RIVV DSRA RDG +IE++G Y+P     N N  +  +     WL  GAQ S+ V   +++  +  +    KV++KK       ++EV
  S:     3 VKIRLARFGAKKRPFYRIVVADSRAPRDGRFIERIGQYDPMLSKDNKNCVVVKADRLKYWLNVGAQASERVLWFIKKGIITLEAEKKKVETKKAEIKKVKEQEV 106
>gi|71908679|ref|YP_286266.1| SSU ribosomal protein S16P [Dechloromonas aromatica RCB] >gi|109893876|sp|Q47BI5|RS16_DECAR 30S ribosomal protein S16 >gi|71848300|gb|AAZ47796.1| SSU ribosomal protein S16P [Dechloromonas aromatica RCB] (84 aa)
Score = 131, Expect = 1.4e-06, Identities = 31/75 (41%), Positives = 44/75 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           MV IRL R G  K PF+ +VV DSR RRDG ++E++G Y P        + ++ +    W   GAQ S TV  L+++  
  S:     1 MVVIRLARGGAKKRPFYNMVVTDSRNRRDGRFVERIGFYNPVASGNAEALRVSVDRLAYWQSNGAQLSPTVARLVKQHA 79
>gi|15645765|ref|NP_207942.1| 30S ribosomal protein S16 [Helicobacter pylori 26695] >gi|188527935|ref|YP_001910622.1| 30S ribosomal protein S16 [Helicobacter pylori Shi470] >gi|2500466|sp|P56023|RS16_HELPY 30S ribosomal protein S16 >gi|2314310|gb|AAD08199.1| ribosomal protein S16 (rpS16) [Helicobacter pylori 26695] >gi|188144175|gb|ACD48592.1| 30S ribosomal protein S16 [Helicobacter pylori Shi470] (76 aa)
Score = 131, Expect = 1.5e-06, Identities = 34/70 (48%), Positives = 45/70 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+R+VV DSR RRDG +IE +G Y P      + I++E    W   GA+ S+ V+ L
  S:     1 MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSEPKDIKIDKERLNYWKGVGAKMSERVEKL 72
>gi|87301100|ref|ZP_01083941.1| 30S ribosomal protein S16 [Synechococcus sp. WH 5701] >gi|87284068|gb|EAQ76021.1| 30S ribosomal protein S16 [Synechococcus sp. WH 5701] (134 aa)
Score = 131, Expect = 1.5e-06, Identities = 31/79 (39%), Positives = 50/79 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  +E++G Y P      ++ E     L +GAQP+DTV++LL + G+ +K
  S:     1 MIKLRLKRFGKKREASFRLVATNSTSRRDGLPLEELGFYNPRTKETRLDAEAIRVRLSQGAQPTDTVRSLLEKGGLIEK 79
>gi|33592897|ref|NP_880541.1| 30S ribosomal protein S16 [Bordetella pertussis Tohama I] >gi|161609269|ref|NP_889724.2| 30S ribosomal protein S16 [Bordetella bronchiseptica RB50] >gi|50403613|sp|Q7VXD8|RS16_BORPE 30S ribosomal protein S16 >gi|50403615|sp|Q7WHL9|RS16_BORBR 30S ribosomal protein S16 >gi|33572545|emb|CAE42125.1| 30S ribosomal protein S16 [Bordetella pertussis Tohama I] (86 aa)
Score = 131, Expect = 1.5e-06, Identities = 33/73 (45%), Positives = 42/73 (57%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           M+ IRL R G  K PF+ +V  DSR RRDG ++E+VG Y P       N  IAL     W   GA  S  V+ L++E
  S:     1 MLVIRLARGGSKKRPFYNLVATDSRNRRDGRFVERVGFYNPVAAEGTENLRIALDRVQYWTGNGALLSPAVERLVKE 77
>gi|53720101|ref|YP_109087.1| 30S ribosomal protein S16 [Burkholderia pseudomallei K96243] >gi|53724764|ref|YP_102218.1| 30S ribosomal protein S16 [Burkholderia mallei ATCC 23344] >gi|67642889|ref|ZP_00441640.1| COG0228: Ribosomal protein S16 [Burkholderia mallei GB8 horse 4] >gi|76810900|ref|YP_334347.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1710b] >gi|83718427|ref|YP_442198.1| 30S ribosomal protein S16 [Burkholderia thailandensis E264] >gi|121600068|ref|YP_993847.1| 30S ribosomal protein S16 [Burkholderia mallei SAVP1] >gi|124384860|ref|YP_001026909.1| 30S ribosomal protein S16 [Burkholderia mallei NCTC 10229] >gi|126440964|ref|YP_001059878.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 668] >gi|126449160|ref|YP_001079803.1| 30S ribosomal protein S16 [Burkholderia mallei NCTC 10247] >gi|126451631|ref|YP_001067164.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1106a] >gi|134277458|ref|ZP_01764173.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 305] >gi|161356600|ref|ZP_02102477.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1106b] >gi|161374086|ref|ZP_02113636.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1710a] >gi|166999761|ref|ZP_02265595.1| 30S ribosomal protein S16 [Burkholderia mallei PRL-20] >gi|167563603|ref|ZP_02356519.1| 30S ribosomal protein S16 [Burkholderia oklahomensis EO147] >gi|167570767|ref|ZP_02363641.1| 30S ribosomal protein S16 [Burkholderia oklahomensis C6786] >gi|167581077|ref|ZP_02373951.1| 30S ribosomal protein S16 [Burkholderia thailandensis TXDOH] >gi|167619157|ref|ZP_02387788.1| 30S ribosomal protein S16 [Burkholderia thailandensis Bt4] >gi|167720641|ref|ZP_02403877.1| 30S ribosomal protein S16 [Burkholderia pseudomallei DM98] >gi|167739628|ref|ZP_02412402.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 14] >gi|167816832|ref|ZP_02448512.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 91] >gi|167825234|ref|ZP_02456705.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 9] >gi|167837425|ref|ZP_02464308.1| 30S ribosomal protein S16 [Burkholderia thailandensis MSMB43] >gi|167846738|ref|ZP_02472246.1| 30S ribosomal protein S16 [Burkholderia pseudomallei B7210] >gi|167895324|ref|ZP_02482726.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 7894] >gi|167903710|ref|ZP_02490915.1| 30S ribosomal protein S16 [Burkholderia pseudomallei NCTC 13177] >gi|167911959|ref|ZP_02499050.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 112] >gi|167919951|ref|ZP_02507042.1| 30S ribosomal protein S16 [Burkholderia pseudomallei BCC215] >gi|194314904|ref|YP_002010731.1| 30S ribosomal protein S16 [Burkholderia mallei ATCC 10399] >gi|194505764|ref|YP_002035335.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1655] >gi|194513771|ref|YP_002026262.1| 30S ribosomal protein S16 [Burkholderia pseudomallei Pasteur 52237] >gi|194517059|ref|YP_002052735.1| 30S ribosomal protein S16 [Burkholderia pseudomallei S13] >gi|194521405|ref|YP_002056941.1| 30S ribosomal protein S16 [Burkholderia mallei FMH] >gi|194526749|ref|YP_002062274.1| 30S ribosomal protein S16 [Burkholderia mallei JHU] >gi|194572911|ref|YP_002107906.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 406e] >gi|194573382|ref|YP_002108269.1| 30S ribosomal protein S16 [Burkholderia mallei 2002721280] >gi|166234400|sp|A3MHR7|RS16_BURM7 30S ribosomal protein S16 >gi|166234401|sp|A2S4P0|RS16_BURM9 30S ribosomal protein S16 >gi|166234402|sp|A1V6J4|RS16_BURMS 30S ribosomal protein S16 >gi|166234403|sp|A3NXU3|RS16_BURP0 30S ribosomal protein S16 >gi|166234404|sp|A3NC07|RS16_BURP6 30S ribosomal protein S16 >gi|81605522|sp|Q62M50|RS16_BURMA 30S ribosomal protein S16 >gi|81607785|sp|Q63S30|RS16_BURPS 30S ribosomal protein S16 >gi|109893867|sp|Q3JQ06|RS16_BURP1 30S ribosomal protein S16 >gi|109893869|sp|Q2SY01|RS16_BURTA 30S ribosomal protein S16 >gi|52210515|emb|CAH36498.1| 30S ribosomal protein S16 [Burkholderia pseudomallei K96243] >gi|52428187|gb|AAU48780.1| ribosomal protein S16 [Burkholderia mallei ATCC 23344] >gi|76580353|gb|ABA49828.1| ribosomal protein S16 [Burkholderia pseudomallei 1710b] >gi|83652252|gb|ABC36315.1| ribosomal protein S16 [Burkholderia thailandensis E264] >gi|121228878|gb|ABM51396.1| 30S ribosomal protein S16 [Burkholderia mallei SAVP1] >gi|124292880|gb|ABN02149.1| 30S ribosomal protein S16 [Burkholderia mallei NCTC 10229] >gi|126220457|gb|ABN83963.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 668] >gi|126225273|gb|ABN88813.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1106a] >gi|126242030|gb|ABO05123.1| 30S ribosomal protein S16 [Burkholderia mallei NCTC 10247] >gi|134251108|gb|EBA51187.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 305] >gi|147745415|gb|EDK52495.1| 30S ribosomal protein S16 [Burkholderia mallei FMH] >gi|147750759|gb|EDK57828.1| 30S ribosomal protein S16 [Burkholderia mallei JHU] >gi|148029301|gb|EDK87206.1| 30S ribosomal protein S16 [Burkholderia mallei 2002721280] >gi|157805482|gb|EDO82652.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 406e] >gi|157987723|gb|EDO95488.1| 30S ribosomal protein S16 [Burkholderia pseudomallei Pasteur 52237] >gi|160697906|gb|EDP87876.1| 30S ribosomal protein S16 [Burkholderia mallei ATCC 10399] >gi|169652319|gb|EDS85012.1| 30S ribosomal protein S16 [Burkholderia pseudomallei S13] >gi|184211651|gb|EDU08694.1| 30S ribosomal protein S16 [Burkholderia pseudomallei 1655] (84 aa)
Score = 131, Expect = 1.7e-06, Identities = 34/73 (46%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG---VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IV  DSR RRDG +IE+VG Y P       + I ++    W   GAQ S TV+ L+++
  S:     1 MVIIRLARGGSKKRPFYNIVATDSRNRRDGRFIERVGFYNPVATKGEALRIAQDRLTYWQGVGAQLSPTVERLVKQ 76
>gi|91794105|ref|YP_563756.1| 30S ribosomal protein S16 [Shewanella denitrificans OS217] >gi|122968556|sp|Q12KJ3|RS16_SHEDO 30S ribosomal protein S16 >gi|91716107|gb|ABE56033.1| ribosomal protein S16 [Shewanella denitrificans OS217] (83 aa)
Score = 131, Expect = 1.7e-06, Identities = 32/73 (43%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++ +    W+  GA  SD V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPLARGQEETLRLDLDRVEHWVATGAATSDRVAKLIKD 77
>gi|71082961|ref|YP_265680.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1062] >gi|109894781|sp|Q4FP12|RS16_PELUB 30S ribosomal protein S16 >gi|71062074|gb|AAZ21077.1| 30S ribosomal protein S16 [Candidatus Pelagibacter ubique HTCC1062] (177 aa)
Score = 131, Expect = 1.7e-06, Identities = 34/76 (44%), Positives = 48/76 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+KIRL+R G  K P +++V+ DSR  RDG +IEKVG + P      +  V +  E    WL +GAQP+  V  +L E G+
  S:     1 MIKIRLSRGGTKKRPVYKVVIADSRRARDGRFIEKVGFFNPLLPKDKKERVGLEAERIKYWLGQGAQPTTRVARILGENGI 81
>gi|108563515|ref|YP_627831.1| 30S ribosomal protein S16 [Helicobacter pylori HPAG1] >gi|122980466|sp|Q1CSB5|RS16_HELPH 30S ribosomal protein S16 >gi|107837288|gb|ABF85157.1| ribosomal protein S16 [Helicobacter pylori HPAG1] (76 aa)
Score = 131, Expect = 1.8e-06, Identities = 34/70 (48%), Positives = 45/70 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV--VNINEEIALSWLKKGAQPSDTVKNL 70
           M  IRLTR+GR K PF+R+VV DSR RRDG +IE +G Y P      + I++E    W   GA+ S+ V+ L
  S:     1 MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSEPKDIKIDKERLNYWKSVGAKMSERVEKL 72
>gi|836625|emb|CAA77799.1| ribosomal protein S16 [Solanum tuberosum] (74 aa)
Score = 131, Expect = 1.8e-06, Identities = 27/64 (42%), Positives = 46/64 (71%)
  Q:    17 FRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           +RIV ID R+RR+G  ++KVG Y+P +    +N    L +L+KGAQP++TV+++L++  V+K+ 
  S:     3 YRIVAIDVRSRREGKDLQKVGFYDPIKNQTYLNVPAILYFLEKGAQPTETVQDILKKAEVFKEL 66
>gi|48474482|sp|Q8KTS4|RS16_TREPR 30S ribosomal protein S16 (93 aa)
Score = 130, Expect = 1.8e-06, Identities = 27/75 (36%), Positives = 42/75 (56%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           M+ IRL R G    P +++VV DSR +R+G ++ +VG Y P     +I+  +   W ++GA P+ TV  LL    
  S:     1 MLAIRLRRCGARGRPAYQVVVADSRRKRNGVFLCRVGYYNPRLKSAHIDTVMLRLWTERGAAPTRTVARLLHRHA 75
>gi|118052315|ref|ZP_01520862.1| ribosomal protein S16 [Comamonas testosteroni KF-1] >gi|118000443|gb|EAV14600.1| ribosomal protein S16 [Comamonas testosteroni KF-1] (84 aa)
Score = 130, Expect = 1.9e-06, Identities = 34/73 (46%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           MV IRL+R G    PF+ IV  D R RRDGA+IE++G Y P          +AL     W   GAQ SDT + L++E
  S:     1 MVVIRLSRGGSKARPFYNIVAADKRVRRDGAFIERLGFYNPSARGAEEGLRLALDRVNYWKSVGAQTSDTAERLIKE 77
>gi|116072342|ref|ZP_01469609.1| 30S ribosomal protein S16 [Synechococcus sp. BL107] >gi|116064864|gb|EAU70623.1| 30S ribosomal protein S16 [Synechococcus sp. BL107] (152 aa)
Score = 130, Expect = 1.9e-06, Identities = 29/79 (36%), Positives = 47/79 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL   G+ +K
  S:    23 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEAIRERLGQGAQPTDIVRTLLERGGLIEK 101
>gi|114330465|ref|YP_746687.1| 30S ribosomal protein S16 [Nitrosomonas eutropha C91] >gi|122314521|sp|Q0AIU9|RS16_NITEC 30S ribosomal protein S16 >gi|114307479|gb|ABI58722.1| SSU ribosomal protein S16P [Nitrosomonas eutropha C91] (85 aa)
Score = 130, Expect = 1.9e-06, Identities = 35/79 (44%), Positives = 47/79 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           MV +RL R G  K PF+ +VV DSR  RDG +IE+VG Y P     E  + I  +    W  +GAQ S TV  L+++ G  +K
  S:     1 MVVVRLARGGAKKRPFYNMVVADSRRHRDGKFIERVGFYNPRATGGEESLRIQMDRLNHWQSQGAQLSSTVSRLVKQFGRQQK 83
>gi|22297584|ref|NP_680831.1| 30S ribosomal protein S16 [Thermosynechococcus elongatus BP-1] >gi|31076956|sp|Q8DMS1|RS16_SYNEL 30S ribosomal protein S16 >gi|22293761|dbj|BAC07593.1| 30S ribosomal protein S16 [Thermosynechococcus elongatus BP-1] (83 aa)
Score = 130, Expect = 1.9e-06, Identities = 29/71 (40%), Positives = 45/71 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           M+K+RL R G+ +   +RIV +++  RRDG  +E++G Y+P    V + EE     L +GAQP+DTV+ L 
  S:     1 MIKLRLKRYGKKRNATYRIVAMNNTDRRDGRALEELGFYDPIHNEVRLKEEAIKRRLAQGAQPTDTVRRLF 71
>gi|13473696|ref|NP_105264.1| 30S ribosomal protein S16 [Mesorhizobium loti MAFF303099] >gi|20140183|sp|Q98E70|RS16_RHILO 30S ribosomal protein S16 >gi|14024447|dbj|BAB51050.1| ribosomal protein S16 [Mesorhizobium loti MAFF303099] (133 aa)
Score = 130, Expect = 2.0e-06, Identities = 36/97 (37%), Positives = 56/97 (57%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKK 98
           +KIRL R G  K P++ +VV D+R+ RDG +IE +G++ P        V ++ +    WL  GAQP+D V   L E G+ K+  D++   KK     K ++
  S:     3 LKIRLARAGSKKRPYYHVVVADARSPRDGRFIESLGSWNPLLPKDGERVKVDADRVKHWLSHGAQPTDRVLRFLDEAGLAKR--DARSNPKKAEPGKKAQE 101
>gi|92115131|ref|YP_575059.1| SSU ribosomal protein S16P [Chromohalobacter salexigens DSM 3043] >gi|122990394|sp|Q1QT48|RS16_CHRSD 30S ribosomal protein S16 >gi|91798221|gb|ABE60360.1| SSU ribosomal protein S16P [Chromohalobacter salexigens DSM 3043] (83 aa)
Score = 130, Expect = 2.1e-06, Identities = 34/73 (46%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V DSR  RDG +IE++G + P     E  + ++ E A  W + GAQ SD V  LL+E
  S:     1 MVTIRLARGGAKKRPFYHLTVSDSRKSRDGRFIERIGFFNPVARGQEERLRVDLERAAHWQELGAQVSDRVAELLKE 77
>gi|116254276|ref|YP_770114.1| 30S ribosomal protein S16 [Rhizobium leguminosarum bv. viciae 3841] >gi|122988331|sp|Q1MAK5|RS16_RHIL3 30S ribosomal protein S16 >gi|115258924|emb|CAK10033.1| putative 30S ribosomal protein S16 [Rhizobium leguminosarum bv. viciae 3841] (123 aa)
Score = 130, Expect = 2.1e-06, Identities = 40/108 (37%), Positives = 61/108 (56%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAA 109
           +KIRL R G  K P++ +V+ D+R+ RDG ++E +G++ P      E  V +N E    W++ GAQP+D V   L E GV          +K+E   N VK +  K   ++AA
  S:     3 LKIRLARGGSKKRPYYHVVLADARSPRDGRFLENLGSWNPMLAKDDEKRVQLNAERIKHWIEHGAQPTDRVLRFLDEAGV----------AKREVKNNPVKAKPGKRAQERAA 105
>gi|119774026|ref|YP_926766.1| 30S ribosomal protein S16 [Shewanella amazonensis SB2B] >gi|166201630|sp|A1S3Z0|RS16_SHEAM 30S ribosomal protein S16 >gi|119766526|gb|ABL99096.1| ribosomal protein S16 [Shewanella amazonensis SB2B] (83 aa)
Score = 130, Expect = 2.1e-06, Identities = 31/73 (42%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++ +    W+  GA  +D V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVTDSRNARDGRFIERVGFFNPLAKGQEETLRLDLDRVDHWVGNGASTTDRVAKLIKD 77
>gi|15889953|ref|NP_355634.1| 30S ribosomal protein S16 [Agrobacterium tumefaciens str. C58] >gi|22096127|sp|Q8UBZ9|RS16_AGRT5 30S ribosomal protein S16 >gi|15157913|gb|AAK88419.1| 30S ribosomal protein S16 [Agrobacterium tumefaciens str. C58] (126 aa)
Score = 130, Expect = 2.2e-06, Identities = 33/78 (42%), Positives = 51/78 (65%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P+++IVV D+R+ RDG ++EKVG++ P         V +  ++   W+ KGAQP+D V   L E G+ ++
  S:     3 LKIRLARGGSKKRPYYQIVVADARSPRDGRFLEKVGSWNPMLAKDNPLRVELKADLIKEWIAKGAQPTDRVLRFLAEAGLAER 85
>gi|56460827|ref|YP_156108.1| ribosomal protein S16 [Idiomarina loihiensis L2TR] >gi|81599941|sp|Q5QUU8|RS16_IDILO 30S ribosomal protein S16 >gi|56179837|gb|AAV82559.1| Ribosomal protein S16 [Idiomarina loihiensis L2TR] (82 aa)
Score = 130, Expect = 2.4e-06, Identities = 34/73 (46%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IEKVG + P     E  + ++ +    W+ KGAQ SD V  L+++
  S:     1 MVTIRLQRGGAKKRPFYQMVVADSRNARDGRFIEKVGFFNPVARGQEEKLRVDVDRIEHWVSKGAQLSDRVAKLVKD 77
>gi|90421746|ref|YP_530116.1| 30S ribosomal protein S16 [Rhodopseudomonas palustris BisB18] >gi|109894794|sp|Q21CT9|RS16_RHOPB 30S ribosomal protein S16 >gi|90103760|gb|ABD85797.1| SSU ribosomal protein S16P [Rhodopseudomonas palustris BisB18] (110 aa)
Score = 130, Expect = 2.4e-06, Identities = 34/78 (43%), Positives = 47/78 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL R G  K P + +VV DSR  RDG +IE++G + P      E  + ++ +   +W+ KGAQPSD V   L   GV K+
  S:     3 VVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGHFNPLLPKDSEARLKLDLDKVKAWVAKGAQPSDRVARFLDAAGVKKR 85
>gi|51598949|ref|YP_073137.1| 30S ribosomal protein S16 [Borrelia garinii PBi] >gi|81609808|sp|Q660H6|RS16_BORGA 30S ribosomal protein S16 >gi|51573520|gb|AAU07545.1| ribosomal protein S16 [Borrelia garinii PBi] (86 aa)
Score = 129, Expect = 2.5e-06, Identities = 36/78 (46%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V+IRL R+G  K P++RIVV++S + RDG  IE++G Y P E    + I E+    W+ KGA  SDTVK LL +  +  K
  S:     3 VRIRLKRMGAKKRPYYRIVVMNSASPRDGRAIEELGYYHPVEKQKQIKIKEDRMKDWISKGAILSDTVKMLLNKNNLNAK 82
>gi|77976454|ref|ZP_00831942.1| COG0228: Ribosomal protein S16 [Yersinia intermedia ATCC 29909] (111 aa)
Score = 129, Expect = 2.5e-06, Identities = 30/73 (41%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        + ++ +    W+  GA  SD V  L+++
  S:    30 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIAAGQAEALRLDLDRIEHWVGLGATVSDRVSALIKD 106
>gi|148251975|ref|YP_001236560.1| 30S ribosomal protein S16 [Bradyrhizobium sp. BTAi1] >gi|166234396|sp|A5E910|RS16_BRASB 30S ribosomal protein S16 >gi|146404148|gb|ABQ32654.1| SSU ribosomal protein S16P [Bradyrhizobium sp. BTAi1] (110 aa)
Score = 129, Expect = 2.5e-06, Identities = 41/108 (37%), Positives = 59/108 (54%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAA 109
           V IRL R G  K P + +VV DSR  RDG +IE++G + P      E  + ++ E    WL KGAQPSD V   L   GV K+         +++    V ++ +K +A+ AA
  S:     3 VVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLMPKDNEARLKLDMEKVKGWLAKGAQPSDRVARFLDAAGVKKR-------EARQNPIKAVPRKERKAQAEAAA 108
>gi|50122281|ref|YP_051448.1| 30S ribosomal protein S16 [Pectobacterium atrosepticum SCRI1043] >gi|81644243|sp|Q6D1T8|RS16_ERWCT 30S ribosomal protein S16 >gi|49612807|emb|CAG76257.1| 30S ribosomal protein S16 [Erwinia carotovora subsp. atroseptica SCRI1043] (82 aa)
Score = 129, Expect = 2.7e-06, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        + ++ +    WL  GA  SD V +L+++
  S:     1 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIATGQAEALRLDLDRIEHWLGLGATVSDRVSSLIKD 77
>gi|90020850|ref|YP_526677.1| SSU ribosomal protein S16P [Saccharophagus degradans 2-40] >gi|109894798|sp|Q21LG4|RS16_SACD2 30S ribosomal protein S16 >gi|89950450|gb|ABD80465.1| SSU ribosomal protein S16P [Saccharophagus degradans 2-40] (82 aa)
Score = 129, Expect = 2.7e-06, Identities = 32/73 (43%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF+ + V DSR  RDG +IE+VG + P     E  + +  E    WL +GAQ S+ V  L+++
  S:     1 MVSIRLSRGGSKKRPFYHLTVTDSRKSRDGRFIERVGFFNPVARGQEERLRVESERLNYWLSQGAQCSERVAKLIKD 77
>gi|6325244|ref|NP_015312.1| Mitochondrial ribosomal protein of the small subunit; Mrps16p [Saccharomyces cerevisiae] >gi|6094203|sp|Q02608|RT16_YEAST Mitochondrial 37S ribosomal protein S16 >gi|965080|gb|AAB68092.1| Lpa4p >gi|151942779|gb|EDN61125.1| mitochondrial ribosomal protein [Saccharomyces cerevisiae YJM789] >gi|190407932|gb|EDV11197.1| mitochondrial ribosomal protein S16 [Saccharomyces cerevisiae RM11-1a] (121 aa)
Score = 129, Expect = 2.9e-06, Identities = 41/88 (46%), Positives = 53/88 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----------EGVVNINE-----EIALSWLKKGAQPSDTVKNLLREQGV----WKKFMDSKVQSK 88
           +V+IRL R GR   P + IVV +SR  RD   IE +GTY P            GVV I +     +    W+  GAQPS+TV  LLR+ G+    W    +S V  K
  S:     5 LVRIRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRTKYWIGVGAQPSETVTKLLRKAGILNDAWATSKNSNVNRK 111
>gi|57238863|ref|YP_179999.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] >gi|58578792|ref|YP_197004.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] >gi|81557354|sp|Q5HC44|RS16_EHRRW 30S ribosomal protein S16 >gi|57160942|emb|CAH57848.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] >gi|58417418|emb|CAI26622.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Welgevonden] (87 aa)
Score = 129, Expect = 3.0e-06, Identities = 30/72 (41%), Positives = 43/72 (59%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           VKIRL R G  K PF+R+VV DSR  RDG +IE +G Y P         + +  +    WL  GAQP++ +   +++
  S:     3 VKIRLARFGAKKRPFYRVVVADSRVARDGRFIELLGFYNPMLPKEHPSFLKVKVDRLKYWLSVGAQPTERISWFIKK 79
>gi|77972182|ref|ZP_00827756.1| COG0228: Ribosomal protein S16 [Yersinia frederiksenii ATCC 33641] (111 aa)
Score = 129, Expect = 3.0e-06, Identities = 30/73 (41%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        + ++ +    W+  GA  SD V  L+++
  S:    30 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIASGQAEALRLDLDRIEHWVGLGATVSDRVSALIKD 106
>gi|90407075|ref|ZP_01215264.1| 30S ribosomal protein S16 [Psychromonas sp. CNPT3] >gi|90311797|gb|EAS39893.1| 30S ribosomal protein S16 [Psychromonas sp. CNPT3] (81 aa)
Score = 129, Expect = 3.1e-06, Identities = 33/75 (44%), Positives = 45/75 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           MV IRL R G  K PF+++VV DSR  RDG +IEKVG + P        + ++ +    WL  GAQ SD V  L+++  
  S:     1 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIEKVGFFNPTAQGKAEKLRLDTDRINHWLGLGAQLSDRVSKLVKDNA 79
>gi|58616851|ref|YP_196050.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Gardel] >gi|75432652|sp|Q5FFA8|RS16_EHRRG 30S ribosomal protein S16 >gi|58416463|emb|CAI27576.1| 30S ribosomal protein S16 [Ehrlichia ruminantium str. Gardel] (87 aa)
Score = 128, Expect = 3.1e-06, Identities = 30/72 (41%), Positives = 43/72 (59%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           VKIRL R G  K PF+R+VV DSR  RDG +IE +G Y P         + +  +    WL  GAQP++ +   +++
  S:     3 VKIRLARFGAKKRPFYRVVVADSRVARDGRFIELLGFYNPMLPKEHPSFLKVKIDRLKYWLSVGAQPTERISWFIKK 79
>gi|67459777|ref|YP_247401.1| 30S ribosomal protein S16 [Rickettsia felis URRWXCal2] >gi|75535833|sp|Q4UJQ3|RS16_RICFE 30S ribosomal protein S16 >gi|67005310|gb|AAY62236.1| 30S ribosomal protein S16 [Rickettsia felis URRWXCal2] (111 aa)
Score = 128, Expect = 3.5e-06, Identities = 45/107 (42%), Positives = 62/107 (57%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKA 108
           VKIRL R G  K PF+R+VV ++ A RDG ++EKVGTY P     N +E + L       WL  GA+P++ V   + + GV    +  KV+ + E  A   K    K EAK+A
  S:     3 VKIRLARGGAKKRPFYRVVVANATAPRDGDFLEKVGTYNPMLASDN-SERVVLKKDRIEYWLGTGAKPTERVAKFIEQAGV---TLPEKVKKEMEVKAKNRKVRPSKKEAKEA 111
>gi|110806723|ref|YP_690243.1| 30S ribosomal protein S16 [Shigella flexneri 5 str. 8401] >gi|117624831|ref|YP_853744.1| 30S ribosomal protein S16 [Escherichia coli APEC O1] >gi|26109378|gb|AAN81580.1|AE016764_262 30S ribosomal protein S16 [Escherichia coli CFT073] >gi|91073517|gb|ABE08398.1| 30S ribosomal protein S16 [Escherichia coli UTI89] >gi|110616271|gb|ABF04938.1| 30S ribosomal subunit protein S16 [Shigella flexneri 5 str. 8401] >gi|115513955|gb|ABJ02030.1| 30S ribosomal subunit protein S16 [Escherichia coli APEC O1] (102 aa)
Score = 128, Expect = 3.5e-06, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  R+G +IE+VG + P     E    ++ +    W+ +GA  SD V  L++E
  S:    21 MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKE 97
>gi|66044530|ref|YP_234371.1| 30S ribosomal protein S16 [Pseudomonas syringae pv. syringae B728a] >gi|71735073|ref|YP_273612.1| 30S ribosomal protein S16 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|75503053|sp|Q4ZWY9|RS16_PSEU2 30S ribosomal protein S16 >gi|109894784|sp|Q48LW0|RS16_PSE14 30S ribosomal protein S16 >gi|63255237|gb|AAY36333.1| Ribosomal protein S16 [Pseudomonas syringae pv. syringae B728a] >gi|71555626|gb|AAZ34837.1| ribosomal protein S16 [Pseudomonas syringae pv. phaseolicola 1448A] (85 aa)
Score = 128, Expect = 3.5e-06, Identities = 33/74 (44%), Positives = 45/74 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           M+ IRL   G  K PF+ + V DSR  RDG++ E+VG + P     E  +++NEE    WL  GAQ S+ V  LL+E 
  S:     1 MLTIRLALGGSKKRPFYHLTVTDSRNARDGSHKEQVGFFNPVARGQEIRLSVNEERVNYWLSVGAQTSERVAQLLKEH 78
>gi|121610857|ref|YP_998664.1| ribosomal protein S16 [Verminephrobacter eiseniae EF01-2] >gi|166228763|sp|A1WPT9|RS16_VEREI 30S ribosomal protein S16 >gi|121555497|gb|ABM59646.1| SSU ribosomal protein S16P [Verminephrobacter eiseniae EF01-2] (83 aa)
Score = 128, Expect = 3.7e-06, Identities = 34/73 (46%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G    PFF IVV D R RRDG +IE++G Y P     E  + I ++    W   GAQ S TV+ L+++
  S:     1 MVVIRLSRGGAKGRPFFNIVVADKRVRRDGRFIERLGFYNPTAKENEEGLRIMQDRLTYWKSVGAQSSPTVERLVKQ 77
>gi|94501752|ref|ZP_01308266.1| ribosomal protein S16 [Oceanobacter sp. RED65] >gi|94426152|gb|EAT11146.1| ribosomal protein S16 [Oceanobacter sp. RED65] (85 aa)
Score = 128, Expect = 3.9e-06, Identities = 34/73 (46%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ + V D R  RDG +IE+VG + P     E  + ++ E    WL KGAQ SD V  L++E
  S:     1 MVVIRLARGGSKKRPFYHLSVADQRFPRDGRFIERVGFFNPIARGQEERLRVDLERVEYWLSKGAQASDRVTKLVKE 77
>gi|50552670|ref|XP_503745.1| hypothetical protein [Yarrowia lipolytica] >gi|49649614|emb|CAG79336.1| unnamed protein product [Yarrowia lipolytica CLIB122] (106 aa)
Score = 128, Expect = 3.9e-06, Identities = 35/75 (46%), Positives = 45/75 (60%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----------EGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           ++IRL R GR   P + IVV  +  RRDG  IE +GTY P            GV     V ++ + A  W+  GAQPSDT   +L   GV
  S:     5 IRIRLARFGRRHSPLYNIVVAKAGQRRDGLPIEVIGTYNPIPAPRSHEELKRGVLPVKDVELDFDRAKYWIGTGAQPSDTATRILMLAGV 94
>gi|21702577|gb|AAM75974.1|AF481102_10 ribosomal protein S16 [Candidatus Tremblaya princeps] (148 aa)
Score = 128, Expect = 4.0e-06, Identities = 27/75 (36%), Positives = 42/75 (56%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQG 75
           M+ IRL R G    P +++VV DSR +R+G ++ +VG Y P     +I+  +   W ++GA P+ TV  LL    
  S:    56 MLAIRLRRCGARGRPAYQVVVADSRRKRNGVFLCRVGYYNPRLKSAHIDTVMLRLWTERGAAPTRTVARLLHRHA 130
>gi|50086298|ref|YP_047808.1| 30S ribosomal protein S16 [Acinetobacter sp. ADP1] >gi|81613002|sp|Q6F7H9|RS16_ACIAD 30S ribosomal protein S16 >gi|49532274|emb|CAG69986.1| 30S ribosomal protein S16 [Acinetobacter sp. ADP1] (85 aa)
Score = 128, Expect = 4.0e-06, Identities = 30/67 (44%), Positives = 43/67 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTV 67
           MV IRL R G  K PF++IVV DSR  RDG +IE++G + P        + ++ +    W+ +GAQPS+ V
  S:     1 MVVIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQGQAEKLRLDADRFAHWVSQGAQPSERV 71
>gi|62128880|gb|AAX66583.1| 30S ribosomal subunit protein S16 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (102 aa)
Score = 127, Expect = 4.2e-06, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  R+G +IE+VG + P     E    ++ +    W+ +GA  SD V  L++E
  S:    21 MVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKE 97
>gi|114571435|ref|YP_758115.1| SSU ribosomal protein S16P [Maricaulis maris MCS10] >gi|122315004|sp|Q0AKL6|RS16_MARMM 30S ribosomal protein S16 >gi|114341897|gb|ABI67177.1| SSU ribosomal protein S16P [Maricaulis maris MCS10] (152 aa)
Score = 127, Expect = 4.3e-06, Identities = 36/77 (46%), Positives = 50/77 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLR--EQGVWK 78
           +KIRL R G  K P++RIVV DSR+ RDG +IEK+G+Y P        V ++ E   +W+ KGA+P+D V   +   E   WK
  S:     3 LKIRLARGGAKKRPYYRIVVADSRSPRDGRFIEKIGSYNPMLPKDGQRVELDMEKVKAWIAKGAKPTDRVGRFIHQIEADAWK 85
>gi|116667425|pdb|2GY9|P Chain P, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 >gi|116667477|pdb|2GYB|P Chain P, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 (78 aa)
Score = 127, Expect = 4.3e-06, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  R+G +IE+VG + P     E    ++ +    W+ +GA  SD V  L++E
  S:     1 MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKE 77
>gi|33152927|ref|NP_874280.1| 30S ribosomal protein S16 [Haemophilus ducreyi 35000HP] >gi|54039439|sp|Q7VKG0|RS16_HAEDU 30S ribosomal protein S16 >gi|33149152|gb|AAP96669.1| 30S ribosomal protein S16 [Haemophilus ducreyi 35000HP] (82 aa)
Score = 127, Expect = 4.5e-06, Identities = 32/73 (43%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRLTR G  K PF++IVV DSR+ RDG +IE++G + P        + ++     +W+ KGA  S+ V  L++E
  S:     1 MVTIRLTRGGAKKRPFYQIVVADSRSPRDGRFIERIGFFNPLAAGQAERLRLDVAKVDAWVAKGAALSERVATLVKE 77
>gi|28868680|ref|NP_791299.1| 30S ribosomal protein S16 [Pseudomonas syringae pv. tomato str. DC3000] >gi|31076910|sp|Q886V2|RS16_PSESM 30S ribosomal protein S16 >gi|28851919|gb|AAO54994.1| ribosomal protein S16 [Pseudomonas syringae pv. tomato str. DC3000] (85 aa)
Score = 127, Expect = 4.6e-06, Identities = 32/74 (43%), Positives = 45/74 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           M+ IRL   G  K PF+ + V DSR  RDG++ E++G + P     E  +++NEE    WL  GAQ S+ V  LL+E 
  S:     1 MLTIRLALGGSKKRPFYHLTVTDSRNARDGSHKEQIGFFNPVARGQEIRLSVNEERVNYWLSVGAQTSERVAQLLKEH 78
>gi|113971173|ref|YP_734966.1| 30S ribosomal protein S16 [Shewanella sp. MR-4] >gi|114048411|ref|YP_738961.1| 30S ribosomal protein S16 [Shewanella sp. MR-7] >gi|123131179|sp|Q0HSK1|RS16_SHESR 30S ribosomal protein S16 >gi|123324801|sp|Q0HGA8|RS16_SHESM 30S ribosomal protein S16 >gi|113885857|gb|ABI39909.1| ribosomal protein S16 [Shewanella sp. MR-4] >gi|113889853|gb|ABI43904.1| ribosomal protein S16 [Shewanella sp. MR-7] (82 aa)
Score = 127, Expect = 4.7e-06, Identities = 31/73 (42%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++      W+  GA  +D V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPLARGQEETLRLDLARVEHWVSNGAATTDRVAKLIKD 77
>gi|127511996|ref|YP_001093193.1| 30S ribosomal protein S16 [Shewanella loihica PV-4] >gi|166201633|sp|A3QBT6|RS16_SHELP 30S ribosomal protein S16 >gi|126637291|gb|ABO22934.1| ribosomal protein S16 [Shewanella loihica PV-4] (83 aa)
Score = 127, Expect = 4.9e-06, Identities = 31/73 (42%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++ +    W+  GA  +D V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPVARGQEEALRLDLDRVDHWVANGAATTDRVAKLIKD 77
>gi|157826370|ref|YP_001494090.1| 30S ribosomal protein S16 [Rickettsia akari str. Hartford] >gi|166201343|sp|A8GQA7|RS16_RICAH 30S ribosomal protein S16 >gi|157800328|gb|ABV75582.1| 30S ribosomal protein S16 [Rickettsia akari str. Hartford] (111 aa)
Score = 127, Expect = 4.9e-06, Identities = 41/98 (41%), Positives = 62/98 (63%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGVW-----KKFMDSKVQSKKEHNANKVKKE 99
           VKIRL R G  K PF+R+V+ ++ A RDG ++EKVGTY P     N +E + L       WL  GA+P++ V   + + G+      KK MD K +++K  ++ +  KE
  S:     3 VKIRLARGGAKKRPFYRVVIANAAAPRDGDFLEKVGTYNPMLASDN-SERVVLKKDRIEYWLGTGAKPTERVAKFIEQAGLTLPEKVKKEMDVKAKNRKARSSKQEAKE 110
>gi|37525224|ref|NP_928568.1| 30S ribosomal protein S16 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|54039433|sp|Q7N7A0|RS16_PHOLL 30S ribosomal protein S16 >gi|36784651|emb|CAE13551.1| ribosomal protein S16 [Photorhabdus luminescens subsp. laumondii TTO1] (82 aa)
Score = 127, Expect = 5.0e-06, Identities = 30/73 (41%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR+ RDG +IE+VG + P        + ++ +    W+  GA  SD V  L+++
  S:     1 MVTIRLARGGAKKRPFYQVVVTDSRSPRDGRFIERVGFFNPIATGKAEALRLDLDRIEHWIGLGATVSDRVSTLIKD 77
>gi|78185083|ref|YP_377518.1| 30S ribosomal protein S16 [Synechococcus sp. CC9902] >gi|109894813|sp|Q3AX02|RS16_SYNS9 30S ribosomal protein S16 >gi|78169377|gb|ABB26474.1| SSU ribosomal protein S16P [Synechococcus sp. CC9902] (130 aa)
Score = 127, Expect = 5.0e-06, Identities = 29/79 (36%), Positives = 47/79 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL   G+ +K
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEAIRERLGQGAQPTDIVRTLLERGGLIEK 79
>gi|24372935|ref|NP_716977.1| 30S ribosomal protein S16 [Shewanella oneidensis MR-1] >gi|117921456|ref|YP_870648.1| 30S ribosomal protein S16 [Shewanella sp. ANA-3] >gi|166201635|sp|A0KZM3|RS16_SHESA 30S ribosomal protein S16 >gi|31076967|sp|Q8EH72|RS16_SHEON 30S ribosomal protein S16 >gi|24347071|gb|AAN54422.1|AE015579_11 ribosomal protein S16 [Shewanella oneidensis MR-1] >gi|117613788|gb|ABK49242.1| ribosomal protein S16 [Shewanella sp. ANA-3] (82 aa)
Score = 127, Expect = 5.0e-06, Identities = 31/73 (42%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++      W+  GA  +D V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPLARGQEETLRLDLARVEHWVANGAATTDRVAKLIKD 77
>gi|56752329|ref|YP_173030.1| 30S ribosomal protein S16 [Synechococcus elongatus PCC 6301] >gi|81300581|ref|YP_400789.1| 30S ribosomal protein S16 [Synechococcus elongatus PCC 7942] >gi|81561331|sp|Q5MZL0|RS16_SYNP6 30S ribosomal protein S16 >gi|109894812|sp|Q31MB7|RS16_SYNP7 30S ribosomal protein S16 >gi|56687288|dbj|BAD80510.1| 30S ribosomal protein S16 [Synechococcus elongatus PCC 6301] >gi|81169462|gb|ABB57802.1| SSU ribosomal protein S16P [Synechococcus elongatus PCC 7942] (82 aa)
Score = 127, Expect = 5.1e-06, Identities = 27/80 (33%), Positives = 52/80 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           M+K+RL R G+ +   +RIV  +S +RRDG  +E++G Y P      ++    +  L++GAQP++TV+++LR+  ++++ 
  S:     1 MIKLRLKRFGKKREVSYRIVATNSTSRRDGLPLEELGFYNPRTNETRLDVPAIVRRLQQGAQPTETVRSILRKAQIFEQL 80
>gi|103488204|ref|YP_617765.1| ribosomal protein S16 [Sphingopyxis alaskensis RB2256] >gi|98978281|gb|ABF54432.1| SSU ribosomal protein S16P [Sphingopyxis alaskensis RB2256] (201 aa)
Score = 127, Expect = 5.1e-06, Identities = 34/73 (46%), Positives = 46/73 (63%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGV-----VNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           IRL R G  K P+++IVV DSR+ RDG +IE++G+Y P         V ++ E A  W+  GAQP+D V   L   GV
  S:     5 IRLARGGSKKRPYYKIVVADSRSPRDGRFIERIGSYNPLLAKDNPERVKLDAERAKHWISVGAQPTDRVARFLDAAGV 82
>gi|157960877|ref|YP_001500911.1| 30S ribosomal protein S16 [Shewanella pealeana ATCC 700345] >gi|167623031|ref|YP_001673325.1| 30S ribosomal protein S16 [Shewanella halifaxensis HAW-EB4] >gi|189029616|sp|B0TJ75|RS16_SHEHH 30S ribosomal protein S16 >gi|189029617|sp|A8H1D9|RS16_SHEPA 30S ribosomal protein S16 >gi|157845877|gb|ABV86376.1| ribosomal protein S16 [Shewanella pealeana ATCC 700345] >gi|167353053|gb|ABZ75666.1| ribosomal protein S16 [Shewanella halifaxensis HAW-EB4] (83 aa)
Score = 126, Expect = 5.6e-06, Identities = 31/73 (42%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++ +    W+  GA  +D V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPVARGQEEALRLDLDRVEHWVANGAATTDRVAKLIKD 77
>gi|119470050|ref|ZP_01612855.1| 30S ribosomal subunit protein S16 [Alteromonadales bacterium TW-7] >gi|119446760|gb|EAW28033.1| 30S ribosomal subunit protein S16 [Alteromonadales bacterium TW-7] (82 aa)
Score = 126, Expect = 5.7e-06, Identities = 34/73 (46%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR  RDG +IEKVG + P          + LS    W+ +GA  SD V  L+++
  S:     1 MVTIRLQRGGAKKRPFYQIVVADSRFSRDGRFIEKVGFFNPIASGQEEKLRLDLSRVDHWVGQGAGLSDRVAKLVKD 77
>gi|27375593|ref|NP_767122.1| 30S ribosomal protein S16 [Bradyrhizobium japonicum USDA 110] >gi|31076937|sp|Q89X40|RS16_BRAJA 30S ribosomal protein S16 >gi|27348730|dbj|BAC45747.1| 30S ribosomal protein S16 [Bradyrhizobium japonicum USDA 110] (110 aa)
Score = 126, Expect = 5.8e-06, Identities = 38/98 (38%), Positives = 52/98 (53%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKE 99
           V IRL R G  K P + +VV DSR  RDG +IE++G + P      E  + ++ E   +W+ KGAQPSD V   L   GV K+   +  Q        K + E
  S:     3 VVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLLPKDNEARLKLDMEKVKAWVAKGAQPSDRVSRFLDAAGVKKREARNNPQKAVPRKERKAQAE 105
>gi|92119039|ref|YP_578768.1| 30S ribosomal protein S16 [Nitrobacter hamburgensis X14] >gi|123083532|sp|Q1QHI9|RS16_NITHX 30S ribosomal protein S16 >gi|91801933|gb|ABE64308.1| SSU ribosomal protein S16P [Nitrobacter hamburgensis X14] (110 aa)
Score = 126, Expect = 6.1e-06, Identities = 42/110 (38%), Positives = 60/110 (54%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN-----INEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAAS 111
           V IRL R G  K P + +VV DSR  RDG +IE++G + P     N     I+ +   +WL KGAQPSD V   L   GV K+       + + +    V ++ +K +A+ AA S
  S:     3 VVIRLARAGTKKRPVYHVVVADSRYPRDGRFIERLGYFNPLMPKDNADRLKIDLDKVKAWLAKGAQPSDRVARFLDAAGVKKR-------TARNNPEKAVPRKERKAQAEAAAKS 110
>gi|111115527|ref|YP_710145.1| 30S ribosomal protein S16 [Borrelia afzelii PKo] >gi|123145645|sp|Q0SMF9|RS16_BORAP 30S ribosomal protein S16 >gi|110890801|gb|ABH01969.1| ribosomal protein S16 [Borrelia afzelii PKo] (86 aa)
Score = 126, Expect = 6.4e-06, Identities = 36/78 (46%), Positives = 50/78 (64%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           VKIRL R+G  K P++RIVV++S + RDG  IE++G Y   E    + I E+    W+ KGA  SDTVK LL++  +  K
  S:     3 VKIRLKRMGAKKRPYYRIVVMNSTSPRDGRAIEELGYYHLIEKQNQLKIKEDRMKDWISKGAILSDTVKMLLKKNNLNAK 82
>gi|87125497|ref|ZP_01081342.1| 30S ribosomal protein S16 [Synechococcus sp. RS9917] >gi|86166797|gb|EAQ68059.1| 30S ribosomal protein S16 [Synechococcus sp. RS9917] (138 aa)
Score = 126, Expect = 6.4e-06, Identities = 28/76 (36%), Positives = 48/76 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E   + L +GAQP+D V++LL + G+
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEGLRARLSQGAQPTDAVRSLLEKGGL 76
>gi|77359890|ref|YP_339465.1| 30S ribosomal protein S16 [Pseudoalteromonas haloplanktis TAC125] >gi|109894786|sp|Q3IEC9|RS16_PSEHT 30S ribosomal protein S16 >gi|76874801|emb|CAI86022.1| 30S ribosomal subunit protein S16 [Pseudoalteromonas haloplanktis TAC125] (82 aa)
Score = 126, Expect = 6.6e-06, Identities = 33/73 (45%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR  RDG +IEKVG + P     E  + ++      W+ +GA  SD V  L+++
  S:     1 MVTIRLQRGGAKKRPFYQIVVADSRFSRDGRFIEKVGFFNPIAAGQEEKIRLDLPRVEHWVGQGASLSDRVAKLVKD 77
>gi|15616998|ref|NP_240211.1| 30S ribosomal protein S16 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387079|sp|P57474|RS16_BUCAI 30S ribosomal protein S16 >gi|25294779|pir||A84976 30S ribosomal protein S16 [imported] - Buchnera sp. (strain APS) >gi|10039063|dbj|BAB13097.1| 30S ribosomal protein S16 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (79 aa)
Score = 126, Expect = 6.6e-06, Identities = 31/74 (41%), Positives = 48/74 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQ 74
           MVKIRL R G  K PF+++VV DSR  R+G +IE++G + P       ++ +N E    W  +GAQ S+  K L++++
  S:     1 MVKIRLARYGTKKRPFYKLVVADSRFSRNGRFIERLGYFNPIAKGKSEILKLNLERIEHWTNQGAQMSERTKKLIKQK 78
>gi|116515178|ref|YP_802807.1| 30S ribosomal protein S16 [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|122285426|sp|Q057I5|RS16_BUCCC 30S ribosomal protein S16 >gi|116257032|gb|ABJ90714.1| 30S ribosomal protein S16 [Buchnera aphidicola str. Cc (Cinara cedri)] (88 aa)
Score = 126, Expect = 6.7e-06, Identities = 31/71 (43%), Positives = 51/71 (71%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           M+KIRL+R G  K PF++I++ + R+ R+G +IE+VG + PF    E  + I+ +    WL+KGA+ ++ +KNLL
  S:     1 MIKIRLSRHGMKKKPFYQIIIANVRSSRNGKFIERVGFFNPFAKKNEEKIRISTKRIQYWLEKGAKKTNRIKNLL 75
>gi|157804271|ref|YP_001492820.1| 30S ribosomal protein S16 [Rickettsia canadensis str. McKiel] >gi|166201345|sp|A8F0A2|RS16_RICCK 30S ribosomal protein S16 >gi|157785534|gb|ABV74035.1| 30S ribosomal protein S16 [Rickettsia canadensis str. McKiel] (111 aa)
Score = 126, Expect = 6.7e-06, Identities = 44/107 (41%), Positives = 61/107 (57%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKA 108
           VKIRL R G  K PF+R+VV ++ A RDG ++EKVGTY P     N +E + L       WL  GA+P++ V   + + GV    +  KV+ +    A   K    K EAK+A
  S:     3 VKIRLARGGAKKRPFYRVVVANATAPRDGDFLEKVGTYNPMLASDN-SERVVLKKDRIEYWLSTGAKPTERVAKFIEQAGV---ILPEKVKKEMAVKAKNRKPRPSKKEAKEA 111
>gi|114564084|ref|YP_751598.1| 30S ribosomal protein S16 [Shewanella frigidimarina NCIMB 400] >gi|122299043|sp|Q07Z05|RS16_SHEFN 30S ribosomal protein S16 >gi|114335377|gb|ABI72759.1| ribosomal protein S16 [Shewanella frigidimarina NCIMB 400] (83 aa)
Score = 126, Expect = 6.9e-06, Identities = 31/73 (42%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++ +    W+  GA  S+ V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPLARGQEETLRLDLDRVEHWVATGAATSERVAKLIKD 77
>gi|116073374|ref|ZP_01470636.1| 30S ribosomal protein S16 [Synechococcus sp. RS9916] >gi|116068679|gb|EAU74431.1| 30S ribosomal protein S16 [Synechococcus sp. RS9916] (134 aa)
Score = 125, Expect = 7.3e-06, Identities = 29/79 (36%), Positives = 49/79 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V++LL + G+ +K
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDAEGLRERLSQGAQPTDAVRSLLEKGGLLEK 79
>gi|16331102|ref|NP_441830.1| 30S ribosomal protein S16 [Synechocystis sp. PCC 6803] >gi|2500468|sp|P74410|RS16_SYNY3 30S ribosomal protein S16 >gi|1653595|dbj|BAA18508.1| 30S ribosomal protein S16 [Synechocystis sp. PCC 6803] (82 aa)
Score = 125, Expect = 7.4e-06, Identities = 29/80 (36%), Positives = 50/80 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKF 80
           M+K+RL R G+ +   +RIV + S  RRDG  +E++G Y P      ++    +  LK+GAQP+DTV+++L +  V+++ 
  S:     1 MIKLRLKRFGKKREVSYRIVAMHSTTRRDGRPLEELGFYNPRTDETRLDVPAIVKRLKEGAQPTDTVRSILTKAQVFEQL 80
>gi|11467622|ref|NP_050674.1| ribosomal protein S16 [Guillardia theta] >gi|6094133|sp|O78423|RR16_GUITH Chloroplast 30S ribosomal protein S16 >gi|3602947|gb|AAC35608.1| ribosomal protein S16 [Guillardia theta] (76 aa)
Score = 125, Expect = 7.5e-06, Identities = 30/71 (42%), Positives = 44/71 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLL 71
           M+K+RL + GR     +R+VV+ S ++RDG  IE++G Y P     +IN E     L +G +P+ TVKNLL
  S:     1 MLKLRLKKYGRKGQASYRLVVMPSTSKRDGRAIEELGFYNPCTNETHINVERVKVRLSQGVKPTSTVKNLL 71
>gi|77956712|ref|ZP_00820794.1| COG0228: Ribosomal protein S16 [Yersinia bercovieri ATCC 43970] >gi|77960437|ref|ZP_00824308.1| COG0228: Ribosomal protein S16 [Yersinia mollaretii ATCC 43969] (82 aa)
Score = 125, Expect = 7.6e-06, Identities = 30/73 (41%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        + ++ +    W+  GA  SD V  L+++
  S:     1 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIASGQAEALRLDLDRIEHWIGLGATVSDRVSALIKD 77
>gi|33240808|ref|NP_875750.1| 30S ribosomal protein S16 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|54039437|sp|Q7VAU5|RS16_PROMA 30S ribosomal protein S16 >gi|33238337|gb|AAQ00403.1| Ribosomal protein S16 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (131 aa)
Score = 125, Expect = 7.7e-06, Identities = 39/126 (30%), Positives = 72/126 (57%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSASQK 126
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V++LL + G+ +K +        E      ++E++K EAK +A +K A++  A++   ++
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEALRLRLSQGAQPTDAVRSLLEKGGLLEKTI-----RPAELIGKSKQEELRKSEAKTSAKNKKANEEKANEEKVEE 121
>gi|87122824|ref|ZP_01078695.1| Ribosomal protein S16 [Marinomonas sp. MED121] >gi|86161876|gb|EAQ63170.1| Ribosomal protein S16 [Marinomonas sp. MED121] (82 aa)
Score = 125, Expect = 7.7e-06, Identities = 32/73 (43%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF+ + V DSR  RDG YIE++G + P     E  + I+ +    W+  GAQ SD V  L+++
  S:     1 MVTIRLSRGGSKKRPFYHLNVADSRRARDGRYIERLGFFNPVARGQEERLRIDLDRVDHWVGLGAQLSDRVAQLVKD 77
>gi|78196886|gb|ABB34651.1| ribosomal protein S16 [Synechococcus sp. CC9605] (157 aa)
Score = 125, Expect = 7.9e-06, Identities = 29/79 (36%), Positives = 47/79 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL   G+ +K
  S:    23 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEAIRERLGQGAQPTDVVRTLLERGGLLEK 101
>gi|78779765|ref|YP_397877.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9312] >gi|109894782|sp|Q319K4|RS16_PROM9 30S ribosomal protein S16 >gi|78713264|gb|ABB50441.1| SSU ribosomal protein S16P [Prochlorococcus marinus str. MIT 9312] (121 aa)
Score = 125, Expect = 8.5e-06, Identities = 43/120 (35%), Positives = 64/120 (53%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVW-KKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSAS 120
           M+K+RL R G+ K   FRIV  +S +RRDG  ++++G Y P      +N E     L +GAQP+D V+NLL + G+  KK   S    K +    KV K   K E   ++ ++  S  + S
  S:     1 MIKLRLKRFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKETRLNTEALRIRLTQGAQPTDVVRNLLEKGGLLEKKERPSIAIGKAKLEKEKVAKAKIKNEENDSSKAESDSNEAES 121
>gi|157369097|ref|YP_001477086.1| 30S ribosomal protein S16 [Serratia proteamaculans 568] >gi|167011172|sp|A8GA18|RS16_SERP5 30S ribosomal protein S16 >gi|157320861|gb|ABV39958.1| ribosomal protein S16 [Serratia proteamaculans 568] (82 aa)
Score = 125, Expect = 8.6e-06, Identities = 30/73 (41%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        + ++ +    W+  GA  SD V  L+++
  S:     1 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIASGQAEALRLDLDRIEHWVGLGATVSDRVHALIKD 77
>gi|152997771|ref|YP_001342606.1| ribosomal protein S16 [Marinomonas sp. MWYL1] >gi|189029603|sp|A6W1U2|RS16_MARMS 30S ribosomal protein S16 >gi|150838695|gb|ABR72671.1| ribosomal protein S16 [Marinomonas sp. MWYL1] (82 aa)
Score = 125, Expect = 8.7e-06, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL+R G  K PF+ + V DSR  RDG YIE++G + P     E  + I+ +    W+ +GAQ SD    L+++
  S:     1 MVTIRLSRGGSKKRPFYHLNVADSRRARDGRYIERLGFFNPVARGQEERLRIDLDRVNHWVSQGAQLSDRAAQLVKD 77
>gi|94676837|ref|YP_588655.1| ribosomal protein S16 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|123384146|sp|Q1LTQ9|RS16_BAUCH 30S ribosomal protein S16 >gi|94219987|gb|ABF14146.1| ribosomal protein S16 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (88 aa)
Score = 125, Expect = 8.8e-06, Identities = 29/72 (40%), Positives = 47/72 (65%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF---EGV-VNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV+IRL R G  K PF++I+V D+   RDG +IE+VG + P    + V + +N +  L W+  GA+ S+ +  L++
  S:     1 MVRIRLARGGAKKRPFYQIIVTDNHQARDGRFIERVGFFNPLATGQAVDLRLNMDRILYWINHGAKMSERLYALIK 76
>gi|58038678|ref|YP_190642.1| 30S ribosomal protein S16 [Gluconobacter oxydans 621H] >gi|81557214|sp|Q5FUG0|RS16_GLUOX 30S ribosomal protein S16 >gi|58001092|gb|AAW59986.1| SSU ribosomal protein S16P [Gluconobacter oxydans 621H] (115 aa)
Score = 125, Expect = 8.8e-06, Identities = 34/78 (43%), Positives = 45/78 (57%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           +KIRL R G  K P++ IVV DSR+ RDG +IEKVG+Y P         + + +E    WL  GA  +D V   L   G+  K
  S:     3 LKIRLARAGAKKRPYYHIVVADSRSPRDGRFIEKVGSYNPMLPADHADRIRLVDERIKHWLSNGALATDRVARFLGNAGLAPK 85
>gi|16123448|ref|NP_406761.1| 30S ribosomal protein S16 [Yersinia pestis CO92] >gi|22124804|ref|NP_668227.1| 30S ribosomal protein S16 [Yersinia pestis KIM] >gi|45440248|ref|NP_991787.1| 30S ribosomal protein S16 [Yersinia pestis biovar Microtus str. 91001] >gi|51595184|ref|YP_069375.1| 30S ribosomal protein S16 [Yersinia pseudotuberculosis IP 32953] >gi|108808840|ref|YP_652756.1| 30S ribosomal protein S16 [Yersinia pestis Antiqua] >gi|108810968|ref|YP_646735.1| 30S ribosomal protein S16 [Yersinia pestis Nepal516] >gi|145600321|ref|YP_001164397.1| 30S ribosomal protein S16 [Yersinia pestis Pestoides F] >gi|153949898|ref|YP_001402185.1| 30S ribosomal protein S16 [Yersinia pseudotuberculosis IP 31758] >gi|153997659|ref|ZP_02022759.1| 30S ribosomal protein S16 [Yersinia pestis CA88-4125] >gi|162421451|ref|YP_001605454.1| 30S ribosomal protein S16 [Yersinia pestis Angola] >gi|165925811|ref|ZP_02221643.1| ribosomal protein S16 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936758|ref|ZP_02225325.1| ribosomal protein S16 [Yersinia pestis biovar Orientalis str. IP275] >gi|166010141|ref|ZP_02231039.1| ribosomal protein S16 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213017|ref|ZP_02239052.1| ribosomal protein S16 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398824|ref|ZP_02304348.1| ribosomal protein S16 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421601|ref|ZP_02313354.1| ribosomal protein S16 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423168|ref|ZP_02314921.1| ribosomal protein S16 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170025579|ref|YP_001722084.1| ribosomal protein S16 [Yersinia pseudotuberculosis YPIII] >gi|186894199|ref|YP_001871311.1| ribosomal protein S16 [Yersinia pseudotuberculosis PB1/+] >gi|122979434|sp|Q1C411|RS16_YERPA 30S ribosomal protein S16 >gi|122980294|sp|Q1CLJ5|RS16_YERPN 30S ribosomal protein S16 >gi|166218862|sp|A4TQ62|RS16_YERPP 30S ribosomal protein S16 >gi|167011174|sp|A7FLQ7|RS16_YERP3 30S ribosomal protein S16 >gi|20140069|sp|Q8ZBU7|RS16_YERPE 30S ribosomal protein S16 >gi|81640299|sp|Q66E59|RS16_YERPS 30S ribosomal protein S16 >gi|21957629|gb|AAM84478.1|AE013692_7 30S ribosomal subunit protein S16 [Yersinia pestis KIM] >gi|45435104|gb|AAS60664.1| 30S ribosomal protein S16 [Yersinia pestis biovar Microtus str. 91001] >gi|51588466|emb|CAH20074.1| 30S ribosomal subunit protein S16 [Yersinia pseudotuberculosis IP 32953] >gi|108774616|gb|ABG17135.1| SSU ribosomal protein S16P [Yersinia pestis Nepal516] >gi|108780753|gb|ABG14811.1| SSU ribosomal protein S16P [Yersinia pestis Antiqua] >gi|115348927|emb|CAL21886.1| 30S ribosomal protein S16 [Yersinia pestis CO92] >gi|145212017|gb|ABP41424.1| SSU ribosomal protein S16P [Yersinia pestis Pestoides F] >gi|149289296|gb|EDM39376.1| 30S ribosomal protein S16 [Yersinia pestis CA88-4125] >gi|152961393|gb|ABS48854.1| ribosomal protein S16 [Yersinia pseudotuberculosis IP 31758] >gi|162354266|gb|ABX88214.1| ribosomal protein S16 [Yersinia pestis Angola] >gi|165915407|gb|EDR34017.1| ribosomal protein S16 [Yersinia pestis biovar Orientalis str. IP275] >gi|165922423|gb|EDR39600.1| ribosomal protein S16 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991048|gb|EDR43349.1| ribosomal protein S16 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205804|gb|EDR50284.1| ribosomal protein S16 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960520|gb|EDR56541.1| ribosomal protein S16 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051328|gb|EDR62736.1| ribosomal protein S16 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057338|gb|EDR67084.1| ribosomal protein S16 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752113|gb|ACA69631.1| ribosomal protein S16 [Yersinia pseudotuberculosis YPIII] >gi|186697225|gb|ACC87854.1| ribosomal protein S16 [Yersinia pseudotuberculosis PB1/+] (82 aa)
Score = 124, Expect = 9.2e-06, Identities = 30/73 (41%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        + ++ +    W+  GA  SD V  L+++
  S:     1 MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIASGQAEALRLDLDRIEHWIGLGATVSDRVSVLIKD 77
>gi|15803131|ref|NP_289162.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 EDL933] >gi|15832726|ref|NP_311499.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 str. Sakai] >gi|16130530|ref|NP_417100.1| 30S ribosomal subunit protein S16 [Escherichia coli str. K-12 substr. MG1655] >gi|24113947|ref|NP_708457.1| 30S ribosomal protein S16 [Shigella flexneri 2a str. 301] >gi|30064008|ref|NP_838179.1| 30S ribosomal protein S16 [Shigella flexneri 2a str. 2457T] >gi|74313199|ref|YP_311618.1| 30S ribosomal protein S16 [Shigella sonnei Ss046] >gi|82545153|ref|YP_409100.1| 30S ribosomal protein S16 [Shigella boydii Sb227] >gi|82777968|ref|YP_404317.1| 30S ribosomal protein S16 [Shigella dysenteriae Sd197] >gi|89109410|ref|AP_003190.1| 30S ribosomal subunit protein S16 [Escherichia coli W3110] >gi|110642770|ref|YP_670500.1| 30S ribosomal protein S16 [Escherichia coli 536] >gi|157156431|ref|YP_001463928.1| 30S ribosomal protein S16 [Escherichia coli E24377A] >gi|157162085|ref|YP_001459403.1| 30S ribosomal protein S16 [Escherichia coli HS] >gi|161486145|ref|NP_755012.2| 30S ribosomal protein S16 [Escherichia coli CFT073] >gi|162138387|ref|YP_541929.2| 30S ribosomal protein S16 [Escherichia coli UTI89] >gi|168708114|ref|ZP_02740391.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 str. EC4045] >gi|168719674|ref|ZP_02751951.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 str. EC4206] >gi|168734074|ref|ZP_02766351.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 str. EC4115] >gi|168752710|ref|ZP_02777732.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4113] >gi|168758678|ref|ZP_02783685.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4401] >gi|168762401|ref|ZP_02787408.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4501] >gi|168768697|ref|ZP_02793704.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4486] >gi|168773464|ref|ZP_02798471.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4196] >gi|168778587|ref|ZP_02803594.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4076] >gi|168789511|ref|ZP_02814518.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC869] >gi|168793763|ref|ZP_02818770.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 str. EC4042] >gi|168801726|ref|ZP_02826733.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC508] >gi|170019114|ref|YP_001724068.1| ribosomal protein S16 [Escherichia coli ATCC 8739] >gi|170082213|ref|YP_001731533.1| 30S ribosomal subunit protein S16 [Escherichia coli str. K12 substr. DH10B] >gi|170682475|ref|YP_001744792.1| ribosomal protein S16 [Escherichia coli SMS-3-5] >gi|170766041|ref|ZP_02900852.1| ribosomal protein S16 [Escherichia albertii TW07627] >gi|187731405|ref|YP_001881399.1| ribosomal protein S16 [Shigella boydii CDC 3083-94] >gi|188495122|ref|ZP_03002392.1| ribosomal protein S16 [Escherichia coli 53638] >gi|191169059|ref|ZP_03030822.1| ribosomal protein S16 [Escherichia coli B7A] >gi|193064019|ref|ZP_03045104.1| ribosomal protein S16 [Escherichia coli E22] >gi|193071690|ref|ZP_03052591.1| ribosomal protein S16 [Escherichia coli E110019] >gi|194430160|ref|ZP_03062661.1| ribosomal protein S16 [Escherichia coli B171] >gi|194435114|ref|ZP_03067350.1| ribosomal protein S16 [Shigella dysenteriae 1012] >gi|194439366|ref|ZP_03071444.1| ribosomal protein S16 [Escherichia coli 101-1] >gi|195940203|ref|ZP_03085585.1| 30S ribosomal protein S16 [Escherichia coli O157:H7 str. EC4024] >gi|67472368|sp|P0A7T3|RS16_ECOLI 30S ribosomal protein S16 >gi|123048955|sp|Q0TEN0|RS16_ECOL5 30S ribosomal protein S16 >gi|167011166|sp|A7ZQ49|RS16_ECO24 30S ribosomal protein S16 >gi|167011167|sp|A8A3B6|RS16_ECOHS 30S ribosomal protein S16 >gi|189044380|sp|B1IVM4|RS16_ECOLC 30S ribosomal protein S16 >gi|67472369|sp|P0A7T4|RS16_ECOL6 30S ribosomal protein S16 >gi|67472370|sp|P0A7T5|RS16_ECO57 30S ribosomal protein S16 >gi|67472371|sp|P0A7T6|RS16_SHIFL 30S ribosomal protein S16 >gi|109894801|sp|Q31XD6|RS16_SHIBS 30S ribosomal protein S16 >gi|109894802|sp|Q32CX9|RS16_SHIDS 30S ribosomal protein S16 >gi|109894803|sp|Q3YYM9|RS16_SHISS 30S ribosomal protein S16 >gi|33357893|pdb|1P6G|P Chain P, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357970|pdb|1P87|P Chain P, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754054|pdb|2AVY|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754110|pdb|2AW7|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666563|pdb|1VS5|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666615|pdb|1VS7|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138068|pdb|2I2P|P Chain P, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138139|pdb|2I2U|P Chain P, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|157836036|pdb|2QOU|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836083|pdb|2QOW|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836140|pdb|2QOY|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836187|pdb|2QP0|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429713|pdb|2QAL|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429765|pdb|2QAN|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429823|pdb|2QB9|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429875|pdb|2QBB|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429927|pdb|2QBD|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429979|pdb|2QBF|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430033|pdb|2QBH|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430086|pdb|2QBJ|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431386|pdb|2Z4K|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431439|pdb|2Z4M|P Chain P, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988803|pdb|2VHO|P Chain P, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 3 Of 4) >gi|168988824|pdb|2VHP|P Chain P, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 4 Of 4) >gi|12517031|gb|AAG57720.1|AE005490_15 30S ribosomal subunit protein S16 [Escherichia coli O157:H7 EDL933] >gi|43143|emb|CAA25958.1| unnamed protein product [Escherichia coli] >gi|1788961|gb|AAC75658.1| 30S ribosomal subunit protein S16 [Escherichia coli str. K-12 substr. MG1655] >gi|13362943|dbj|BAB36895.1| 30S ribosomal subunit protein S16 [Escherichia coli O157:H7 str. Sakai] >gi|24053054|gb|AAN44164.1| 30S ribosomal subunit protein S16 [Shigella flexneri 2a str. 301] >gi|30042264|gb|AAP17989.1| 30S ribosomal subunit protein S16 [Shigella flexneri 2a str. 2457T] >gi|73856676|gb|AAZ89383.1| 30S ribosomal subunit protein S16 [Shigella sonnei Ss046] >gi|81242116|gb|ABB62826.1| 30S ribosomal subunit protein S16 [Shigella dysenteriae Sd197] >gi|81246564|gb|ABB67272.1| 30S ribosomal subunit protein S16 [Shigella boydii Sb227] >gi|85675480|dbj|BAA16494.2| 30S ribosomal subunit protein S16 [Escherichia coli W3110] >gi|110344362|gb|ABG70599.1| 30S ribosomal protein S16 [Escherichia coli 536] >gi|157067765|gb|ABV07020.1| ribosomal protein S16 [Escherichia coli HS] >gi|157078461|gb|ABV18169.1| ribosomal protein S16 [Escherichia coli E24377A] >gi|169754042|gb|ACA76741.1| ribosomal protein S16 [Escherichia coli ATCC 8739] >gi|169890048|gb|ACB03755.1| 30S ribosomal subunit protein S16 [Escherichia coli str. K12 substr. DH10B] >gi|170125187|gb|EDS94118.1| ribosomal protein S16 [Escherichia albertii TW07627] >gi|170520193|gb|ACB18371.1| ribosomal protein S16 [Escherichia coli SMS-3-5] >gi|187428397|gb|ACD07671.1| ribosomal protein S16 [Shigella boydii CDC 3083-94] >gi|187770685|gb|EDU34529.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4196] >gi|188013551|gb|EDU51673.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4113] >gi|188490321|gb|EDU65424.1| ribosomal protein S16 [Escherichia coli 53638] >gi|189003599|gb|EDU72585.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4076] >gi|189354551|gb|EDU72970.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4401] >gi|189362029|gb|EDU80448.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4486] >gi|189367266|gb|EDU85682.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC4501] >gi|189370841|gb|EDU89257.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC869] >gi|189376160|gb|EDU94576.1| ribosomal protein S16 [Escherichia coli O157:H7 str. EC508] >gi|190900900|gb|EDV60686.1| ribosomal protein S16 [Escherichia coli B7A] >gi|192929254|gb|EDV82863.1| ribosomal protein S16 [Escherichia coli E22] >gi|192954985|gb|EDV85487.1| ribosomal protein S16 [Escherichia coli E110019] >gi|194411785|gb|EDX28106.1| ribosomal protein S16 [Escherichia coli B171] >gi|194416645|gb|EDX32778.1| ribosomal protein S16 [Shigella dysenteriae 1012] >gi|194421728|gb|EDX37737.1| ribosomal protein S16 [Escherichia coli 101-1] (82 aa)
Score = 124, Expect = 9.3e-06, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  R+G +IE+VG + P     E    ++ +    W+ +GA  SD V  L++E
  S:     1 MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKE 77
>gi|51209882|ref|YP_063546.1| 30S ribosomal protein S16 [Gracilaria tenuistipitata var. liui] >gi|68053127|sp|Q6B914|RR16_GRATL Chloroplast 30S ribosomal protein S16 >gi|50657636|gb|AAT79621.1| 30S ribosomal protein S16 [Gracilaria tenuistipitata var. liui] (78 aa)
Score = 124, Expect = 1.0e-05, Identities = 31/73 (42%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           M+KIRL R GR + P +RI+VIDSR  RDG  IE++G Y P      IN       + +GAQP+  V+ ++ +
  S:     1 MLKIRLKRFGRKRQPSYRIIVIDSRKPRDGRPIEEIGFYSPLNNKSKINLIQVKKRIYQGAQPTKKVQQIISQ 73
>gi|159903873|ref|YP_001551217.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9211] >gi|159889049|gb|ABX09263.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9211] (125 aa)
Score = 124, Expect = 1.1e-05, Identities = 38/124 (30%), Positives = 67/124 (54%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASKPSASKSAS 124
           M+K+RL R G+ +   FR+V  +S +RRDG  +E++G Y P      ++ E   + L +GAQP+D V++LL + G+ +K +       K+  A   +   KK   +K   SK +   S + +++
  S:     1 MIKLRLKRYGKKREASFRLVACNSTSRRDGRPLEELGFYNPRTKETRLDTEALRTRLSQGAQPTDAVRSLLEKGGLIEKTIRPAEIEGKKKQALARQSASKKAVKEKTEESKGSEVDSETSTSA 124
>gi|33862623|ref|NP_894183.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. MIT 9313] >gi|50403612|sp|Q7TV43|RS16_PROMM 30S ribosomal protein S16 >gi|33634539|emb|CAE20525.1| 30S Ribosomal protein S16 [Prochlorococcus marinus str. MIT 9313] (122 aa)
Score = 124, Expect = 1.2e-05, Identities = 37/110 (33%), Positives = 62/110 (56%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAA 110
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V++LL + G+ +K +             +V  + K+ EA+KAAA
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEALRLRLSQGAQPTDAVRSLLEKGGLIEKTV----------RPAEVVGKAKQAEARKAAA 100
>gi|71279379|ref|YP_270724.1| ribosomal protein S16 [Colwellia psychrerythraea 34H] >gi|109893874|sp|Q47WU8|RS16_COLP3 30S ribosomal protein S16 >gi|71145119|gb|AAZ25592.1| ribosomal protein S16 [Colwellia psychrerythraea 34H] (81 aa)
Score = 123, Expect = 1.2e-05, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IEKVG + P        + ++ +    W+ +GA  SD V  L+++
  S:     1 MVTIRLARGGAKKRPFYQVVVADSRNSRDGRFIEKVGFFNPTAQGQAEKLRLDLDRITHWVGQGATVSDRVAKLVKD 77
>gi|118594349|ref|ZP_01551696.1| 30S ribosomal protein S16 [Methylophilales bacterium HTCC2181] >gi|118440127|gb|EAV46754.1| 30S ribosomal protein S16 [Methylophilales bacterium HTCC2181] (189 aa)
Score = 123, Expect = 1.2e-05, Identities = 33/72 (45%), Positives = 45/72 (62%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLR 72
           MV IRL+R G  K P+F +VV DS+ RRDG +IE+VG Y P  G    +E + L       W   GA  S+TV  +++
  S:     1 MVIIRLSRSGSKKRPYFNVVVADSKKRRDGRFIERVGFYNP--GANQGSEALRLDTDRISYWQGHGALLSETVGRIVK 76
>gi|33866151|ref|NP_897710.1| 30S ribosomal protein S16 [Synechococcus sp. WH 8102] >gi|50403632|sp|Q7TTU5|RS16_SYNPX 30S ribosomal protein S16 >gi|33639126|emb|CAE08132.1| 30S Ribosomal protein S16 [Synechococcus sp. WH 8102] (140 aa)
Score = 123, Expect = 1.3e-05, Identities = 29/79 (36%), Positives = 47/79 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL   G+ +K
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEAIRERLGQGAQPTDVVRTLLERGGLIEK 79
>gi|16761529|ref|NP_457146.1| 30S ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16765991|ref|NP_461606.1| 30S ribosomal protein S16 [Salmonella typhimurium LT2] >gi|29143000|ref|NP_806342.1| 30S ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56414641|ref|YP_151716.1| 30S ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161615608|ref|YP_001589573.1| 30S ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|162139558|ref|YP_217664.2| 30S ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167545926|ref|ZP_02341493.1| hypothetical protein Sentent_21741 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167553523|ref|ZP_02347272.1| hypothetical protein Sentente_23732 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167560004|ref|ZP_02353009.1| hypothetical protein Sententeri_24515 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992456|ref|ZP_02573554.1| hypothetical protein Sententer_01000014_0100013462 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168219013|ref|ZP_02644245.1| hypothetical protein Senterenterica_01375 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227828|ref|ZP_02653059.1| hypothetical protein Sententeric_18798 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168234198|ref|ZP_02659256.1| hypothetical protein Sententerica_24673 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239446|ref|ZP_02664504.1| hypothetical protein Senteenterica_24944 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168244699|ref|ZP_02669631.1| hypothetical protein Senterienterica_23883 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168262152|ref|ZP_02684125.1| hypothetical protein Salmentericaenterica_13773 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464151|ref|ZP_02698068.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168823046|ref|ZP_02835046.1| hypothetical protein Salentericaenterica_26935 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194444399|ref|YP_002041939.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194451722|ref|YP_002046681.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194471822|ref|ZP_03077806.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735365|ref|YP_002115686.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189029613|sp|A9MZ51|RS16_SALPB 30S ribosomal protein S16 >gi|61236718|sp|P0A2A9|RS16_SALTY 30S ribosomal protein S16 >gi|61236721|sp|P0A2B0|RS16_SALTI 30S ribosomal protein S16 >gi|81599408|sp|Q5PFF6|RS16_SALPA 30S ribosomal protein S16 >gi|109894799|sp|Q57L29|RS16_SALCH 30S ribosomal protein S16 >gi|25294787|pir||AH0833 30S ribosomal chain protein S16 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|402165|emb|CAA52885.1| ribosomal protein S16 [Salmonella typhimurium] >gi|16421222|gb|AAL21565.1| 30S ribosomal subunit protein S16 [Salmonella typhimurium LT2] >gi|16503830|emb|CAD05855.1| 30S ribosomal subunit protein S16 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138633|gb|AAO70202.1| 30S ribosomal subunit protein S16 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56128898|gb|AAV78404.1| 30S ribosomal subunit protein S16 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161364972|gb|ABX68740.1| hypothetical protein SPAB_03389 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403062|gb|ACF63284.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194410026|gb|ACF70245.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194458186|gb|EDX47025.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710867|gb|ACF90088.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633262|gb|EDX51676.1| ribosomal protein S16 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (82 aa)
Score = 123, Expect = 1.3e-05, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  R+G +IE+VG + P     E    ++ +    W+ +GA  SD V  L++E
  S:     1 MVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKE 77
>gi|116194109|ref|XP_001222867.1| hypothetical protein CHGG_06772 [Chaetomium globosum CBS 148.51] >gi|88182685|gb|EAQ90153.1| hypothetical protein CHGG_06772 [Chaetomium globosum CBS 148.51] (112 aa)
Score = 123, Expect = 1.3e-05, Identities = 32/76 (42%), Positives = 49/76 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP------FEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGV 76
           +VKIRL R GR   PF+ IVV  +R  R+   +E +GTY+P      ++    ++++I L       W+  GAQP+DT+  LL   G+
  S:     2 VVKIRLARFGRTNKPFYNIVVAHARTARNSRPLEVIGTYDPIPKTDLYDDSGALHKDIKLDMTRAKYWIGVGAQPTDTMWRLLSLVGI 89
>gi|161353764|ref|YP_381206.2| 30S ribosomal protein S16 [Synechococcus sp. CC9605] >gi|109894814|sp|Q3AL81|RS16_SYNSC 30S ribosomal protein S16 (135 aa)
Score = 123, Expect = 1.4e-05, Identities = 29/79 (36%), Positives = 47/79 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL   G+ +K
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEAIRERLGQGAQPTDVVRTLLERGGLLEK 79
>gi|113476150|ref|YP_722211.1| SSU ribosomal protein S16P [Trichodesmium erythraeum IMS101] >gi|123160744|sp|Q111T6|RS16_TRIEI 30S ribosomal protein S16 >gi|110167198|gb|ABG51738.1| SSU ribosomal protein S16P [Trichodesmium erythraeum IMS101] (141 aa)
Score = 123, Expect = 1.4e-05, Identities = 28/76 (36%), Positives = 49/76 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+K+RL R G+ +   +RIV ++S +RRDG  +E++G Y P      ++       L++GAQP+DTV+++L++  V
  S:     1 MIKLRLKRYGKKRESSYRIVAMNSDSRRDGRPLEELGFYNPRTDETRLDVPGITRRLEQGAQPTDTVRDILKKANV 76
>gi|113954183|ref|YP_729981.1| 30S ribosomal protein S16 [Synechococcus sp. CC9311] >gi|123132665|sp|Q0IC41|RS16_SYNS3 30S ribosomal protein S16 >gi|113881534|gb|ABI46492.1| ribosomal protein S16 [Synechococcus sp. CC9311] (128 aa)
Score = 123, Expect = 1.4e-05, Identities = 29/79 (36%), Positives = 48/79 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL + G+ +K
  S:     1 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDAEALRVRLSQGAQPTDAVRFLLEKGGLLEK 79
>gi|88809130|ref|ZP_01124639.1| 30S ribosomal protein S16 [Synechococcus sp. WH 7805] >gi|88787072|gb|EAR18230.1| 30S ribosomal protein S16 [Synechococcus sp. WH 7805] (155 aa)
Score = 123, Expect = 1.4e-05, Identities = 29/79 (36%), Positives = 48/79 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E     L +GAQP+D V+ LL + G+ +K
  S:    18 MIKLRLKRFGKKREASFRLVACNSTSRRDGRPLQELGYYNPRTKETRLDAEALRERLGQGAQPTDAVRTLLEKGGLIEK 96
>gi|94969899|ref|YP_591947.1| SSU ribosomal protein S16P [Acidobacteria bacterium Ellin345] >gi|123381389|sp|Q1IMM7|RS16_ACIBL 30S ribosomal protein S16 >gi|94551949|gb|ABF41873.1| SSU ribosomal protein S16P [Acidobacteria bacterium Ellin345] (84 aa)
Score = 123, Expect = 1.5e-05, Identities = 34/70 (48%), Positives = 42/70 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFE--GVVNINEEIALSWLKKGAQPSDTVKNL 70
           M+ IRL+R G  K P +RIVVI+    RDG  +E VGTY P    G + +  E    W+ KGAQ SD VK L
  S:     1 MLMIRLSRRGARKQPHYRIVVIEKDRARDGRSVEVVGTYNPRTNPGSIELKRERVEYWVSKGAQMSDRVKKL 72
>gi|58700056|ref|ZP_00374603.1| ribosomal protein S16 [Wolbachia endosymbiont of Drosophila ananassae] >gi|58533429|gb|EAL57881.1| ribosomal protein S16 [Wolbachia endosymbiont of Drosophila ananassae] (58 aa)
Score = 123, Expect = 1.5e-05, Identities = 27/40 (67%), Positives = 31/40 (77%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP 41
           VKIRL R G  K PF+RIVV DSRA RDG +IEK+G Y+P
  S:     3 VKIRLARFGAKKRPFYRIVVADSRAPRDGRFIEKIGQYDP 42
>gi|117620936|ref|YP_855208.1| ribosomal protein S16 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166234387|sp|A0KG23|RS16_AERHH 30S ribosomal protein S16 >gi|117562343|gb|ABK39291.1| ribosomal protein S16 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (82 aa)
Score = 123, Expect = 1.5e-05, Identities = 31/73 (42%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEG----VVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE+VG + P        +N++      W+  GA  SD V  L+++
  S:     1 MVTIRLQRGGAKKRPFYQVVVADSRNARDGRFIERVGFFNPVASGNAEKLNLDLARIEHWVGTGAAVSDRVAKLIKD 77
>gi|85714454|ref|ZP_01045442.1| Ribosomal protein S16 [Nitrobacter sp. Nb-311A] >gi|85698901|gb|EAQ36770.1| Ribosomal protein S16 [Nitrobacter sp. Nb-311A] (110 aa)
Score = 122, Expect = 1.6e-05, Identities = 34/78 (43%), Positives = 45/78 (57%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN-----INEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
           V IRL R G  K P + +V  DSR  RDG +IE++G + P     N     ++ +   +WL KGAQPSD V   L   GV K+
  S:     3 VVIRLARAGTKKRPVYHVVAADSRYPRDGRFIERLGHFNPLMPKDNADRLKLDLDKVKAWLAKGAQPSDRVARFLDAAGVKKR 85
>gi|85058524|ref|YP_454226.1| 30S ribosomal protein S16 [Sodalis glossinidius str. 'morsitans'] >gi|109894804|sp|Q2NVK4|RS16_SODGM 30S ribosomal protein S16 >gi|84779044|dbj|BAE73821.1| 30S ribosomal protein S16 [Sodalis glossinidius str. 'morsitans'] (82 aa)
Score = 122, Expect = 1.6e-05, Identities = 31/73 (42%), Positives = 47/73 (64%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR  RDG +IE++G + P      EG + ++ +    W+ +GA  S+ V  L+++
  S:     1 MVTIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPIATGQAEG-LRLDLDRIEHWVGQGATVSERVSALIKD 77
>gi|88860521|ref|ZP_01135159.1| 30S ribosomal subunit protein S16 [Pseudoalteromonas tunicata D2] >gi|88817719|gb|EAR27536.1| 30S ribosomal subunit protein S16 [Pseudoalteromonas tunicata D2] (82 aa)
Score = 122, Expect = 1.7e-05, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR  RDG +IEKVG + P     E  + ++      W+ +GA  +D V  ++++
  S:     1 MVTIRLQRGGAKKRPFYQIVVADSRFSRDGRFIEKVGFFNPIAQGQEEKIRVDLTRVEHWVGQGASLTDRVAKIVKD 77
>gi|146312731|ref|YP_001177805.1| SSU ribosomal protein S16P [Enterobacter sp. 638] >gi|167011168|sp|A4WDH4|RS16_ENT38 30S ribosomal protein S16 >gi|145319607|gb|ABP61754.1| SSU ribosomal protein S16P [Enterobacter sp. 638] (82 aa)
Score = 121, Expect = 2.0e-05, Identities = 30/72 (41%), Positives = 42/72 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+++VV DSR  R+G +IE+VG + P          + L+    W+  GA  SD V  L++
  S:     1 MVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFNPLASGAEEETRLDLARVAHWVGLGATVSDRVAALIK 76
>gi|120599793|ref|YP_964367.1| 30S ribosomal protein S16 [Shewanella sp. W3-18-1] >gi|146292271|ref|YP_001182695.1| 30S ribosomal protein S16 [Shewanella putrefaciens CN-32] >gi|166201634|sp|A4Y4L3|RS16_SHEPC 30S ribosomal protein S16 >gi|166201636|sp|A1RMB8|RS16_SHESW 30S ribosomal protein S16 >gi|120559886|gb|ABM25813.1| ribosomal protein S16 [Shewanella sp. W3-18-1] >gi|145563961|gb|ABP74896.1| ribosomal protein S16 [Shewanella putrefaciens CN-32] (83 aa)
Score = 121, Expect = 2.1e-05, Identities = 30/73 (41%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV DSR  RDG +IE+VG + P     E  + ++      W+  GA  ++ V  L+++
  S:     1 MVTIRLARGGAKKRPFYNIVVADSRNARDGRFIERVGFFNPLARGQEETLRLDLARVEHWVSNGAATTERVAKLIKD 77
>gi|75676964|ref|YP_319385.1| 30S ribosomal protein S16 [Nitrobacter winogradskyi Nb-255] >gi|109894777|sp|Q3SNV8|RS16_NITWN 30S ribosomal protein S16 >gi|74421834|gb|ABA06033.1| SSU ribosomal protein S16P [Nitrobacter winogradskyi Nb-255] (110 aa)
Score = 121, Expect = 2.1e-05, Identities = 40/110 (36%), Positives = 59/110 (53%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVN-----INEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAAS 111
           V IRL R G  K P + +V  DSR  RDG +IE++G + P     N     ++ +   +WL KGAQPSD V   L   GV K+       + + +    V ++ +K +A+ AA S
  S:     3 VVIRLARAGTKKRPVYHVVAADSRYPRDGRFIERLGHFNPLMPKDNADRLKLDLDKVKAWLAKGAQPSDRVARFLDAAGVKKR-------TPRNNPVKAVPRKERKAQAEAAAKS 110
>gi|11467477|ref|NP_043623.1| ribosomal protein S16 [Odontella sinensis] >gi|1350877|sp|P49503|RR16_ODOSI Chloroplast 30S ribosomal protein S16 >gi|1185172|emb|CAA91655.1| 30S ribosomal protein S16 [Odontella sinensis] (79 aa)
Score = 121, Expect = 2.3e-05, Identities = 30/76 (39%), Positives = 45/76 (59%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           M+K+RL R GR K P +R+VV+++  RRDG  +E+VG Y         +      WL  GA+P+ TV NLL++  +
  S:     1 MLKLRLKRSGRKKQPSYRLVVMENTTRRDGRPVEQVGYYNTITKESYFDVIKIKKWLNYGAKPTQTVLNLLKKAKI 76
>gi|125811130|ref|XP_001361759.1| GA21001-PA [Drosophila pseudoobscura] >gi|54636935|gb|EAL26338.1| GA21001-PA [Drosophila pseudoobscura] (120 aa)
Score = 121, Expect = 2.3e-05, Identities = 31/73 (42%), Positives = 41/73 (56%)
  Q:     4 IRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGV 76
           IR  RLG    PF+ IVV++ R  +    IE+VG+Y+P      E +V +N E    WL KGA  SD    LL   G+
  S:    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSYDPLPNDFNERLVALNTERIRFWLGKGAHISDPAAELLGVAGL 97
>gi|54778769|gb|AAV39603.1| ribosomal protein S16 [synthetic construct] (109 aa)
Score = 121, Expect = 2.4e-05, Identities = 30/72 (41%), Positives = 44/72 (61%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           V IRL R G  K PF+++VV DSR  R+G +IE+VG + P     E    ++ +    W+ +GA  SD V  L++E
  S:    26 VTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKE 101
>gi|29653790|ref|NP_819482.1| ribosomal protein S16 [Coxiella burnetii RSA 493] >gi|154705981|ref|YP_001424967.1| ribosomal protein S16 [Coxiella burnetii Dugway 5J108-111] >gi|161349299|ref|ZP_02096684.1| ribosomal protein S16 [Coxiella burnetii 'MSU Goat Q177'] >gi|161830775|ref|YP_001596375.1| ribosomal protein S16 [Coxiella burnetii RSA 331] >gi|189044376|sp|A9KEE7|RS16_COXBN 30S ribosomal protein S16 >gi|189044377|sp|A9NBR1|RS16_COXBR 30S ribosomal protein S16 >gi|54039442|sp|Q83E83|RS16_COXBU 30S ribosomal protein S16 >gi|29541053|gb|AAO89996.1| ribosomal protein S16 [Coxiella burnetii RSA 493] >gi|154355267|gb|ABS76729.1| ribosomal protein S16 [Coxiella burnetii Dugway 5J108-111] >gi|161762642|gb|ABX78284.1| ribosomal protein S16 [Coxiella burnetii RSA 331] >gi|164601551|gb|EDQ95150.1| ribosomal protein S16 [Coxiella burnetii 'MSU Goat Q177'] (137 aa)
Score = 121, Expect = 2.4e-05, Identities = 34/73 (46%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+ IVV D R  RDG +IE+VG Y P     +  + + +E    WL +GAQ S  VK+L+++
  S:     1 MVVIRLARGGSKKNPFYHIVVADRRKPRDGRFIERVGYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIKK 77
>gi|51474045|ref|YP_067802.1| 30S ribosomal protein S16 [Rickettsia typhi str. Wilmington] >gi|81610740|sp|Q68VN6|RS16_RICTY 30S ribosomal protein S16 >gi|51460357|gb|AAU04320.1| 30S ribosomal protein S16 [Rickettsia typhi str. Wilmington] (111 aa)
Score = 121, Expect = 2.5e-05, Identities = 42/98 (42%), Positives = 61/98 (62%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS------WLKKGAQPSDTVKNLLREQGVW-----KKFMDSKVQSKKEHNANKVKKE 99
           VKIRL R G  K PF+R+V+ ++ A RDG ++EKVGTY P     N +E + L       WL  GA+P++ V   + + GV      KK M+ K +++K   + K  KE
  S:     3 VKIRLARGGAKKRPFYRVVIANATAPRDGDFLEKVGTYNPMLASDN-SERVVLKKDRIEYWLSTGAKPTERVAKFIEKAGVTLPKNVKKEMEVKAKNRKVRPSKKESKE 110
>gi|160900777|ref|YP_001566359.1| ribosomal protein S16 [Delftia acidovorans SPH-1] >gi|160366361|gb|ABX37974.1| ribosomal protein S16 [Delftia acidovorans SPH-1] (84 aa)
Score = 121, Expect = 2.6e-05, Identities = 31/73 (42%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALS----WLKKGAQPSDTVKNLLRE 73
           MV IRL+R G    PF+ IV  D R RRDG++IE++G Y P          +AL     W   GAQ S+T + L+++
  S:     1 MVVIRLSRGGSKARPFYNIVAADKRVRRDGSFIERLGFYNPNARGGEEGLRVALDRVNYWKGVGAQASETAERLIKQ 77
>gi|145588704|ref|YP_001155301.1| ribosomal protein S16 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|171463911|ref|YP_001798024.1| ribosomal protein S16 [Polynucleobacter necessarius STIR1] >gi|189029608|sp|A4SW73|RS16_POLSQ 30S ribosomal protein S16 >gi|145047110|gb|ABP33737.1| SSU ribosomal protein S16P [Polynucleobacter sp. QLW-P1DMWA-1] >gi|171193449|gb|ACB44410.1| ribosomal protein S16 [Polynucleobacter necessarius STIR1] (81 aa)
Score = 120, Expect = 2.7e-05, Identities = 31/72 (43%), Positives = 41/72 (56%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEP----FEGVVNINEEIALSWLKKGAQPSDTVKNLLR 72
           MV IRL R G  K PF+ IV  D R RRD  +IE++G + P     E  + I ++    W   GAQ S TV  L++
  S:     1 MVVIRLARGGSKKRPFYSIVATDKRNRRDSNFIERIGYFNPQAAATEQAMRIAQDRLTYWTGVGAQISPTVVRLIK 76
>gi|62858601|ref|NP_001016347.1| mitochondrial ribosomal protein S16 [Xenopus (Silurana) tropicalis] >gi|89266945|emb|CAJ81716.1| mitochondrial ribosomal protein S16 [Xenopus tropicalis] (141 aa)
Score = 120, Expect = 2.7e-05, Identities = 36/107 (33%), Positives = 55/107 (51%)
  Q:     2 VKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF-----EGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKA 108
           V IRL   G    PF+RIV   ++  RDG Y+E++GTY+P      E +V++N E    W+  GA  +  V  LL   G +       +      NA ++K+E +K    +A
  S:    17 VAIRLALAGCTNRPFYRIVAAHNKRARDGKYLEQLGTYDPMPNIYNEKLVSLNIEQIKYWIGCGAHTTKPVAKLLGLAGFF------PLHPMTITNAERLKREKEKQSNAEA 122
>gi|89075049|ref|ZP_01161490.1| putative ribosomal protein S16 [Photobacterium sp. SKA34] >gi|89049136|gb|EAR54701.1| putative ribosomal protein S16 [Photobacterium sp. SKA34] (82 aa)
Score = 120, Expect = 2.8e-05, Identities = 29/73 (39%), Positives = 45/73 (61%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR  RDG  IE++G + P     E  + ++ +    W+ +GA  +D  + L+++
  S:     1 MVTIRLARHGAKKRPFYQIVVADSRCSRDGRNIEQIGFFNPLAKGQEERLRLDLDRVNHWVGQGASVTDRAEKLIKD 77
>gi|54310151|ref|YP_131171.1| putative ribosomal protein S16 [Photobacterium profundum SS9] >gi|90414889|ref|ZP_01222854.1| putative ribosomal protein S16 [Photobacterium profundum 3TCK] >gi|81615022|sp|Q6LMV7|RS16_PHOPR 30S ribosomal protein S16 >gi|46914590|emb|CAG21369.1| putative ribosomal protein S16 [Photobacterium profundum SS9] >gi|90324003|gb|EAS40597.1| putative ribosomal protein S16 [Photobacterium profundum 3TCK] (83 aa)
Score = 120, Expect = 2.8e-05, Identities = 31/73 (42%), Positives = 43/73 (58%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR  RDG  IEK+G + P     E  + ++ +    W+  GA  SD    L+++
  S:     1 MVTIRLARHGAKKRPFYQIVVADSRCARDGRNIEKIGFFNPLAKGQEERLRLDLDRVNHWVGLGATVSDRTAKLIKD 77
>gi|72382691|ref|YP_292046.1| 30S ribosomal protein S16 [Prochlorococcus marinus str. NATL2A] >gi|109894783|sp|Q46JI5|RS16_PROMT 30S ribosomal protein S16 >gi|72002541|gb|AAZ58343.1| SSU ribosomal protein S16P [Prochlorococcus marinus str. NATL2A] (110 aa)
Score = 120, Expect = 2.9e-05, Identities = 37/116 (31%), Positives = 64/116 (55%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEVKKPEAKKAAASKPASK 116
           M+K+RL R G+ +   FR+V  +S +RRDG  ++++G Y P      ++ E   + L +GAQP+D V+ LL + G+ +K      + +      K K+E ++   KK AA+   S+
  S:     1 MIKLRLKRFGKKRETSFRLVACNSTSRRDGRPLQELGFYNPRTKETRLDTEALRTRLGQGAQPTDAVRTLLEKGGLLEK------KVRPAEVLGKQKQEKERSAKKKDAAASETSE 110
>gi|59711156|ref|YP_203932.1| 30S ribosomal protein S16 [Vibrio fischeri ES114] >gi|163730704|ref|ZP_02138176.1| 30S ribosomal protein S16 [Vibrio fischeri MJ11] >gi|75431794|sp|Q5E7F2|RS16_VIBF1 30S ribosomal protein S16 >gi|59479257|gb|AAW85044.1| 30S ribosomal subunit protein S16 [Vibrio fischeri ES114] >gi|161396101|gb|EDQ20398.1| 30S ribosomal protein S16 [Vibrio fischeri MJ11] (82 aa)
Score = 120, Expect = 3.0e-05, Identities = 32/73 (43%), Positives = 46/73 (63%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF++IVV DSR +  G YIEKVG + P     E  + ++ +    W+++GA  SD V  L+++
  S:     1 MVTIRLARHGAKKRPFYQIVVADSRFKATGRYIEKVGFFNPTAQGQEEGLRLDLDRVGHWVEQGAGLSDRVAKLVKD 77
>gi|109897898|ref|YP_661153.1| 30S ribosomal protein S16 [Pseudoalteromonas atlantica T6c] >gi|123360986|sp|Q15VI9|RS16_PSEA6 30S ribosomal protein S16 >gi|109700179|gb|ABG40099.1| SSU ribosomal protein S16P [Pseudoalteromonas atlantica T6c] (83 aa)
Score = 120, Expect = 3.0e-05, Identities = 30/73 (41%), Positives = 44/73 (60%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPF----EGVVNINEEIALSWLKKGAQPSDTVKNLLRE 73
           MV IRL R G  K PF+++VV DSR  RDG +IE +G + P     E  + ++ +    W+  GA  SD V  L+++
  S:     1 MVTIRLQRGGAKKRPFYQVVVADSRRSRDGRFIENIGFFNPTAQGQEERLRLDLDRVEHWVGNGAGLSDRVARLVKD 77
>gi|50293487|ref|XP_449155.1| unnamed protein product [Candida glabrata] >gi|49528468|emb|CAG62125.1| unnamed protein product [Candida glabrata] (121 aa)
Score = 120, Expect = 3.0e-05, Identities = 39/100 (39%), Positives = 56/100 (56%)
  Q:     1 MVKIRLTRLGRHKLPFFRIVVIDSRARRDGAYIEKVGTYEPFEGVVNINE---------EIALS------WLKKGAQPSDTVKNLLREQGVWKKFMDSKVQSKKEHNANKVKKEV 100
           +V+IRL R GR   P + IVV  S   RD   IE +GTY P    +  +E         E+AL       W+  GAQPSDTV  L ++ G+      +K  + +E    + +KE+
  S:     5 LVRIRLARFGRVNSPLYNIVVARSHKARDAKPIEVLGTYNPVPKPLKKSEVKKGVIPTKEVALDFDRAKYWIGVGAQPSDTVVRLFQKAGILGPEWGNKKSTLQERPTIQPRKEL 119