>gi|26553555|ref|NP_757489.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma penetrans HF-2] >gi|46577474|sp|Q8CXQ6|TRMD_MYCPE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|26453561|dbj|BAC43893.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma penetrans HF-2] (226 aa)
Score = 1074, Expect = 1.9e-115, Identities = 226/226 (100%), Positives = 226/226 (100%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN
  S:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
>gi|160915184|ref|ZP_02077397.1| hypothetical protein EUBDOL_01192 [Eubacterium dolichum DSM 3991] >gi|158432983|gb|EDP11272.1| hypothetical protein EUBDOL_01192 [Eubacterium dolichum DSM 3991] (240 aa)
Score = 656, Expect = 5.2e-67, Identities = 113/221 (51%), Positives = 169/221 (76%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKIT+++LF  +F+ F+ TSIIK+A+ +  V++E+VNFR+++ D H+ VDDTP GGGAGM+L++QP+ D +  ++  +S VV++TP GK ++Q +A +   ++EH+IL+CGHYEGFDERI +YVD E+S+GD++LTGGE AA+ I D++IRL+  VI  +S   +SF+N LL+YP YT+P  F+G +VP+VLLSG+H+ I K R +  + KTK+ R DL  K
  S:     1 MKITIVTLFPEYFDSFQTTSIIKRALEHQRVELELVNFRDYTLDKHHNVDDTPCGGGAGMLLSVQPVADCLKAIREKDSLVVMMTPQGKVFHQGLARELVGSYEHIILLCGHYEGFDERIRSYVDMELSLGDFVLTGGEAAALVISDALIRLVDGVIQEDSHLDDSFENGLLEYPQYTRPVEFDGQRVPDVLLSGHHENIRKWRLKESLRKTKLKRPDLLAK 222
>gi|26454675|sp|P75132|TRMD_MYCPN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) (231 aa)
Score = 621, Expect = 5.4e-63, Identities = 114/225 (50%), Positives = 159/225 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           MKITVL+LFE     + N SI+ +A    LV+ E++N+R + KD H  VDD  YGGG GMVL  +PI+ A+   +T  SKVVLL+P G+ ++Q +A      EHLILICGHYEGFD R+  +VD  IS+GD++L+GGE+ A++++D+ +RLI  VI+  SL  ESF+N LLD+P YT+PY+ +G KVPE+LLSG+HK+I   RKE Q+ +T   R DL+ +YL +
  S:     1 MKITVLTLFEQVVWPYLNASIMAQAQKAKLVEFEVINWRQYCKDKHQTVDDMAYGGGGGMVLKAEPILKALKACRTPQSKVVLLSPEGQQFSQPMAQALTQTEHLILICGHYEGFDYRLYKHVDQIISLGDFVLSGGELVALSVIDATVRLIKGVINDQSLIHESFNNYLLDFPAYTRPYDLDGDKVPEILLSGDHKKIEAYRKEQQLLRTAQYRPDLYKQYLAK 225
>gi|169350419|ref|ZP_02867357.1| hypothetical protein CLOSPI_01187 [Clostridium spiroforme DSM 1552] >gi|169292739|gb|EDS74872.1| hypothetical protein CLOSPI_01187 [Clostridium spiroforme DSM 1552] (239 aa)
Score = 620, Expect = 6.8e-63, Identities = 115/226 (50%), Positives = 157/226 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           MKI +L+LF   F  F NTSIIK+AI  NLVD+++ +FR FS D H  VDD PYGGG GMVL  +PI++ +  +   +S V+L++P G T+N  +A    T +HLI+ICGHYEGFDERI +YVD EISIGDY+LTGGE+++M + D++IRL+   I  +S + +SF   LL+YP YT+P  + G  VP+VLLSG+H+ I K RK   + +T + R DL  KY  +N
  S:     1 MKIDILTLFPEMFEGFLNTSIIKRAIEKNLVDVKLYDFREFSNDKHKHVDDYPYGGGQGMVLRCEPIIECLKTLVDDDSLVILMSPQGLTFNHALATTLSTKKHLIIICGHYEGFDERIRDYVDMEISIGDYVLTGGELSSMVVSDAIIRLLDGAIKEDSHQDDSFSQGLLEYPQYTRPQCYEGKSVPDVLLSGHHENIRKWRKYQSLKRTYLKRPDLLEKYEFDN 226
>gi|12045304|ref|NP_073115.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma genitalium G37] >gi|1351301|sp|P47683|TRMD_MYCGE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|3845038|gb|AAC72465.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma genitalium G37] >gi|166078918|gb|ABY79536.1| tRNA (guanine-N1)-methyltransferase [synthetic Mycoplasma genitalium JCVI-1.0] (231 aa)
Score = 618, Expect = 1.5e-62, Identities = 119/224 (53%), Positives = 163/224 (72%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MKITVL+LFEN    + N+SI+ +A   NLV  E+VN+RNF  D H  VDD  YGGG+GMVL  +PI++ +N  K  NS VVLL+P G+ ++Q  A +   +EHLIL+ GHYEGFD+RI  Y+D  +S+GD++L+GGE+ A++++D+ +RLI  VI+  SL  ESF++NLLD+P YT+PY+  G KVPEVLLSG+H++I   RKE QI KT   R DL+ KYL+
  S:     1 MKITVLTLFENTIWPYLNSSIMLQAQKANLVQFEVVNWRNFCNDKHKTVDDMAYGGGSGMVLKAEPIINCLNFYKAPNSHVVLLSPEGEQFSQNCAKKLTKYEHLILLSGHYEGFDQRIYKYIDQIVSLGDFVLSGGELVALSVIDATVRLIKGVINDQSLICESFNDNLLDFPVYTRPYDLKGDKVPEVLLSGDHQKIESFRKEQQILKTAKYRPDLYKKYLE 224
>gi|13358132|ref|NP_078406.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971254|ref|ZP_02553531.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168281924|ref|ZP_02689591.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308072|ref|ZP_02690747.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762374|ref|YP_001752652.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189036192|sp|B1AJK8|TRMD_UREP2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|26401023|sp|Q9PPS2|TRMD_UREPA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|11256647|pir||D82874 tRNA (guanine-N1)-methyltransferase UU567 [imported] - Ureaplasma urealyticum >gi|6899575|gb|AAF30981.1|AE002155_3 tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827951|gb|ACA33213.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902688|gb|EDT48977.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675915|gb|EDT87820.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701031|gb|EDU19313.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] (228 aa)
Score = 617, Expect = 1.9e-62, Identities = 125/223 (56%), Positives = 166/223 (74%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           MKI++LSLF   +  +   SII  AI NN V IE+++FR ++ D H KVDD  YGGGAGMVL ++PIV AI  +++SNS V+L TP G+ +NQ++AN F   ++H+I+I GHYEGFDERI  Y+D + SIGD++LTGGE+ +M I D+VIRL+  VIS +SLE+ESF+N LLDYP YT+P  F G+KVP++LLSG+HK I   RK+ Q   TK NR DL+ KYL
  S:     1 MKISILSLFPELYETWIKHSIISNAIKNNQVIIEVIDFRLYTNDKHKKVDDYQYGGGAGMVLRIEPIVAAIRAIRSSNSYVILTTPKGQVFNQELANNFVSKYDHIIIIAGHYEGFDERINYYIDAQYSIGDFVLTGGELPSMVISDAVIRLLDGVISPSSLETESFNNYLLDYPVYTRPLVFEGHKVPDILLSGHHKNIADFRKQQQETITKKNRPDLYQKYL 224
>gi|50365357|ref|YP_053782.1| tRNA guanine-N1-methyltransferase [Mesoplasma florum L1] >gi|84029225|sp|Q6F0S5|TRMD_MESFL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|50363913|gb|AAT75898.1| tRNA guanine-N1-methyltransferase [Mesoplasma florum L1] (243 aa)
Score = 609, Expect = 1.4e-61, Identities = 118/218 (54%), Positives = 159/218 (72%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK ++L+LF N    + + SIIKKA+    +++EI++ R+F+   HN+VD+  +GGG GMVL   P+V AI  VKT NS VVL +P GKT+NQ +A  F T + H+I++CGHYEGFDERI+ Y+D EISIGDY+LTGGE+ ++ +LDS+ R++P VI+  S E ESF+NNLLDYP YTKP+++ G KVPEVLLSG+H  I K R E Q+  T   R DL
  S:     1 MKYSILTLFPNIIKSYISESIIKKALEREKIELEIIDIRDFTTLPHNQVDEYQFGGGRGMVLMCDPVVSAIESVKTENSIVVLTSPQGKTWNQNLAKSFATEYNHIIIVCGHYEGFDERILKYIDVEISIGDYVLTGGELPSLIMLDSITRILPGVINTESHEQESFENNLLDYPVYTKPHDYRGDKVPEVLLSGHHANIQKWRDEQQLISTFNKRPDL 219
>gi|42560962|ref|NP_975413.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|84029228|sp|Q6MTI1|TRMD_MYCMS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|42492459|emb|CAE77055.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (240 aa)
Score = 608, Expect = 1.8e-61, Identities = 119/218 (54%), Positives = 163/218 (74%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK ++++LF    N +   SIIK+AI    + IEI++ RNFS  SHN+VDD  YGGG+GMVL ++P++ AI  VKT+ S V+L TP GKT NQ I   +   +EH+I++CGHYEG+DER+++Y+D EISIGDY++TGGE+A++ ++DS+ RL+PNVI   S E+ESF+NNLLD+P YTKPY F   KVP+VLLSG+H+ I K R+E Q+ KT   R DL
  S:     1 MKFSIITLFPKIINSYIEESIIKRAINKQAIKIEIIDLRNFSTLSHNQVDDYQYGGGSGMVLMIEPLIKAIESVKTTKSIVLLTTPQGKTLNQSIVKTYANNYEHIIIVCGHYEGYDERVLDYIDDEISIGDYVITGGELASLILVDSISRLLPNVIKQESHENESFENNLLDHPVYTKPYEFRNKKVPDVLLSGHHQNIKKWREEQQVIKTLKKRPDL 219
>gi|83319498|ref|YP_424516.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|119370973|sp|Q2SRU7|TRMD_MYCCT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|83283384|gb|ABC01316.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (240 aa)
Score = 603, Expect = 7.3e-61, Identities = 118/218 (54%), Positives = 163/218 (74%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK ++++LF    N +   SIIK+AI    + IEI++ RNFS  +HN+VDD  YGGG+GMVL ++P++ AI  VKT+ S V+L TP GKT NQ I   +   +EH+I++CGHYEG+DER+++Y+D EISIGDY++TGGE+A++ ++DS+ RL+PNVI   S E+ESF+NNLLD+P YTKPY F   KVP+VLLSG+H+ I K R+E Q+ KT   R DL
  S:     1 MKFSIITLFPKIINSYIEESIIKRAINKQAIQIEIIDLRNFSTLNHNQVDDYQYGGGSGMVLMIEPLIKAIESVKTTKSIVLLTTPQGKTLNQSIVKTYSNNYEHIIIVCGHYEGYDERVLDYIDDEISIGDYVITGGELASLILVDSISRLLPNVIKQESYENESFENNLLDHPVYTKPYEFRNKKVPDVLLSGHHQNIKKWREEQQVIKTLKKRPDL 219
>gi|167756887|ref|ZP_02429014.1| hypothetical protein CLORAM_02436 [Clostridium ramosum DSM 1402] >gi|167703062|gb|EDS17641.1| hypothetical protein CLORAM_02436 [Clostridium ramosum DSM 1402] (239 aa)
Score = 602, Expect = 9.0e-61, Identities = 114/222 (51%), Positives = 151/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F  F NTSIIK+AI   LV IE+ +FR FS D H  VDD PYGGG GMVL   PIV+ +  + T +S ++L++P G T N   A +    +HLI+ICGHYEGFDERI +YVD E+SIGDY+LTGGE+ +M + D+VIRL+   I  +S   +SF + LL+YP YT+P  ++G +VPEVL+SG+H+ I K RK   + KT + R DL   Y
  S:     1 MKIDILTLFPEMFTGFLNTSIIKRAIDKGLVTIELHDFREFSIDKHKHVDDYPYGGGQGMVLMCAPIVECLKTIATDDSFIILMSPQGITLNHGCAVELSAKKHLIIICGHYEGFDERIRDYVDMELSIGDYVLTGGELGSMVVSDAVIRLLDGAIKEDSHMDDSFSHGLLEYPQYTRPQCYDGNEVPEVLMSGHHENIRKWRKFQSLKKTYLKRPDLLESY 222
>gi|195962434|ref|ZP_03098639.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia spielmanii A14S] (239 aa)
Score = 602, Expect = 1.0e-60, Identities = 122/225 (54%), Positives = 160/225 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           MK TV+SLF      F   SI+KKAI   +V  E+VN R+FSKD H + DD PYGGGAGMVL  +P+  A+ HVK +    + L+PSG  Y Q++A+     E +++ICG YEG D+RI++ YVD+EISIGDY+L+ GEIAA+ ++DSV RLI  VI+ NSL  ESF   N LL+YP+YT+PY+F G KVPEVL+SG+H+ I   R    I KTK NR DL++KYLK+
  S:     1 MKFTVISLFPAIIKPFFENSIMKKAINKGIVSFELVNVRDFSKDKHKRCDDLPYGGGAGMVLRAEPMSFALEHVKATKKTTIFLSPSGIKYTQELAHSLSKREEIVIICGRYEGIDQRIMDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLIDGVINPNSLLEESFGIKNGLLEYPHYTRPYDFMGIKVPEVLISGHHENIKNWRLFKAIEKTKKNRYDLYLKYLKK 228
>gi|138894722|ref|YP_001125175.1| tRNA methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196247659|ref|ZP_03146361.1| tRNA (guanine-N1)-methyltransferase [Geobacillus sp. G11MC16] >gi|134266235|gb|ABO66430.1| tRNA methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196212443|gb|EDY07200.1| tRNA (guanine-N1)-methyltransferase [Geobacillus sp. G11MC16] (245 aa)
Score = 602, Expect = 1.0e-60, Identities = 116/222 (52%), Positives = 156/222 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +L+LF + F    N SI+KKA     V+I +VNFR F+ + H  VDD PYGGGAGMVL  QPI DA+ HV  ++  ++++LL P G+ Y Q+ A +    EHL+LICGHYEG+DERI  Y V  EISIGDYILTGGE+ AM I+DSV+RL+P V+ +  S   +SF + LL+YP YT+P +F G KVP+VLLSGNH+ I + R++  + +T   R DL + Y
  S:     2 MRIDILTLFPDMFPGVLNESILKKAQEKGAVNIRLVNFREFADNKHKTVDDYPYGGGAGMVLKPQPIFDAVEHVTAESPGARIILLCPQGERYTQKKAEELAKEEHLVLICGHYEGYDERIRQYLVTDEISIGDYILTGGELGAMVIVDSVVRLLPGVLGNEASPVDDSFSSGLLEYPQYTRPADFRGMKVPDVLLSGNHQLIAEWREKESLRRTVQKRPDLLVDY 227
>gi|195959367|ref|ZP_03095576.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia sp. SV1] (239 aa)
Score = 601, Expect = 1.1e-60, Identities = 123/224 (54%), Positives = 158/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TVLSLF      F   SI+KKAI   +V  E+V+ R+FSKD H + DD PYGGGAGMVL  +PI  A+ HVK++    + L+PSG  Y+Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPEVLLSG+H  I   R      KTK NR DL++KYL+
  S:     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGMVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVKSAKKTTIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYNFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKYLE 227
>gi|188159369|ref|ZP_02512576.2| tRNA (guanine-N1)-methyltransferase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (240 aa)
Score = 601, Expect = 1.1e-60, Identities = 120/218 (55%), Positives = 164/218 (75%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK ++++LF    N +   SIIK+AI    + IE+++ R+FS  SHN+VDD  YGGG+GMVL ++P++ AI  VKT+NS V+L TP GKT NQ I  ++    EH+I+ICGHYEG+DERI++Y+D EISIGDY++TGGE+A++ ++DS+ R+IPNVI   S E+ESF+NNLLD+P YTKPY F   KVP+VLLSG+H+ I K R+E Q+ KT   R DL
  S:     1 MKFSIITLFPKIINSYIEESIIKRAINKQAIQIEVIDLRDFSTLSHNQVDDYQYGGGSGMVLMIEPLIRAIESVKTTNSIVLLTTPQGKTLNQSIVKKYANNDEHIIIICGHYEGYDERILDYIDDEISIGDYVITGGELASLILVDSISRIIPNVIKQESHENESFENNLLDHPVYTKPYEFRNNKVPDVLLSGHHQNIKKWREEQQVIKTLKKRPDL 219
>gi|119953475|ref|YP_945684.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia turicatae 91E135] >gi|119862246|gb|AAX18014.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia turicatae 91E135] (239 aa)
Score = 600, Expect = 1.4e-60, Identities = 117/224 (52%), Positives = 160/224 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MKIT+LSLF +    F   SI+KK I+  ++  E+++ RNFS D H + DD PYGGGAGMVL  QPI  A+++V   +   + ++PSG  YNQ++A      + L++ICG YEG D+RII+ YVD+EIS+GDY+L+ GE+AA+ I+DSV RL+  VI+ NSL  ESF  +  LL+YP+YT+PY F G +VP VLLSG+H+EI K R    I KTK NR DL++KYL+
  S:     1 MKITILSLFPSIITPFFENSIMKKVISKGIISCEVISIRNFSDDKHKRCDDIPYGGGAGMVLKAQPISAALDYVNARSKTTIFVSPSGLKYNQKLAYDLSKKDELVIICGRYEGLDQRIIDLYVDFEISVGDYVLSSGEVAALVIIDSVYRLLEGVINPNSLLEESFSCECGLLEYPHYTRPYEFKGLEVPNVLLSGHHEEIRKWRFMKSIEKTKKNRYDLYLKYLE 227
>gi|167940769|ref|ZP_02527844.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 8] >gi|167958914|ref|ZP_02545986.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973210|ref|ZP_02555487.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974129|ref|ZP_02556406.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975478|ref|ZP_02557755.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988789|ref|ZP_02570460.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337882|ref|ZP_02694497.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 10] >gi|168362550|ref|ZP_02695729.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808094|ref|ZP_02829153.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 2] >gi|195867990|ref|ZP_03079986.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903266|gb|EDT49555.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208982|gb|EDU06025.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018675|gb|EDU56715.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998064|gb|EDU67161.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659965|gb|EDX53345.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660324|gb|EDX53585.1| tRNA (guanine-N1)-methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (228 aa)
Score = 598, Expect = 2.8e-60, Identities = 130/223 (58%), Positives = 167/223 (74%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           MKI++LSLF   +  + N SII  AI NN V IEI+NFR ++ D H KVDD  YGGGAGMVL ++PIV AI  ++T NS V+L TP G+ +NQ++AN+F   ++H+I+I GHYEGFDERI  YVD + SIGD++LTGGE+ +M I D+VIRL+  VIS +SLESESF+N LLDYP YT+P  F G++VP+VLLSG+HK I   RK+ Q   TK NR DL+ KYL
  S:     1 MKISILSLFPELYETWINHSIISNAIKNNQVTIEIINFRLYTNDKHKKVDDYQYGGGAGMVLMIEPIVSAIRAIRTPNSYVILTTPKGQVFNQELANEFVSKYDHIIIIAGHYEGFDERINYYVDAQYSIGDFVLTGGELPSMVISDAVIRLLDGVISSSSLESESFNNYLLDYPVYTRPVVFEGHQVPDVLLSGHHKNIADFRKQQQEMITKKNRPDLYQKYL 224
>gi|110004278|emb|CAK98616.1| probable trna guanine-n1--methyltransferase protein [Spiroplasma citri] (243 aa)
Score = 596, Expect = 4.3e-60, Identities = 118/220 (53%), Positives = 158/220 (71%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEH-LILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           K TVL+LF   FN F  TSIIKKA+   ++ I+IV+ R++S   H++VDD  YGGG GMVL ++P+V  I   +T +S  +LLTP GK Y Q+   QF    + LIL+CGHYEGFDER++ Y+DYE+SIGDYILTGGE+A+M ++DSV RL  NVI+  S  ++SF NNLLDYP YTKP  ++G+ VPEVLLSG+H++I + R+   + KT + R DL  K
  S:     3 KFTVLTLFPEMFNNFMTTSIIKKALCEKMITIKIVDIRDYSIGKHHQVDDYQYGGGEGMVLMIEPLVATIKAHQTKDSLTILLTPQGKQYVQEQVQQFAANNNDLILVCGHYEGFDERVLYYIDYELSIGDYILTGGELASMVVIDSVTRLCKNVINTQSHLNDSFSNNLLDYPVYTKPVEYDGHYVPEVLLSGHHQKIAQWREYEALKKTWLKRPDLLEK 223
>gi|78045134|ref|YP_360262.1| tRNA (guanine-N1)-methyltransferase [Carboxydothermus hydrogenoformans Z-2901] >gi|119382726|sp|Q3AC72|TRMD_CARHZ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|77997249|gb|ABB16148.1| tRNA (guanine-N1)-methyltransferase [Carboxydothermus hydrogenoformans Z-2901] (253 aa)
Score = 596, Expect = 5.0e-60, Identities = 114/219 (52%), Positives = 154/219 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF   F    N+SI+KKA    ++ I  +N R+F+ D H++ DD PYGGGAGMV+ ++PI+ A   +  +NS  ++L+P G+ +NQ++A +    EHLI ICGHYEG DER+    VD EISIGDYILTGGEIAAM I+D+V RL+P V+    S E ESF + LL+YP+YT+P NF G +VPEVLLSGNHK+I+  RK+  +  T   R+DL 
  S:     1 MKIDILTLFPEMFYGPLNSSILKKAQEKGIITINYINIRDFTTDRHHQADDKPYGGGAGMVMKVEPIIKAYEAIPKNNSFTIMLSPQGRKFNQKLARELSQKEHLIFICGHYEGIDERVRQLIVDEEISIGDYILTGGEIAAMVIIDAVARLVPGVLGDEVSAEEESFSDQLLEYPHYTRPRNFRGLEVPEVLLSGNHKKIDLWRKKQSLLNTLFRRRDLL 221
>gi|168579738|ref|ZP_02723734.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 72a] >gi|195955139|ref|ZP_03093832.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi CA-11.2a] (239 aa)
Score = 595, Expect = 5.5e-60, Identities = 122/224 (54%), Positives = 158/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TVLSLF      F   SI+KKAI   +V  E+V+ R+FSKD H + DD PYGGGAGMVL  +PI  A+ HV+++    + L+PSG  Y+Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPEVLLSG+H  I   R      KTK NR DL++KYL+
  S:     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVESTKKTTIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYNFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKYLE 227
>gi|168526081|ref|ZP_02719720.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 118a] >gi|195949024|ref|ZP_03090124.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi WI91-23] >gi|195950986|ref|ZP_03092083.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 29805] (239 aa)
Score = 594, Expect = 8.5e-60, Identities = 121/224 (54%), Positives = 159/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TVLSLF      F   SI+KKAI   +V+ E+V+ R+FSKD H + DD PYGGGAGMVL  +PI  A+ HV+++    + L+PSG  Y+Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PY+F G KVPEVLLSG+H  I   R      KTK NR DL++KYL+
  S:     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVNFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVESAKKTTIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYDFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKYLE 227
>gi|168692330|ref|ZP_02725122.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 94a] (239 aa)
Score = 594, Expect = 8.7e-60, Identities = 121/224 (54%), Positives = 158/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TVLSLF      F   SI+KKAI   +V  E+V+ R+FSKD H + DD PYGGGAGMVL  +PI  A+ HV+++    + L+PSG  Y+Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPE+LLSG+H  I   R      KTK NR DL++KYL+
  S:     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVESTKKTTIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYNFKGIKVPEILLSGHHANIKNWRLVKAREKTKKNRYDLYLKYLE 227
>gi|15595043|ref|NP_212832.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi B31] >gi|167931973|ref|ZP_02519060.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 156a] >gi|195941517|ref|ZP_03086899.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 80a] >gi|195960436|ref|ZP_03096641.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi 64b] >gi|3915146|sp|O51641|TRMD_BORBU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|2688630|gb|AAC67045.1| tRNA (guanine-N1)-methyltransferase (trmD) [Borrelia burgdorferi B31] (239 aa)
Score = 594, Expect = 8.9e-60, Identities = 121/224 (54%), Positives = 158/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TVLSLF      F   SI+KKAI   +V  E+V+ R+FSKD H + DD PYGGGAGMVL  +PI  A+ HV+++    + L+PSG  Y+Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PY+F G KVPEVLLSG+H  I   R      KTK NR DL++KYL+
  S:     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVESAKKTTIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYDFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKYLE 227
>gi|160947514|ref|ZP_02094681.1| hypothetical protein PEPMIC_01448 [Peptostreptococcus micros ATCC 33270] >gi|158446648|gb|EDP23643.1| hypothetical protein PEPMIC_01448 [Peptostreptococcus micros ATCC 33270] (230 aa)
Score = 591, Expect = 1.6e-59, Identities = 117/223 (52%), Positives = 160/223 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           +KIT+L+LF +F +  ++  ++ KAI   ++++EI+N R+FSKD HNKVDD  YGGGAGM++T+QP+ DAI   K  NSKVV L+P G+   Q    +    EHLI +CGHYEG D RII N+VD EIS+GDY++TGGEI AM ++D+V R++  V+ +  S  ++S  NNLL Y  +T+P NFNG +VPEVLLSGNHKEI K R+E  +  TK  R DL+ KY+
  S:     2 IKITILTLFPDFIDSIRSYGVLGKAIEKGVIELEILNIRDFSKDKHNKVDDEIYGGGAGMLMTVQPVFDAIKFSKKDNSKVVFLSPQGEVLTQNKCKELSKKEHLIFLCGHYEGIDSRIINNFVDEEISVGDYVVTGGEIPAMLLIDAVCRMVDGVLGNSESASTDSHYNNLLQYDVFTRPRNFNGIEVPEVLLSGNHKEIEKWREESSLENTKKKRPDLYEKYI 226
>gi|16800972|ref|NP_471240.1| hypothetical protein lin1906 [Listeria innocua Clip11262] >gi|26400801|sp|Q92AL6|TRMD_LISIN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|16414407|emb|CAC97136.1| trmD [Listeria innocua] (245 aa)
Score = 589, Expect = 2.6e-59, Identities = 112/222 (50%), Positives = 158/222 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LS+F + F+    +SIIKKAI N  V +E+ +FR +++  H  VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL   Y
  S:     1 MKIDILSIFPDMFSGVTGSSIIKKAIENERVAVEVTDFREYAEGKHQVVDDYPYGGGAGMLLKAQPIFDAVQAVKDKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLLKNY 228
>gi|31544829|ref|NP_853407.1| hypothetical protein MGA_0439 [Mycoplasma gallisepticum R] >gi|33860234|sp|Q9RDV3|TRMD_MYCGA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|31541675|gb|AAP56975.1| TrmD [Mycoplasma gallisepticum R] (234 aa)
Score = 589, Expect = 2.9e-59, Identities = 117/222 (52%), Positives = 164/222 (73%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK------VVLLTPSGKTYNQQIANQFKTFEH-LILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI VL+LF++F   + + SIIK A+    V++E++NFR ++ D H  VDDT YGG AGM+L L+P+V+ +  +K +  K        LL+P G+ Y+Q  A      +H LILI G YEGFDERI +YVD  +S+GD+++TGGE+AA+ ++DS++RL+PNVI+ +SL SESF+N LLDYP YTKPY+F GYKVP+VLLSGNH+ I    ++  IN TK+ R DL++KY
  S:     1 MKIVVLTLFDDFVRSYYDFSIIKNALDKKAVELEVINFRQYANDKHKTVDDTIYGGSAGMLLKLEPLVNCLRDIKQNQFKDPNKIRTYLLSPQGEVYDQNKAVALSQSDHDLILIAGRYEGFDERIYHYVDGALSVGDFVITGGELAALIVVDSIVRLLPNVINKDSLSSESFNNYLLDYPMYTKPYDFEGYKVPDVLLSGNHQAIAAFNQQEAINNTKMKRPDLYLKY 229
>gi|16803832|ref|NP_465317.1| hypothetical protein lmo1792 [Listeria monocytogenes EGD-e] >gi|47097597|ref|ZP_00235124.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes str. 1/2a F6854] >gi|153174999|ref|ZP_01930420.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL N3-165] >gi|153186693|ref|ZP_01936898.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes J0161] >gi|153191275|ref|ZP_01938523.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes J2818] >gi|153198548|ref|ZP_01942519.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes 10403S] >gi|26400779|sp|Q8Y6A3|TRMD_LISMO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|16411246|emb|CAC99870.1| trmD [Listeria monocytogenes] >gi|47014028|gb|EAL05034.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes str. 1/2a F6854] >gi|126940980|gb|EBA18883.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes J0161] >gi|127631927|gb|EBA21652.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes 10403S] >gi|127765312|gb|EBA25661.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes J2818] >gi|133729782|gb|EBA31480.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL N3-165] (245 aa)
Score = 589, Expect = 3.3e-59, Identities = 113/222 (50%), Positives = 158/222 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK +NQ++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL   Y
  S:     1 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFNQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLLKNY 228
>gi|169342743|ref|ZP_02863783.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens C str. JGS1495] >gi|169299249|gb|EDS81319.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens C str. JGS1495] (236 aa)
Score = 588, Expect = 3.7e-59, Identities = 117/226 (51%), Positives = 160/226 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF--IKYLKEN 226
           MKI +L+LF   F+ FK+ SII +A  N  + IE VN R+++ + H KVDD PYGGGAGMV+T QPIVDAI  VK  N  KV+ L P GKT+NQ++A +    E LI +CGHYEG D+R+  Y D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S  S + ES+ +  L+YP YT+P+ F G KVPEVL+SG+H+ I K R++  +  TK  R D+F  IK  KE+
  S:     1 MKINILTLFPEMFDIFKH-SIIGRARENGFLHIETVNIRDYTLNKHKKVDDYPYGGGAGMVMTPQPIVDAIKAVKEKNKGKVIFLGPRGKTFNQEMAKELSKEEELIFVCGHYEGIDQRVYKYFDLEISLGDFVLTGGEMACIPVIDSISRLVPGVLGSEESFQDESYYDGTLEYPQYTRPFEFEGEKVPEVLMSGHHENIRKWRRKQSLLITKERRPDMFEKIKLSKED 229
>gi|116873227|ref|YP_850008.1| tRNA (guanine-N1)-methyltransferase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466440|sp|A0AJP7|TRMD_LISW6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|116742105|emb|CAK21229.1| trmD [Listeria welshimeri serovar 6b str. SLCC5334] (245 aa)
Score = 588, Expect = 3.7e-59, Identities = 112/222 (50%), Positives = 159/222 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LS+F + F+     SIIKKAI N  V++E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL   Y
  S:     1 MKIDILSIFPDMFSGVTGNSIIKKAIENERVEVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLLKNY 228
>gi|193216616|ref|YP_001999858.1| tRNA (Guanine-1)-methyltransferase [Mycoplasma arthritidis 158L3-1] >gi|193001939|gb|ACF07154.1| tRNA (Guanine-1)-methyltransferase [Mycoplasma arthritidis 158L3-1] (228 aa)
Score = 588, Expect = 4.0e-59, Identities = 116/221 (52%), Positives = 157/221 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFD-NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI +LSLF  +F  F+  S+I KAI    ++I ++NFR+FSK+ H KVDDT YGGG GM+L ++PI  A+  V   NS  +LL+P G+ +NQ  A++    + + L+CGHYEGFDER++ +VD E+S+GD+ILTGGEI AM I ++V RL+P V+   S E+ESF+ + LLDYP YTKP  + G KVPEVLLSGNH  I++ RKE   +KT  NRKD+  K
  S:     1 MKINILSLFPEYFKAFQENSMIAKAIKLGHLEINVINFRDFSKEKHQKVDDTVYGGGDGMLLQVEPIDLALESV--PNSYKILLSPQGQVFNQTKAHELAKHQEITLVCGHYEGFDERVLEFVDEELSVGDFILTGGEIPAMLITEAVARLVPGVLKKGSHENESFEGDGLLDYPQYTKPAIYKGLKVPEVLLSGNHALIDRWRKEASYSKTLKNRKDILAK 220
>gi|6601575|gb|AAF19036.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma gallisepticum] (234 aa)
Score = 587, Expect = 4.8e-59, Identities = 118/222 (53%), Positives = 165/222 (74%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAI-----NHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEH-LILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI VL+LF++F   + + SII+ A+    V++E++NFR ++ D H  VDDT YGG AGM+L L+P+V+ +     N  K SN  +  LL+P G+ Y+Q  A      +H LILI G YEGFDERI +YVD  +S+GD+++TGGE+AA+ ++DS++RL+PNVI+ +SL SESF+N LLDYP YTKPY+F GYKVP+VLLSGNH+ I    ++  IN TK+ R DL++KY
  S:     1 MKIVVLTLFDDFVRSYYDFSIIRNALDKKAVELEVINFRQYANDKHKTVDDTIYGGSAGMLLKLEPLVNCLRDIKQNQFKDSNKIRTYLLSPQGEVYDQNKAVALSQSDHDLILIAGRYEGFDERIYHYVDGALSVGDFVITGGELAALIVVDSIVRLLPNVINKDSLSSESFNNYLLDYPMYTKPYDFEGYKVPDVLLSGNHQAIAAFNQQEAINNTKMKRPDLYLKY 229
>gi|167454362|ref|ZP_02320585.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL J2-064] (245 aa)
Score = 587, Expect = 4.9e-59, Identities = 112/222 (50%), Positives = 159/222 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I++ R +  + +T   R DL   Y
  S:     1 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIDEWRDKESLKRTYERRPDLLKNY 228
>gi|110799681|ref|YP_696396.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium perfringens ATCC 13124] >gi|168210658|ref|ZP_02636283.1| tRNA -methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|182625870|ref|ZP_02953636.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens D str. JGS1721] >gi|118575138|sp|Q0TPP4|TRMD_CLOP1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|110674328|gb|ABG83315.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens ATCC 13124] >gi|170711257|gb|EDT23439.1| tRNA -methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|177908904|gb|EDT71396.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens D str. JGS1721] (236 aa)
Score = 587, Expect = 5.3e-59, Identities = 116/226 (51%), Positives = 160/226 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF--IKYLKEN 226
           MKI +L+LF   F+ FK+ SII +A  N  + IE VN R+++ + H KVDD PYGGGAGMV+T QP+VDAI  VK  N  KV+ L P GKT+NQ++A +    E LI +CGHYEG D+R+  Y D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S  S + ES+ +  L+YP YT+P+ F G KVPEVL+SG+H+ I K R++  +  TK  R D+F  IK  KE+
  S:     1 MKINILTLFPEMFDIFKH-SIIGRARENGFLHIETVNIRDYTLNKHKKVDDYPYGGGAGMVMTPQPVVDAIKAVKEKNKGKVIFLGPRGKTFNQEMAKELSKEEELIFVCGHYEGIDQRVYKYFDLEISLGDFVLTGGEMACIPVIDSISRLVPGVLGSEESFQDESYYDGTLEYPQYTRPFEFEGEKVPEVLMSGHHENIRKWRRKQSLLITKERRPDMFEKIKLSKED 229
>gi|15615042|ref|NP_243345.1| tRNA methyltransferase [Bacillus halodurans C-125] >gi|18203169|sp|Q9KA15|TRMD_BACHD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|10175099|dbj|BAB06198.1| tRNA methyltransferase [Bacillus halodurans C-125] (246 aa)
Score = 586, Expect = 5.8e-59, Identities = 111/219 (50%), Positives = 154/219 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI  L+LF   F    ++SI+K+A     V   +VNFR +S++ H KVDD PYGGGAGMVL+ QP+ DA+  +    +S  +V+L+ P G+T+ Q+ A +    EHLIL+CGHYEG+DERI +Y V  E+SIGDY+LTGGE+ AM I DSV RL+P V+ +  S +++SF   LL+YP YT+P +F G+KVP+VLLSG+H+ I + RKE  + +T   R DL 
  S:     1 MKIDFLTLFPEMFQGVLHSSILKQAQERGAVSFRVVNFREYSENKHKKVDDYPYGGGAGMVLSPQPLFDAVEDLTKKSSSTPRVILMCPQGETFTQRKAEELAQAEHLILLCGHYEGYDERIRSYLVTDELSIGDYVLTGGELGAMVIADSVTRLLPAVLGNETSAQTDSFSTGLLEYPQYTRPADFRGWKVPDVLLSGHHQNIERWRKEQSLKRTLERRPDLL 224
>gi|15828939|ref|NP_326299.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma pulmonis UAB CTIP] >gi|26400825|sp|Q98Q98|TRMD_MYCPU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|14089882|emb|CAC13641.1| TRNA (GUANINE-N1)-METHYLTRANSFERASE (M1G-METHYLTRANSFERASE) (TRNA [GM37] METHYLTRANSFERASE) [Mycoplasma pulmonis] (225 aa)
Score = 586, Expect = 5.9e-59, Identities = 118/225 (52%), Positives = 160/225 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           +KI  L++F  +F+ F   SII KAI    + I +++FR FS++ H KVDD+ YGGG GM+L +QPI  A+   KT     +L++P GK +NQ+IA +  K    +  + G YEGFDERI+NY+D E+SIGDYILTGGE+ +M + DS+IRL  +VI   S E+ESF+NNLLDYP YT+P  F G++VPE+LL+GNHKEI K RK+ QI KTKINR DL+ ++  E
  S:     2 LKINFLTIFPKYFDCFLKESIIGKAIERKKISINVIDFREFSENKHKKVDDSVYGGGQGMLLQVQPIAKAL---KTLKGLKILVSPQGKLFNQEIAKEIVKNHSEITFVSGRYEGFDERILNYIDIELSIGDYILTGGELPSMVMADSIIRLWEDVIKKESYENESFENNLLDYPQYTRPRVFEGFEVPEILLNGNHKEIEKWRKQKQIEKTKINRPDLYERFKNE 224
>gi|167933453|ref|ZP_02520528.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi ZS7] >gi|167943632|ref|ZP_02530706.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia burgdorferi Bol26] (239 aa)
Score = 586, Expect = 6.2e-59, Identities = 120/224 (53%), Positives = 158/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TVLSLF      F   SI+KKAI   +V  E+V+ R+FSK+ H + DD PYGGGAGMVL  +PI  A+ HV+++    + L+PSG  Y+Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PY+F G KVPEVLLSG+H  I   R      KTK NR DL++KYL+
  S:     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVSFELVDVRDFSKNKHKRCDDLPYGGGAGMVLKAEPISFALEHVESTKKTTIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYDFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKYLE 227
>gi|110802605|ref|YP_698996.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium perfringens SM101] >gi|118575139|sp|Q0SSB1|TRMD_CLOPS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|110683106|gb|ABG86476.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens SM101] (236 aa)
Score = 586, Expect = 6.9e-59, Identities = 118/226 (52%), Positives = 160/226 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF--IKYLKEN 226
           MKI +L+LF   F+ FK+ SII +A  N  + IE VN R+++ + H KVDD PYGGGAGMV+T QPIVDAI  VK  N  KV+ L P GKT+NQ++A +    E LI +CGHYEG D+RI  Y D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S  S + ES+ +  L+YP YT+P+ F G KVPEVL+SG+H+ I K R++  +  TK  R D+F  IK  KE+
  S:     1 MKINILTLFPEMFDIFKH-SIIGRARENGFLHIETVNIRDYTLNKHKKVDDYPYGGGAGMVMTPQPIVDAIKAVKEKNKGKVIFLGPRGKTFNQEMAKELSKEEELIFVCGHYEGIDQRIYKYFDLEISLGDFVLTGGEMACIPVIDSISRLVPGVLGSEESFQDESYYDGTLEYPQYTRPFEFEGEKVPEVLISGHHENIRKWRRKESLLITKERRPDMFEKIKLSKED 229
>gi|168216996|ref|ZP_02642621.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens NCTC 8239] >gi|182380938|gb|EDT78417.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens NCTC 8239] (236 aa)
Score = 586, Expect = 7.5e-59, Identities = 116/226 (51%), Positives = 160/226 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF--IKYLKEN 226
           MKI +L+LF   F+ FK+ SII +A  N  + IE VN R+++ + H KVDD PYGGGAGMV+T QP+VDAI  VK  N  KV+ L P GKT+NQ++A +    E LI +CGHYEG D+R+  Y D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S  S + ES+ +  L+YP YT+P+ F G KVPEVL+SG+H+ I K R++  +  TK  R D+F  IK  KE+
  S:     1 MKINILTLFPEMFDIFKH-SIIGRARENGFLHIETVNIRDYTLNKHKKVDDYPYGGGAGMVMTPQPVVDAIKAVKEKNKGKVIFLGPRGKTFNQEMAKELSKEEELIFVCGHYEGIDQRVYKYFDLEISLGDFVLTGGEMACIPVIDSISRLVPGVLGSEESFQDESYYDGTLEYPQYTRPFEFEGEKVPEVLMSGHHENIRKWRRKESLLITKERRPDMFEKIKLSKED 229
>gi|168207940|ref|ZP_02633945.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens E str. JGS1987] >gi|170660757|gb|EDT13440.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens E str. JGS1987] (236 aa)
Score = 586, Expect = 7.5e-59, Identities = 115/226 (50%), Positives = 161/226 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF--IKYLKEN 226
           MKI +L+LF   F+ FK+ SII +A  N  + IE VN R+++ + H KVDD PYGGGAGMV+T QP+VDAI  VK  N  KV+ L P GKT+NQ++A +    E LI +CGHYEG D+R+  Y D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S +S + ES+ +  L+YP YT+P+ F G K+PEVL+SG+H+ I K R++  +  TK  R D+F  IK  KE+
  S:     1 MKINILTLFPEMFDIFKH-SIIGRARENGFLHIETVNIRDYTLNKHKKVDDYPYGGGAGMVMTPQPVVDAIKAVKEKNKGKVIFLGPRGKTFNQEMAKELSKEEELIFVCGHYEGIDQRVYKYFDLEISLGDFVLTGGEMACIPVIDSISRLVPGVLGSEDSFQDESYYDGTLEYPQYTRPFEFEGEKIPEVLMSGHHENIRKWRRKESLLITKERRPDMFEKIKLSKED 229
>gi|46908024|ref|YP_014413.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes str. 4b F2365] >gi|47094471|ref|ZP_00232149.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes str. 4b H7858] >gi|153167601|ref|ZP_01927741.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL N1-017] >gi|153202767|ref|ZP_01944230.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes HPB2262] >gi|167014977|ref|ZP_02277510.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL J1-194] >gi|167217801|ref|ZP_02287437.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL J1-175] >gi|84029223|sp|Q71YM4|TRMD_LISMF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46881294|gb|AAT04590.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes str. 4b F2365] >gi|47017154|gb|EAL08009.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes str. 4b H7858] >gi|133726880|gb|EBA28578.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL N1-017] >gi|133735085|gb|EBA36783.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes HPB2262] (245 aa)
Score = 585, Expect = 7.6e-59, Identities = 112/222 (50%), Positives = 158/222 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL   Y
  S:     1 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLLKNY 228
>gi|147668964|ref|YP_001213782.1| tRNA (Guanine37-N1) methyltransferase [Dehalococcoides sp. BAV1] >gi|189036080|sp|A5FSB5|TRMD_DEHSB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|146269912|gb|ABQ16904.1| tRNA (Guanine37-N1) methyltransferase [Dehalococcoides sp. BAV1] (248 aa)
Score = 585, Expect = 7.8e-59, Identities = 110/221 (49%), Positives = 159/221 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI VL+LF   F      SI K+A  NNLV +EI NFR+F+ D H+ VDD+PYGGGAGM+L  +P+ +A+  V     + + V+LL+P G+++NQ++A +    E LI+ICGHYEGFDER+  ++   EISIGD++LTGGE+AAM ++D+V RLIP V+ S  S + +S  N LL++P+YT+P  F G+ +P+VLLSGNH +IN+ R++  + +T   R D+F K
  S:     1 MKIDVLTLFPEMFQSPFEESIFKRATDNNLVRLEIHNFRDFAHDKHHAVDDSPYGGGAGMLLKPEPLFEAVEDVLREDPTPAPVILLSPQGRSFNQEVARELAKHERLIIICGHYEGFDERVREHLSTDEISIGDFVLTGGELAAMVVIDAVSRLIPGVLGSGESSQDDSHSNGLLEHPHYTRPPVFRGWGIPDVLLSGNHAQINRWRRKESLRRTLKRRPDMFEK 226
>gi|167575686|ref|ZP_02368560.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia valaisiana VS116] (239 aa)
Score = 585, Expect = 9.0e-59, Identities = 119/224 (53%), Positives = 159/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TV+SLF      F   SI+KKAI   +V+ E+++ R+FSK+ H + DD PYGGGAGMVL  +PI  A+ HV+ +    + L+PSGK Y Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPEVL+SG+H+ I   R      KTK NR DL++KYL+
  S:     1 MKFTVISLFPAIIKPFFENSIMKKAINKGIVNFELIDVRDFSKNKHKRCDDLPYGGGAGMVLKAEPISFALEHVEATKKTTIFLSPSGKKYTQELAYSLSKEEEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYNFMGIKVPEVLVSGHHENIRNWRLFKAREKTKKNRYDLYLKYLE 227
>gi|73748189|ref|YP_307428.1| tRNA (guanine-N1)-methyltransferase [Dehalococcoides sp. CBDB1] >gi|119382734|sp|Q3ZZA6|TRMD_DEHSC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|73659905|emb|CAI82512.1| tRNA (guanine-N1)-methyltransferase [Dehalococcoides sp. CBDB1] (248 aa)
Score = 584, Expect = 9.9e-59, Identities = 109/221 (49%), Positives = 159/221 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI VL+LF   F      SI K+A  NNLV +EI NFR+F+ D H+ VDD+PYGGGAGM+L  +P+ +A+  V     + + ++LL+P G+++NQ++A +    E LI+ICGHYEGFDER+  ++   EISIGD++LTGGE+AAM ++D+V RLIP V+ S  S + +S  N LL++P+YT+P  F G+ +P+VLLSGNH +IN+ R++  + +T   R D+F K
  S:     1 MKIDVLTLFPEMFQSPFEESIFKRATDNNLVRLEIYNFRDFAHDKHHAVDDSPYGGGAGMLLKPEPLFEAVEDVLREDPTPAPIILLSPQGRSFNQEVARELAKHERLIIICGHYEGFDERVREHLATDEISIGDFVLTGGELAAMVVIDAVSRLIPGVLGSGESSQDDSHSNGLLEHPHYTRPPVFRGWGIPDVLLSGNHAQINRWRRKESLRRTLKRRPDMFEK 226
>gi|18310691|ref|NP_562625.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium perfringens str. 13] >gi|26400770|sp|Q8XJP7|TRMD_CLOPE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|18145372|dbj|BAB81415.1| tRNA (guanine-N1)-methyltransferase [Clostridium perfringens str. 13] (236 aa)
Score = 584, Expect = 1.1e-58, Identities = 114/226 (50%), Positives = 160/226 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF--IKYLKEN 226
           MKI +L+LF   F+ FK+ SII +A  N  + IE +N R+++ + H KVDD PYGGGAGMV+T QP+VDAI  VK  N  KV+ L P GKT+NQ++A +    E L+ +CGHYEG D+R+  Y D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S  S + ES+ +  L+YP YT+P+ F G KVPEVL+SG+H+ I K R++  +  TK  R D+F  IK  KE+
  S:     1 MKINILTLFPEMFDIFKH-SIIGRARENGFLHIETINIRDYTLNKHKKVDDYPYGGGAGMVMTPQPVVDAIKAVKEKNKGKVIFLGPRGKTFNQEMAKELSKEEELVFVCGHYEGIDQRVYKYFDLEISLGDFVLTGGEMACIPVIDSISRLVPGVLGSEESFQDESYYDGTLEYPQYTRPFEFEGEKVPEVLMSGHHENIRKWRRKQSLLITKERRPDMFEKIKLSKED 229
>gi|111115530|ref|YP_710148.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia afzelii PKo] >gi|167942416|ref|ZP_02529490.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia afzelii ACA-1] >gi|110890804|gb|ABH01972.1| tRNA guanine-N1 methyltransferase [Borrelia afzelii PKo] (239 aa)
Score = 584, Expect = 1.2e-58, Identities = 118/224 (52%), Positives = 158/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TV+SLF      F   SI+KKAI   +V  E+V+ R+FSKD H + DD PYGGGAGMVL  +P+  A+ HV+ +    + L+PSG  Y Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEI+A+ ++DS+ RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPEVL+SG+H+ I   R    I KTK NR DL++KYL+
  S:     1 MKFTVISLFPVIIKPFFENSIMKKAINKGIVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPMFFALEHVEAAKKTTIFLSPSGIKYTQELAYSLSKKEEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEISALVLIDSIYRLLDGVINPNSLLEESFGMKNGLLEYPHYTRPYNFMGIKVPEVLVSGHHENIKNWRLLKAIEKTKKNRYDLYLKYLE 227
>gi|167344023|ref|ZP_02289864.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL J1-208] (229 aa)
Score = 583, Expect = 1.3e-58, Identities = 111/219 (50%), Positives = 157/219 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL 
  S:     1 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLL 225
>gi|56419736|ref|YP_147054.1| tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) [Geobacillus kaustophilus HTA426] >gi|84029214|sp|Q5L0P4|TRMD_GEOKA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|56379578|dbj|BAD75486.1| tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) [Geobacillus kaustophilus HTA426] (244 aa)
Score = 583, Expect = 1.3e-58, Identities = 111/222 (50%), Positives = 155/222 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +L+LF   F+   + SI+KKA     VDI +++FR F+ + H  VDD PYGGGAGMVL  QPI DA+ HV   +  ++++LL P G+ Y Q+ A +     HL+LICGHYEG+DERI  Y+   EISIGDYILTGGE+ AM I+DSV+RL+P V+ +  S   +SF + LL+YP YT+P +F G KVP++LLSGNH+ I + R++  + +T + R DL  +Y
  S:     1 MRIDILTLFPGMFSGVLSESILKKAQEKGAVDIRLIDFREFADNKHKTVDDYPYGGGAGMVLKPQPIFDAVEHVTAGSPGARIILLCPQGERYTQKKAEELAKETHLVLICGHYEGYDERIRQYLATDEISIGDYILTGGELGAMVIVDSVVRLLPGVLGNEASPVDDSFSSGLLEYPQYTRPADFRGMKVPDILLSGNHQLIAEWREKESLRRTFLRRPDLLDEY 226
>gi|28210937|ref|NP_781881.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium tetani E88] >gi|38258551|sp|Q895M2|TRMD_CLOTE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|28203376|gb|AAO35818.1| tRNA (guanine-N1)-methyltransferase [Clostridium tetani E88] (239 aa)
Score = 582, Expect = 2.0e-58, Identities = 117/221 (52%), Positives = 160/221 (72%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN-SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           +I +L+LF + FN F N SI+ KA+  ++++I  +N R+F++D H KVDD PYGGGAGMV++LQPIVD++  VK SN  KV+ L P GKT++ ++A +    E LI +CGHYEG DER  +Y+D EIS+GD+ILTGGE+A + I+DS+ RLIP V+  N S   ESF   LL+YP+YT+P NF G +VP++LLSG+H+ I K RK   +  TK  R DLF KY
  S:     4 RIDILTLFPDMFNIF-NHSIMGKALEKDIININTINIRDFTEDKHKKVDDYPYGGGAGMVMSLQPIVDSLKRVKESNRGKVIFLGPRGKTFSHEMAKELSKEEELIFLCGHYEGIDERCYDYIDLEISLGDFILTGGEMACIPIVDSICRLIPGVLGKNESFMEESFYEGLLEYPHYTRPENFKGKEVPKILLSGHHENIRKWRKSKSLKITKKRRPDLFKKY 225
>gi|168266213|ref|ZP_02688178.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL J2-071] (242 aa)
Score = 582, Expect = 2.2e-58, Identities = 112/222 (50%), Positives = 158/222 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL   Y
  S:     1 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRVKESLKRTYERRPDLLKNY 228
>gi|195947707|ref|ZP_03088893.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia garinii PBr] (239 aa)
Score = 582, Expect = 2.2e-58, Identities = 118/224 (52%), Positives = 157/224 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TV+SLF      F   SI+KKAI   +V  E+++ R+FSKD H + DD PYGGGAGMVL  +P+  A+ HV+ +    + L+PSG  Y Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPEVL+SG+H+ I   R      KTK NR DL++KYL+
  S:     1 MKFTVISLFPAIIKPFFENSIMKKAIDKGIVSFELIDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPMYFALEHVEATKKTTIFLSPSGIKYTQELAYSLSKKEEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGVKNGLLEYPHYTRPYNFMGIKVPEVLVSGHHENIKNWRLFKAKEKTKKNRYDLYLKYLE 227
>gi|171326474|ref|ZP_02914947.1| tRNA (guanine-N1)-methyltransferase [Geobacillus sp. WCH70] >gi|171087549|gb|EDT33927.1| tRNA (guanine-N1)-methyltransferase [Geobacillus sp. WCH70] (245 aa)
Score = 581, Expect = 2.9e-58, Identities = 112/222 (50%), Positives = 156/222 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK--TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +L+LF N F    N SI+KKA     V + ++NFR+F+ + H  VDD PYGGGAGMVL  QPI DA+ +V   + + +++LL P G+ Y Q+ A +    +HL+LICGHYEG+DERI  Y V  EISIGDY+LTGGE+ AM I+DSV+RL+P V+ +  S   +SF + LL++P+YT+P +F G KVPEVLLSGNH+ I + R++  + +T + R DL   Y
  S:     2 MRIDILTLFPNMFTGVFNESILKKAQEKKAVSLNVINFRDFADNKHKTVDDYPYGGGAGMVLKPQPIFDAVAYVTKYSEHPRIILLCPQGERYTQKKAEELAKEDHLVLICGHYEGYDERIREYLVTDEISIGDYVLTGGELGAMVIVDSVVRLLPGVLGNEASPVHDSFSSGLLEHPHYTRPADFRGMKVPEVLLSGNHRLIEEWREKQSLKRTFLRRPDLLENY 227
>gi|187933965|ref|YP_001885447.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum B str. Eklund 17B] >gi|187722118|gb|ACD23339.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum B str. Eklund 17B] (238 aa)
Score = 579, Expect = 4.1e-58, Identities = 112/219 (51%), Positives = 157/219 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI++L+LF   F+ F N SII +A  NN+V++E++N R+ + D H KVDD PYGGGAGMV+  QPI+D I   K +N  KV+ L P GKT+NQ++A      E+LI +CGHYEG DER+  ++D E+S+GD+ILTGGE+AA+ ++DS++RLIP V+    S   ESF  +LL+YP YT+PY F G  VPE+LLSG+H+ I K R+   ++ T+  R DL+
  S:     1 MKISILTLFPEMFSIF-NHSIIGRAQENNIVELELLNIRDNTLDKHKKVDDYPYGGGAGMVMAPQPIIDTIRKAKENNKGKVIFLGPRGKTFNQKMAMDLSKEENLIFLCGHYEGIDERVYKHIDMEVSLGDFILTGGEMAAIPVIDSILRLIPGVLGKEESFVDESFSEDLLEYPQYTRPYEFEGEHVPEILLSGHHENIRKWRRLQSLDLTRKRRPDLY 220
>gi|71164786|sp|Q6XYU1|TRMD_SPIKU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|34849439|gb|AAP58938.1| tRNA-guanine-N1-methyltransferase [Spiroplasma kunkelii] (267 aa)
Score = 579, Expect = 4.2e-58, Identities = 119/220 (54%), Positives = 156/220 (70%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEH-LILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           K TVL+LF   FN F  TSIIKKA+   L+ I+I+N R++S   H +VDD  YGGG GMVL ++P+V AI   +T +S  +LLTP GK Y Q+   QF   ++ LIL+CGHYEGFDERI+ Y+DYE+SIGDYILTGGE+A+M ++DSV RL  NVI+  S  ++SF  NLLDYP YTKP  + G+ VPEVLLSG+H++I + R+   + KT + R  L  K
  S:     3 KFTVLTLFPEMFNNFMTTSIIKKALYEKLIAIKIINIRDYSIGKHYQVDDYQYGGGEGMVLMIEPLVAAIKAQQTRDSVTILLTPQGKQYVQEQVQQFAANDNDLILVCGHYEGFDERILYYIDYELSIGDYILTGGELASMVVIDSVTRLCENVINTQSHLNDSFSKNLLDYPVYTKPVEYGGHYVPEVLLSGHHQKIAQWREYEALKKTWLKRPYLLEK 223
>gi|167037685|ref|YP_001665263.1| tRNA (guanine-N1)-methyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856519|gb|ABY94927.1| tRNA (guanine-N1)-methyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] (242 aa)
Score = 579, Expect = 4.7e-58, Identities = 115/221 (52%), Positives = 150/221 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   VL+LF   F+   + SI+K+AI    + + ++N R+FSKD H +VDD PYGGG GMV+  QP+ DAI  VK+  N  V  L P GK +NQ++A +    E + L+CGHYEG DER+ + +D EIS+GD+ILTGGEIAAMAI+D+V RLI  V+S   S   ESF NNLL+YP YT+P  F G KVPE+LLSGNH EI K R++  +  T + R DL  K
  S:     2 MIFDVLTLFPEMFDSVLSYSILKRAIEKGKIKVNLINIRDFSKDKHKRVDDYPYGGGPGMVMMPQPLFDAIEFVKSQGNIPVYYLGPKGKIFNQEMAVKMSKLERIALLCGHYEGIDERVYSVIDEEISLGDFILTGGEIAAMAIIDAVTRLIEGVLSHPQSAIEESFANNLLEYPQYTRPEVFRGMKVPEILLSGNHAEIAKWRRQKSLEITLLKRPDLLKK 224
>gi|186685870|ref|YP_001869066.1| tRNA (guanine-N1)-methyltransferase [Nostoc punctiforme PCC 73102] >gi|186468322|gb|ACC84123.1| tRNA (guanine-N1)-methyltransferase [Nostoc punctiforme PCC 73102] (238 aa)
Score = 579, Expect = 4.7e-58, Identities = 104/221 (47%), Positives = 154/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +++LF + FN   N+ ++ KA+A  + ++ +VN R+F+ D H KVDD PYGGG GM++  +PI  A+  +      +++L++P G+T NQ +  +  T ++ L++ICGHYEG DER+++ V  E+S+GD+ILTGGEI AMA+++ V+RLIP  ++   SL +ESF+  LLDYP YT+P NF G KVP+VLLSGNH  I + R E QI KT+  R DL  K
  S:     1 MRFDIVTLFPDCFNSVLNSGLLGKALAKQIAEVHLVNPRDFTTDKHRKVDDEPYGGGVGMLMKPEPIFTAVESLPVLPRREIILMSPQGQTINQSLLKELVTNYDQLVVICGHYEGVDERVLHLVTREVSLGDFILTGGEIPAMALINGVVRLIPGTVAKTESLTAESFEEGLLDYPQYTRPANFRGLKVPDVLLSGNHAAIAQWRYEQQIQKTRDRRPDLLEK 224
>gi|150016063|ref|YP_001308317.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|189036075|sp|A6LSN1|TRMD_CLOB8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|149902528|gb|ABR33361.1| tRNA (guanine-N1)-methyltransferase [Clostridium beijerinckii NCIMB 8052] (239 aa)
Score = 579, Expect = 4.7e-58, Identities = 117/221 (52%), Positives = 156/221 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI++L+LF   F+ F + SII +A  NN+VD+E +N R+++ + H KVDD PYGGGAGMV+  QPIVD I   K SN  KVV L P GKT+NQ+IA +    E LI +CGHYEG DER+  ++D EIS+GD++LTGGE+AA+ ++D ++RLIP V+    S   ESF N LL+YP YT+P  F G KVPE+LLSG+H+ I K R+   +  TK  R DL+ K
  S:     1 MKISILTLFPEMFSIFDH-SIIGRARENNIVDLETLNIRDYTLNKHKKVDDYPYGGGAGMVMAPQPIVDTIRDAKLSNKGKVVFLGPRGKTFNQEIAKELSKEEGLIFLCGHYEGIDERVYKHIDMEISLGDFVLTGGEMAAIPVIDCILRLIPGVLGKEESFMEESFYNGLLEYPQYTRPEEFEGDKVPEILLSGHHENIRKWRRLKSLEVTKKIRPDLYKK 222
>gi|148377889|ref|YP_001256765.1| tRNA (guanine-N(1)-)-methyltransferase [Mycoplasma agalactiae PG2] >gi|148291935|emb|CAL59326.1| tRNA (Guanine-N(1)-)-methyltransferase [Mycoplasma agalactiae PG2] (227 aa)
Score = 578, Expect = 5.5e-58, Identities = 115/218 (52%), Positives = 151/218 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFD-NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MKI  L+LF N+F+ F   SII KAI N L+DI IV+FR FS D H+KVDD  YGGG GM+L ++PI  A++ +++     +L++P GK +NQQ A +   F+ +  I G YEGFDER+   VD E+SIGDY+LTGGE+ +M + DS+IRLI NVI   S E ESF+ + LLDYP YT+P  + G  VP+VLL+GNH EI K RKE +  KT  NR D+
  S:     1 MKINFLTLFPNYFSPFTEESIIAKAIENKLIDINIVDFRLFSLDKHHKVDDETYGGGQGMLLQIEPIDRALDSLESRGGYKILVSPQGKVFNQQKARELSKFDQITFISGRYEGFDERVTELVDEELSIGDYVLTGGELPSMVMADSIIRLIDNVIRKESHEYESFEGDGLLDYPQYTRPREYKGMSVPDVLLNGNHAEIEKWRKEAKYKKTLKNRPDI 219
>gi|164688559|ref|ZP_02212587.1| hypothetical protein CLOBAR_02204 [Clostridium bartlettii DSM 16795] >gi|164602972|gb|EDQ96437.1| hypothetical protein CLOBAR_02204 [Clostridium bartlettii DSM 16795] (231 aa)
Score = 578, Expect = 6.2e-58, Identities = 115/225 (51%), Positives = 158/225 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV----KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+  +++LF   FN +   SI+K+AI   ++++ + N R+FS + H KVDD P+GGGAGM++T QPI D   H+       N +V+ LTP GKT  Q I   F   E +IL+CGHYEG D+RII+  V  EISIGDY+LTGGE+ A+ ++D++ RLIP V++ N S E ESF+N+LL+YP+YT+P  F G  VP+VLLSGNH++I   RKE  I  TK  RKDL+ KY K+
  S:     1 MRFHIMTLFPEIFNSYFGESIMKRAIEKGIIEVFVYNIRDFSANKHKKVDDYPFGGGAGMLMTPQPIYDTYKHIVDTHNIENPRVIYLTPKGKTLKQGIVKGFSKEEDIILLCGHYEGIDQRIIDLIVTDEISIGDYVLTGGELPALILVDAIARLIPGVLNQNESFEDESFENDLLEYPHYTRPREFMGLNVPDVLLSGNHQKIEAWRKEQAIEITKKRRKDLYKKYCKK 231
>gi|167040346|ref|YP_001663331.1| tRNA (guanine-N1)-methyltransferase [Thermoanaerobacter sp. X514] >gi|166854586|gb|ABY92995.1| tRNA (guanine-N1)-methyltransferase [Thermoanaerobacter sp. X514] (242 aa)
Score = 577, Expect = 7.2e-58, Identities = 115/221 (52%), Positives = 150/221 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   VL+LF   F+   + SI+K+AI    + + ++N R+FSKD H +VDD PYGGG GMV+  QP+ DAI  VK+  N  V  L P GK +NQ++A +    E + L+CGHYEG DER+ + +D EIS+GD+ILTGGEIAAMAI+D+V RLI  V+S   S   ESF NNLL+YP YT+P  F G KVPE+LLSGNH EI K R++  +  T + R DL  K
  S:     2 MIFDVLTLFPEMFDSVLSYSILKRAIEKGKIKVNLINIRDFSKDKHKRVDDYPYGGGPGMVMMPQPLFDAIEFVKSQGNIPVYYLGPKGKIFNQEMAVKMSKLERIALLCGHYEGIDERVYSVIDEEISLGDFILTGGEIAAMAIIDAVTRLIEGVLSHSQSAIEESFANNLLEYPQYTRPEVFRGMKVPEILLSGNHAEIAKWRRQKSLEITLLKRPDLLKK 224
>gi|90961610|ref|YP_535526.1| tRNA (guanine-N(1)-)-methyltransferase [Lactobacillus salivarius UCC118] >gi|119382745|sp|Q1WU92|TRMD_LACS1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|90820804|gb|ABD99443.1| tRNA (Guanine-N(1)-)-methyltransferase [Lactobacillus salivarius UCC118] (250 aa)
Score = 577, Expect = 7.3e-58, Identities = 108/222 (48%), Positives = 156/222 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +LSLF   F      SI+ KA+  +++DIE+ NFR+F+ +  N VDD PYGGGAGM+L  QPI DA+++++  N    +V+LL P+G+ ++Q +A +    +HL  ICGHYEG+DERI   V  EIS+GD++LTGGE+ AM ++D+ +RL+P+V+  N S   +SF   LL+YP YT+P NF G +VPEVLLSGNH++I + RK+  + +T   R DL  +Y
  S:     1 MKIDILSLFPEMFGPL-TESIVGKAVEKDILDIEVTNFRDFTTNKQNHVDDYPYGGGAGMLLQAQPIYDALDNIEEKNGNLGRVILLDPAGRKFDQSVAEELSKEDHLTFICGHYEGYDERIRAKVTDEISLGDFVLTGGELGAMVVIDATVRLLPDVLGNNESASGDSFSMGLLEYPQYTRPSNFRGMEVPEVLLSGNHQKIAEWRKKESLRRTYQRRPDLLEEY 225
>gi|167404732|ref|ZP_02309511.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL J2-003] (271 aa)
Score = 576, Expect = 1.0e-57, Identities = 111/219 (50%), Positives = 157/219 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL 
  S:    43 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLL 267
>gi|81428333|ref|YP_395333.1| tRNA (guanine-N1-)-methyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|119382746|sp|Q38XQ7|TRMD_LACSS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|78609975|emb|CAI55022.1| tRNA (guanine-N1-)-methyltransferase [Lactobacillus sakei subsp. sakei 23K] (246 aa)
Score = 576, Expect = 1.0e-57, Identities = 107/219 (48%), Positives = 155/219 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI VLSLF +      + SII KAI  +L+D+E+ +FR+FS + HN VDD PYGGGAGM+L  QPI +A++ V   N    +V+LL P+G T+NQ++A +F   +HL+ ICGHYEG+DERI   V  E+S+GD+++TGGE+ AM ++D++ RL+P V+ +  S  ++SF   LL++P YT+P  + G KVPEVL++GNHK IN+ R +  + +T   R DL 
  S:     1 MKIDVLSLFPDMVQNGLSQSIIGKAIDRDLIDLEVTDFRDFSVNKHNSVDDAPYGGGAGMLLRPQPIFEAMDQVNAKNPGHKRVILLDPAGVTFNQKVAEEFAQEDHLVFICGHYEGYDERIRTLVTDEVSLGDFVVTGGELGAMVMIDAISRLVPGVLGNEQSAVTDSFSTGLLEHPQYTRPPEYRGLKVPEVLMNGNHKLINEWRDKMSLKRTYERRPDLL 223
>gi|148544375|ref|YP_001271745.1| tRNA (Guanine37-N1) methyltransferase [Lactobacillus reuteri F275] >gi|184153739|ref|YP_001842080.1| tRNA (guanine-N1)-methyltransferase [Lactobacillus reuteri F275] >gi|194466485|ref|ZP_03072472.1| tRNA (guanine-N1)-methyltransferase [Lactobacillus reuteri 100-23] >gi|166988163|sp|A5VKN4|TRMD_LACRF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|148531409|gb|ABQ83408.1| tRNA (Guanine37-N1) methyltransferase [Lactobacillus reuteri F275] >gi|183225083|dbj|BAG25600.1| tRNA (guanine-N1)-methyltransferase [Lactobacillus reuteri F275] >gi|194453521|gb|EDX42418.1| tRNA (guanine-N1)-methyltransferase [Lactobacillus reuteri 100-23] (252 aa)
Score = 576, Expect = 1.0e-57, Identities = 107/219 (48%), Positives = 150/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN--HVKT----SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +LSLF N F      SII KA  N  +DI + +FR ++ D HN VDD P+GGGAGM+L  QPI DA++  H +T    S  +V+L+ P+G+ ++Q  A +    +HL  ICGHYEG+DERI N V  E S+GDY+LTGGE+AAM ++D+ +R +P V+ +++S   +SF N LL+YP YT+P +F G KVPEVL SGNH++I + R    + +T   R DL 
  S:     1 MRIDILSLFPNMFQATMGESIIGKAQDNGFIDINVTDFRQYTTDKHNHVDDAPFGGGAGMLLQAQPIFDAMDAIHEQTKDQYSKGRVILMDPAGRKFDQAYAKELAQEDHLTFICGHYEGYDERIRNLVTDEASLGDYVLTGGELAAMVMIDATVRFVPGVLGNMSSPMGDSFSNGLLEYPQYTRPADFRGMKVPEVLTSGNHQKIKEWRMRESLRRTLHRRPDLL 226
>gi|28378337|ref|NP_785229.1| tRNA (guanine-N1-)-methyltransferase [Lactobacillus plantarum WCFS1] >gi|38258522|sp|Q88WJ2|TRMD_LACPL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|28271172|emb|CAD64077.1| tRNA (guanine-N1-)-methyltransferase [Lactobacillus plantarum WCFS1] (246 aa)
Score = 574, Expect = 1.5e-57, Identities = 104/219 (47%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +LSLF   F    + S+I  AI N+++++++ NFR+F+ D HN VDD PYGGGAGM+L  QPI DA+  V+  +    +V+LL P+G  +NQ +A  F   EHL  ICGHYEG+DERI + V  E+S+GDY+LTGGE+ AM ++D+ +RL+P V+ +  S   +SF + LL+YP YT+P +F G KVP++LLSG+H +I+  R E  + +T   R D+ 
  S:     1 MQIDILSLFPEMFAGPLHESMIGNAIENDVINVDVTNFRDFTTDKHNHVDDYPYGGGAGMLLQPQPIFDALASVQEKHPAPGRVILLDPAGVQFNQHVAEDFAQEEHLTFICGHYEGYDERIRSLVTDEVSLGDYVLTGGELGAMVMIDATVRLLPGVLGNSESAPGDSFSSGLLEYPQYTRPADFRGMKVPDILLSGDHGKIDDWRLEQALKRTYERRPDML 223
>gi|146297156|ref|YP_001180927.1| tRNA (guanine-N1)-methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166231350|sp|A4XLF1|TRMD_CALS8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|145410732|gb|ABP67736.1| tRNA (Guanine37-N1) methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] (245 aa)
Score = 574, Expect = 1.5e-57, Identities = 114/218 (52%), Positives = 151/218 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M   VL+LF     +  N SI+K+A    L+ IE +N R+++KD H + DD PYGGG GMV+T QPIVDA   +K+S   +V+ LTP GK Y Q IA +F   E L++ICGHYEG D+R+I+  V  EISIGDY+L+GGE AA+ ++DS+ RL+  VI   S+E ESF   LL+YP+YT+PY F G KVPEVLLSGNH++I K R+   + KT  +R DL
  S:     1 MVFKVLTLFPEVILQATNFSILKRAQEKGLIKIEAINIRDYTKDKHKRTDDYPYGGGFGMVMTAQPIVDAYESIKSSKPHRVIYLTPQGKKYTQDIAKEFSKEEELVIICGHYEGIDQRVIDLIVTDEISIGDYVLSGGEYAALVLIDSISRLVEGVIEKKSVEEESFSECLLEYPHYTRPYEFRGLKVPEVLLSGNHEKIKKWRRYQSLLKTIKSRPDL 220
>gi|152976207|ref|YP_001375724.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024959|gb|ABS22729.1| tRNA (guanine-N1)-methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (245 aa)
Score = 574, Expect = 1.6e-57, Identities = 109/219 (49%), Positives = 154/219 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF   F     +SI+KKA     V++ +VNFR+++ + HN VDD PYGGGAGMVLT QPI DA+  +    T   ++VL+ P G+ + Q+ A +    EH+I +CGHYEG+DERI  + V  EISIGDY+LTGGE+A+M I DSV+RL+P V+ + NS   +SF   LL++P+YT+P +F G KVP+VL+SGNHK+I++ R +  + +T   R DL 
  S:     2 MKIDILTLFPEMFTGVFGSSILKKAQEKEAVELRVVNFRDYTTNKHNSVDDYPYGGGAGMVLTPQPIFDAVEDLTKETTQKPRIVLMCPQGERFTQKKAEELAKEEHVIFVCGHYEGYDERIREHLVTDEISIGDYVLTGGELASMVITDSVVRLLPGVLGNQNSQVEDSFSTGLLEHPHYTRPADFRGMKVPDVLMSGNHKKIDEWRHKESLRRTYTRRPDLL 225
>gi|188589196|ref|YP_001920594.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188499477|gb|ACD52613.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum E3 str. Alaska E43] (238 aa)
Score = 574, Expect = 1.8e-57, Identities = 112/219 (51%), Positives = 156/219 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI++L+LF   F+ F N SII +A  N ++++E++N R+ + D H KVDD PYGGGAGMV+  QPIVD I   K +N  KVV L P GKT+NQ++A      E+LI +CGHYEG D+R+  ++D E+S+GD+ILTGGE+AA+ ++DS++RLIP V+    S   ESF  +LL+YP YT+PY F G  VPE+LLSG+H+ I K R+   +N T+  R DL+
  S:     1 MKISILTLFPEMFSIF-NHSIIGRAQENKIIELEVLNIRDNTLDKHKKVDDYPYGGGAGMVMAPQPIVDTIRKAKENNKGKVVFLGPRGKTFNQKMAMDLSKEENLIFLCGHYEGIDQRVYKHIDMEVSLGDFILTGGEMAAIPVIDSILRLIPGVLGKEESFMDESFSEDLLEYPQYTRPYEFEGECVPEILLSGHHENIRKWRRLQSLNLTENRRPDLY 220
>gi|116618572|ref|YP_818943.1| tRNA (Guanine37-N1) methyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271228|sp|Q03W52|TRMD_LEUMM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|116097419|gb|ABJ62570.1| tRNA (Guanine37-N1) methyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (243 aa)
Score = 573, Expect = 2.0e-57, Identities = 104/221 (47%), Positives = 154/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+I VLSLF + F   +  SII KAI    +D ++ +FR+F+++ HN VDD P+GGGAGM+LT QPI DA+  V+       +V+LL P+G+ +N ++A +  T++HL  + GHYEG+DERI   VD EIS+GDY+LTGGE+ AM I+D+ +R +P ++ +  S E +SF++ LL++P YT+P +F G  VPEVL SGNH +I + R +  + +T + R DL  K
  S:     1 MRIDVLSLFPDMFAPMRQ-SIIGKAIDKGALDFQVTDFRDFTENKHNNVDDYPFGGGAGMLLTPQPIFDAMASVEKQAGGKGRVILLDPAGRQFNHEVAQELATYDHLTFVAGHYEGYDERIRELVDDEISLGDYVLTGGELGAMVIIDATVRFLPEILGNAASAEGDSFEDGLLEFPQYTRPADFRGRMVPEVLTSGNHAKIAEWRLKESLRRTYLRRPDLLEK 224
>gi|145652225|gb|ABP88158.1| hypothetical protein [Borrelia lonestari] (240 aa)
Score = 573, Expect = 2.4e-57, Identities = 113/225 (50%), Positives = 158/225 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNN---LLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           MKIT+LSLF +    F   SI+KK +   ++  EI++ R+FS D + + DD PYGGGAGMVL  QPI  A+ +V +     + ++PSG  Y Q++A        L++ICG YEG D+RII+ YVD+EIS+GDY+L+ GE+AA+ ++DSV RL+ +VIS +SL  ESF+     LL+YP+YT+PY F   KVP+VLLSG+H+EI K R    + KTK NR DL++KYL+E
  S:     1 MKITILSLFPSIITPFFENSIMKKVVDRGIISYEIISIRDFSDDRYKRCDDAPYGGGAGMVLKAQPISAALEYVNSKVKTTIFVSPSGIKYTQKLAYDLSKKRELVIICGRYEGLDQRIIDLYVDFEISVGDYVLSSGEVAALVVIDSVYRLLDDVISPSSLMEESFNFGSGLLLEYPHYTRPYEFKELKVPDVLLSGHHEEIRKWRFIKSVEKTKKNRYDLYLKYLEE 229
>gi|23098991|ref|NP_692457.1| tRNA methyltransferase [Oceanobacillus iheyensis HTE831] >gi|38258582|sp|Q8CXH3|TRMD_OCEIH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|22777219|dbj|BAC13492.1| tRNA methyltransferase [Oceanobacillus iheyensis HTE831] (245 aa)
Score = 572, Expect = 2.5e-57, Identities = 112/221 (50%), Positives = 155/221 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I +L+LF   F+    +SI+ KA+       ++VNFR +SK+ H KVDD PYGGGAGMVLT QPI DA+  VK+   S  +V+L+ P G+T  QQ + +    +HLI ICGHYEG+DERI  + V  EISIGDY+LTGGE+ +M ++DSV+RL+P+V+ +  S   +SF   LL++P+YT+P +F GYKVPEVLLSGNH  I+  R++  + +T   R+DL  K
  S:     1 MHIDILTLFPEMFHGVFQSSILNKAVERQQFTYDLVNFREYSKNKHQKVDDYPYGGGAGMVLTPQPIFDAVEAVKSKRNSKPRVILMCPQGETLTQQKSEELAKEDHLIFICGHYEGYDERIREHIVTDEISIGDYVLTGGELGSMVVVDSVVRLLPDVLGNQQSAPQDSFSTGLLEHPHYTRPADFRGYKVPEVLLSGNHANIDSWRRKQSLIRTWNRRRDLLDK 226
>gi|163812856|ref|ZP_02204512.1| tRNA (guanine-N1)-methyltransferase [Dehalococcoides sp. VS] >gi|157403516|gb|EDO69580.1| tRNA (guanine-N1)-methyltransferase [Dehalococcoides sp. VS] (248 aa)
Score = 572, Expect = 2.5e-57, Identities = 110/221 (49%), Positives = 156/221 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI VL+LF   F      SI K+A   NLV +EI NFR+FS D H+ VDD+PYGGGAGM+L  +P+ +A+  V   +   + V+LL+P G+T+NQ +A +    + LI+ICGHYEGFDER+  ++   EISIGD++LTGGE+AAM ++D+V RLIP V+ S +S E +S  N LL++P+YT+P  F G+ +PEVLLSGNH  I++ R++  + +T   R D+  K
  S:     1 MKIDVLTLFPEMFQSPFEESIFKRAADKNLVRLEIHNFRDFSHDKHHAVDDSPYGGGAGMLLKPEPLFEAVEAVMEKDPTPAPVILLSPQGRTFNQSVARELAGNQRLIIICGHYEGFDERVREHLATDEISIGDFVLTGGELAAMVVIDTVSRLIPGVLGSEDSSEEDSHSNGLLEHPHYTRPPVFRGWGIPEVLLSGNHARIDRWRRKESLRRTLKRRPDMLEK 226
>gi|51598952|ref|YP_073140.1| tRNA (guanine-N(1)-)-methyltransferase [Borrelia garinii PBi] >gi|84029204|sp|Q660H3|TRMD_BORGA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|51573523|gb|AAU07548.1| tRNA guanine-N1 methyltransferase [Borrelia garinii PBi] (239 aa)
Score = 572, Expect = 2.5e-57, Identities = 117/224 (52%), Positives = 156/224 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MK TV+SLF      F   SI+KKAI   +V  E+++ R+FSKD H + DD  YGGGAGMVL  +P+  A+ HV+ +    + L+PSG  Y Q++A      E +++ICG YEG D+RII+ YVD+EISIGDY+L+ GEIAA+ ++DSV RL+  VI+ NSL  ESF   N LL+YP+YT+PYNF G KVPEVL+SG+H+ I   R      KTK NR DL++KYL+
  S:     1 MKFTVISLFPAIIKPFFENSIMKKAINKGIVSFELIDVRDFSKDKHKRCDDLSYGGGAGMVLKAEPMSFALEHVEATKKTTIFLSPSGIKYTQELAYSLSKKEEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLDGVINPNSLLEESFGMKNGLLEYPHYTRPYNFMGIKVPEVLVSGHHENIKNWRLFKAREKTKKNRYDLYLKYLE 227
>gi|187918553|ref|YP_001884116.1| hypothetical protein BH0698 [Borrelia hermsii DAH] >gi|119861401|gb|AAX17196.1| hypothetical protein BH0698 [Borrelia hermsii DAH] (239 aa)
Score = 570, Expect = 4.7e-57, Identities = 110/224 (49%), Positives = 155/224 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSL--ESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MKIT+LSLF +    F   SI+KK +   ++  E+++ R+FS D H + DD PYGGGAGMVL   PI  A+ +V   +   + ++PSG  Y Q++A        L++ICG YEG D+R+I+ YVD E+S+GDY+L+ GE+AA+ I+DSV RL+   I+ +SL  ES SFD  LL+YP+YT+PY F G +VP+VLLSG+H+EI K R    + KTK NR DL++KYL+
  S:     1 MKITILSLFPSIITPFFENSIMKKVVDRGIISYEVISIRDFSDDKHKRCDDIPYGGGAGMVLKAPPISAALEYVNAKSKTTIFVSPSGLKYTQKLAYDLSKKSELVIICGRYEGLDQRVIDLYVDLEVSVGDYVLSSGEVAALVIIDSVYRLLDGAINPSSLLEESFSFDCGLLEYPHYTRPYEFKGLEVPDVLLSGHHEEIKKWRFIKSVEKTKKNRYDLYLKYLE 227
>gi|30021929|ref|NP_833560.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus cereus ATCC 14579] >gi|38258426|sp|Q812X2|TRMD_BACCR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|29897485|gb|AAP10761.1| tRNA (Guanine-N1) -methyltransferase [Bacillus cereus ATCC 14579] (244 aa)
Score = 570, Expect = 4.9e-57, Identities = 109/219 (49%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF + F     +SI+KKA     V++ +VNFR+++   HN VDD PYGGGAGMVLT QPI DA+  +        +VVL+ P G+ + Q+ A +    EHLI +CGHYEG+DERI  + V  EISIGDY+LTGGE+A+M I DSV+RL+P V+  ++ + E SF   LL++P+YT+P +F G KVP+VL+SGNHK I++ R +  + +T   R DL 
  S:     1 MKIDILTLFPDMFTGVFGSSILKKAQEKEAVNLRVVNFRDYTTSKHNSVDDYPYGGGAGMVLTPQPIFDAVEDLTKETERKPRVVLMCPQGERFTQKKAEELAGEEHLIFVCGHYEGYDERIREHLVTDEISIGDYVLTGGELASMVITDSVVRLLPGVLGNHASQVEDSFSTGLLEHPHYTRPADFRGMKVPDVLMSGNHKNIDEWRHKESLRRTYTRRPDLL 224
>gi|13508398|ref|NP_110348.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma pneumoniae M129] >gi|2146681|pir||S73509 tRNA (guanine-N1)-methyltransferase trmD - Mycoplasma pneumoniae (strain ATCC 29342) >gi|1673846|gb|AAB95831.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma pneumoniae M129] (210 aa)
Score = 569, Expect = 5.6e-57, Identities = 102/204 (50%), Positives = 145/204 (71%)
  Q:    22 IKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           + +A    LV+ E++N+R + KD H  VDD  YGGG GMVL  +PI+ A+   +T  SKVVLL+P G+ ++Q +A      EHLILICGHYEGFD R+  +VD  IS+GD++L+GGE+ A++++D+ +RLI  VI+  SL  ESF+N LLD+P YT+PY+ +G KVPE+LLSG+HK+I   RKE Q+ +T   R DL+ +YL +
  S:     1 MAQAQKAKLVEFEVINWRQYCKDKHQTVDDMAYGGGGGMVLKAEPILKALKACRTPQSKVVLLSPEGQQFSQPMAQALTQTEHLILICGHYEGFDYRLYKHVDQIISLGDFVLSGGELVALSVIDATVRLIKGVINDQSLIHESFNNYLLDFPAYTRPYDLDGDKVPEILLSGDHKKIEAYRKEQQLLRTAQYRPDLYKQYLAK 204
>gi|113475626|ref|YP_721687.1| tRNA (guanine-N(1)-)-methyltransferase [Trichodesmium erythraeum IMS101] >gi|122964937|sp|Q113W0|TRMD_TRIEI tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|110166674|gb|ABG51214.1| tRNA (Guanine37-N(1)-) methyltransferase [Trichodesmium erythraeum IMS101] (227 aa)
Score = 569, Expect = 7.0e-57, Identities = 107/219 (48%), Positives = 151/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  V++LF +FF    N+ ++ +A   N+  + +VN RN++ D + KVDD  YGGG GMVL  +PI  A+  + T S  +V+LLTP GK  +Q +  +  T +E LILICGHYEG DER+   V  E+S+GD++LTGGEI A+A+++ V+RL+P  +    SLE ESF++ LLDYP YT+P NF G+KVPEVLLSG+H EI + R + Q+ +TK  R DL 
  S:     1 MRFDVITLFPDFFTTPLNSGLLGRAFNKNIAKVNLVNPRNYTTDKYKKVDDESYGGGVGMVLKPEPIFAAVESLPTLSKREVILLTPQGKRMHQGLFRELATDYEQLILICGHYEGIDERVQYLVSREVSLGDFVLTGGEIPALALINGVVRLLPGTVGKAESLECESFESGLLDYPQYTRPANFRGWKVPEVLLSGHHAEIARWRYQQQLQRTKSRRPDLL 222
>gi|73662836|ref|YP_301617.1| tRNA guanine-N1-mehtyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|119371003|sp|Q49X26|TRMD_STAS1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|72495351|dbj|BAE18672.1| tRNA guanine-N1-mehtyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (245 aa)
Score = 568, Expect = 7.2e-57, Identities = 106/222 (47%), Positives = 157/222 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   FN   N SI+K+A   N++ +  V+FR+F+++ HN+VDD P+GGG GMVL  +PI +A+  + KT +++V+L+ P GK + Q IAN+    EH++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RL+P V+ +  S E +SF + LL++P YT+P  + G  VP+VLLSGNH  I++ R E +I +T + R DL  +Y
  S:     1 MKIDFLTLFPEMFNGVLNQSILKRAQDKNMLTVNTVDFRHFAENKHNQVDDYPFGGGQGMVLKPEPIFNAMESIEKTDDTRVILMCPQGKPFTQAIANELSQSEHVVFICGHYEGYDERIREHLVTDEISMGDYVLTGGELPAMVMTDAIVRLLPGVLGNQQSHEDDSFQDGLLEFPQYTRPREYKGMSVPDVLLSGNHAHIDRWRHEQKILRTFVKRPDLLERY 225
>gi|126657550|ref|ZP_01728706.1| tRNA (guanine-N(1)-)-methyltransferase [Cyanothece sp. CCY0110] >gi|126621254|gb|EAZ91967.1| tRNA (guanine-N(1)-)-methyltransferase [Cyanothece sp. CCY0110] (233 aa)
Score = 568, Expect = 8.5e-57, Identities = 106/222 (47%), Positives = 156/222 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI V++LF +FF     + ++ KA+AN++  + ++N R+F+ D H++VDD PYGGG GMVL  +PI  A+N V +  +++V+LLTP G    Q       T ++ LILICGHYEG DERI    D EIS+GD++LT GEI A+A+++ V+RL+P  +  V SL++ESF++ LLDYP YT+P  F  ++VPEVL SGNH+ I + R++ QI +T+  R DL+ K+
  S:     1 MKIDVITLFPDFFTSGLQSGLLGKALANHIATVNLINPRDFAPDKHHRVDDIPYGGGVGMVLKPEPIFAAVNSVPRLPSTQVILLTPQGSPLTQNTLQDLTTNYQQLILICGHYEGVDERIRYLADREISLGDFVLTCGEIPALALINGVVRLLPGTVGKVESLKAESFEDGLLDYPQYTRPAVFQDWQVPEVLRSGNHQLIAQWRRDEQIKRTQQRRPDLWEKF 225
>gi|148380403|ref|YP_001254944.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|153933623|ref|YP_001384620.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153935798|ref|YP_001388137.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium botulinum A str. Hall] >gi|168180674|ref|ZP_02615338.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916] >gi|166231357|sp|A7FW09|TRMD_CLOB1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166231358|sp|A5I4M3|TRMD_CLOBH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|148289887|emb|CAL83995.1| tRNA (Guanine-n(1)-)-methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152929667|gb|ABS35167.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|152931712|gb|ABS37211.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum A str. Hall] >gi|182668389|gb|EDT80368.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916] (240 aa)
Score = 567, Expect = 9.5e-57, Identities = 118/222 (53%), Positives = 152/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I VL+LF   F+ F N SII +AI   ++ I  VN R+++ D H KVDD PYGGGAGMV+++QPIVD+I  VK  N  KV+ L P GKT+NQ +A +    E LI +CGHYEG DER   Y+D EIS+GD++LTGGE+A + I+DS+ RL+  V+ S  S E ESF N LL+YP YT+P  + G  VPEVLLSG+H+ I K RK   +  T   R DLF KY
  S:     1 MRIDVLTLFPEMFSIF-NHSIIGRAIEKEILKINTVNIRDYTIDKHKKVDDYPYGGGAGMVMSVQPIVDSIKAVKKENKGKVIFLGPKGKTFNQNLAKELAKEEELIFLCGHYEGIDERAYEYIDMEISLGDFVLTGGEMACIPIVDSICRLVDGVLGSSESYEDESFYNGLLEYPQYTRPAIYEGKSVPEVLLSGHHENIKKWRKAKSLIITDKVRPDLFKKY 223
>gi|169824226|ref|YP_001691837.1| tRNA (guanine-N(1)-)-methyltransferase [Finegoldia magna ATCC 29328] >gi|167831031|dbj|BAG07947.1| tRNA (Guanine-N(1)-)-methyltransferase [Finegoldia magna ATCC 29328] (233 aa)
Score = 567, Expect = 1.0e-56, Identities = 112/225 (49%), Positives = 163/225 (72%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           MK  +L+LF   F+  K+  +I KAI NNL+++E+VN R+++K+ H KVDD  YGGGAGM++T QPI D +  V  + SKVV ++P GK  NQQ   +    + ++++CGHYEG D RIIN Y D EISIGDY++TGGE+ AM ++D V R+I +V+  + S +++S  N LL   +YT+P  FNGY+VPEVLLSGNH++I + R++ ++N TK+ R+D++ KYLKE
  S:     1 MKFIILTLFPESFDYLKSYGVIGKAIQNNLIELEVVNIRDYTKNKHKKVDDEIYGGGAGMLMTCQPIYDCLEDVNKNQSKVVFMSPQGKVLNQQKCIELSKEKEIVILCGHYEGVDSRIINHYCDEEISIGDYVMTGGELGAMVLIDCVSRMINDVLGNDESYKTDSHYNLLLQEDSYTRPRVFNGYEVPEVLLSGNHEKIEQWREKSRLNNTKLKREDIYQKYLKE 227
>gi|119512791|ref|ZP_01631860.1| tRNA (guanine-N(1)-)-methyltransferase [Nodularia spumigena CCY9414] >gi|119462563|gb|EAW43531.1| tRNA (guanine-N(1)-)-methyltransferase [Nodularia spumigena CCY9414] (235 aa)
Score = 566, Expect = 1.3e-56, Identities = 102/225 (45%), Positives = 155/225 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFK-TFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+  +++LF + F     + ++ KA+A  +  + +VN R+F+ D H+K DD PYGGG GM++  +PI  A+  + T    +V+L++P G+T NQ +  +    ++ L++ICGHYEG DER+++ V  E+S+GD+ILTGGEI +MA+L+ V+RL+P  +  V SL+ ESF+  LLDYP YT+P +F G+KVP+VLLSGNH EI + R E QI +T   R DL  K+ +E
  S:     1 MRFDIVTLFPDCFTSVLTSGLLGKALAKQIAQVNLVNPRDFTTDKHHKADDEPYGGGVGMLMKPEPIFAAVESLPTLPRREVILMSPQGQTINQPLLKELAGNYDQLVVICGHYEGVDERVLHLVTREVSLGDFILTGGEIPSMALLNGVVRLLPGTVGKVESLKVESFEEGLLDYPQYTRPADFRGWKVPDVLLSGNHAEIARWRYEQQIQRTGDRRPDLLQKWQEE 228
>gi|116492616|ref|YP_804351.1| tRNA (Guanine37-N1) methyltransferase [Pediococcus pentosaceus ATCC 25745] >gi|122265920|sp|Q03FW3|TRMD_PEDPA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|116102766|gb|ABJ67909.1| tRNA (Guanine37-N1) methyltransferase [Pediococcus pentosaceus ATCC 25745] (245 aa)
Score = 566, Expect = 1.3e-56, Identities = 104/219 (47%), Positives = 153/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS----KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI VL+LF        + SI+ KAI    +++++ +FR +S + H  VDD PYGGGAGM+LT QPI DA+ HVK+ N+    +V+L+ P GK +NQ +A  F   EHL  ICGHYEG+DERI   VD E+S+GD+++TGGE+AA+ ++D+ +RL+P+++ + +S   +SF   LL++P YT+P +F G KVP +LLSGNH +I++ R+   + KT   R DL 
  S:     1 MKIDVLTLFPKMVEVPLHESIVGKAIEAGKLNVDVTDFRQYSTNKHGNVDDYPYGGGAGMLLTPQPIFDAMEHVKSQNNQSTGRVILVDPGGKQFNQTMAEDFAKEEHLTFICGHYEGYDERIKTLVDDEVSLGDFVITGGELAALTMIDATVRLLPDILGNKDSAVDDSFSTGLLEFPQYTRPEDFRGLKVPSILLSGNHGKIDEWRRTESLKKTLARRPDLL 224
>gi|170757200|ref|YP_001781988.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum B1 str. Okra] >gi|169122412|gb|ACA46248.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum B1 str. Okra] (240 aa)
Score = 566, Expect = 1.5e-56, Identities = 118/222 (53%), Positives = 150/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I VL+LF   F+ F N SII +AI   ++ I  VN R+++ D H KVDD PYGGGAGMV+  QPIVD+I  VK  N  KV+ L P GKT+NQ +A +    E LI +CGHYEG DER   Y+D EIS+GD++LTGGE+A + I+DS+ RL+  V+ S  S E ESF N LL+YP YT+P  + G  VPEVLLSG+H+ I K RK   +  T   R DLF KY
  S:     1 MRIDVLTLFPQMFSIF-NHSIIGRAIEKEILKINTVNIRDYTIDKHKKVDDYPYGGGAGMVMAAQPIVDSIKTVKKENKGKVIFLGPKGKTFNQNLAKELAKEEELIFLCGHYEGIDERAYEYIDMEISLGDFVLTGGEMACIPIVDSICRLVDGVLKSSESYEDESFYNGLLEYPQYTRPATYEGKSVPEVLLSGHHENIKKWRKAKSLIITNKVRPDLFKKY 223
>gi|153938908|ref|YP_001391743.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium botulinum F str. Langeland] >gi|166231359|sp|A7GG33|TRMD_CLOBL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|152934804|gb|ABS40302.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum F str. Langeland] (240 aa)
Score = 565, Expect = 1.7e-56, Identities = 118/222 (53%), Positives = 150/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I VL+LF   F+ F N SII +AI   ++ I  VN R+++ D H KVDD PYGGGAGMV+  QPIVD+I  VK  N  KV+ L P GKT+NQ +A +    E LI +CGHYEG DER   Y+D EIS+GD++LTGGE+A + I+DS+ RL+  V+ S  S E ESF N LL+YP YT+P  + G  VPEVLLSG+H+ I K RK   +  T   R DLF KY
  S:     1 MRIDVLTLFPEMFSIF-NHSIIGRAIEKEILKINTVNIRDYTIDKHKKVDDYPYGGGAGMVMAAQPIVDSIKTVKKENKGKVIFLGPKGKTFNQNLAKELAKEEELIFLCGHYEGIDERAYEYIDMEISLGDFVLTGGEMACIPIVDSICRLVDGVLKSSESYEDESFYNGLLEYPQYTRPATYEGKSVPEVLLSGHHENIKKWRKAKSLIITNKVRPDLFKKY 223
>gi|56964054|ref|YP_175785.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus clausii KSM-K16] >gi|84029199|sp|Q5WFN6|TRMD_BACSK tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|56910297|dbj|BAD64824.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus clausii KSM-K16] (244 aa)
Score = 565, Expect = 1.7e-56, Identities = 107/222 (48%), Positives = 154/222 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI VL+LF + F     +SI+K+A    +V  + V+FR ++ + H KVDD PYGGGAGMVL+ QPI DA++ +  +  K   +++L P G+ ++QQ A +    EHLI +CGHYEGFDER+ + V  E+SIGDY+LTGGE+AAM I DSV+RL+P V+  + S  ++S+   LL++P+YT+P +F G KVP+VLLSG+H +I + R E  + +T   R DL   Y
  S:     1 MKIDVLTLFPDMFTGVFGSSILKQASDKGIVSFQTVDFREYAANKHRKVDDYPYGGGAGMVLSPQPIFDAVSALTKNGKKKPRIIMLCPQGEQHSQQKAAELAKEEHLIFLCGHYEGFDERVRHLVTDELSIGDYVLTGGELAAMVIADSVVRLLPGVLGNDESAVTDSYSTGLLEHPHYTRPADFRGMKVPDVLLSGHHAKIEEWRMEQSLRRTLERRPDLLKGY 226
>gi|187778962|ref|ZP_02995435.1| hypothetical protein CLOSPO_02557 [Clostridium sporogenes ATCC 15579] >gi|187772587|gb|EDU36389.1| hypothetical protein CLOSPO_02557 [Clostridium sporogenes ATCC 15579] (242 aa)
Score = 565, Expect = 1.8e-56, Identities = 116/222 (52%), Positives = 154/222 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I VL+LF   F+ F N SII +A+   ++ I  VN R+++ + H KVDD PYGGGAGMV+++QPIVD+I  VKT N  KV+ L P GKT+NQ +A +    E LI +CGHYEG DER+  Y+D EIS+GD++LTGGE+A + I+DS+ RL+  V+ S  S E ESF N LL+YP YT+P  + G  VP+VLLSG+H+ I K RK   +  TK  R DL  KY
  S:     3 MRIDVLTLFPEMFSIF-NHSIIGRAMEKEILKINTVNIRDYTINKHKKVDDYPYGGGAGMVMSVQPIVDSIKMVKTENKGKVIFLGPKGKTFNQNLAKELAKEEELIFLCGHYEGIDERVYEYIDMEISLGDFVLTGGEMACIPIVDSICRLVDGVLKSSESYEDESFYNGLLEYPQYTRPPIYEGKAVPDVLLSGHHENIKKWRKAKSLMITKKVRPDLLKKY 225
>gi|150390504|ref|YP_001320553.1| tRNA (guanine-N1)-methyltransferase [Alkaliphilus metalliredigens QYMF] >gi|166988157|sp|A6TRS6|TRMD_ALKMQ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|149950366|gb|ABR48894.1| tRNA (guanine-N1)-methyltransferase [Alkaliphilus metalliredigens QYMF] (247 aa)
Score = 565, Expect = 1.8e-56, Identities = 114/219 (52%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK+ +L+LF   FN    TSI+KKA    L+DI+  N R+F+ + H KVDD P+GGGAGMV+T QPI D  +HV          K + L+P G T+ Q+ A +    E LI +CGHYEG D+RII+  V  EISIGDY+LTGGE+ AM I+D++ RLIP V+S   S E ESF   LL+YP+YT+P  FNG +VP VLLSGNHK+I+  R++  I  T   R DL 
  S:     1 MKVRILTLFPEMFNGPFGTSILKKAQEKELIDIQCFNIRDFALNKHKKVDDYPFGGGAGMVMTPQPIFDCHHHVTQMLNLNEPCKTIYLSPKGSTFTQEKAMELAKEEQLIFLCGHYEGIDQRIIDELVTDEISIGDYVLTGGELPAMVIVDAITRLIPGVLSTEASYEDESFHCGLLEYPHYTRPRAFNGLEVPSVLLSGNHKDIDMWRRKQSIELTFERRPDLL 226
>gi|17231374|ref|NP_487922.1| tRNA (guanine-N(1)-)-methyltransferase [Nostoc sp. PCC 7120] >gi|26400784|sp|Q8YQF1|TRMD_ANASP tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|17133016|dbj|BAB75581.1| tRNA methyltransferase [Nostoc sp. PCC 7120] (252 aa)
Score = 565, Expect = 1.9e-56, Identities = 101/225 (44%), Positives = 154/225 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+  +++LF + F    ++ ++ KA+A  +  + +VN R+F+ D H KVDD PYGGG GM++  +PI  A+  +      +V+L++P G+T NQ +  +    +E L++ICGHYEG D+R+++ V  E+S+GD+ILTGGEI AMA+++ V+RL+P  ++   SL +ESF+  LLDYP YT+P NF G+KVP+VLLSGNH  I + R E QI +T   R DL  K+ +E
  S:     1 MRFDIVTLFPDCFTSVLSSGLLGKALAKQIAQVNLVNPRDFTTDKHRKVDDEPYGGGVGMLMKPEPIFSAVESLPILERREVILMSPQGQTINQPLLRELVSNYEQLVVICGHYEGVDDRVLHLVTREVSLGDFILTGGEIPAMALINGVVRLLPGTVAKTESLTAESFEEGLLDYPQYTRPANFRGWKVPDVLLSGNHAAIAQWRYEQQIKRTSDRRPDLLEKWQQE 228
>gi|153954030|ref|YP_001394795.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium kluyveri DSM 555] >gi|189036076|sp|A5N816|TRMD_CLOK5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|146346911|gb|EDK33447.1| Hypothetical protein CKL_1405 [Clostridium kluyveri DSM 555] (244 aa)
Score = 564, Expect = 2.2e-56, Identities = 114/219 (52%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +KI +L+LF   F+ F N SII +AI  N++ I   N RNF+++ H KVDD PYGGG+GM++T QPIVD IN VKT N   VV L P GK ++Q +A +  + + LI +CGHYEG DER+  Y+D EISIGD+I+TGGE+A + I+DS+ R+IP V+ S  S   ESF N +L+YP YT+P  F G +VPEVL+SG+H+ I K R+      TK  R DLF
  S:     3 VKIDILTLFPEMFHVF-NYSIIGRAIEKNILSINTFNIRNFTENKHRKVDDYPYGGGSGMIMTAQPIVDCINSVKTQNKGNVVYLGPRGKIFDQSMAKKLSSEKELIFLCGHYEGIDERVYRYIDLEISIGDFIVTGGEMACIPIVDSICRMIPGVLSSTESYTEESFYNGVLEYPQYTRPEFFRGDRVPEVLISGHHENIRKWRRAKSFILTKNKRPDLF 222
>gi|163941579|ref|YP_001646463.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163863776|gb|ABY44835.1| tRNA (guanine-N1)-methyltransferase [Bacillus weihenstephanensis KBAB4] (244 aa)
Score = 564, Expect = 2.3e-56, Identities = 106/219 (48%), Positives = 150/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF + F     +SI+KKA     V++ +VNFR ++   HN VDD PYGGGAGMVLT QPI DA+  +        ++VL+ P G+ + Q+ A +    EH+I +CGHYEG+DERI  + V  EISIGDY+LTGGE+A+M + DSV+RL+P V+   + + E SF   LL++P+YT+P +F G KVP+VL+SGNHK I++ R +  + +T   R DL 
  S:     1 MKIDILTLFPDMFTGVFGSSILKKAQEKEAVELRVVNFREYTTSKHNSVDDYPYGGGAGMVLTPQPIFDAVEELTKETDRKPRIVLMCPQGERFTQKKAEELAGEEHVIFVCGHYEGYDERIREHLVTDEISIGDYVLTGGELASMVVTDSVVRLLPGVLGNQTSQVEDSFSTGLLEHPHYTRPADFRGMKVPDVLMSGNHKNIDEWRHKESLRRTYTRRPDLL 224
>gi|168184651|ref|ZP_02619315.1| tRNA -methyltransferase [Clostridium botulinum Bf] >gi|182672296|gb|EDT84257.1| tRNA -methyltransferase [Clostridium botulinum Bf] (240 aa)
Score = 564, Expect = 2.4e-56, Identities = 117/222 (52%), Positives = 150/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I VL+LF   F+ F N SII +AI   ++ I  VN R+++ D H KVDD PYGGGAGMV+  QPIVD+I  VK  N  KV+ L P GKT+NQ +A +    E LI +CGHYEG DER   Y+D EIS+GD++LTGGE+A + I+DS+ RL+  V+ S  S E ESF N LL+YP YT+P  + G  VP+VLLSG+H+ I K RK   +  TK  R DL  KY
  S:     1 MRIDVLTLFPEMFSIF-NHSIIGRAIGKEILKINTVNIRDYTIDKHKKVDDYPYGGGAGMVMAAQPIVDSIKTVKKENKGKVIFLGPKGKTFNQNLAKELAKEEELIFLCGHYEGIDERAYEYIDMEISLGDFVLTGGEMACIPIVDSICRLVDGVLKSSESYEDESFYNGLLEYPQYTRPPIYEGKAVPDVLLSGHHENIKKWRKAKSLMITKKVRPDLLKKY 223
>gi|163814205|ref|ZP_02205597.1| hypothetical protein COPEUT_00359 [Coprococcus eutactus ATCC 27759] >gi|158450654|gb|EDP27649.1| hypothetical protein COPEUT_00359 [Coprococcus eutactus ATCC 27759] (247 aa)
Score = 564, Expect = 2.7e-56, Identities = 113/226 (50%), Positives = 157/226 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M   +L+LF        +TSI  +AI +  + IE +N R+++KD HN VDD PYGGGAGMV+  QP+ DA   +     +   V+ +TP G+T+NQ IA +    E ++L+CGHYEG DER++   VD  +SIGD++LTGGE+ AMAI+D+V RL+P V++  +S E E+F NNLL+YP YT+P  F G +VP+VLLSGNHK IN+ R E  I +TK NR D++ KY+ EN
  S:     1 MNFYILTLFPEMVMNGLSTSITGRAIESGKLHIEAINIRDYTKDKHNHVDDYPYGGGAGMVMQAQPVYDAYTALVEKIGRKPWVIYMTPQGQTFNQGIAQELSEKEDIVLLCGHYEGIDERVLEMIVDDYMSIGDFVLTGGELPAMAIVDAVSRLVPGVLNNEDSAEIETFYNNLLEYPQYTRPPEFMGRRVPDVLLSGNHKLINEWRLEQSIERTKANRPDMYEKYIAEN 231
>gi|75908033|ref|YP_322329.1| tRNA (guanine-N(1)-)-methyltransferase [Anabaena variabilis ATCC 29413] >gi|119382719|sp|Q3MC52|TRMD_ANAVT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|75701758|gb|ABA21434.1| tRNA (Guanine37-N1) methyltransferase [Anabaena variabilis ATCC 29413] (244 aa)
Score = 562, Expect = 3.6e-56, Identities = 100/225 (44%), Positives = 155/225 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+  +++LF + F    ++ ++ KA+A  +  + +VN R+F+ D H KVDD PYGGG GM++  +PI  A+  +      +V+L++P G+T +Q +  +    +E L++ICGHYEG D+R+++ V  E+S+GD+ILTGGEI AMA+++ V+RL+P  ++   SL +ESF+  LLDYP YT+P NF G+KVP+VLLSGNH  I++ R E QI +T   R DL  K+ +E
  S:     1 MRFDIVTLFPDCFTSVLSSGLLGKALAKQIAQVNLVNPRDFTTDKHRKVDDEPYGGGVGMLMKPEPIFSAVESLPILERREVILMSPQGQTIDQPLLRELVSNYEQLVVICGHYEGVDDRVLHLVTREVSLGDFILTGGEIPAMALINGVVRLLPGTVAKTESLTAESFEEGLLDYPQYTRPANFRGWKVPDVLLSGNHAAISQWRYEQQIKRTSDRRPDLLEKWQQE 228
>gi|15895035|ref|NP_348384.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium acetobutylicum ATCC 824] >gi|26400816|sp|Q97I94|TRMD_CLOAB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|15024727|gb|AAK79724.1|AE007684_12 TRNA-(guanine-N1)-methyltransferase, TrmD [Clostridium acetobutylicum ATCC 824] (242 aa)
Score = 562, Expect = 4.0e-56, Identities = 111/221 (50%), Positives = 155/221 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +KI +L+LF   F+ F N S+I +A  N +++I   N R+++ D H K DD PYGGGAGMV+T QPIVD+I  VK SN  KV+ L P GK ++Q+ A +    E LI++CGHYEG DER+  Y+D E S+GD++LTGGE+A + I+DS+ R+IP V+S + S   ESF + LL+YP YT+P  F G +VP+VL+SG+H+ I K R++  +  TK  RKDLF K
  S:     5 LKIDILTLFPEMFDLF-NLSMIGRAKKNGIIEINTYNIRDYTIDKHKKTDDYPYGGGAGMVMTPQPIVDSIRSVKESNKGKVIFLGPRGKKFDQEDAKKLADREELIILCGHYEGIDERVYKYIDEEYSLGDFVLTGGEMACIPIVDSICRMIPGVLSKSESYIEESFYSGLLEYPQYTRPEEFEGARVPDVLISGHHENIRKWRRKQALKITKDRRKDLFDK 226
>gi|116495080|ref|YP_806814.1| tRNA-(guanine-N1)-methyltransferase [Lactobacillus casei ATCC 334] >gi|191638583|ref|YP_001987749.1| tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) [Lactobacillus casei] >gi|122263503|sp|Q038K0|TRMD_LACC3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|116105230|gb|ABJ70372.1| tRNA (Guanine37-N1) methyltransferase [Lactobacillus casei ATCC 334] >gi|190712885|emb|CAQ66891.1| tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) [Lactobacillus casei BL23] (255 aa)
Score = 561, Expect = 5.8e-56, Identities = 102/219 (46%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPI---VDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I VLSLF N F   +  S+I KAI   L++ ++V++R++S D H+ VDDTPYGGGAGM+L  +P+   +D +N       +V+L+ P+GK +N Q A      +HL+ ICGHYEG+DERI   V  E S+GDY+LTGGE+ AM ++D+++RL+P V+  + S  ++SF+N LL+YP YT+P  + G KVPEVL +GNH+ I + R++  + +T + R DL 
  S:     1 MQIDVLSLFPNMFEPLRE-SMIGKAIERELLNFDVVDYRSYSHDKHHHVDDTPYGGGAGMLLKPEPLFEAMDGVNERHPGPKRVILMDPAGKKFNHQAARALSQEDHLVFICGHYEGYDERIRTLVTDEYSLGDYVLTGGELPAMVMIDAIVRLLPGVLGNDESAHTDSFENGLLEYPQYTRPPEYRGMKVPEVLQNGNHQLIARWRQKESLRRTYLRRPDLL 222
>gi|188996067|ref|YP_001930318.1| tRNA (guanine-N1)-methyltransferase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931134|gb|ACD65764.1| tRNA (guanine-N1)-methyltransferase [Sulfurihydrogenibium sp. YO3AOP1] (254 aa)
Score = 560, Expect = 6.2e-56, Identities = 112/221 (50%), Positives = 153/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK--TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI ++++F ++F  FKN  ++ KAI + LV+I  +N R+F+ D H  VDD  YGGG GM+L  +PI  A +++K  + N   ++  P GKT+NQ++A +    E L++ICG YEG DER+   VD EISIGDYIL+GGE A + I+DSVIRL+P V+S + S E +SF + LL YPNYT+P  F G KVPEVLLSGNHK I K R+  ++ +T  NR DL  K
  S:     1 MKIYIITIFPDYFECFKNYGVVNKAIKSGLVEINTINLRDFTSDKHKTVDDVVYGGGPGMLLKPEPIFKAFDYIKNISKNPYTIITEPWGKTFNQEMARKLAEKEELVIICGRYEGVDERVKTLVDEEISIGDYILSGGEPATLVIMDSVIRLLPGVLSDDESKEVDSFSDGLLGYPNYTRPAEFRGMKVPEVLLSGNHKLIEKWRRFQKLKRTYKNRPDLLEK 224
>gi|160892784|ref|ZP_02073574.1| hypothetical protein CLOL250_00315 [Clostridium sp. L2-50] >gi|156865825|gb|EDO59256.1| hypothetical protein CLOL250_00315 [Clostridium sp. L2-50] (245 aa)
Score = 560, Expect = 6.7e-56, Identities = 111/222 (50%), Positives = 157/222 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M   VL+LF +   +   TSI  +A+   L+ IE VN R+F+KD H  VDD PYGGGAGMV+  +P+ +A  ++  KT    KV+ +TP G+T+ Q++A +F   + L+L+CGHYEG DER++  +  DY +SIGD++LTGGE+ AMAI+D+V RL+P V++ + S E ESF ++LL+YP YT+P  F G KVP+VLLSG+HK I   R E  I++TK  R DL+ KY
  S:     5 MNFYVLTLFPDMIMDGLRTSITGRAMEAGLIHIEAVNIRDFTKDKHKHVDDYPYGGGAGMVMQAEPVYNAYQYLCEKTGKKLKVIYMTPQGRTFTQKVAEEFAVEDDLVLLCGHYEGIDERVLELIVTDY-VSIGDFVLTGGELPAMAIIDTVSRLVPGVLNNDDSAEIESFHDDLLEYPQYTRPVEFMGKKVPDVLLSGHHKNIEAWRLEQSISRTKERRPDLYAKY 231
>gi|42526396|ref|NP_971494.1| tRNA (guanine-N(1)-)-methyltransferase [Treponema denticola ATCC 35405] >gi|85543867|sp|Q73PB5|TRMD_TREDE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|41816589|gb|AAS11375.1| tRNA (guanine-N1)-methyltransferase [Treponema denticola ATCC 35405] (243 aa)
Score = 559, Expect = 7.8e-56, Identities = 109/221 (49%), Positives = 151/221 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  VL+LF      F  TSI+ KA+   ++   +VN R+F+ D H   DD  YGGGAGM+L  +P+  A++ V  S+ +V+ +TPSGK +NQ++A +F + E L+ +CG YEG D+RII+ YVD EIS+GDY+++ GE+AA+ I+D+V RLI  VIS  SLE ESF   LL+YP YT+P NF G +VPEVLLSG+H  I+K R + +I KT   R DL  K
  S:     1 MRFDVLTLFPEIPEAFFKTSIMAKAVEKGIISCNLVNIRDFAFDKHRSCDDIVYGGGAGMLLLPEPLSLALDSVNASSKRVIYVTPSGKPFNQELAKEFSSEEALVFVCGRYEGIDQRIIDEYVDDEISVGDYVMSSGELAALVIIDAVYRLIDGVISGESLEEESFSGFLLEYPQYTRPRNFKGKEVPEVLLSGHHLNIHKWRLKKRIEKTLKTRPDLIEK 222
>gi|170759667|ref|YP_001787757.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum A3 str. Loch Maree] >gi|169406656|gb|ACA55067.1| tRNA (guanine-N1)-methyltransferase [Clostridium botulinum A3 str. Loch Maree] (240 aa)
Score = 557, Expect = 1.5e-55, Identities = 117/222 (52%), Positives = 150/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I VL+LF   F+ F N SII +AI N  + I  VN R+++ + H KVDD PYGGGAGMV+  QPIVD+I  VK  N  KV+ L P GKT+NQ +A +    E LI +CGHYEG DER   Y+D EIS+GD++LTGGE+A + I+DS+ RL+  V+ S  S E ESF N LL+YP YT+P  + G  VP+VLLSG+H+ I K RK   +  T   R DLF KY
  S:     1 MRIDVLTLFPEMFSIF-NHSIIGRAIENEFLKINTVNIRDYTINKHKKVDDYPYGGGAGMVMAAQPIVDSIKTVKKENKGKVIFLGPKGKTFNQDLAKELAREEELIFLCGHYEGIDERAYEYIDMEISLGDFVLTGGEMACIPIVDSICRLLDGVLGSSESYEDESFYNGLLEYPQYTRPAIYEGKAVPKVLLSGHHENIKKWRKAKSLIITNKVRPDLFKKY 223
>gi|20807905|ref|NP_623076.1| tRNA-(guanine-N1)-methyltransferase [Thermoanaerobacter tengcongensis MB4] >gi|26400908|sp|Q8R5S2|TRMD_THETN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|20516472|gb|AAM24680.1| tRNA-(guanine-N1)-methyltransferase [Thermoanaerobacter tengcongensis MB4] (241 aa)
Score = 556, Expect = 2.0e-55, Identities = 108/221 (48%), Positives = 147/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   VL+LF   F    + SI+K+A+  + + + ++N R+FSKD H +VDD PYGGG GMV+  QP+ DAI  VK+  N  V  L+P GK + Q++A +    E + L+CGHYEG DER+   +D EISIGD+ILTGGE+AAM ++D+V RLI  V+S   S   ESF + LL+YP YT+P  F G +VPEVLLSGNH EI + R++  +  T + R DL  K
  S:     1 MIFDVLTLFPEMFECVLSHSILKRAVEKSKLKVNLINIRDFSKDKHKRVDDYPYGGGPGMVMMPQPLFDAIEFVKSQGNIPVYYLSPKGKIFTQEMARELSKMERIALLCGHYEGIDERVYAVIDGEISIGDFILTGGELAAMVVIDAVTRLIDGVLSHPQSALEESFSDYLLEYPQYTRPEVFRGMRVPEVLLSGNHAEIARWRRQKSLEITLLKRPDLLKK 223
>gi|57234911|ref|YP_181086.1| tRNA (guanine-N1)-methyltransferase [Dehalococcoides ethenogenes 195] >gi|119382733|sp|Q3Z9L3|TRMD_DEHE1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|57225359|gb|AAW40416.1| tRNA (guanine-N1)-methyltransferase [Dehalococcoides ethenogenes 195] (248 aa)
Score = 556, Expect = 2.1e-55, Identities = 111/221 (50%), Positives = 156/221 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI VL+LF   F      SI K+A   NLV +EI NFR+FS D H+ VDDTPYGGGAGM+L  +P+ +A+  V   +   + V+LL+P G+T+NQ +A +    + LI+ICGHYEGFDER+  ++   EISIGD++LTGGE+AAM ++D+V RLIP V+   +S ES+S  N LL++P+YT+P  F G+ +PEVLLSGNH  I++ R++  + +T   R D+  K
  S:     1 MKIDVLTLFPEMFQSPFEESIFKRAADKNLVRLEIHNFRDFSHDKHHAVDDTPYGGGAGMLLKPEPLFEAVEAVMEKDPTPAPVILLSPQGRTFNQSVARELANHQRLIIICGHYEGFDERVREHLATDEISIGDFVLTGGELAAMVVIDAVSRLIPGVLGSDDSSESDSHSNGLLEHPHYTRPPVFRGWDIPEVLLSGNHARIDRWRRKESLRRTLKRRPDMLEK 226
>gi|126698853|ref|YP_001087750.1| tRNA (guanine-n(1)-)-methyltransferase [Clostridium difficile 630] >gi|168714818|ref|ZP_02747095.1| tRNA (Guanine-n(1)-)-methyltransferase [Clostridium difficile QCD-63q42] >gi|196127296|ref|ZP_03119045.1| tRNA (guanine-n(1)-)-methyltransferase [Clostridium difficile ATCC 43255] >gi|118575137|sp|Q18BC2|TRMD_CLOD6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|115250290|emb|CAJ68112.1| tRNA (Guanine-n(1)-)-methyltransferase [Clostridium difficile 630] (231 aa)
Score = 555, Expect = 2.4e-55, Identities = 118/221 (53%), Positives = 160/221 (72%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS----NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +++LF   FN + + SI+K+A+   ++++ I N R+FS + H KVDD P+GGGAGMV+T QPI D   H+ T+    N  V+ LTP GK YNQ +A Q    E +IL+CGHYEG DERII+  V  EISIGDY+LTGGE+ A+ ++DS+ RLIP V++   S E ESF +NLL+YP+YT+P +F G KVPEVLLSGNHK+I++ R+E  I  TK  R DL+ K
  S:     1 MRFHIMTLFPEIFNSYMDESIMKRAVEKGIIEVHIYNIRDFSNNKHKKVDDYPFGGGAGMVMTPQPIYDTYKHIITTHNINNPSVIYLTPKGKVYNQSMAKQMSLKEDIILLCGHYEGIDERIIDLIVTDEISIGDYVLTGGELPALIMIDSISRLIPGVLNQEESFEEESFKDNLLEYPHYTRPRDFEGLKVPEVLLSGNHKKIDEWRREESIRITKERRFDLYKK 227
>gi|89098667|ref|ZP_01171549.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus sp. NRRL B-14911] >gi|89086629|gb|EAR65748.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus sp. NRRL B-14911] (248 aa)
Score = 555, Expect = 2.6e-55, Identities = 106/219 (48%), Positives = 150/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS----NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI VL+LF   F      SI+KKA  NN V   +VNFR+++ + H  VDD PYGGGAGMVL  QPI DA+  +K        +VVLL P G+ Y Q+ A +  + +HLI +CGHYEG+DERI  + V  EISIGD++LTGGE+ AM ++DS++RL+P V+ +  S   +SF    L++P+YT+P +F G KVP++L SGNH+ +++ R +  + +T + R DLF
  S:     1 MKIDVLTLFPEMFGGVFGHSILKKAEENNAVSYNVVNFRDYADNKHKTVDDYPYGGGAGMVLKPQPIFDAVADLKVKAGGGEPRVVLLCPQGERYTQKKAEELSSLDHLIFVCGHYEGYDERIREHLVTDEISIGDFVLTGGELGAMVLIDSIVRLLPGVLGNEESHMKDSFSTGFLEHPHYTRPADFRGMKVPDILTSGNHRLVDEWRMKESLKRTYLRRPDLF 225
>gi|168696414|ref|ZP_02728691.1| tRNA (Guanine-n(1)-)-methyltransferase [Clostridium difficile QCD-37x79] >gi|168730851|ref|ZP_02763128.1| tRNA (Guanine-n(1)-)-methyltransferase [Clostridium difficile QCD-97b34] >gi|196160763|ref|ZP_03121324.1| tRNA (guanine-n(1)-)-methyltransferase [Clostridium difficile CIP 107932] (231 aa)
Score = 554, Expect = 3.5e-55, Identities = 119/221 (53%), Positives = 159/221 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT----SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +++LF   FN + + SI+K+A+   ++++ I N R+FS + H KVDD P+GGG GMV+T QPI D   H+ T    SN  V+ LTP GK YNQ IA Q    E +IL+CGHYEG DERII+  V  EISIGDY+LTGGE+ A+ ++DS+ RLIP V++   S E ESF +NLL+YP+YT+P +F G KVPEVLLSGNHK+I++ R+E  I  TK  R DL+ K
  S:     1 MRFHIMTLFPEIFNSYMDESIMKRAVEKGIIEVYIYNIRDFSNNKHKKVDDYPFGGGVGMVMTPQPIYDTYKHIITTHNISNPSVIYLTPKGKVYNQSIAKQMSLKEDIILLCGHYEGVDERIIDLIVTDEISIGDYVLTGGELPALIMIDSISRLIPGVLNQEESFEEESFKDNLLEYPHYTRPRDFEGLKVPEVLLSGNHKKIDEWRREESIRITKERRFDLYKK 227
>gi|196190023|gb|EDX84987.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. PCC 7335] (258 aa)
Score = 552, Expect = 5.3e-55, Identities = 97/222 (43%), Positives = 150/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           ++  ++SLF  FF     + +I KA+   +  +EI N R+F+ D H++VDD PYGGG GMV+  +PI  A+  +     + V+L+TP G+T  Q +  +  +++ L+LICGHYEG DER++N    E+S+GD++LT GEI A+ +L+ V+RL+P  ++  +SL+ ESF+ NLLDYP YT+P  F  + VPEVL+SGNH  I + RK+ Q+ +T+  R DLF ++
  S:    29 LRFDIVSLFPEFFVSPLESGLIGKALQRQIATVEITNPRDFTTDKHHRVDDIPYGGGVGMVMKPEPIFAAVESLPIMPKRAVILMTPQGRTMEQALFKELASYDQLVLICGHYEGVDERVLNITTQEVSLGDFVLTCGEIPALTLLNGVVRLLPGTVAKTDSLKYESFEANLLDYPQYTRPAQFRQWSVPEVLMSGNHGVIAQWRKQQQLERTQQRRPDLFKRW 252
>gi|196165600|ref|ZP_03126131.1| tRNA (guanine-n(1)-)-methyltransferase [Clostridium difficile QCD-23m63] (231 aa)
Score = 552, Expect = 5.9e-55, Identities = 118/221 (53%), Positives = 159/221 (71%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS----NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +++LF   FN + + SI+K+A+   ++++ I N R+FS + H KVDD P+GGGAGMV+T QPI D   H+ T+    N  V+ LTP GK YNQ IA      E +IL+CGHYEG DERII+  V  EISIGDY+LTGGE+ A+ ++DS+ RLIP V++   S E ESF +NLL+YP+YT+P +F G KVPEVLLSGNHK+I++ R+E  I  TK  R DL+ K
  S:     1 MRFHIMTLFPEIFNSYMDESIMKRAVEKGIIEVHIYNIRDFSNNKHKKVDDYPFGGGAGMVMTPQPIYDTYKHIITTHNINNPSVIYLTPKGKVYNQSIAKHMSLKEDIILLCGHYEGIDERIIDLIVTDEISIGDYVLTGGELPALIMIDSISRLIPGVLNQEESFEEESFKDNLLEYPHYTRPRDFEGLKVPEVLLSGNHKKIDEWRREESIRITKERRFDLYKK 227
>gi|186454784|ref|ZP_02965099.1| tRNA (guanine-N1)-methyltransferase [bacterium Ellin514] >gi|184208343|gb|EDU05387.1| tRNA (guanine-N1)-methyltransferase [bacterium Ellin514] (222 aa)
Score = 552, Expect = 5.9e-55, Identities = 106/219 (48%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV-DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK+ VL+LF   F    + SI+++A     +D+ I N R+++ D H  VDD P+GGG GM+L  +PI +A+  +    ++V+LL+PSG+ ++Q IA +    EHL+LICG YEGFDERI  ++ D E+SIGDY+LT G + AM I+D+V RL+P V+  + S   ESF + LL+YP+YT+P +F G KVPEVLLSGNH EI K R E    +TK  R DL 
  S:     1 MKVDVLTLFPAMFAGPLDESIVQRARKTGALDLTIRNLRDYTHDRHKTVDDRPFGGGPGMLLKPEPIFEAVEDLAREKTRVILLSPSGRKFDQAIARELAQQEHLLLICGSYEGFDERIREHLADDELSIGDYVLTNGALPAMVIIDAVTRLLPGVLGDDESSHEESFSHGLLEYPHYTRPADFRGMKVPEVLLSGNHAEIAKWRAEQAKLRTKERRPDLL 221
>gi|116333579|ref|YP_795106.1| tRNA-(guanine-N1)-methyltransferase [Lactobacillus brevis ATCC 367] >gi|122269734|sp|Q03RU7|TRMD_LACBA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|116098926|gb|ABJ64075.1| tRNA (Guanine37-N1) methyltransferase [Lactobacillus brevis ATCC 367] (254 aa)
Score = 551, Expect = 6.6e-55, Identities = 102/218 (46%), Positives = 150/218 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-------KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+I VLSLF + F+   + SI+ KAI N  + + + NFR++S + H  VDD P+GGGAGM+L  QPI DA+   +   +       +V+LL P+G T+NQ +A  F   EHL  +CGHYEG+DERI   V  E+S+GD++LTGGE+A+M ++D+ +RL+P V+ +  S   +SF + LL+YP YT+P +F G  VP+VL+SGNH +I K R++  + +T   R DL
  S:     1 MRIDVLSLFPDMFSGPMHDSIVGKAIENGHLTMPVTNFRDYSTNKHGNVDDYPFGGGAGMLLQPQPIFDALKATEEQAAAEGLPKGRVILLDPAGVTFNQHVAEDFAHEEHLTFLCGHYEGYDERIRTLVTDEVSLGDFVLTGGELASMVMIDATVRLLPGVLGNAESAPGDSFSSGLLEYPQYTRPADFRGMTVPDVLISGNHGKIEKWRQKEALRRTYQRRPDL 226
>gi|184155697|ref|YP_001844037.1| tRNA (guanine-N1-)-methyltransferase [Lactobacillus fermentum IFO 3956] >gi|183227041|dbj|BAG27557.1| tRNA (guanine-N1-)-methyltransferase [Lactobacillus fermentum IFO 3956] (252 aa)
Score = 551, Expect = 7.5e-55, Identities = 100/219 (45%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS------KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +LSLF + F+     SI+ +A  +  VDI++ +FR ++ D H  VDD P+GGGAGM+L  QPI DA++ ++          +V+L+ P+G+ ++Q  A +    EHL  ICGHYEG+DERI   V  E S+GDY+LTGGE+AAM ++D+ +R +P V+ +++S   +SF N LL+YP YT+P +F G KVPEVL SGNH++I + R    + +T   R DL 
  S:     1 MRIDILSLFPDMFDATLGQSIVGRAQDDGFVDIKVTDFRQYTTDKHRHVDDAPFGGGAGMLLQAQPIFDAMDAIEQETKDTYPKGRVILMDPAGRRFDQDFAMELAQEEHLTFICGHYEGYDERIRQLVTDEASLGDYVLTGGELAAMVMVDATVRFVPGVLGNMSSPMGDSFSNGLLEYPQYTRPADFRGMKVPEVLTSGNHEKIREWRMRESLKRTLERRPDLL 226
>gi|172057907|ref|YP_001814367.1| tRNA (guanine-N1)-methyltransferase [Exiguobacterium sibiricum 255-15] >gi|171990428|gb|ACB61350.1| tRNA (guanine-N1)-methyltransferase [Exiguobacterium sibiricum 255-15] (242 aa)
Score = 551, Expect = 8.2e-55, Identities = 100/219 (45%), Positives = 150/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M ITVL+LF   F    N SI+ +A     +++  VNFR++S + H +VDD+PYGGGAGM+L  QPI DAI  +  +  +++ LTP+G+ ++Q++A ++     L+ +CGHYEGFD+R+ +  V  E+S+GD++LTGGE+AAM ++D+ +RL+P+V+    S E +SF   LL+YP+YT+P +F G  VPEVLLSGNH  I   R+E  + +T   R DL 
  S:     1 MNITVLTLFPEMFTAL-NHSIVARAQEEKRIELNYVNFRDYSTNRHGRVDDSPYGGGAGMLLMPQPIFDAIADLPEAKRRIIALTPTGRRFDQRLAEEWSKETDLVFLCGHYEGFDQRVHDELVTDEVSLGDFVLTGGELAAMTMIDATVRLLPDVLGKAASHEDDSFSTGLLEYPHYTRPADFRGLTVPEVLLSGNHARIETWRREQALRRTLERRPDLL 220
>gi|71894036|ref|YP_278144.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma synoviae 53] (228 aa)
Score = 551, Expect = 8.2e-55, Identities = 107/219 (48%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNN-LLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI  L+LF  +F    N SIIKKA+   +++  +V+FR+F+K  H KVDD  YGGG G++L ++PI  A++ ++      +L+TP GK ++Q++AN+   ++ + LI G YEGFDER+   VD EISIGDY+LTGGE+ AM I DS+ RL+P VI   S+E++SF N  LLDYP YT+P  +   KVPEVL +GNHKEI++ + + Q+ KTK NR D+ 
  S:     2 MKINFLTLFPRYFEPLINESIIKKAVDKKILEFNVVDFRDFTKSKHRKVDDEIYGGGHGLLLQVEPIDLALDSLENRGGYKILVTPQGKIFDQKMANKLAKYDQITLISGRYEGFDERVTYLVDEEISIGDYVLTGGELPAMVIADSICRLVPGVIKKESVENDSFQNEGLLDYPQYTRPREYKNMKVPEVLFNGNHKEISEWKLKAQLEKTKKNRPDIL 221
>gi|148887445|sp|Q4A738|TRMD_MYCS5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|144574926|gb|AAZ43433.2| tRNA (guanine-N1)-methyltransferase [Mycoplasma synoviae 53] (227 aa)
Score = 550, Expect = 9.3e-55, Identities = 107/219 (48%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNN-LLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI  L+LF  +F    N SIIKKA+   +++  +V+FR+F+K  H KVDD  YGGG G++L ++PI  A++ ++      +L+TP GK ++Q++AN+   ++ + LI G YEGFDER+   VD EISIGDY+LTGGE+ AM I DS+ RL+P VI   S+E++SF N  LLDYP YT+P  +   KVPEVL +GNHKEI++ + + Q+ KTK NR D+ 
  S:     1 MKINFLTLFPRYFEPLINESIIKKAVDKKILEFNVVDFRDFTKSKHRKVDDEIYGGGHGLLLQVEPIDLALDSLENRGGYKILVTPQGKIFDQKMANKLAKYDQITLISGRYEGFDERVTYLVDEEISIGDYVLTGGELPAMVIADSICRLVPGVIKKESVENDSFQNEGLLDYPQYTRPREYKNMKVPEVLFNGNHKEISEWKLKAQLEKTKKNRPDIL 220
>gi|16078666|ref|NP_389485.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus subtilis subsp. subtilis str. 168] >gi|3915143|sp|O31741|TRMD_BACSU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|2633975|emb|CAB13476.1| tRNA methyltransferase [Bacillus subtilis subsp. subtilis str. 168] (243 aa)
Score = 550, Expect = 1.0e-54, Identities = 105/219 (47%), Positives = 147/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI  L+LF   F     +SI++KA   + V  ++VNFR +S + HN VDD PYGGGAGMVL  QP+ DA+  + +  +   +++L+ P G+ + Q+ A Q    EHL+ ICGHYEG+DERI  + V  EISIGD++LTGGE+ AM I DSV+RL+P V+   +   E SF   LL++P+YT+P ++ G KVPE LLSGNH +I + R +  I +T + R DL 
  S:     1 MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSKAAAAPRIILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHIEDSFSTGLLEHPHYTRPADYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLL 224
>gi|89895340|ref|YP_518827.1| tRNA-(guanine-N1)-methyltransferase [Desulfitobacterium hafniense Y51] >gi|119382737|sp|Q24UA9|TRMD_DESHY tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|89334788|dbj|BAE84383.1| tRNA-(guanine-N1)-methyltransferase [Desulfitobacterium hafniense Y51] (262 aa)
Score = 549, Expect = 1.4e-54, Identities = 101/221 (45%), Positives = 153/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MK TVL+LF   F    + SI+K+A A  L+++ ++NFR+++   H  VDD PYGGGAGMVL  +P+  A+  +  S    ++VLL+P G+ + Q+ A ++  ++ L+ ICGHYEGFDERI +  D E+S+GD++LTGGE+AAM ++D+V RL+P V+    S E +S    LL+YP+YT+P  F G +VP+VLLSG+H+ I + R++  + +T + R DLF K
  S:     1 MKFTVLTLFPEMFAPV-HESILKRAQAAQLIEVSLINFRDYAASKHKNVDDVPYGGGAGMVLKPEPLFAALRDLPPSPGRRRIVLLSPQGEVFQQRKAEEWSRWDELVFICGHYEGFDERIRSLADEEVSLGDFVLTGGELAAMVMMDAVARLLPGVLGEKASAEEDSHSGGLLEYPHYTRPPVFEGMEVPDVLLSGHHRRIEEWRRKESLRRTFLKRPDLFAK 223
>gi|154686019|ref|YP_001421180.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus amyloliquefaciens FZB42] >gi|166231337|sp|A7Z4M3|TRMD_BACA2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|154351870|gb|ABS73949.1| TrmD [Bacillus amyloliquefaciens FZB42] (243 aa)
Score = 548, Expect = 1.6e-54, Identities = 106/222 (47%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F     +SI++KA     V  +++NFR FS + H  VDD PYGGGAGMVL  QP+ DA+  +     +  +++L+ P G+ Y Q+ A +    EHL+ ICGHYEG+DERI  + V  EISIGD++LTGGE+ AM I DSV+RL+P V+   +   E SF   LL++P+YT+P ++ G KVPE LLSGNH +I K R +  I +T + R DL   Y
  S:     1 MKIDFLTLFPEMFQGVLGSSILQKAQEKEAVRFDVINFRAFSDNKHQTVDDYPYGGGAGMVLKPQPVFDAVEKLTAGTDAKPRIILVCPQGERYTQKKAEELAQEEHLMFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHVEDSFSTGLLEHPHYTRPADYRGLKVPETLLSGNHAKIQKWRNKESIRRTFLRRPDLLKNY 227
>gi|104774246|ref|YP_619226.1| tRNA (guanine-N1)-methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514336|ref|YP_813242.1| tRNA-(guanine-N1)-methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274932|sp|Q049R8|TRMD_LACDB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119382744|sp|Q1G9L4|TRMD_LACDA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|103423327|emb|CAI98170.1| tRNA (Guanine-N1)-methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093651|gb|ABJ58804.1| tRNA (Guanine37-N1) methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (245 aa)
Score = 548, Expect = 1.8e-54, Identities = 102/221 (46%), Positives = 153/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLES--ESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I VL+LF   F   +  S++ +   +    + +VNFR+FS   H  VDDTPYGGGAGMVL ++PI DA++ ++ +  KV++  P GKT+N+Q+A ++   E+L  ICGH+EGFD+R+ +  D  +SIGDY+LTGGE+  M+++D+ +RL+P ++  N+L +  ESF + LL+YP YT+P +F G KVPEVLLSGNH +I++ R    +  TK++R DL  K
  S:     1 MNINVLTLFPEMFTPLQ-VSLLGRGQEDGKWKLNLVNFRDFSDRPHKSVDDTPYGGGAGMVLQVKPIKDALDSLE-NKGKVIITAPQGKTFNEQMAQEWSKEENLTFICGHFEGFDQRVYDLADEMVSIGDYVLTGGELPTMSMIDATVRLLPGILG-NALSTVEESFSDGLLEYPQYTRPADFEGQKVPEVLLSGNHGKIDEWRHYQALKATKLHRPDLLEK 220
>gi|167212541|ref|ZP_02282848.1| hypothetical protein LmonL_16150 [Listeria monocytogenes LO28] (247 aa)
Score = 548, Expect = 1.8e-54, Identities = 102/192 (53%), Positives = 143/192 (74%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLL 192
           MKI +LS+F + F+     SIIKKAI N  V +E+ +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK +NQ++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LL
  S:     6 MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFNQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILL 203
>gi|194014664|ref|ZP_03053281.1| tRNA (guanine-N1)-methyltransferase [Bacillus pumilus ATCC 7061] >gi|194013690|gb|EDW23255.1| tRNA (guanine-N1)-methyltransferase [Bacillus pumilus ATCC 7061] (244 aa)
Score = 548, Expect = 1.9e-54, Identities = 107/218 (49%), Positives = 145/218 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MKI  L+LF   F    ++SI+KKA     V   +VNFR +S   H  VDD PYGGGAGMVL  QP+ DA+  +    SK   ++L+ P G+ Y Q+ A +    EHL+ ICGHYEG+DERI  + V  EISIGD++LTGGE+ AM I DSV+RL+P+V+   +   E SF   LL++P+YT+P ++ G KVPEVLLSGNH +I + R++  + +T   R DL
  S:     1 MKIDFLTLFPEMFEGVLHSSILKKAQEKEAVSFNVVNFREYSDHKHKTVDDYPYGGGAGMVLKAQPVFDAVEDLTKKASKKPRIILVCPQGERYTQKKAEELAKEEHLMFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPHVLGKEASHIEDSFSTGLLEHPHYTRPADYKGLKVPEVLLSGNHAKIEEWRRKESLKRTYTRRPDL 223
>gi|118443416|ref|YP_878282.1| tRNA (guanine-N(1)-)-methyltransferase [Clostridium novyi NT] >gi|166231360|sp|A0Q0Y0|TRMD_CLONN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|118133872|gb|ABK60916.1| tRNA (guanine-N1)-methyltransferase [Clostridium novyi NT] (241 aa)
Score = 548, Expect = 1.9e-54, Identities = 115/219 (52%), Positives = 151/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF   F+ F N SII +AI   ++ I+  N R++S + H KVDD PYGGGAGMV+T QPIVD+I  +K +N  KV+ L P GKT+NQ+IA      + LI ICGHYEG DER+  Y+D EIS+GD++LTGGE+A + ++DS+ RL+P V+ S  S   ESF N LL+YP YT+P  F G  VP+VLLSG+H  I K R+   +  TK  R DLF
  S:     3 MKIDILTLFPEMFDIF-NHSIIGRAIDKGILKIQSHNIRDYSMNKHKKVDDYPYGGGAGMVMTPQPIVDSIKDLKINNKGKVIFLGPRGKTFNQEIAKTLSKEKELIFICGHYEGIDERVYKYIDEEISLGDFVLTGGEMACIPVVDSICRLVPGVLSSSESYMEESFYNGLLEYPQYTRPECFEGENVPKVLLSGHHDNIRKWRRYKSLTITKTRRPDLF 222
>gi|161507704|ref|YP_001577660.1| tRNA methyltransferase [Lactobacillus helveticus DPC 4571] >gi|172048317|sp|A8YVT2|TRMD_LACH4 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|160348693|gb|ABX27367.1| tRNA methyltransferase [Lactobacillus helveticus DPC 4571] (239 aa)
Score = 547, Expect = 2.0e-54, Identities = 99/219 (45%), Positives = 150/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI VL+LF + F   +  S++ + + +   D+ +VNFR+F+ D H+ VDDTPYGGGAGMVL + PI  A++ +  S  KV++  P GKT+N+Q+A  +   + L  ICGHYEGFD+R+ +  D  +SIGDY+LTGGE+  M+++D+ +RL+P ++ +  S   ESF + LL+YP YT+P +F G KVPEVL SGNH++I + R +  +  T ++R D+ 
  S:     1 MKINVLTLFPDMFTPLQ-VSMLGRGLEDGKWDLNLVNFRDFTTDVHHHVDDTPYGGGAGMVLQIMPIKKALDSLP-STGKVIITAPQGKTFNEQMAQDWAKEDELTFICGHYEGFDQRVYDLADETVSIGDYVLTGGELPTMSMIDATVRLLPGILGNAASPVEESFSHGLLEYPQYTRPADFEGQKVPEVLTSGNHQKIAEWRHKEALKATYLHRPDML 218
>gi|134299897|ref|YP_001113393.1| tRNA (guanine-N1)-methyltransferase [Desulfotomaculum reducens MI-1] >gi|172044313|sp|A4J665|TRMD_DESRM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|134052597|gb|ABO50568.1| tRNA (Guanine37-N1) methyltransferase [Desulfotomaculum reducens MI-1] (254 aa)
Score = 547, Expect = 2.0e-54, Identities = 101/219 (46%), Positives = 153/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS----KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +L+LF   F    N SI+K+A  NNL+ I+ +N R+FS++ H+ VDDTPYGGGAGMV+  +P+ +  +H+K  N+    +V+++ P G+ + Q+ A +    E+L+++CGHYEG DER+    V  EISIGDY+LTGGE+ AM ++D+V R+IP V+    S E +SF N LL++P++TKP  + GY+VPE+LLSG+H  I K R+   + +T   R +L 
  S:     1 MRIDILTLFPEMFQGPFNHSILKRAQENNLLQIDTINIRDFSQNKHHTVDDTPYGGGAGMVMGPEPLFECFDHLKAKNAGQVGRVIMMCPQGEPFTQEYAKELAREENLVIVCGHYEGIDERVREVLVTDEISIGDYVLTGGELPAMVVVDAVARMIPGVLGETASAEEDSFYNGLLEHPHFTKPREYRGYEVPEILLSGHHGNIRKWRRRQSLLRTLERRPELL 225
>gi|191164559|ref|ZP_03026422.1| tRNA (guanine-N1)-methyltransferase [Geobacter sp. M21] >gi|190994331|gb|EDV69796.1| tRNA (guanine-N1)-methyltransferase [Geobacter sp. M21] (249 aa)
Score = 547, Expect = 2.2e-54, Identities = 107/219 (48%), Positives = 149/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK  +L+LF   F      SI+K+A    L+++ + N R+++ D H   DD PYGGGAGMV+ ++PI  AI  VK    NSKVVL TP G+ +N Q+A +    E +++ICG YEG DER+    VD EIS+GD++LTGGEIAAM I+D+V RL+P V+ S  S + +SF + LL+YP YT+P  F G KVP++LLSGNH EI K R++ Q+ +T  +R +L 
  S:     1 MKFDILTLFPAMFEGPLTESILKRASEKGLIEVALHNIRDWAFDKHATADDAPYGGGAGMVMKVEPIAGAIEAVKAKRPNSKVVLTTPCGRPFNHQVAEELSREEGVVIICGRYEGVDERVRTLCVDDEISLGDFVLTGGEIAAMVIVDAVSRLVPGVLGSDESAQYDSFADGLLEYPQYTRPPEFRGEKVPDILLSGNHAEIAKWRRKEQMKRTLASRPELL 223
>gi|157362992|ref|YP_001469759.1| tRNA (guanine-N1)-methyltransferase [Thermotoga lettingae TMO] >gi|157313596|gb|ABV32695.1| tRNA (guanine-N1)-methyltransferase [Thermotoga lettingae TMO] (246 aa)
Score = 547, Expect = 2.4e-54, Identities = 100/221 (45%), Positives = 142/221 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+I + S+F  F    K   +I +A+   ++ IE++N R+F+ D H  VDD PYGGG GMV+  +P  +   H   K SN   ++ +P G  +N +IA      E+L++ CG YEG DER++  VD EISIGDY+L+GGE+AAM I D+V R +P VI   S + +SF N LLDYP+YT+P  F+G KVP+VLLSGNH+++   R    + +T   R DLF+K
  S:     1 MRIIISSIFPEFVRVIKEYGVIAQALRQQMLQIEVLNLRDFTHDKHRTVDDYPYGGGPGMVMKPEPFFEVYRHCLDKYSNLYTIMTSPQGVQFNNRIARHLSEKENLLIFCGRYEGVDERVMKIVDMEISIGDYVLSGGELAAMVICDAVSRFVPGVIDEESAKRDSFYNELLDYPHYTRPAEFDGMKVPDVLLSGNHEKVELFRIAESLKRTAFRRPDLFVK 223
>gi|154249336|ref|YP_001410161.1| tRNA (guanine-N1)-methyltransferase [Fervidobacterium nodosum Rt17-B1] >gi|171769332|sp|A7HKS1|TRMD_FERNB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|154153272|gb|ABS60504.1| tRNA (guanine-N1)-methyltransferase [Fervidobacterium nodosum Rt17-B1] (246 aa)
Score = 546, Expect = 3.0e-54, Identities = 107/222 (48%), Positives = 149/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +L++F +F    K   +I +A+ NNL+ I+I N R+F+ D H  VDD  YGGG GMV+  +P      +      K  VVL +P GKT N +IA +    E L++ICG YEG DER++ +VD EISIGDY+LTGGE+ AM I D V R IP V+   S++++SF N+LLD+P+YT+P N +G +VPEVLLSGNH+EI   R++  + KT   R DLF+K+
  S:     1 MRIGILTIFPDFVKVIKEYGVIAQAVENNLLQIDIFNLRDFTTDKHKVVDDYAYGGGPGMVMKPEPFFKFFEYYNQMFGKPYVVLTSPQGKTLNNEIAKKLSAQERLLIICGRYEGIDERVMKFVDEEISIGDYVLTGGELPAMVITDVVSRFIPGVVEEESVKNDSFYNDLLDHPHYTRPRNIDGLEVPEVLLSGNHEEIELWRRKESLRKTISKRPDLFLKH 224
>gi|145620449|ref|ZP_01776480.1| tRNA (guanine-N1)-methyltransferase [Geobacter bemidjiensis Bem] >gi|144943274|gb|EDJ78368.1| tRNA (guanine-N1)-methyltransferase [Geobacter bemidjiensis Bem] >gi|197089150|gb|ACH40421.1| tRNA (guanine-N1)-methyltransferase [Geobacter bemidjiensis Bem] (249 aa)
Score = 546, Expect = 3.1e-54, Identities = 106/219 (48%), Positives = 149/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK  +L+LF   F      SI+K+A    L+++ + N R+++ D H   DD PYGGGAGMV+ ++PI  AI  VK    NSKV+L TP G+ +N Q A +    E +++ICG YEG DER+   +VD EIS+GD++LTGGEIAAM I+D+V RL+P V+ S  S + +SF + LL+YP YT+P  F G KVP++LLSGNH EI K R++ Q+ +T  +R +L 
  S:     1 MKFDILTLFPAMFEGPLTESILKRASDKGLIEVALHNIRDWAFDKHATADDAPYGGGAGMVMKVEPIAGAIEAVKAKNPNSKVILTTPCGRPFNHQFAEELSREEGVVIICGRYEGVDERVRTLFVDDEISLGDFVLTGGEIAAMVIVDAVSRLVPGVLGSDESAQYDSFADGLLEYPQYTRPPEFRGEKVPDILLSGNHAEIAKWRRKEQMRRTLASRPELL 223
>gi|145954980|ref|ZP_01803984.1| hypothetical protein CdifQ_04001388 [Clostridium difficile QCD-32g58] >gi|168725096|ref|ZP_02757373.1| tRNA (Guanine-n(1)-)-methyltransferase [Clostridium difficile QCD-76w55] (226 aa)
Score = 544, Expect = 4.4e-54, Identities = 118/216 (54%), Positives = 156/216 (72%)
  Q:     6 LSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT----SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           ++LF   FN + + SI+K+A+   ++++ I N R+FS + H KVDD P+GGG GMV+T QPI D   H+ T    SN  V+ LTP GK YNQ IA Q    E +IL+CGHYEG DERII+  V  EISIGDY+LTGGE+ A+ ++DS+ RLIP V++   S E ESF +NLL+YP+YT+P +F G KVPEVLLSGNHK+I++ R+E  I  TK  R DL+ K
  S:     1 MTLFPEIFNSYMDESIMKRAVEKGIIEVYIYNIRDFSNNKHKKVDDYPFGGGVGMVMTPQPIYDTYKHIITTHNISNPSVIYLTPKGKVYNQSIAKQMSLKEDIILLCGHYEGVDERIIDLIVTDEISIGDYVLTGGELPALIMIDSISRLIPGVLNQEESFEEESFKDNLLEYPHYTRPRDFEGLKVPEVLLSGNHKKIDEWRREESIRITKERRFDLYKK 222
>gi|170017561|ref|YP_001728480.1| tRNA (guanine-N1)-methyltransferase [Leuconostoc citreum KM20] >gi|169804418|gb|ACA83036.1| tRNA (guanine-N1)-methyltransferase [Leuconostoc citreum KM20] (241 aa)
Score = 544, Expect = 4.9e-54, Identities = 103/219 (47%), Positives = 147/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I VLSLF + F   K  SI+ KAI    +D  + +FR+++++ HN VDD P+GGGAGM+L  QPI DA+  V+ +      VVLL P+G+ ++  +A +     HL  I GHYEG+DERI   VD EIS+GDY+LTGGE+ AM I+D+  R +P+V+    S E +SF +NLL++P YT+P +F G KVP+VL+SGNH +I + R +  + +T   R DL 
  S:     1 MRIDVLSLFPDMFTPLKQ-SILGKAIDKGALDFHVTDFRDYTENKHNNVDDYPFGGGAGMLLMAQPIFDAMAAVEKAAGDKGHVVLLDPAGRKFDHHVAEELAQKSHLTFIAGHYEGYDERIRELVDDEISLGDYVLTGGELGAMVIIDATARFLPDVLGNQVSAEEDSFQDNLLEFPQYTRPADFRGRKVPDVLMSGNHAKIAEWRLKESLRRTWQRRPDLL 222
>gi|109645686|ref|ZP_01369606.1| tRNA (guanine-N1)-methyltransferase [Desulfitobacterium hafniense DCB-2] >gi|109643635|gb|EAT53188.1| tRNA (guanine-N1)-methyltransferase [Desulfitobacterium hafniense DCB-2] (263 aa)
Score = 544, Expect = 5.4e-54, Identities = 100/221 (45%), Positives = 152/221 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MK TVL+LF   F    + SI+K+A A  L+++ ++NFR+++   H  VDD PYGGGAGMVL  +P+  A+  +  S    ++VLL+P G+ + Q+ A ++  ++ L+ ICGHYEGFDER  +  D E+S+GD++LTGGE+AAM ++D+V RL+P V+    S E +S    LL+YP+YT+P  F G +VP+VLLSG+H+ I + R++  + +T + R DLF K
  S:     2 MKFTVLTLFPEMFAPV-HESILKRAQAAQLIEVSLINFRDYAASKHKNVDDVPYGGGAGMVLKPEPLFAALRDLPPSPGRRRIVLLSPQGEVFQQRKAEEWSRWDELVFICGHYEGFDERTRSLADEEVSLGDFVLTGGELAAMVMMDAVARLLPGVLGEKASAEEDSHSGGLLEYPHYTRPPVFEGMEVPDVLLSGHHRRIEEWRRKESLRRTFLKRPDLFAK 224
>gi|157692282|ref|YP_001486744.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus pumilus SAFR-032] >gi|166988159|sp|A8FD67|TRMD_BACP2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|157681040|gb|ABV62184.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus pumilus SAFR-032] (244 aa)
Score = 543, Expect = 6.8e-54, Identities = 106/218 (48%), Positives = 145/218 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MKI  L+LF   F    ++SI+KKA     V   +VNFR +S   H  VDD PYGGGAGMVL  QP+ DA+  +    SK   ++L+ P G+ Y Q+ A +    EHL+ ICGHYEG+DERI  + V  EISIGD++LTGGE+ AM I DSV+RL+P+V+   +   E SF   LL++P+YT+P ++ G KVP+VLLSGNH +I + R++  + +T   R DL
  S:     1 MKIDFLTLFPEMFEGVLHSSILKKAQEKEAVSFNVVNFREYSDHKHKTVDDYPYGGGAGMVLKAQPVFDAVEDLTNKASKKPRIILVCPQGERYTQKKAEELAKEEHLMFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPHVLGKEASHIEDSFSTGLLEHPHYTRPADYKGLKVPDVLLSGNHAKIEEWRRKESLKRTYTRRPDL 223
>gi|30263844|ref|NP_846221.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus anthracis str. Ames] >gi|42782933|ref|NP_980180.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus cereus ATCC 10987] >gi|47529269|ref|YP_020618.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186691|ref|YP_029943.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus anthracis str. Sterne] >gi|49478409|ref|YP_037902.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141647|ref|YP_085182.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus cereus E33L] >gi|65321169|ref|ZP_00394128.1| COG0336: tRNA-(guanine-N1)-methyltransferase [Bacillus anthracis str. A2012] >gi|118479063|ref|YP_896214.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|166231338|sp|A0RHL4|TRMD_BACAH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|38258428|sp|Q81JG7|TRMD_BACAN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|77416684|sp|Q636I5|TRMD_BACCZ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|84029197|sp|Q6HEX4|TRMD_BACHK tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|85543857|sp|Q732M9|TRMD_BACC1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|30258488|gb|AAP27707.1| tRNA (guanine-N1)-methyltransferase [Bacillus anthracis str. Ames] >gi|42738860|gb|AAS42788.1| tRNA (guanine-N1)-methyltransferase [Bacillus cereus ATCC 10987] >gi|47504417|gb|AAT33093.1| tRNA (guanine-N1)-methyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180618|gb|AAT55994.1| tRNA (guanine-N1)-methyltransferase [Bacillus anthracis str. Sterne] >gi|49329965|gb|AAT60611.1| tRNA (guanine-N1)-methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975116|gb|AAU16666.1| tRNA (guanine-N1)-methyltransferase [Bacillus cereus E33L] >gi|118418288|gb|ABK86707.1| tRNA (Guanine37-N1) methyltransferase [Bacillus thuringiensis str. Al Hakam] (244 aa)
Score = 543, Expect = 7.1e-54, Identities = 109/219 (49%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF + F     +SI+KKA     V++ +VNFR+++   HN VDD PYGGGAGMVLT QPI DA+  +        +VVL+ P G+ + Q+ A +    EHLI +CGHYEG+DERI  + V  EISIGDY+LTGGE+A+M I DSV+RL+P V+  ++ + E SF   LL++P+YT+P +F G KVP+VL+SGNHK I++ R +  + +T   R DL 
  S:     1 MKIDILTLFPDMFTGVFGSSILKKAQEKEAVELRVVNFRDYTTSKHNSVDDYPYGGGAGMVLTPQPIFDAVEDLTKETERKPRVVLMCPQGERFTQKKAEELAEEEHLIFVCGHYEGYDERIREHLVTDEISIGDYVLTGGELASMVITDSVVRLLPGVLGNHASQVEDSFSTGLLEHPHYTRPADFRGMKVPDVLMSGNHKNIDEWRHKESLRRTYTRRPDLL 224
>gi|116629445|ref|YP_814617.1| tRNA-(guanine-N1)-methyltransferase [Lactobacillus gasseri ATCC 33323] >gi|116095027|gb|ABJ60179.1| tRNA (Guanine37-N1) methyltransferase [Lactobacillus gasseri ATCC 33323] (245 aa)
Score = 542, Expect = 8.1e-54, Identities = 99/219 (45%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI VL+LF + F   +  S++ + + +   ++ +VNFRNF+ D H+ VDDTPYGGGAGMVL + PI  A++ + T+  KV++  P GKT+N+++A  +   E+L  ICGHYEGFD+R+ +  D  +SIGDY+LTGGE+  M+++D+ +RL+P ++ +  S   ESF + LL+YP YT+P +F G KVPEVL SGNH++I + R +  +  T ++R D+ 
  S:     6 MKINVLTLFPDMFTPLQ-VSMLGRGLEDKKWELNLVNFRNFTTDVHHHVDDTPYGGGAGMVLQIMPIKKALDSL-TNKGKVIITAPQGKTFNEKMAQDWSKEENLTFICGHYEGFDQRVYDLADETVSIGDYVLTGGELPTMSMIDATVRLLPGILGNAASPVEESFSHGLLEYPQYTRPADFEGQKVPEVLTSGNHQKIAEWRHKEALRATYLHRPDML 223
>gi|85860171|ref|YP_462373.1| tRNA (guanine-N(1)-)-methyltransferase [Syntrophus aciditrophicus SB] >gi|119371006|sp|Q2LVU2|TRMD_SYNAS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|85723262|gb|ABC78205.1| tRNA (Guanine-N(1)-)-methyltransferase [Syntrophus aciditrophicus SB] (250 aa)
Score = 540, Expect = 1.3e-53, Identities = 99/221 (44%), Positives = 151/221 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           ++  +LS F   F+   + S++KKA    L++I + N R++++D H   DD PYGGG GM++ ++P+  A+  ++       VVLLTP G+ +NQ++A +      ++LICGHYEG DERI +   + EISIGDY+LTGGE++AM ++DSV RL+P V+ +V+S   +SF + LL+YP YT+P  + G+KVPEVLLSGNHK I+  R++  + +T + R DL  K
  S:     2 LRFDILSTFPEMFDSPFSCSLLKKAQDKGLIEIRLHNIRDYTEDRHRMTDDAPYGGGGGMLMKVEPVDKALRCIEADRDHIPVVLLTPQGQVFNQEVAEELSKHSRIVLICGHYEGVDERIRVRLANREISIGDYVLTGGELSAMVLVDSVSRLVPGVLGNVDSAAFDSFSSGLLEYPQYTRPSEYRGWKVPEVLLSGNHKTIDSWRRKEALKRTWLRRPDLIEK 226
>gi|83589819|ref|YP_429828.1| tRNA (Guanine37-N1) methyltransferase [Moorella thermoacetica ATCC 39073] >gi|119370972|sp|Q2RJV4|TRMD_MOOTA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|83572733|gb|ABC19285.1| tRNA (Guanine37-N1) methyltransferase [Moorella thermoacetica ATCC 39073] (250 aa)
Score = 540, Expect = 1.4e-53, Identities = 100/221 (45%), Positives = 149/221 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV----KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M++ VL++F   F  F NTSIIK+A     +++ +VN R ++++ H  VDD P+GGG GMV+  +P+  A+  +    + +   V+L++P G+ +NQ +A +    EHLILICGHYEG DER+ +  V  EISIGDY+LTGGE+ AM I+D+V RL+P V+        +SF   LL+YP YT+P +F G +VPEVLLSGNH++I + R++  + +T   R DL  +
  S:     1 MRVDVLTIFPEMFTGFLNTSIIKRAREQGRLEVNLVNIRAYARNKHRNVDDYPFGGGPGMVMQAEPLFLAVEDLLPGGEAARPPVILMSPQGEAFNQGMAEELAREEHLILICGHYEGVDERVRLALVTREISIGDYVLTGGELPAMVIIDAVTRLLPGVLGAPEGAREDSFAMGLLEYPQYTRPRSFRGLEVPEVLLSGNHEQIRRWRRQQALERTWRRRPDLLAR 227
>gi|171778253|ref|ZP_02919459.1| hypothetical protein STRINF_00301 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282953|gb|EDT48377.1| hypothetical protein STRINF_00301 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (237 aa)
Score = 540, Expect = 1.5e-53, Identities = 106/222 (47%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   +  SI+ KA    L+DI   NFR+ ++ + + VDD PYGGG GM+L  QPI D I+ +     +V+LL P+G+T++Q  A +    + LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM I+D+ +RLIPNV+    S + +SF + LL++P YT+PY+F G KVP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     1 MKIDILTLFPEMFAPLE-YSIVGKAKEKGLLDINYHNFRDNAEKARH-VDDEPYGGGQGMLLRAQPIFDTIDKIDAKKPRVILLDPAGRTFDQSYAEELAQEDELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPNVLGKEASHQDDSFSSGLLEFPQYTRPYDFRGMKVPDVLMSGHHENIRKWRIEQSLRKTLERRPDLLEDY 221
>gi|85057587|ref|YP_456503.1| tRNA (guanine-N1) -methyltransferase [Aster yellows witches'-broom phytoplasma AYWB] >gi|119382720|sp|Q2NJG9|TRMD_AYWBP tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|84789692|gb|ABC65424.1| tRNA (Guanine-N1) -methyltransferase [Aster yellows witches'-broom phytoplasma AYWB] (242 aa)
Score = 540, Expect = 1.5e-53, Identities = 105/219 (47%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFE-HLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++++F +FF  F  TSIIK+A+    V I+I + R +S + HN+VDD+ YGGG GM+L+  P  D +  +KT  SKV+LL+P G+ +NQ  A  F   E HLI++CG+YEG D RI+ Y+D EISIGDY+LTGGEIAA  ++D++ RLIP VI   S   +S    LL YP YT+P N+  + VP +LLSGNH +I   R++  + KT   R DL 
  S:     1 MIIEIITIFPSFFKSFCETSIIKRALEQKKVQIKIHDLRIYSSNKHNQVDDSVYGGGVGMLLSFPPFFDCLQKIKTPQSKVILLSPQGQIFNQIHATNFAQKETHLIILCGNYEGVDARILQYIDAEISIGDYVLTGGEIAATVLVDAITRLIPGVIKEQSYLEDSHQQGLLKYPQYTRPQNYFNHVVPTILLSGNHAKIRSWRQKESLKKTLQKRPDLL 220
>gi|172037150|ref|YP_001803651.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. ATCC 51142] >gi|171698604|gb|ACB51585.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. ATCC 51142] (242 aa)
Score = 538, Expect = 2.3e-53, Identities = 107/222 (48%), Positives = 155/222 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M I V++LF +FF     + ++ KA+AN++  + ++N R+F+ D H++VDD PYGGG GMVL  +PI  A+N V +  +++V+LLTP G    Q       T ++ LILICGHYEG DERI    D EIS+GD+ILT GEI A+A+++ V+RL+P  +  V SL++ESF++ LLDYP YT+P  F  +++PEVL SGNH+ I + RKE QI +T+  R DL+ K+
  S:     1 MNIDVITLFPDFFTSGLQSGLLGKALANHIATVNLINPRDFALDKHHRVDDIPYGGGVGMVLKPEPIFAAVNSVHRLPSTQVILLTPQGSPLTQTTLQDLSTNYQQLILICGHYEGVDERIRYLADREISLGDFILTCGEIPALALINGVVRLLPGTVGKVESLKAESFEDGLLDYPQYTRPAVFQDWQIPEVLRSGNHQLIAQWRKEQQIQRTQQRRPDLWEKF 225
>gi|39938957|ref|NP_950723.1| tRNA-(guanine-N1)-methyltransferase [Onion yellows phytoplasma OY-M] >gi|83287917|sp|Q6YQA4|TRMD_ONYPE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|39722066|dbj|BAD04556.1| tRNA-(guanine-N1)-methyltransferase [Onion yellows phytoplasma OY-M] (242 aa)
Score = 538, Expect = 2.5e-53, Identities = 103/219 (47%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFE-HLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++++F  FF  F  TSIIK+A+    V I++ + R +SK+ HN+VDD+ YGGG GM+L+  P  D +  +KT  SKV+LL+P GK +NQ  A  F   E HLI++CG+YEG D RI+ Y+D EISIGDY+LTGGEIAA  ++D++ RL+P VI   S   +S    LL +P YT+P ++  ++VP VLLSGNH +I   R++  +  T   R DL 
  S:     1 MIIEIITIFPLFFKSFCETSIIKRALEQKKVQIKLHDLRTYSKNKHNQVDDSVYGGGVGMLLSFPPFFDCLQKIKTPQSKVILLSPQGKIFNQIHATNFAQKETHLIILCGNYEGVDARILQYIDAEISIGDYVLTGGEIAATVLVDAITRLLPEVIKEQSFLEDSHQQGLLKHPQYTRPQSYLNHEVPAVLLSGNHAKIRCWRQKESLKATLQKRPDLL 220
>gi|19703628|ref|NP_603190.1| tRNA (guanine-N1) -methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|26400757|sp|Q8R5Y4|TRMD_FUSNN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|19713738|gb|AAL94489.1| tRNA (Guanine-N1) -methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (238 aa)
Score = 538, Expect = 2.5e-53, Identities = 106/218 (48%), Positives = 154/218 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MKI +L+LF   F+ F + SII +AI    V++ I++ R++  D H + DD P+GGG GMV+  +P+  A+ +V   + KV+  +P GK +NQ+IA +    E L +I GHYEG DER++ N VD E+SIGD++LTGGEIAAMAI D++IRL+P+VI   S E++SF N LLDYP+YT+P  +   KVPEVLLSGNHK+I++ R +  + +T + R++L
  S:     1 MKINILTLFPKMFDGFLSESIIARAIKFGAVEVNIIDIRDYCFDKHKQADDMPFGGGNGMVMKPEPLFLALENV---SGKVIYTSPQGKIFNQEIAKELVKEEELTIIAGHYEGVDERVVENKVDMELSIGDFVLTGGEIAAMAISDTIIRLLPDVIKKESYENDSFYNGLLDYPHYTRPAEYKDLKVPEVLLSGNHKKIDEWRLKESLRRTYLRRREL 216
>gi|46446290|ref|YP_007655.1| tRNA (guanine-N(1)-)-methyltransferase [Candidatus Protochlamydia amoebophila UWE25] >gi|67473686|sp|Q6MDG9|TRMD_PARUW tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46399931|emb|CAF23380.1| probable tRNA (guanine N-1)-methyltransferase [Candidatus Protochlamydia amoebophila UWE25] (222 aa)
Score = 538, Expect = 2.6e-53, Identities = 106/219 (48%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + +LSLF  +F    + SI+K+A    L+ I + + R+F+ +  ++VDD PYGGG GMV+  QP+  AI HVKT  +KV+ L+P G+T N     Q    +HLIL+CGHYEG D+R+++  VD EISIGDY+LT G +AA+ +LD+  R IP V+   S  +E SF+  LLDYP+YT+P  F G  VP VLLSGNH+EI K R E  + KT+  R DL 
  S:     1 MIVDILSLFPGYFKGPFDESILKRAQEKGLLTIRLTDIRDFADNRFHRVDDRPYGGGPGMVMMPQPVTMAIQHVKTPEAKVIYLSPQGRTLNAVKCRQLALEKHLILLCGHYEGIDQRVLDEEVDEEISIGDYVLTNGCLAAIVLLDAFSRFIPGVLGHPSAAAEDSFEGGLLDYPHYTRPEVFQGCSVPNVLLSGNHQEIAKWRHEQALKKTQEIRPDLL 221
>gi|42519385|ref|NP_965315.1| tRNA (guanine-N1)-methyltransferase [Lactobacillus johnsonii NCC 533] >gi|68065368|sp|Q74IQ6|TRMD_LACJO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|41583673|gb|AAS09281.1| tRNA (Guanine-N1)-methyltransferase [Lactobacillus johnsonii NCC 533] (240 aa)
Score = 537, Expect = 3.0e-53, Identities = 100/219 (45%), Positives = 153/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI VL+LF + F   +  S++ + + +   ++ +VNFR+F+ D H+ VDDTPYGGGAGMVL + PI  A++ + T+  KV++  P GKT+N+++A  +   E+L  ICGHYEGFD+RI +  D  +SIGDY+LTGGE+  M+++D+ +RL+P ++  S + +E ESF + LL+YP YT+P +F G KVPEVL SGNH++I + R +  +  T + R D+ 
  S:     1 MKINVLTLFPDMFTPLQ-VSMLGRGLEDKKWELNLVNFRDFTSDVHHHVDDTPYGGGAGMVLQIMPIKKALDSL-TNKGKVIITAPQGKTFNEKMAQDWSKEENLTFICGHYEGFDQRIYDLADETVSIGDYVLTGGELPTMSMIDATVRLLPGILGNSASPVE-ESFSHGLLEYPQYTRPADFEGQKVPEVLTSGNHQKIAEWRHKEALRATYLYRPDML 218
>gi|52785582|ref|YP_091411.1| tRNA (guanine-N(1)-)-methyltransferase [Bacillus licheniformis ATCC 14580] >gi|163119433|ref|YP_078996.2| tRNA (guanine-N(1)-)-methyltransferase [Bacillus licheniformis ATCC 14580] >gi|84029198|sp|Q65JP6|TRMD_BACLD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|52348084|gb|AAU40718.1| TrmD [Bacillus licheniformis DSM 13] >gi|145902940|gb|AAU23358.2| tRNA methyltransferase [Bacillus licheniformis ATCC 14580] (243 aa)
Score = 535, Expect = 4.8e-53, Identities = 103/222 (46%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F     +SI++KA   + V   +VNFR +S + H  VDD PYGGGAGMVL  QP+ DA+  +      + +++L+ P G+ Y QQ A +    EHL+ ICGHYEG+DERI  ++   EISIGD++LTGGE+ AM I DSV+RL+P V+       E SF   LL++P+YT+P ++ G KVP+VL SGNH +I + R++  + +T + R DL   Y
  S:     1 MKIDFLTLFPEMFEGVLGSSILQKAQDKDAVRFRVVNFRAYSDNKHQTVDDYPYGGGAGMVLKPQPVFDAVEKLTAEAGGSPRIILVCPQGERYTQQKAEELAREEHLMFICGHYEGYDERIREHLSTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEESHLEDSFSTGLLEHPHYTRPADYKGLKVPDVLTSGNHAKIKEWRRKESLRRTFLRRPDLLENY 227
>gi|148265780|ref|YP_001232486.1| tRNA (guanine-N1)-methyltransferase [Geobacter uraniireducens Rf4] >gi|189036084|sp|A5G7Z5|TRMD_GEOUR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|146399280|gb|ABQ27913.1| tRNA (Guanine37-N1) methyltransferase [Geobacter uraniireducens Rf4] (247 aa)
Score = 535, Expect = 5.7e-53, Identities = 101/219 (46%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK  +L+LF   F+     SI+K+A    L+++++ N R+F+ D H+  DD PYGGGAGMV+ ++P+   I H K  +  ++V+L TP G+++N  +A +    E LI+ICG YEG DER+   +VD EISIGD++LTGGE+AAM ++D+V R +P V+ S  S  ++SF + LL+YP YT+P  F G  VP VLLSGNH+EI K R+   + +T  +R DL 
  S:     1 MKFDILTLFPAMFDGPLTESILKRAAEKGLIEVKLHNIRDFAFDRHSVTDDYPYGGGAGMVMKVEPLAACIEHAKVGSPRARVILTTPRGRSFNHAVAEELAREEALIIICGRYEGVDERVRELFVDDEISIGDFVLTGGEMAAMVLVDAVSRFVPGVLGSDESAVNDSFADGLLEYPQYTRPAEFRGLGVPSVLLSGNHQEIAKWRRRQSLGRTAASRPDLL 223
>gi|196176792|gb|EDX71803.1| tRNA (guanine-N1)-methyltransferase [Microcoleus chthonoplastes PCC 7420] (298 aa)
Score = 535, Expect = 5.7e-53, Identities = 95/224 (42%), Positives = 155/224 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           ++  V++LF +FF     + ++ KA+   +  + +VN R+F+ D H +VDD PYGGG GM++  +PI  A+  + +    +V+L+TP G+  NQ +  +  T ++ +++ICGHYEG DER+++ V  E+S+GD++LT GEI A+A+++ V+RL P  +  V SL+ ESF+  LLDYP +T+P  F G+ VP+VLLSGNH+ I++ RK+ QI +T+  R DL+ K++K
  S:    54 VRFDVVTLFPDFFTSPLASGLLGKALTKQIAQVHLVNPRDFATDKHRRVDDEPYGGGVGMLMKPEPIFAAVESLPRLPRREVILMTPQGQPMNQPLLVELATGYDQIVIICGHYEGVDERVLHLVTREVSLGDFVLTCGEIPALALINGVVRLRPGTVGKVESLKLESFEAGLLDYPQWTRPAEFRGWHVPDVLLSGNHQAIDQWRKDQQIQRTRERRPDLYDKWVK 280
>gi|39995752|ref|NP_951703.1| tRNA (guanine-N1)-methyltransferase [Geobacter sulfurreducens PCA] >gi|84029215|sp|Q74FG3|TRMD_GEOSL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|39982516|gb|AAR33976.1| tRNA (guanine-N1)-methyltransferase [Geobacter sulfurreducens PCA] (245 aa)
Score = 535, Expect = 6.2e-53, Identities = 102/221 (46%), Positives = 147/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MK  +L+LF   F+     SII++A+    VDI + N R+++ D H  VDD PYGGG GMV+ ++P+   I  VK     ++V+L TP G+ ++   A +   +E LI++CG YEG DER+ + +VD E SIGD++LTGGE+AAM ++D+VIR IP V+ S  S E +SF + LL+YP YT+P  F G +VP VLLSGNH EI++ R++  +  T+  R DL  K
  S:     1 MKFDILTLFPAMFDGPLTESIIRRAVERGFVDISLHNIRDYATDRHRVVDDAPYGGGDGMVMKVEPLAACIEAVKAERPAARVILTTPRGRRFDHDAARELAGYEELIIVCGRYEGIDERVRDLFVDDEFSIGDFVLTGGELAAMVMIDAVIRFIPGVLGSPGSAEYDSFADGLLEYPQYTRPVEFRGVQVPGVLLSGNHAEISRWRRQKALELTRRVRPDLLHK 225
>gi|37520458|ref|NP_923835.1| tRNA (guanine-N(1)-)-methyltransferase [Gloeobacter violaceus PCC 7421] >gi|46577346|sp|Q7MBC8|TRMD_GLOVI tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|35211452|dbj|BAC88830.1| tRNA methyltransferase [Gloeobacter violaceus PCC 7421] (227 aa)
Score = 534, Expect = 6.3e-53, Identities = 101/219 (46%), Positives = 151/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYV-DYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +++LF  FF      S++ +AIA  + +I I N R+F+ D +  VDDTPYGGGAGMVL  +P+  A+  +   +   V+LLTP G+   Q         +  L+L+CGHYEG DER+  ++  +EIS+GD++LTGGEI A+A++D ++RL+P  + +  SLESESF++NLL+YP YT+P +F G++VPEVLLSG+H +I   R+E Q+ +T+  R DL 
  S:     1 MRIDIVTLFPEFFVSPLQCSLLARAIAGGVCNIAITNPRDFAADRYRTVDDTPYGGGAGMVLKPEPLFAAVESLPIIAPRAVILLTPQGRPLKQVFLRSLAADYAQLVLLCGHYEGVDERVRAHLATHEISLGDFVLTGGEIPALALIDGIVRLLPGTVGNRASLESESFEDNLLEYPQYTRPADFRGWQVPEVLLSGHHAQIAHWRREQQLTRTRERRPDLL 223
>gi|148322882|gb|EDK88132.1| tRNA (guanine-N(1)-)-methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (238 aa)
Score = 534, Expect = 6.9e-53, Identities = 105/218 (48%), Positives = 153/218 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MKI +L+LF   F+ F + SII +AI    V++ I++ R++  D H + DD P+GGG GMV+  +P+  A+ +V   + KV+  +P GKT+NQ+IA +    E L +I GHYEG DER++ N VD E+SIGD++LTGGEI AM I D++IRL+P+VI   S E++SF N LLDYP+YT+P  +   KVPEVLLSGNHK+I++ R +  + +T + R++L
  S:     1 MKINILTLFPKMFDGFLSESIIARAIKFGAVEVNIIDIRDYCFDKHKQADDMPFGGGNGMVMKPEPLFLALENV---SGKVIYTSPQGKTFNQEIAKELVKEEELTIIAGHYEGIDERVVENKVDMELSIGDFVLTGGEIPAMTISDTIIRLLPDVIKKESYENDSFYNGLLDYPHYTRPAEYKDLKVPEVLLSGNHKKIDEWRLKESLRRTYLRRREL 216
>gi|162448031|ref|YP_001621163.1| tRNA (guanine-N1-)-methyltransferase [Acholeplasma laidlawii PG-8A] >gi|189036069|sp|A9NHF7|TRMD_ACHLI tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|161986138|gb|ABX81787.1| tRNA (guanine-N1-)-methyltransferase [Acholeplasma laidlawii PG-8A] (243 aa)
Score = 534, Expect = 7.7e-53, Identities = 107/220 (48%), Positives = 147/220 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFK-TFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFI 220
           M I ++++F NFF++F  TS IK AI +  V+I I + R ++     K+DDTPYGGGAGM++   P    IN +KT ++  VLL+P G  +NQQ+A +++   +HLILICGHYEG D+RI N +D EISIGDY+LTGGEI AM I DS+ RLIP VI+  S   ++    LL YP YTKP  + G  VP++L SG+H++I   R E  + KT + R DL +
  S:     1 MIIDIITIFPNFFDQFLTTSKIKHAIEDKRVEINIHDLRLYTDLKGGKIDDTPYGGGAGMLMIYPPFHKLINKLKTKDTYTVLLSPQGNVFNQQVATKWRDEIKHLILICGHYEGIDDRIQNLIDEEISIGDYVLTGGEIPAMVITDSITRLIPGVINEASYMEDTHQQGLLKYPQYTKPDEYLGMSVPDILKSGHHEKIRLWRLEKSLEKTYLKRPDLLV 221
>gi|119489857|ref|ZP_01622612.1| tRNA methyltransferase [Lyngbya sp. PCC 8106] >gi|119454285|gb|EAW35436.1| tRNA methyltransferase [Lyngbya sp. PCC 8106] (226 aa)
Score = 533, Expect = 1.0e-52, Identities = 97/201 (48%), Positives = 140/201 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINK 201
           M+  +++LF +FF+    + ++ KA+A  +  I +VN R+F+ D H +VDD PYGGG GMVL  +PI  A+  V       ++LLTP G+  NQ +  ++ T F+ L++ICGHYEG DERI + V  E+S+GD++LTGGEI AM +++ VIRL+P  +    SL++ESF+  LLDYP+YT+P  F G+KVP+VL SGNH EI K
  S:     1 MRFDIITLFPDFFSSPLQSGLLGKALAKEIAQIHLVNPRDFTTDKHRRVDDEPYGGGVGMVLKPEPIFAAVESVPILPRRDIILLTPQGERMNQSLFREWATNFDQLVVICGHYEGIDERITHIVTREVSLGDFVLTGGEIPAMTLVNGVIRLLPGTVGKEESLKAESFEQQLLDYPHYTRPAEFRGWKVPDVLRSGNHAEIEK 204
>gi|71893633|ref|YP_279079.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma hyopneumoniae J] >gi|72080624|ref|YP_287682.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma hyopneumoniae 7448] >gi|119370974|sp|Q4A880|TRMD_MYCH7 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119370975|sp|Q4AA53|TRMD_MYCHJ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|71851760|gb|AAZ44368.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma hyopneumoniae J] >gi|71913748|gb|AAZ53659.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma hyopneumoniae 7448] (227 aa)
Score = 532, Expect = 1.1e-52, Identities = 112/224 (50%), Positives = 165/224 (73%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MKI +L+LF  +F  F   SII KAI    + I +VNFR+FSK+ H KVDD  YGGG G++L +QP+VDA+  V       + L+P G+ ++Q +A +    + + ++CGHYEGFD+RII N++D+E+S+GD+ILTGGEIAAMAI+D++IRL P++I+  SL++E+F++ LLD+P Y++P NF G +VP+VL+SGNH+EI + R+E +   TK  R DL+ K+LK
  S:     1 MKINILTLFPRYFEVFCRESIIGKAIKQKKITINVVNFRDFSKNKHKKVDDYVYGGGPGLLLQIQPVVDALEKV---GGLKIALSPQGQKFDQSVARKLAKEDEITILCGHYEGFDQRIIDNFIDFELSLGDFILTGGEIAAMAIIDAIIRLKPDIINPESLKNETFNDFLLDFPQYSRPANFRGLEVPKVLISGNHREIGEWRQEQRELITKKKRPDLWEKFLK 222
>gi|42520832|ref|NP_966747.1| tRNA (guanine-N1)-methyltransferase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|84029287|sp|Q73GD5|TRMD_WOLPM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|42410572|gb|AAS14681.1| tRNA (guanine-N1)-methyltransferase [Wolbachia endosymbiont of Drosophila melanogaster] (236 aa)
Score = 531, Expect = 1.6e-52, Identities = 104/217 (47%), Positives = 153/217 (70%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFD--NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +T+LS+F   F  F N S+  KA+   + ++E++N R+F+KD H+ VDD PYGGGAGMV+    + DA++ + +   N+K + +TPSG  +NQ IA +   F H+ ++CG +EG D+RII+ Y  YE+SIGDYIL+GGE AAM +LD+ IRL+P V+ + +S+  ESF+    +L+YP YT+P  + GYKVPEVLLSGNHK+I+  R++     TK  R +L 
  S:     5 VTILSIFPEMFPGFLNYSLAGKALEKKIWNLEVINIRSFAKDKHSTVDDVPYGGGAGMVMRSDVVGDAVDSMLSVHKNTKFIYMTPSGTKFNQNIARELLEFPHITILCGRFEGIDQRIIDAYTPYELSIGDYILSGGEPAAMVVLDACIRLLPGVVNNTDSITEESFNYGGGVLEYPQYTRPEQWKGYKVPEVLLSGNHKKISDWRQKQSHVITKKRRPELL 227
>gi|15902731|ref|NP_358281.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae R6] >gi|116516895|ref|YP_816173.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae D39] >gi|148992444|ref|ZP_01822139.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae SP9-BS68] >gi|149010593|ref|ZP_01831964.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|149021645|ref|ZP_01835676.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae SP23-BS72] >gi|168488448|ref|ZP_02712647.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae SP195] >gi|182683697|ref|YP_001835444.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae CGSP14] >gi|122278941|sp|Q04LC5|TRMD_STRP2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|38258580|sp|Q8CWS4|TRMD_STRR6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|15458276|gb|AAK99491.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae R6] >gi|116077471|gb|ABJ55191.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae D39] >gi|147765074|gb|EDK72003.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|147928761|gb|EDK79774.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae SP9-BS68] >gi|147930106|gb|EDK81092.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae SP23-BS72] >gi|182629031|gb|ACB89979.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae CGSP14] >gi|183573072|gb|EDT93600.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae SP195] (239 aa)
Score = 531, Expect = 1.6e-52, Identities = 107/222 (48%), Positives = 149/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F+  ++ SI+ KA    L+DI+  NFR N  K  H  VDD PYGGG GM+L +QPI D+ + ++  N +V+LL P+GK ++Q  A      E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H++I + R    + KT   R DL   Y
  S:     1 MKIDILTLFPEMFSPLEH-SIVGKAREKGLLDIQYHNFRENAEKARH--VDDEPYGGGQGMLLRVQPIFDSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELIFICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDDSFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHY 221
>gi|158337230|ref|YP_001518405.1| tRNA (guanine-N(1)-)-methyltransferase [Acaryochloris marina MBIC11017] >gi|189036068|sp|B0CAM2|TRMD_ACAM1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|158307471|gb|ABW29088.1| tRNA (guanine-N1)-methyltransferase [Acaryochloris marina MBIC11017] (235 aa)
Score = 530, Expect = 2.0e-52, Identities = 99/226 (43%), Positives = 152/226 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+  +L+LF  FF     TS++ KA+AN + ++ + N R+F+ D H++VDD  YGGG GM++  +PI  A+  +      ++VL TP G+  +Q + ++    ++ L++ICGHYEG DER+  + V  E+S+GD++LT GEI A+ +L+ VIRL P  +  V SL+ ESF+  LLDYP YT+P  F G++VP VL SGNH  I + R+E QI +T+  R DL+ K+LK++
  S:     1 MRFDILTLFPEFFTSPLQTSLLGKALANEVAEVHLTNPRDFTTDKHHRVDDEVYGGGVGMLMKPEPIFAAVESLPCLPRRQIVLFTPQGRPMDQPLFHELANHYDQLVMICGHYEGVDERVAEHLVTQELSLGDFVLTCGEIPALTLLNGVIRLRPGTVGKVESLKKESFETELLDYPQYTRPAEFRGWQVPSVLRSGNHALIERWRQEQQIQRTRDRRPDLYQKWLKKS 230
>gi|190571275|ref|YP_001975633.1| tRNA (guanine-N1)-methyltransferase [Wolbachia pipientis] >gi|190357547|emb|CAQ54984.1| tRNA (guanine-N1)-methyltransferase [Wolbachia pipientis] (232 aa)
Score = 530, Expect = 2.0e-52, Identities = 102/217 (47%), Positives = 155/217 (71%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +T+L++F   F  F N S+  KA+   + ++EIVN R+F+KD H+ VDD PYGGGAGMV+    I +A+++V ++  N++ + +TPSG  +NQ+IA +     H+ ++CG +EG D+R+I+ Y  YE+SIGDYIL+GGE AAM +LD+ IRL+P V+ + +S+  ESF     +L+YP YT+P  ++ YKVPEVLLSGNH++I+  R+E    +TK  R +L 
  S:     5 VTILTIFPEMFPGFLNYSLAGKALEKKIWNLEIVNIRSFAKDKHSTVDDVPYGGGAGMVMRPDVIGNAVDNVLSAHKNTRFIYMTPSGTKFNQRIAKELTEIPHVTILCGRFEGVDQRVIDVYTPYELSIGDYILSGGEPAAMVVLDACIRLLPGVVNNFDSVAEESFSYSGGILEYPQYTRPEQWSRYKVPEVLLSGNHRKISDWRREQSYVRTKERRPELL 227
>gi|121533792|ref|ZP_01665619.1| tRNA (guanine-N1)-methyltransferase [Thermosinus carboxydivorans Nor1] >gi|121307783|gb|EAX48698.1| tRNA (guanine-N1)-methyltransferase [Thermosinus carboxydivorans Nor1] (248 aa)
Score = 530, Expect = 2.1e-52, Identities = 99/219 (45%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS----NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++SLF   F+     SIIK+A    L+ + I+N R+F+ D H  VDD P+GGG+GMV+  +P+  A+   KT+      +++L+ P G+ + Q  A +   ++HLIL+CGHYEG DERI  Y VD  +SIGDY+LTGGE+ AM + D+V R+IP V+   ++   +SF + LL+YP YT+P  FNG++VPEVLLSG+H +I + R++  + +T   R DL 
  S:     1 MRIDIISLFPEMFDGPFGHSIIKRAREAGLLIVNIINPRDFAYDKHRIVDDYPFGGGSGMVMKPEPLYRAVESAKTAVESNKRRIILMCPGGEVFTQHKARELAAYDHLILVCGHYEGVDERIRQYVVDEAVSIGDYVLTGGELPAMVVTDAVARMIPGVLGASDAAVHDSFYSGLLEYPQYTRPREFNGWEVPEVLLSGDHAKIERWRRKQSLKRTLERRPDLL 225
>gi|15900673|ref|NP_345277.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae TIGR4] >gi|111658332|ref|ZP_01409020.1| hypothetical protein SpneT_02000472 [Streptococcus pneumoniae TIGR4] >gi|148989861|ref|ZP_01821155.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP6-BS73] >gi|148997143|ref|ZP_01824797.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP11-BS70] >gi|149007661|ref|ZP_01831278.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP18-BS74] >gi|168486208|ref|ZP_02710716.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|168490868|ref|ZP_02715011.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|168575440|ref|ZP_02721376.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae MLV-016] >gi|169833097|ref|YP_001694238.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|194397425|ref|YP_002037424.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae G54] >gi|26400980|sp|Q97RM4|TRMD_STRPN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|14972255|gb|AAK74917.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae TIGR4] >gi|147756843|gb|EDK63883.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP11-BS70] >gi|147760816|gb|EDK67787.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP18-BS74] >gi|147924803|gb|EDK75887.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP6-BS73] >gi|168995599|gb|ACA36211.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|183570783|gb|EDT91311.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|183574617|gb|EDT95145.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|183578503|gb|EDT99031.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae MLV-016] >gi|194357092|gb|ACF55540.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae G54] (239 aa)
Score = 530, Expect = 2.2e-52, Identities = 107/222 (48%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F+  ++ SI+ KA    L+DI+  NFR N  K  H  VDD PYGGG GM+L  QPI D+ + ++  N +V+LL P+GK ++Q  A      E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H++I + R    + KT   R DL   Y
  S:     1 MKIDILTLFPEMFSPLEH-SIVGKAREKGLLDIQYHNFRENAEKARH--VDDEPYGGGQGMLLRAQPIFDSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELIFICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDDSFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHY 221
>gi|169827102|ref|YP_001697260.1| tRNA (guanine-N(1)-)-methyltransferase [Lysinibacillus sphaericus C3-41] >gi|168991590|gb|ACA39130.1| tRNA (guanine-N(1)-)-methyltransferase [Lysinibacillus sphaericus C3-41] (246 aa)
Score = 530, Expect = 2.3e-52, Identities = 102/222 (45%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M I VLSLF + F+     SI+KKA   N V +E+ + R FS + HN+VDD PYGGGAGMVL  +P+  A+  +      +++L+ P G+ + Q+ A +    + L+ +CGHYEG+DERI  + V  EISIGD++LTGGE+ AM ++DSV+RL+P V+   +S   +SF   LL++P+YT+P  F G KVP+VLLSGNH +I + R+E  + +T   R DL   Y
  S:     2 MNIHVLSLFPDMFSGVFGASILKKAQEKNAVKLEVTDIRTFSGNKHNQVDDYPYGGGAGMVLKPEPMFSAVEAICAGKQPRIILMCPQGERFTQKKAEELSQEKELVFLCGHYEGYDERIRQHLVTDEISIGDFVLTGGELGAMTVIDSVVRLLPGVLGQEDSHIQDSFSTGLLEHPHYTRPAEFRGMKVPDVLLSGNHAKIEQWREEQSLKRTFERRPDLLDLY 226
>gi|177667170|ref|ZP_02942801.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 8801] >gi|196247166|ref|ZP_03145879.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 8802] >gi|172073939|gb|EDT59360.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 8801] >gi|196205050|gb|EDX99855.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 8802] (229 aa)
Score = 529, Expect = 2.4e-52, Identities = 98/224 (43%), Positives = 150/224 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFK-TFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           M+I V++LF +FF      S++ +A+   +  + ++N R F+ D H++VDD PYGGG GMVL  +PI  A+  +      +++LLTP G+  NQ +  +    +E L+LICGHYEG DERI    D E+S+GD++LT GEI A+A+++ V+RL+P  +   +SL+ ESF+  LLDYP YT+P  F  ++VPEVL SGNH+ I + R + Q+ +T+  R DL+ K+L+
  S:     1 MQIDVITLFPDFFTSPLQCSLLGRALTKGIAQVNLINPRQFTLDKHHRVDDEPYGGGVGMVLKPEPIFAAVESLTVLPKRQIILLTPQGQPLNQALLQELSGNYEQLVLICGHYEGVDERIRYLADREVSLGDFVLTCGEIPALALINGVVRLLPGTVGKADSLKYESFEVGLLDYPQYTRPPIFREWEVPEVLRSGNHQAIEQWRYQQQLERTQQRRPDLWQKWLE 227
>gi|54020036|ref|YP_115609.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma hyopneumoniae 232] >gi|76363865|sp|Q601V6|TRMD_MYCH2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|53987209|gb|AAV27410.1| tRNA (guanine-n1)-methyltransferase [Mycoplasma hyopneumoniae 232] (227 aa)
Score = 529, Expect = 2.5e-52, Identities = 112/224 (50%), Positives = 165/224 (73%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           MKI +L+LF  +F  F   SII KAI +  + I +VNFR+FSK+ H KVDD  YGGG G++L +QP+VDA+  V       + L+P G+ ++Q +A +    + + ++CGHYEGFD+RII N++D+E+S+GD+ILTGGEIAAMAI+D++IRL P++I+  SL++E+F++ LLD+P Y++P NF G +VP VL+SGNH+EI + R+E +   TK  R DL+ K+LK
  S:     1 MKINILTLFPRYFEVFCRESIIGKAIKHKKITINVVNFRDFSKNKHKKVDDYVYGGGPGLLLQIQPVVDALEKV---GGLKIALSPQGQKFDQGVARKLAKEDEITILCGHYEGFDQRIIDNFIDFELSLGDFILTGGEIAAMAIIDAIIRLKPDIINPESLKNETFNDFLLDFPQYSRPANFRGLEVPNVLISGNHREIGEWRQEQRELITKKKRPDLWEKFLK 222
>gi|29376427|ref|NP_815581.1| tRNA (guanine-N1)-methyltransferase [Enterococcus faecalis V583] >gi|38258431|sp|Q820U3|TRMD_ENTFA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|29343891|gb|AAO81651.1| tRNA (guanine-N1)-methyltransferase [Enterococcus faecalis V583] (246 aa)
Score = 529, Expect = 2.7e-52, Identities = 100/219 (45%), Positives = 149/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS----KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I VL+LF   F      SII KA    L+++ + NFR+FS + H  VDD PYGGGAGM+L +QPI D +  ++   +    +V+LL P+GK +NQ++A +F   EHL+ ICGHYEG+DERI   V  E+S+GDY+LTGGE+ AM ++D+ +RL+P+V+  N S +++S    LL++P YT+P  FN  +VP VL +GNHK I + + +  + +T + R D+ 
  S:     1 MRIDVLTLFPRMFEGPMGESIIGKAREKQLLELNVSNFRDFSDNKHQTVDDYPYGGGAGMLLKVQPIYDNLKAIEEETNQQPKRVILLDPAGKPFNQKMAEEFSQEEHLVFICGHYEGYDERIRTMVTDEVSLGDYVLTGGELGAMVMIDATVRLLPDVLGNNLSAQTDSHSTGLLEHPQYTRPAIFNDMEVPAVLTNGNHKLIAEWQLKESLRRTFLRRPDML 224
>gi|81096791|ref|ZP_00875121.1| tRNA (guanine-N1-)-methyltransferase [Streptococcus suis 89/1591] >gi|80977143|gb|EAP40696.1| tRNA (guanine-N1-)-methyltransferase [Streptococcus suis 89/1591] (241 aa)
Score = 529, Expect = 2.9e-52, Identities = 104/222 (46%), Positives = 146/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +L+LF   F   ++ SI+ KA    L++I   NFR  ++ + + VDD PYGGG GM+L  QPI D ++ ++ +  +V+LL P+G+T+NQ  A +    E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI    S   +SF + LL+YP YT+PY + G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     1 MRIDILTLFPEMFAPLEH-SIVGKARDKGLLEINYHNFREKAEKARH-VDDEPYGGGQGMLLRAQPIFDTMDSIEQAKPRVILLDPAGRTFNQAYAEELAQEEQLIFICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKEVSHTDDSFSSGLLEYPQYTRPYEYRGMVVPDVLMSGHHENIRKWRLEESLRKTYQRRPDLLENY 221
>gi|58698985|ref|ZP_00373838.1| tRNA (guanine-N1)-methyltransferase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534502|gb|EAL58648.1| tRNA (guanine-N1)-methyltransferase [Wolbachia endosymbiont of Drosophila ananassae] (236 aa)
Score = 528, Expect = 3.2e-52, Identities = 103/217 (47%), Positives = 153/217 (70%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFD--NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +T+L++F   F  F N S+  KA+   + ++E++N R+F+KD H+ VDD PYGGGAGMV+    + DA++ + +   N+K + +TPSG  +NQ IA +   F H+ ++CG +EG D+RII+ Y  YE+SIGDYIL+GGE AAM +LD+ IRL+P V+ + +S+  ESF+    +L+YP YT+P  + GYKVPEVLLSGNHK+I+  R++     TK  R +L 
  S:     5 VTILTIFPEMFPGFLNYSLAGKALEKKIWNLEVINIRSFAKDKHSTVDDVPYGGGAGMVMRSDVVGDAVDSMLSVHKNTKFIYMTPSGTKFNQNIARELLEFPHITILCGRFEGIDQRIIDAYTPYELSIGDYILSGGEPAAMVVLDACIRLLPGVVNNTDSITEESFNYGGGVLEYPQYTRPEQWKGYKVPEVLLSGNHKKISDWRQKQSHVITKKRRPELL 227
>gi|56751872|ref|YP_172573.1| tRNA (guanine-N(1)-)-methyltransferase [Synechococcus elongatus PCC 6301] >gi|81301044|ref|YP_401252.1| tRNA (guanine-N(1)-)-methyltransferase [Synechococcus elongatus PCC 7942] >gi|84029284|sp|Q5N0W7|TRMD_SYNP6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119371009|sp|Q31L04|TRMD_SYNP7 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|56686831|dbj|BAD80053.1| tRNA (guanine-N1)-methyltransferase [Synechococcus elongatus PCC 6301] >gi|81169925|gb|ABB58265.1| tRNA (Guanine37-N(1)-) methyltransferase [Synechococcus elongatus PCC 7942] (235 aa)
Score = 528, Expect = 3.2e-52, Identities = 100/219 (45%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  +++LF  FF+    + +I KAIA  L ++   N R+F+ D H+KVDD PYGGGAGMVL  +P+  A+  +   +  +V+ L+P G+   Q +     T  E L+L+CGHYEG DER++ ++D EIS+GD++LT GEI A+A+L+ V+RL P  I    S   +SF + LLDYP+YT+P  F G KVPEVLLSGNH  I   R++ Q+ +T+  R DL+
  S:     1 MRFDLITLFPEFFHSPLQSGLIAKAIAKGLAEVHCTNPRDFTCDRHHKVDDEPYGGGAGMVLKPEPLAAALESLPVVTPRQVIYLSPQGEPMTQALFQDLATSVEQLVLVCGHYEGIDERVMTWIDREISLGDFVLTCGEIPALALLNGVLRLRPGTIGKEESHRCDSFSDGLLDYPHYTRPAEFRGLKVPEVLLSGNHGAIAAWRRQQQLERTRDRRPDLY 222
>gi|34762812|ref|ZP_00143798.1| tRNA (Guanine-N1) -methyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887514|gb|EAA24598.1| tRNA (Guanine-N1) -methyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (238 aa)
Score = 528, Expect = 3.2e-52, Identities = 103/218 (47%), Positives = 153/218 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MKI +L+LF   F+ F + SI+ +AI    V++ I++ R++  D H + DD P+GGG GMV+  +P+  A+   + ++ KV+  +P GKT+NQ+IA +    + L +I GHYEG DER++ N VD E+SIGD++LTGGEI AM I D++IRL+P+VI   S E++SF N LLDYP+YT+P  +   KVPEVLLSGNHK+I++ R +  + +T + RK+L
  S:     1 MKINILTLFPKMFDGFLSESIVARAIKFGAVEVNIIDIRDYCFDKHKQADDMPFGGGNGMVMKPEPLFLAL---ENASGKVIYTSPQGKTFNQEIAKELVKEKELTIIAGHYEGIDERVVENKVDMELSIGDFVLTGGEIPAMVISDTIIRLLPDVIKKESYENDSFYNGLLDYPHYTRPAEYKDLKVPEVLLSGNHKKIDEWRLKESLRRTYLRRKEL 216
>gi|150021668|ref|YP_001307022.1| tRNA (guanine-N1)-methyltransferase [Thermosipho melanesiensis BI429] >gi|166200460|sp|A6LNY6|TRMD_THEM4 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|149794189|gb|ABR31637.1| tRNA (guanine-N1)-methyltransferase [Thermosipho melanesiensis BI429] (246 aa)
Score = 528, Expect = 3.5e-52, Identities = 98/220 (44%), Positives = 145/220 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFI 220
           M+I++L++F       K   +I +AI N +++IEI N R+F+ D H  VDD P+GGG GMV+  +P  +   + K    N+  +L +P G      +  +    E +++ICG YEG DER+  +VD EISIGDY+LTGGE+ AM I+D+V R IP+VI   S+E E+F+  LLD+P+YT+P N+ G +VPEVLLSG+HK+I   R++  + KT + R DLF+
  S:     1 MRISILTIFPEMVEIVKKYGVISRAIKNGILEIEIFNLRDFTNDKHKTVDDYPFGGGPGMVMKPEPFFNFFEYYKERYGNTYTILTSPQGDRLTNHLVKELSEKESILIICGRYEGIDERVTKFVDREISIGDYVLTGGELPAMVIVDAVSRFIPDVIDKKSVEQETFNTGLLDHPHYTRPRNYKGLEVPEVLLSGDHKKIEIWRRKMALKKTMLKRPDLFL 222
>gi|99034595|ref|ZP_01314557.1| hypothetical protein Wendoof_01000630 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (236 aa)
Score = 528, Expect = 3.5e-52, Identities = 103/217 (47%), Positives = 153/217 (70%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFD--NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +T+L++F   F  F N S+  KA+   + ++E++N R+F+KD H+ VDD PYGGGAGMV+    + DA++ + +   N+K + +TPSG  +NQ IA +   F H+ ++CG +EG D+RII+ Y  YE+SIGDYIL+GGE AAM +LD+ IRL+P V+ + +S+  ESF+    +L+YP YT+P  + GYKVPEVLLSGNHK+I+  R++     TK  R +L 
  S:     5 VTILTIFPEMFPGFLNYSLAGKALEKKIWNLEVINVRSFAKDKHSTVDDVPYGGGAGMVMRSDVVGDAVDSMLSVHKNTKFIYMTPSGTKFNQNIARELLEFPHITILCGRFEGIDQRIIDAYTPYELSIGDYILSGGEPAAMVVLDACIRLLPGVVNNTDSITEESFNYGGGVLEYPQYTRPEQWKGYKVPEVLLSGNHKKISDWRQKQSHVITKKRRPELL 227
>gi|70726675|ref|YP_253589.1| tRNA-mehtyltransferase [Staphylococcus haemolyticus JCSC1435] >gi|81175046|sp|Q4L5U2|TRMD_STAHJ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|68447399|dbj|BAE04983.1| tRNA-mehtyltransferase [Staphylococcus haemolyticus JCSC1435] (245 aa)
Score = 528, Expect = 3.8e-52, Identities = 100/222 (45%), Positives = 152/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F+   N SI+K+A    ++ +  VNFR+++ + HN+VDD P+GGG GMVL  +P+ +A+  + +T  ++V+L+ P G+ ++Q+IA +    EH++ ICGHYEG+DERI  + V  EISIGDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  F    VP+VLLSGNH  I + R E ++ +T   R DL  +Y
  S:     1 MKIDYLTLFPEMFDGVLNHSILKRAQDKEIISVNTVNFRDYAINKHNQVDDYPFGGGQGMVLKPEPVFNAMKDLQRTDQTRVILMCPQGRPFSQEIAQELSEAEHIVFICGHYEGYDERIRTHLVTDEISIGDYVLTGGELPAMTMTDAIVRLIPGVLGNQQSHQDDSFSDGLLEFPQYTRPREFENMTVPDVLLSGNHANIEQWRHEQKLIRTYHKRPDLLDRY 225
>gi|146318474|ref|YP_001198186.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus suis 05ZYH33] >gi|146320667|ref|YP_001200378.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus suis 98HAH33] >gi|166200454|sp|A4W0T9|TRMD_STRS2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166200456|sp|A4VUJ7|TRMD_STRSY tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|145689280|gb|ABP89786.1| tRNA-(guanine-N1)-methyltransferase [Streptococcus suis 05ZYH33] >gi|145691473|gb|ABP91978.1| tRNA-(guanine-N1)-methyltransferase [Streptococcus suis 98HAH33] (241 aa)
Score = 527, Expect = 4.6e-52, Identities = 107/222 (48%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +L+LF   F   ++ SI+ KA    L++I   NFR N  K  H  VDD PYGGG GM+L  QPI D ++ ++ +  +V+LL P+G+T+NQ  A +    E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI    S   +SF + LL+YP YT+PY + G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     1 MRIDILTLFPEMFAPLEH-SIVGKARDKGLLEINYHNFRENAEKARH--VDDEPYGGGQGMLLLAQPIFDTMDSIEQTKPRVILLDPAGRTFNQAYAEELAQEEQLIFICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKEVSHTDDSFSSGLLEYPQYTRPYEYRGMVVPDVLMSGHHENIRKWRLEESLRKTYQRRPDLLENY 221
>gi|30024050|ref|NP_267720.2| tRNA (guanine-N(1)-)-methyltransferase [Lactococcus lactis subsp. lactis Il1403] >gi|26400831|sp|Q9CFB7|TRMD_LACLA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) (247 aa)
Score = 527, Expect = 4.7e-52, Identities = 104/222 (46%), Positives = 146/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +LS+F   F    N SI+ KA    ++++   +FR  + +    VDD PYGGG GM+L  QPI D ++ +     K   V+LL P+GK ++Q++A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AA  ++D+V+RLIP V+  V S E +SF + LL+YP YT+P +F G KVPEVL+SG+H+ I K R +  + KT   R DL  KY
  S:     1 MRIDILSIFPEMFGPL-NQSIVGKAQDKGILELHTHDFRENATNKQRHVDDMPYGGGQGMLLMPQPIFDTMDKIPQKPEKPARVILLDPAGKKFDQKMAEELSQEEQLIFICGHYEGYDERIKTLVTDEISLGDFVLTGGEVAATVMVDAVVRLIPGVLGKVASHEDDSFSSGLLEYPQYTRPEDFRGMKVPEVLMSGHHENIRKWRLKESLRKTLERRPDLLDKY 225
>gi|195978231|ref|YP_002123475.1| tRNA (Guanine37-N1)-methyltransferase TrmD [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974936|gb|ACG62462.1| tRNA (Guanine37-N1)-methyltransferase TrmD [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (243 aa)
Score = 527, Expect = 5.2e-52, Identities = 103/222 (46%), Positives = 150/222 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR+ ++ + + VDD PYGGG GM+L  QPI D ++ ++ +  +V+LL P+GK ++Q  A +    E LI ICGHYEG+DERI   +  EIS+GD++LTGGE+AAM ++D+ +RLIPNV+    S + +SF + LL+YP YT+PY++ G KVP+VL+SG+H+ I   R E  + KT + R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDHAEKARH-VDDEPYGGGQGMLLRAQPIFDTMDSIQATKPRVILLDPAGKPFHQSYAEELALEEELIFICGHYEGYDERIKTLITDEISLGDFVLTGGELAAMTMIDATVRLIPNVLGKQASHQEDSFSSGLLEYPQYTRPYDYRGMKVPDVLMSGHHEHIRLWRMEQSLKKTYLRRPDLLETY 221
>gi|95930751|ref|ZP_01313484.1| tRNA (guanine-N1)-methyltransferase [Desulfuromonas acetoxidans DSM 684] >gi|95133231|gb|EAT14897.1| tRNA (guanine-N1)-methyltransferase [Desulfuromonas acetoxidans DSM 684] (249 aa)
Score = 526, Expect = 5.5e-52, Identities = 103/219 (47%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK  V++LF   F+     SII KA+A  LV I     R++++  H   DDTPYGGG GMV+  +P+  AI  +K  +  ++V++++P G+ + QQ A Q    E LI +CG YEGFDER+ +YVD E SIGD++LTGGE+ AM I+D+V RL+P V+ S  S E++SF + LL++P+YT+P  F G KVPEVLLSG+H  I   R+  Q+ +T   R DL 
  S:     1 MKFEVVTLFPEMFDSPFAGSIIGKAVAKGLVQITAHPLRDWAEGRHQVTDDTPYGGGDGMVMKPEPLCRAIQSLKQQHPRARVLMMSPQGQRFTQQRAAQLAEEESLIFLCGRYEGFDERVRSYVDEEYSIGDFVLTGGELPAMVIIDAVARLVPGVLGSQGSAEADSFSDGLLEHPHYTRPAEFEGRKVPEVLLSGDHARIAAWRRSQQLLRTLQRRPDLL 222
>gi|169830844|ref|YP_001716826.1| tRNA (guanine-N1)-methyltransferase [Candidatus Desulforudis audaxviator MP104C] >gi|169637688|gb|ACA59194.1| tRNA (guanine-N1)-methyltransferase [Candidatus Desulforudis audaxviator MP104C] (249 aa)
Score = 526, Expect = 5.5e-52, Identities = 103/218 (47%), Positives = 143/218 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M I++L+LF   F     +SIIK+A    LVDIE+ + R+FS + H  VDDTPYGGG GMV+  +PI  A++H+         VVLL P G+ ++Q  A        L+LICGHYEG DER+   VD EIS+GD+++TGGEI AM ++D+V RL+P V+      E +SF   LL+YP YT+P ++ G  VPEVLLSG+H EI + R++  + +T + R DL
  S:     1 MIISILTLFPEMFAGPFGSSIIKRARERGLVDIELFDIRDFSPNRHRTVDDTPYGGGGGMVMRPEPIRRALDHLLERGRGGGTVVLLCPQGRRFDQDSARALAAAGKLVLICGHYEGVDERVREDVDLEISVGDFVVTGGEIPAMLVVDAVCRLVPGVLGEPGGAEDDSFAGGLLEYPQYTRPRDYLGRDVPEVLLSGHHGEIERWRRQEALLRTLVRRPDL 222
>gi|15618041|ref|NP_224325.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila pneumoniae CWL029] >gi|15835653|ref|NP_300177.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila pneumoniae J138] >gi|16752927|ref|NP_445198.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila pneumoniae AR39] >gi|33241453|ref|NP_876394.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila pneumoniae TW-183] >gi|26400849|sp|Q9Z964|TRMD_CHLPN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|4376380|gb|AAD18270.1| tRNA (guanine N-1)-Methyltransferase [Chlamydophila pneumoniae CWL029] >gi|7189571|gb|AAF38470.1| tRNA (guanine-N1)-methyltransferase [Chlamydophila pneumoniae AR39] >gi|8978491|dbj|BAA98328.1| tRNA (guanine N-1)-methyltransferase [Chlamydophila pneumoniae J138] >gi|33235961|gb|AAP98051.1| tRNA (guanine-N1-)-methyltransferase [Chlamydophila pneumoniae TW-183] (361 aa)
Score = 526, Expect = 6.2e-52, Identities = 104/223 (46%), Positives = 145/223 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           MKI +LSLF  +F+    TSI+ +AI   L+D+++ N R+F      +VDDTP+ GG GM+L  +P+  AI  V+  NSKV+ L+P G     + + +     HLIL+CGHYEG DER I + VD EISIGDY+LT G IAA+ ++D+V R IP V+ +  S E +S +N LL+ P YT+P  F G +VPEVLL G+HK I++ R E    +T   R DL++ YL
  S:     1 MKIDILSLFPGYFDGPLQTSILGRAIKQRLLDVQLTNLRDFGLGKWKQVDDTPFSGG-GMLLMAEPVTSAIRSVRKENSKVIYLSPQGALLTAEKSRELAAASHLILLCGHYEGIDERAIESEVDEEISIGDYVLTNGGIAALVLIDAVSRFIPGVLGNQESAERDSLENGLLEGPQYTRPREFEGKEVPEVLLQGDHKAISQWRLEQSERRTYERRPDLYLNYL 224
>gi|12724567|gb|AAK05662.1|AE006387_5 tRNA methyltransferase [Lactococcus lactis subsp. lactis Il1403] (251 aa)
Score = 526, Expect = 6.4e-52, Identities = 104/222 (46%), Positives = 146/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +LS+F   F    N SI+ KA    ++++   +FR  + +    VDD PYGGG GM+L  QPI D ++ +     K   V+LL P+GK ++Q++A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AA  ++D+V+RLIP V+  V S E +SF + LL+YP YT+P +F G KVPEVL+SG+H+ I K R +  + KT   R DL  KY
  S:     5 MRIDILSIFPEMFGPL-NQSIVGKAQDKGILELHTHDFRENATNKQRHVDDMPYGGGQGMLLMPQPIFDTMDKIPQKPEKPARVILLDPAGKKFDQKMAEELSQEEQLIFICGHYEGYDERIKTLVTDEISLGDFVLTGGEVAATVMVDAVVRLIPGVLGKVASHEDDSFSSGLLEYPQYTRPEDFRGMKVPEVLMSGHHENIRKWRLKESLRKTLERRPDLLDKY 229
>gi|186899993|ref|ZP_02972953.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 7424] >gi|186692929|gb|EDU17545.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 7424] (231 aa)
Score = 526, Expect = 6.5e-52, Identities = 102/226 (45%), Positives = 151/226 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+  +++LF +FF     + ++ KA+   +  + +VN R+F+ D H++VDD PYGGG GM+L  +PI  A+  ++     +VVL+TP G+  +Q I  +  T F+ L+LICGHYEG DER+  Y V  EIS+GD++LT GEI A+ +L+ VIRL+P  +    SL+ ESF+ +LLDYP YT+P  F  ++VP VL SGNH+ I + RK+ QI +TK  R DL+ K+   N
  S:     1 MRFDIITLFPDFFTSPLQSGLLGKALDKQIAQVNLVNPRDFALDKHHRVDDEPYGGGVGMLLKPEPIFAAVESLEILPRREVVLMTPQGQPLSQPILRELATDFDQLVLICGHYEGVDERVTQYLVTREISLGDFVLTCGEIPALTVLNGVIRLLPGTVGKEESLKLESFEADLLDYPQYTRPALFRDWEVPAVLRSGNHQAIEQWRKQQQIERTKERRPDLWEKWTINN 230
>gi|49483403|ref|YP_040627.1| putative tRNA (guanine-7-)-methyltransferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|85543864|sp|Q6GHJ5|TRMD_STAAR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|49241532|emb|CAG40218.1| putative tRNA (guanine-7-)-methyltransferase [Staphylococcus aureus subsp. aureus MRSA252] (245 aa)
Score = 526, Expect = 6.5e-52, Identities = 103/222 (46%), Positives = 151/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F+   N SI+K+A  NN + I  VNFR+++ + HN+VDD PYGGG GMVL  +P+ +A+  +  T  ++V+L+ P G+ ++ Q A +    +H++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  F G  VP+VLLSGNH  I+  R E ++ +T   R DL  KY
  S:     1 MKIDYLTLFPEMFDGVLNHSIMKRAQENNKLQINTVNFRDYAINKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVTEQARVILMCPQGEPFSHQKAVELSKADHIVFICGHYEGYDERIRTHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNEQSHQDDSFSDGLLEFPQYTRPREFKGLTVPDVLLSGNHANIDAWRHEQKLIRTYNKRPDLIEKY 225
>gi|77407215|ref|ZP_00784184.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae H36B] >gi|77174177|gb|EAO77077.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae H36B] (245 aa)
Score = 526, Expect = 6.7e-52, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR  ++ S + VDD PYGGG GM+L  QPI D I+ +    ++V+LL P+G+T++Q  A +    + LI ICGHYEG+DERI + V  E+S+GD++LTGGE+AAM ++D+ +RLIP VI    S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     2 MKIDILTLFPEMFAPLEH-SIVGKAKERGLLEINYHNFRENAEKSRH-VDDEPYGGGQGMLLRAQPIFDTIDKIDAQKARVILLDPAGRTFDQDFAEELSKEDELIFICGHYEGYDERIKSLVTDEVSLGDFVLTGGELAAMTMVDATVRLIPEVIGKETSHQDDSFSSGLLEYPQYTRPYDYLGMTVPDVLMSGHHENIRKWRLEQSLRKTLERRPDLLENY 222
>gi|139473978|ref|YP_001128694.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes str. Manfredo] >gi|166200453|sp|A2RF48|TRMD_STRPG tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|134272225|emb|CAM30477.1| tRNA (Guanine-N(1)-)-methyltransferase [Streptococcus pyogenes str. Manfredo] (243 aa)
Score = 525, Expect = 6.9e-52, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR++++ + + VDD PYGGG GM+L  QPI D I  ++    +++LL P+GK + Q  A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM I+D+ +RLIP V+   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I   R E  + KT + R DL  +Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDYAEKARH-VDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERY 221
>gi|50914021|ref|YP_059993.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS10394] >gi|94988342|ref|YP_596443.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94994143|ref|YP_602241.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS10750] >gi|84029280|sp|Q5XCQ3|TRMD_STRP6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|118575161|sp|Q1J777|TRMD_STRPF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119371004|sp|Q1JMB3|TRMD_STRPC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|50903095|gb|AAT86810.1| tRNA (Guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS10394] >gi|94541850|gb|ABF31899.1| tRNA (Guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94547651|gb|ABF37697.1| tRNA (Guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS10750] (239 aa)
Score = 525, Expect = 7.1e-52, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR++++ + + VDD PYGGG GM+L  QPI D I  ++    +++LL P+GK + Q  A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM I+D+ +RLIP V+   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I   R E  + KT + R DL  +Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDYAEKARH-VDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERY 221
>gi|19745923|ref|NP_607059.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS8232] >gi|26400892|sp|Q8P1F3|TRMD_STRP8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|19748079|gb|AAL97558.1| putative tRNA (guanine-N1)-methyltransferase [Streptococcus pyogenes MGAS8232] (239 aa)
Score = 525, Expect = 7.1e-52, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR++++ + + VDD PYGGG GM+L  QPI D I  ++    +++LL P+GK + Q  A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM I+D+ +RLIP V+   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I   R E  + KT + R DL  +Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDYAEKARH-VDDEPYGGGQGMLLRAQPIFDTIEQIEVKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERY 221
>gi|21282852|ref|NP_645940.1| tRNA (guanine-N1)-mehtyltransferase [Staphylococcus aureus subsp. aureus MW2] >gi|49486079|ref|YP_043300.1| putative tRNA (guanine-7-)-methyltransferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651809|ref|YP_186115.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|82750844|ref|YP_416585.1| tRNA guanine-N(1)-methyltransferase [Staphylococcus aureus RF122] >gi|87160858|ref|YP_493830.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus USA300] >gi|88194947|ref|YP_499747.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221362|ref|YP_001332184.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|172048858|sp|A6QGE0|TRMD_STAAE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|26400889|sp|Q8NX06|TRMD_STAAW tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|85543863|sp|Q5HGJ2|TRMD_STAAC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|85543865|sp|Q6G9X3|TRMD_STAAS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119371000|sp|Q2FHJ8|TRMD_STAA3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119371001|sp|Q2FZ43|TRMD_STAA8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119371002|sp|Q2YXM5|TRMD_STAAB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|21204291|dbj|BAB94988.1| tRNA (guanine-N1)-mehtyltransferase [Staphylococcus aureus subsp. aureus MW2] >gi|49244522|emb|CAG42951.1| putative tRNA (guanine-7-)-methyltransferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285995|gb|AAW38089.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|82656375|emb|CAI80793.1| tRNA guanine-N(1)-methyltransferase [Staphylococcus aureus RF122] >gi|87126832|gb|ABD21346.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202505|gb|ABD30315.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374162|dbj|BAF67422.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus str. Newman] (245 aa)
Score = 525, Expect = 7.7e-52, Identities = 103/222 (46%), Positives = 151/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F+   N SI+K+A  NN + I  VNFR+++ + HN+VDD PYGGG GMVL  +P+ +A+  +  T  ++V+L+ P G+ ++ Q A +    +H++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  F G  VP+VLLSGNH  I+  R E ++ +T   R DL  KY
  S:     1 MKIDYLTLFPEMFDGVLNHSIMKRAQENNKLQINTVNFRDYAINKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVTEQTRVILMCPQGEPFSHQKAVELSKADHIVFICGHYEGYDERIRTHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNEQSHQDDSFSDGLLEFPQYTRPREFKGLTVPDVLLSGNHANIDAWRHEQKLIRTYNKRPDLIEKY 225
>gi|77409303|ref|ZP_00786008.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae COH1] >gi|77172100|gb|EAO75264.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae COH1] (251 aa)
Score = 524, Expect = 9.1e-52, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR  ++ S + VDD PYGGG GM+L  QPI D I+ +    ++V+LL P+G+T++Q  A +    + LI ICGHYEG+DERI + V  E+S+GD++LTGGE+AAM ++D+ +RLIP VI    S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     2 MKIDILTLFPEMFAPLEH-SIVGKAKERGLLEIXYHNFRENAEKSRH-VDDEPYGGGQGMLLRAQPIFDTIDKIDAQKARVILLDPAGRTFDQDFAEELSKEDELIFICGHYEGYDERIKSLVTDEVSLGDFVLTGGELAAMTMVDATVRLIPEVIGKETSHQDDSFSSGLLEYPQYTRPYDYLGMTVPDVLMSGHHENIRKWRLEQSLRKTLERRPDLLENY 222
>gi|15924230|ref|NP_371764.1| tRNA-mehtyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926823|ref|NP_374356.1| tRNA-(guanine-N1)-mehtyltransferase [Staphylococcus aureus subsp. aureus N315] >gi|148267731|ref|YP_001246674.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150393789|ref|YP_001316464.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|156979561|ref|YP_001441820.1| tRNA-mehtyltransferase [Staphylococcus aureus subsp. aureus Mu3] >gi|166200452|sp|A7X1L0|TRMD_STAA1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|189036189|sp|A6U159|TRMD_STAA2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|189036190|sp|A5ISC5|TRMD_STAA9 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|54039753|sp|P66971|TRMD_STAAN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|54042257|sp|P66970|TRMD_STAAM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|13701040|dbj|BAB42335.1| tRNA [Staphylococcus aureus subsp. aureus N315] >gi|14247010|dbj|BAB57402.1| tRNA-mehtyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|147740800|gb|ABQ49098.1| tRNA (Guanine37-N(1)-) methyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|149946241|gb|ABR52177.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|156721696|dbj|BAF78113.1| tRNA-mehtyltransferase [Staphylococcus aureus subsp. aureus Mu3] (245 aa)
Score = 524, Expect = 9.4e-52, Identities = 103/222 (46%), Positives = 151/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F+   N SI+K+A  NN + I  VNFR+++ + HN+VDD PYGGG GMVL  +P+ +A+  +  T  ++V+L+ P G+ ++ Q A +    +H++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  F G  VP+VLLSGNH  I+  R E ++ +T   R DL  KY
  S:     1 MKIDYLTLFPEMFDGVLNHSIMKRAQENNKLQINTVNFRDYAINKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVTEQTRVILMCPQGEPFSHQKAVELSKADHIVFICGHYEGYDERIRTHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNEQSHQDDSFSDGLLEFPQYTRPREFKGLTVPDVLLSGNHANIDAWRHEQKLIRTYNKRPDLIEKY 225
>gi|159028778|emb|CAO89949.1| trmD [Microcystis aeruginosa PCC 7806] (231 aa)
Score = 524, Expect = 9.6e-52, Identities = 99/225 (44%), Positives = 153/225 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFK-TFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+  +++LF +FF     + ++ KA+  ++  + +VN R+F+ D H +VDD PYGGG GM+L  +PI +AI  ++T    ++VL+TP G+  NQ +   +  ++  LILICGHYEG DER+  + V  E+S+GD++LT GEI A+AI++ V RL+P  +    SL+ ESF+  LLDYP YT+P  F  ++VP VL SGNH++I   R + Q+++TK  R DL+ K+L+E
  S:     1 MQFDIITLFPDFFTSPLQSGLLAKALERDIARVNLVNLRDFAHDKHRRVDDEPYGGGVGMLLKPEPIFEAIESLETLPPREIVLMTPQGEPLNQALLKTWAGSYRQLILICGHYEGVDERVCEHLVTREVSLGDFVLTCGEIPALAIVNGVTRLLPGTVGKAESLKLESFEAGLLDYPQYTRPPVFRSWQVPPVLRSGNHQDIADWRYQQQLDRTKERRPDLWQKWLEE 229
>gi|168727447|ref|ZP_02759724.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (250 aa)
Score = 524, Expect = 1.1e-51, Identities = 103/222 (46%), Positives = 151/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F+   N SI+K+A  NN + I  VNFR+++ + HN+VDD PYGGG GMVL  +P+ +A+  +  T  ++V+L+ P G+ ++ Q A +    +H++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  F G  VP+VLLSGNH  I+  R E ++ +T   R DL  KY
  S:     1 MKIDYLTLFPEMFDGVLNHSIMKRAQENNKLQINTVNFRDYAINKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVTEQTRVILMCPQGEPFSHQKAVELSKADHIVFICGHYEGYDERIRTHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNEQSHQDDSFSDGLLEFPQYTRPREFKGLTVPDVLLSGNHANIDAWRHEQKLIRTYNKRPDLIEKY 225
>gi|148985871|ref|ZP_01818965.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP3-BS71] >gi|147922017|gb|EDK73141.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pneumoniae SP3-BS71] (239 aa)
Score = 523, Expect = 1.3e-51, Identities = 106/222 (47%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F+  ++ SI+ KA    L+DI+  NFR N  K  H  VDD PYGGG GM+L  QPI ++ + ++  N +V+LL P+GK ++Q  A      E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H++I + R    + KT   R DL   Y
  S:     1 MKIDILTLFPEMFSPLEH-SIVGKAREKGLLDIQYHNFRENAEKARH--VDDEPYGGGQGMLLRAQPIFNSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELIFICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDDSFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHY 221
>gi|37525226|ref|NP_928570.1| tRNA (guanine-N(1)-)-methyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|46577345|sp|Q7MB64|TRMD_PHOLL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|36784653|emb|CAE13553.1| tRNA (guanine-N1-)-methyltransferase (M1G-methyltransferase) [Photorhabdus luminescens subsp. laumondii TTO1] (250 aa)
Score = 523, Expect = 1.3e-51, Identities = 105/219 (47%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F    +  +  +A+ N L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ +AI+  KT+    +KV+ L+P G+  NQQ   +  T E LILICG YEG DER+I   +D E SIGDY+L+GGEI AM ++DSV R IP V+    S E +SF + LLD P+YT+P   +G +VP VLLSGNH EIN+ R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITDYGVTGRAVKNGLLSIECWNPRDFTYDRHRTVDDRPYGGGPGMLMMVQPLREAIHAAKTAAGEGAKVIYLSPQGRKLNQQGVCELATNEKLILICGRYEGIDERVIQTEIDEEWSIGDYVLSGGEIPAMTMIDSVSRFIPGVLGHQASAEEDSFADGLLDCPHYTRPEVLDGMEVPPVLLSGNHAEINRWRMKQSLGRTWLRRPELL 224
>gi|188585998|ref|YP_001917543.1| tRNA (Guanine37-N(1)-) methyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350685|gb|ACB84955.1| tRNA (Guanine37-N(1)-) methyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] (256 aa)
Score = 523, Expect = 1.3e-51, Identities = 101/221 (45%), Positives = 150/221 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-----NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I +++LF   F+    +SII +A+A  ++ + +++ R FS + H KVDD PYGGGAGMV+  +PI  A++ +K S     N K V +TP G  Y+Q+ A +  +   L ++CGHYEG DER+  + VD EIS+GDY+LTGGE+ AM ILDSV RL+P V+   +S +++SF+N LL++P YT+P  F G +VPE+L+SG+HK I   + +  + +T   R DL  K
  S:     1 MHIDIMTLFPEMFHGVLESSIIGRALAREMITVNLIDIREFSTNKHRKVDDYPYGGGAGMVMKPEPIFYAMDELKKSPSFNVNQKTVFVTPQGNPYSQEKAKELSSLNRLTILCGHYEGVDERVRQHLVDEEISVGDYVLTGGELPAMVILDSVTRLVPGVLGDESSAKTDSFNNYLLEHPQYTRPAIFRGLEVPEILMSGDHKRIATWKTKESLKRTLSRRPDLLDK 228
>gi|24379322|ref|NP_721277.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus mutans UA159] >gi|38258586|sp|Q8DUN6|TRMD_STRMU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|24377245|gb|AAN58583.1|AE014928_4 putative tRNA methyltransferase [Streptococcus mutans UA159] >gi|93277283|tpg|DAA01810.1| TPA_exp: tRNA methyltransferase [Streptococcus mutans UA159] (240 aa)
Score = 523, Expect = 1.4e-51, Identities = 108/222 (48%), Positives = 140/222 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR N  K  H  VDD PYGGG GM+L  QPI D  + +     +V+LL P+G+ +NQ  A        LI ICGHYEG+DERI   V  EIS+GD+ILTGGE+AAM I+D+ +RLIP VI    S + +SF + LL+YP YT+PY + G KVP+VLLSG+H+ I   R E  + KT   R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAQTKGLLEINYHNFRENAEKARH--VDDEPYGGGQGMLLRAQPIFDTFDKIAAKKPRVILLDPAGQQFNQSYAEDLAQEGELIFICGHYEGYDERIKTLVTDEISLGDFILTGGELAAMTIIDATVRLIPEVIGKEASHQDDSFSSGLLEYPQYTRPYEYRGMKVPDVLLSGHHENIRLWRLEQSLRKTWERRPDLLEHY 221
>gi|116490848|ref|YP_810392.1| tRNA (Guanine37-N1) methyltransferase [Oenococcus oeni PSU-1] >gi|122276970|sp|Q04FP5|TRMD_OENOB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|116091573|gb|ABJ56727.1| tRNA (Guanine37-N1) methyltransferase [Oenococcus oeni PSU-1] (249 aa)
Score = 523, Expect = 1.4e-51, Identities = 104/221 (47%), Positives = 149/221 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS----KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI VLS+F + F+  +  S+I KAI   L+D ++ +FR F+ +    VDD  YGGGAGM+L  QPI DA+  VK  N+     V+L+ P+G+ ++  +A +  T+ HL  I GHYEG+D RI N VD EIS+GDY+LTGGE+A+M I+D+ +R + NV+ +  S   +SF N LL+ P YT+P NF G +VPEVL +G+H++I K R +  + KT + R DL  K
  S:     1 MKIDVLSIFPDMFDPLRQ-SMIGKAIEKGLIDFKVTDFREFTTNKQRHVDDVVYGGGAGMLLMPQPIFDAMEEVKKENNGDKGHVILVDPAGRKFDHHVAKKLSTYNHLTFISGHYEGYDNRIRNLVDEEISLGDYVLTGGELASMVIIDATVRFLDNVLGNSESAADDSFQNGLLEEPQYTRPANFRGIQVPEVLTNGDHEKIRKWRLKESLRKTFLRRPDLLEK 225
>gi|149196240|ref|ZP_01873295.1| tRNA-(guanine-N1)-methyltransferase [Lentisphaera araneosa HTCC2155] >gi|149140501|gb|EDM28899.1| tRNA-(guanine-N1)-methyltransferase [Lentisphaera araneosa HTCC2155] (210 aa)
Score = 523, Expect = 1.4e-51, Identities = 100/202 (49%), Positives = 141/202 (69%)
  Q:    18 NTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESF--DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++SII +A+ ++LV I I N R +S D H +VDD PYGGG GM+++ + I  A+  +KT  SKV+ ++PSG+ + Q++A +    EHLIL+CGHYEG D+R+++  +D EISIGDYIL+ G +AAM I D+VIRLIP  +  + S   ESF  ++ LL++P YT+P  F   +VPEVLLSGNHK+I + R E    KT   R DL 
  S:     2 SSSIIGRAVESDLVKISIHNLREYSTDKHRRVDDRPYGGGPGMIMSCETIFRAVEDLKTPTSKVIYMSPSGEVFKQRLAEELVEEEHLILLCGHYEGVDQRVLDGIIDREISIGDYILSNGNLAAMVISDAVIRLIPGALGCSESAIDESFNQEDGLLEHPQYTRPEEFRHMRVPEVLLSGNHKKIKEWRSEQSYQKTLTRRPDLL 207
>gi|168484437|ref|ZP_02709389.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|172042308|gb|EDT50354.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC1873-00] (239 aa)
Score = 523, Expect = 1.4e-51, Identities = 106/222 (47%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F+  ++ SI+ KA    L+DI+  NFR N  K  H  VDD PYGGG GM+L  QPI D+ + ++  N +V+LL P+GK ++Q  A      E LI ICG YEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H++I + R    + KT   R DL   Y
  S:     1 MKIDILTLFPEMFSPLEH-SIVGKAREKGLLDIQYHNFRENAEKARH--VDDEPYGGGQGMLLRAQPIFDSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELIFICGRYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDDSFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHY 221
>gi|22537501|ref|NP_688352.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus agalactiae 2603V/R] >gi|76787539|ref|YP_329995.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus agalactiae A909] >gi|76797718|ref|ZP_00779986.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae 18RS21] >gi|77412595|ref|ZP_00788882.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae CJB111] >gi|22534381|gb|AAN00225.1|AE014254_5 tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae 2603V/R] >gi|76562596|gb|ABA45180.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae A909] >gi|76586942|gb|EAO63432.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae 18RS21] >gi|77161358|gb|EAO72382.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae CJB111] (251 aa)
Score = 523, Expect = 1.5e-51, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR  ++ S + VDD PYGGG GM+L  QPI D I+ +    ++V+LL P+G+T++Q  A +    + LI ICGHYEG+DERI + V  E+S+GD++LTGGE+AAM ++D+ +RLIP VI    S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     2 MKIDILTLFPEMFAPLEH-SIVGKAKERGLLEINYHNFRENAEKSRH-VDDEPYGGGQGMLLRAQPIFDTIDKIDAQKARVILLDPAGRTFDQDFAEELSKEDELIFICGHYEGYDERIKSLVTDEVSLGDFVLTGGELAAMTMVDATVRLIPEVIGKETSHQDDSFSSGLLEYPQYTRPYDYLGMTVPDVLMSGHHENIRKWRLEQSLRKTLERRPDLLENY 222
>gi|21910110|ref|NP_664378.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS315] >gi|28896192|ref|NP_802542.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes SSI-1] >gi|71903303|ref|YP_280106.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS6180] >gi|26400879|sp|Q8K7X3|TRMD_STRP3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119371005|sp|Q48U55|TRMD_STRPM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|21904302|gb|AAM79181.1| putative tRNA (guanine-N1)-methyltransferase [Streptococcus pyogenes MGAS315] >gi|28811443|dbj|BAC64375.1| putative tRNA (guanine-N1)-methyltransferase [Streptococcus pyogenes SSI-1] >gi|71802398|gb|AAX71751.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS6180] (243 aa)
Score = 522, Expect = 1.6e-51, Identities = 102/222 (45%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR++++ + + VDD PYGGG GM+L  QPI D I  ++    +++LL P+GK + Q  A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM ++D+ +RLIP V+   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I   R E  + KT + R DL  +Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDYAEKARH-VDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTMVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERY 221
>gi|25011466|ref|NP_735861.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus agalactiae NEM316] >gi|46577473|sp|Q8CX07|TRMD_STRA5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46577482|sp|Q8E4H7|TRMD_STRA3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|118575159|sp|Q3K0F8|TRMD_STRA1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|24413004|emb|CAD47083.1| unknown [Streptococcus agalactiae NEM316] (250 aa)
Score = 522, Expect = 1.7e-51, Identities = 103/222 (46%), Positives = 148/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR  ++ S + VDD PYGGG GM+L  QPI D I+ +    ++V+LL P+G+T++Q  A +    + LI ICGHYEG+DERI + V  E+S+GD++LTGGE+AAM ++D+ +RLIP VI    S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKERGLLEINYHNFRENAEKSRH-VDDEPYGGGQGMLLRAQPIFDTIDKIDAQKARVILLDPAGRTFDQDFAEELSKEDELIFICGHYEGYDERIKSLVTDEVSLGDFVLTGGELAAMTMVDATVRLIPEVIGKETSHQDDSFSSGLLEYPQYTRPYDYLGMTVPDVLMSGHHENIRKWRLEQSLRKTLERRPDLLENY 221
>gi|149173196|ref|ZP_01851827.1| tRNA (Guanine-N(1))-methyltransferase [Planctomyces maris DSM 8797] >gi|148848002|gb|EDL62334.1| tRNA (Guanine-N(1))-methyltransferase [Planctomyces maris DSM 8797] (233 aa)
Score = 522, Expect = 1.7e-51, Identities = 101/221 (45%), Positives = 146/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESF-DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +L+LF   F+ +    ++K+AI N LV+I+  NFR+++ D H  VDD PYGGG GM++    +   + HV+       K+++LTP G+T NQ +A +      L L+CG YEGFDERI I     EIS GD+I  GGE+ AM I+++VIRLIP V+   +S + +SF ++ LL+YP YT+P NF G +VPEVLLSGNH+EI + R E  + +T+  R DL  +
  S:     1 MRFDILTLFPELFDSYLEQGLLKRAIRNQLVEIQRWNFRDWATDKHASVDDRPYGGGPGMLIGCDTVFQCVEHVREVVPEPGKLIMLTPQGRTLNQSLAQELSKERQLTLLCGRYEGFDERIRIGLEPMEISAGDFITNGGEVPAMLIIETVIRLIPGVLGDESSAKYDSFSESGLLEYPQYTRPQNFRGMEVPEVLLSGNHQEIARWRHEQSLLRTRERRSDLLTE 227
>gi|16329435|ref|NP_440163.1| tRNA (guanine-N(1)-)-methyltransferase [Synechocystis sp. PCC 6803] >gi|2499064|sp|P72828|TRMD_SYNY3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|1651917|dbj|BAA16843.1| tRNA (m1G37) methyltransferase [Synechocystis sp. PCC 6803] (231 aa)
Score = 521, Expect = 2.5e-51, Identities = 96/222 (43%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+  VL+LF +FF     + ++ KA+   +  + ++N R+F+ D H +VDD PYGGG GMV+  +PI  A+  +   S  +V+L+TP G+  +Q +  +   ++ L+LICGHYEG DER+   V  E+S+GD++LT GEI A+ +++ VIRL+P  +    SL +ESF  +LLDYP+YT+P  F G  VP VLLSGNH+ I + R E Q  +T+  R DL+ K+
  S:     1 MQFDVLTLFPDFFTSPLQSGLLGKALEKAIASVNLINPRDFTTDKHRRVDDEPYGGGVGMVIKPEPIFAAVESLPVLSKREVILMTPQGQPMDQALFRELTNYDQLVLICGHYEGVDERVCQLVTREVSLGDFVLTCGEIPALTLINGVIRLLPGTVGKEASLIAESFSTDLLDYPHYTRPPVFRGLAVPPVLLSGNHQAIAQWRLEQQEERTQQRRPDLWQKW 224
>gi|163762497|ref|ZP_02169562.1| ATP-dependent DNA helicase RecG [Bacillus selenitireducens MLS10] >gi|160357236|gb|EDP83884.1| ATP-dependent DNA helicase RecG [Bacillus selenitireducens MLS10] (247 aa)
Score = 520, Expect = 2.7e-51, Identities = 103/219 (47%), Positives = 149/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK+++++LF   F      SI+K+A    +V  +++NFR FS+D H +VDD PYGGG GMVLT QP+ DA+  VK +     +V+LL P G+ Y Q+ A +    EHLIL+CGHYEG+DERI    V  EIS+GDY+LTGGEI AM + DSV RL+P  + +  S  ++S    LL+YP+YT+P  + G +VP++LLSG+HK I++ R++  + +T   R D+ 
  S:     1 MKMSIMTLFPEMFEGVFGHSILKQAQEKGIVSYDVINFRTFSEDKHQRVDDYPYGGGGGMVLTPQPLFDAVESVKKTKDQAPRVILLCPQGEVYTQKKAEELAGEEHLILLCGHYEGYDERIRQELVTDEISVGDYVLTGGEIGAMIVADSVTRLLPGALGNETSAVTDSHSTGLLEYPHYTRPAEYRGLRVPDILLSGHHKRIDEWRRQEALKRTLDRRPDML 224
>gi|116512361|ref|YP_809577.1| tRNA (guanine-N(1)-)-methyltransferase [Lactococcus lactis subsp. cremoris SK11] >gi|116108015|gb|ABJ73155.1| tRNA (Guanine37-N1) methyltransferase [Lactococcus lactis subsp. cremoris SK11] (251 aa)
Score = 520, Expect = 2.7e-51, Identities = 101/222 (45%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +LS+F + F    N SI+ KA    ++++   +FR  + +    VDD PYGGG GM+L  QPI D ++ +   + K   V+LL P+GK ++Q++A +    E LI ICGHYEG+DERI   V  E+S+GD++LTGGE+AA  ++D+V+RLIP V+    S E +SF + LL+YP YT+P +F G KVPEVL+SG+H+ I K R    + KT   R DL   Y
  S:     5 MRIDILSIFPDMFGPL-NQSIVGKAQDKGILELHTHDFRENATNKQRHVDDMPYGGGQGMLLMPQPIFDTMDKIPQKSEKPARVILLDPAGKKFDQKMAEELSEEEQLIFICGHYEGYDERIKTLVTDEVSLGDFVLTGGEVAATVMIDAVVRLIPGVLGKAASHEDDSFSSGLLEYPQYTRPEDFRGMKVPEVLMSGHHENIRKWRLRESLKKTLERRPDLLDTY 229
>gi|85712462|ref|ZP_01043511.1| tRNA (guanine-N(1)-)-methyltransferase [Idiomarina baltica OS145] >gi|85693740|gb|EAQ31689.1| tRNA (guanine-N(1)-)-methyltransferase [Idiomarina baltica OS145] (248 aa)
Score = 520, Expect = 2.8e-51, Identities = 98/218 (44%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M I V+SLF + F+      + ++AI  +L+ + + N R+F+ D H  VDD PYGGG GM++ +QP+VDAIN  K +   ++ V+ L+P G+T +     Q    + +ILI G YEG D+R+I+ YVD E SIGDY+L+GGE+ AM ++D+V R++P V+   +S   +SF N LLD P+YT+P  +NG +VP VLLSGNH++I + R +  + KT + RK+L
  S:     1 MHIGVISLFPDMFSAITEHGVTRRAIKEDLLTVSVWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLVDAINAAKAALGEDTPVIYLSPQGQTLDHGGVTQLAQNDRMILIAGRYEGIDQRVIDQYVDAEWSIGDYVLSGGELPAMVLIDAVARMVPGVLGHQDSAAEDSFANGLLDCPHYTRPETYNGQQVPTVLLSGNHEKIRQWRLQQALGKTWLQRKEL 223
>gi|77414631|ref|ZP_00790770.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae 515] >gi|77159318|gb|EAO70490.1| tRNA (guanine-N1)-methyltransferase [Streptococcus agalactiae 515] (251 aa)
Score = 520, Expect = 2.8e-51, Identities = 103/222 (46%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR  ++ S + VDD PYGGG GM+L  QPI D I  +    ++V+LL P+G+T++Q  A +    + LI ICGHYEG+DERI + V  E+S+GD++LTGGE+AAM ++D+ +RLIP VI    S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I K R E  + KT   R DL   Y
  S:     2 MKIDILTLFPEMFAPLEH-SIVGKAKERGLLEINYHNFRENAEKSRH-VDDEPYGGGQGMLLRAQPIFDTIGKIDAQKARVILLDPAGRTFDQNFAEELSKEDELIFICGHYEGYDERIKSLVTDEVSLGDFVLTGGELAAMTMVDATVRLIPEVIGKETSHQDDSFSSGLLEYPQYTRPYDYLGMTVPDVLMSGHHENIRKWRLEQSLRKTLERRPDLLENY 222
>gi|125623778|ref|YP_001032261.1| tRNA (guanine-N(1)-)-methyltransferase [Lactococcus lactis subsp. cremoris MG1363] >gi|124492586|emb|CAL97531.1| tRNA (guanine-N1)-methyltransferase [Lactococcus lactis subsp. cremoris MG1363] (251 aa)
Score = 520, Expect = 3.0e-51, Identities = 101/222 (45%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+I +LS+F + F    N SI+ KA    ++++   +FR  + +    VDD PYGGG GM+L  QPI D ++ +   + K   V+LL P+GK ++Q++A +    E LI ICGHYEG+DERI   V  E+S+GD++LTGGE+AA  ++D+V+RLIP V+    S E +SF + LL+YP YT+P +F G KVPEVL+SG+H+ I K R    + KT   R DL   Y
  S:     5 MRIDILSIFPDMFGPL-NQSIVGKAQDKGILELHTHDFRENATNKQRHVDDMPYGGGQGMLLMPQPIFDTMDKIPQKSEKPARVILLDPAGKKFDQKMAEELSEEEQLIFICGHYEGYDERIKTLVTDEVSLGDFVLTGGEVAATVMIDAVVRLIPGVLGKAASHEDDSFSSGLLEYPQYTRPEDFRGMKVPEVLMSGHHENIRKWRLRESLKKTLERRPDLLDTY 229
>gi|166365485|ref|YP_001657758.1| tRNA (guanine-N(1)-)-methyltransferase [Microcystis aeruginosa NIES-843] >gi|189036089|sp|B0JJC4|TRMD_MICAN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166087858|dbj|BAG02566.1| tRNA (guanine-N1)-methyltransferase [Microcystis aeruginosa NIES-843] (231 aa)
Score = 520, Expect = 3.2e-51, Identities = 97/225 (43%), Positives = 154/225 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFK-TFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+  +++LF +FF     + ++ KA+  ++  + +VN R+F+ D H +VDD PYGGG GM+L  +PI +AI  ++     ++VL+TP G+  +Q +   +  +++ LILICGHYEG DER+  + V  E+S+GD++LT GEI A+AI++ V RL+P  +    SL+ ESF+  LLDYP YT+P  F G++VP VL SGNH++I   R + Q+++TK  R D++ K+L+E
  S:     1 MQFDIITLFPDFFTSPLQSGLLAKALERDIARVNLVNLRDFAHDKHRRVDDEPYGGGVGMLLKPEPIFEAIESLEILPPREIVLMTPQGEPLHQALLKTWAGSYQQLILICGHYEGVDERVCEHLVTREVSLGDFVLTCGEIPALAIINGVTRLLPGTVGKAESLKLESFEAGLLDYPQYTRPPVFRGWQVPPVLRSGNHQDIADWRYQQQLDRTKERRPDIWQKWLEE 229
>gi|86608693|ref|YP_477455.1| tRNA (guanine-N(1)-)-methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|119371008|sp|Q2JM55|TRMD_SYNJB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|86557235|gb|ABD02192.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] (251 aa)
Score = 519, Expect = 3.6e-51, Identities = 98/221 (44%), Positives = 143/221 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV-DYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +L+LF  FF       ++ KA+   + ++   N R+F+ D H +VDD PYGGG GMVL  +P   A+  + +    +++LLTP G+  NQ +  +      LIL+CG YEGFDERI  Y+   E+S+GD++LTGGEI A+A+++ V+RL+P  +  V+SL+SESF   LLDYP YT+P  F G+KVP VLLSG+H+ I + R + Q+ +T   R DL  K
  S:     1 MRFDILTLFPEFFETPLRIGLVGKALQQGIAEVHCTNPRDFATDKHRRVDDEPYGGGVGMVLKPEPFFAAVASLPRLDPCEIILLTPQGQPLNQALLQELAQKAQLILLCGQYEGFDERIRQYLATREVSLGDFVLTGGEIPALALINGVVRLLPGTVGKVDSLKSESFQAGLLDYPQYTRPAEFQGHKVPPVLLSGDHQAIARWRLQQQLVRTWQRRPDLLAK 224
>gi|196256204|ref|ZP_03154742.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 7822] >gi|196203384|gb|EDX98201.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 7822] (234 aa)
Score = 519, Expect = 4.0e-51, Identities = 96/222 (43%), Positives = 151/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M+  +++LF +FF     + ++ KA+A  +  + +VN R+F+ D H +VDD PYGGG GM+L  +PI  A+  ++     +++L+TP G+  +Q +  +  T ++ L+LICGHYEG DER+  Y V  E+S+GD++LT GEI A+ I++ V+RL+P  ++   SL++ESF+  LLDYP YT+P  F  ++VP VL SGNH+ I + RK+ QI +TK  R DL+ K+
  S:     1 MRFDLITLFPDFFASPLESGLLGKALAKGIARVNLVNPRDFALDKHRRVDDEPYGGGVGMLLKPEPIFAAVESLEVLPRREIILMTPQGQPLSQCLLKELATNYDQLVLICGHYEGVDERVTQYLVTREVSLGDFVLTCGEIPALTIINGVVRLLPGTVAKQESLKAESFETELLDYPQYTRPAKFRDWEVPAVLRSGNHQLIEQWRKQQQIERTKERRPDLWAKW 226
>gi|168492930|ref|ZP_02717073.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC3059-06] >gi|183576851|gb|EDT97379.1| tRNA (guanine-N1)-methyltransferase [Streptococcus pneumoniae CDC3059-06] (239 aa)
Score = 518, Expect = 4.5e-51, Identities = 106/222 (47%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F+  ++ SI+ KA    L+DI+  NFR N  K  H  VDD PYGG  GM+L  QPI D+ + ++  N +V+LL P+GK ++Q  A      E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H++I + R    + KT   R DL   Y
  S:     1 MKIDILTLFPEMFSPLEH-SIVGKAREKGLLDIQYHNFRENAEKARH--VDDEPYGGSQGMLLRAQPIFDSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELIFICGHYEGYDERIKILVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDDSFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHY 221
>gi|15674882|ref|NP_269056.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes M1 GAS] >gi|71910469|ref|YP_282019.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS5005] >gi|26400992|sp|Q9A0B6|TRMD_STRP1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|13622020|gb|AAK33777.1| putative tRNA (guanine-N1)-methyltransferase [Streptococcus pyogenes M1 GAS] >gi|71853251|gb|AAZ51274.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS5005] (243 aa)
Score = 518, Expect = 5.0e-51, Identities = 102/222 (45%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR++++ + + VDD PYGGG GM+L  QPI D I  ++    +++LL P+GK + Q  A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM ++D+ +RLIP V+   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I   R E  + KT + R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDYAEKARH-VDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTMVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLKKTYLRRPDLLEHY 221
>gi|94990224|ref|YP_598324.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS10270] >gi|118575160|sp|Q1JHF6|TRMD_STRPD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|94543732|gb|ABF33780.1| tRNA (Guanine-N(1)-)-methyltransferase [Streptococcus pyogenes MGAS10270] (243 aa)
Score = 518, Expect = 5.3e-51, Identities = 102/222 (45%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L+DI   NFR++++ + + VDD PYGGG GM+L  QPI D I  ++    +++LL P+GK + Q  A +    E LI ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM ++D+ +RLIP V+   +S + +SF + LL+YP YT+PY++ G  VP+VL+SG+H+ I   R E  + KT + R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAKEKGLLDIHYHNFRDYAEKARH-VDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTMVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTCLRRPDLLEHY 221
>gi|192812204|ref|ZP_03040872.1| tRNA (guanine-N1)-methyltransferase [Geobacillus sp. Y412MC10] >gi|192798611|gb|EDV75123.1| tRNA (guanine-N1)-methyltransferase [Geobacillus sp. Y412MC10] (272 aa)
Score = 517, Expect = 5.8e-51, Identities = 99/211 (46%), Positives = 148/211 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---------------------------SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKT 211
           M+I VL+LF   F+   ++SI+ KA    +V++  +NFR ++ + H +VDDTPYGGG GMVL   PI  A+  +  S+                            +V+L+ P G+T+ Q+ A +    EHL+ ICGHYEG+DERI  + V  E+SIGDY+LTGGE+ AM ++DSV+RL+P V+ +  S  ++SF   LL+YP+YT+P  F G+KVP++LLSG+H  I+  R+E  + +T
  S:     1 MRIDVLTLFPEMFDGVFHSSILGKAAEKEIVNLNAINFRQYAGNKHGQVDDTPYGGGGGMVLKPDPIFAAVEDILASDPNEISNHGEGAHPAGEILAEITGAAKPPRVILMCPQGETFTQKKAEELSQEEHLVFICGHYEGYDERIREFLVTDELSIGDYVLTGGELPAMVVIDSVVRLLPGVLGNETSAVTDSFSTGLLEYPHYTRPAEFRGWKVPDILLSGHHANIDVWRREQALKRT 240
>gi|163750615|ref|ZP_02157852.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella benthica KT99] >gi|161329610|gb|EDQ00601.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella benthica KT99] (248 aa)
Score = 517, Expect = 5.9e-51, Identities = 99/219 (45%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M++ V++LF   F    +  +  +A+ N L++++  N R+F+ D HN VDD PYGGG GM++ +QP+ DAI+  K +    +KV+ L+P G+   QQ   +    + LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AMA++DSV RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH+ I + R +  + +T + R DL 
  S:     1 MRLGVITLFPEMFRAVTDFGVTGRAVKNGLLELQTWNPRDFTHDKHNTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAIGDGAKVIYLSPQGRKLTQQGVEELVKSDSLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMALIDSVSRLVPGVLGKKASAEQDSFSDGLLDCPHYTRPESLDGLDVPAVLLSGNHEHIRRWRLQQSLGRTLLRRPDLL 224
>gi|167767999|ref|ZP_02440052.1| hypothetical protein CLOSS21_02542 [Clostridium sp. SS2/1] >gi|167710328|gb|EDS20907.1| hypothetical protein CLOSS21_02542 [Clostridium sp. SS2/1] (239 aa)
Score = 517, Expect = 6.4e-51, Identities = 106/224 (47%), Positives = 151/224 (67%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           +  +L+LF     +  NTSII +AI   L++I  VN R++S + H KVDD PYGGGAG+V+  +P+  A   ++    K   VV LTP G T++Q++A +    E L+ +CGHYEG DER++  +  DY +SIGDY+LTGGE+ AM ++DS+ RL+P V+ + +S   ESF+N LL+YP YT+P  F   +VPEVLLSG+H+ I K R E  + +TK  R DL+  Y KE
  S:     3 RFHILTLFPEMVMDGLNTSIIGRAIEAGLLEINAVNIRDYSTNKHMKVDDYPYGGGAGLVMQPEPVYRAYKDLEKDMKKKPRVVYLTPQGTTFHQEMAKELAKEEELVFLCGHYEGIDERVLEEIVTDY-VSIGDYVLTGGELPAMVMIDSISRLVPGVLHNDDSAGDESFENGLLEYPQYTRPPVFLDKEVPEVLLSGHHENIRKWRHEQSVKRTKERRPDLWEAYEKE 231
>gi|189425510|ref|YP_001952687.1| tRNA (guanine-N1)-methyltransferase [Geobacter lovleyi SZ] >gi|189421769|gb|ACD96167.1| tRNA (guanine-N1)-methyltransferase [Geobacter lovleyi SZ] (245 aa)
Score = 517, Expect = 7.2e-51, Identities = 103/217 (47%), Positives = 143/217 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKD 217
           M+  +L+LF + F    + SII++     L+ I +   R+++ D H  VDDTPYGGGAGM++  +P+  AI  VK  N  + V+L TP G+ +   +A +      LI++CG YEG DERI  +YVD+EISIGDY+L+GGE+AAM ++DSV RLIP V+ S  S  ++SF + LL+YP YT+P  FNG  VP  LLSGNH EI K R+E  + +T   R D
  S:     1 MRFDILTLFPDMFRGPFDESIIRRGQDKGLIQIGLHQIRDYTVDRHRTVDDTPYGGGAGMLMKPEPLAAAIESVKQLNADATVLLTTPQGRPFTHTLAQELSLKPGLIILCGRYEGVDERIHQHYVDHEISIGDYVLSGGELAAMVLVDSVTRLIPGVLGSDESALTDSFGDGLLEYPQYTRPPEFNGLAVPAPLLSGNHAEIAKWRREQALRRTAERRPD 221
>gi|171853919|emb|CAM11882.1| tRNA (Guanine-N(1)-)-methyltransferase [Candidatus Phytoplasma australiense] (244 aa)
Score = 517, Expect = 7.4e-51, Identities = 103/220 (46%), Positives = 144/220 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFI 220
           M I ++++F  FF  F + SIIK+A+    V I+I + R +S + H +VDD  YGGG GM+L+  P  D +  +KT  SKV+LL+P GK ++Q  AN + +   HLI++CG+YEG D RI+ YVD EISIGDY+LTGGEIAA  ++D+++RLIP VI   S  S+S    LL +P YT+P  +   +VP VLLSGNH +I   R++  +  T   R DL I
  S:     1 MIIEIVTIFPLFFKSFCDNSIIKRALNQQKVQIKIHDLRKYSVNKHQQVDDCVYGGGVGMLLSFPPFFDCLQEIKTPQSKVILLSPQGKIFDQVQANNYASNTPHLIILCGNYEGVDARILKYVDQEISIGDYVLTGGEIAATVVVDAIVRLIPGVIKHESAFSDSHQQGLLKFPQYTRPQIYQNQEVPSVLLSGNHAQIENWRQKESLKITLQKRPDLLI 221
>gi|57866699|ref|YP_188389.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus epidermidis RP62A] >gi|85543866|sp|Q5HPV1|TRMD_STAEQ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|57637357|gb|AAW54145.1| tRNA (guanine-N1)-methyltransferase [Staphylococcus epidermidis RP62A] (245 aa)
Score = 516, Expect = 7.9e-51, Identities = 97/222 (43%), Positives = 152/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F    N SI+K+A    ++++  +NFR++S + HN+VDD P+GGG GMVL  +P+ +A+  + +  +++V+L+ P G+ + Q+IA +    +H++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  +    VPEVLLSGNH  I++ R E ++ +T   R DL  +Y
  S:     1 MKIDYLTLFPEMFEGVLNHSILKRAQDKGIINVNTINFRDYSINKHNQVDDYPFGGGQGMVLKPEPVFNAMEDINRNEHTRVILMCPQGRPFTQEIAQELSEAKHIVFICGHYEGYDERIRKHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNQASHQDDSFSDGLLEFPQYTRPREYKNMSVPEVLLSGNHAHIDQWRHEQKLIRTYEKRPDLLEQY 225
>gi|33240803|ref|NP_875745.1| tRNA-(guanine-N1)-methyltransferase fused to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33238332|gb|AAQ00398.1| tRNA-(guanine-N1)-methyltransferase fused to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (407 aa)
Score = 516, Expect = 8.1e-51, Identities = 101/218 (46%), Positives = 141/218 (64%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQ-IANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++ VLSL  + F       +I +A +  + D+ + N RNF+KDS++KVDD PYGGG GMVL  +P  +A   +      +V+++TP G    Q  +    K +E L+ ICGHYEGFDERI    D EIS+GD+ILTGGE+AAM I++ V+RL+P  I S  SL  ES  + LL++P+YT+P  F G  VP+VLLSGNH  I+  R+E +  +TK  R DL+
  S:     5 RLDVLSLAPDSFQSLNELGVIGRAFSTGIADLNLYNPRNFTKDSYHKVDDEPYGGGVGMVLKTEPFFEAFESIPALPKRRVLMMTPQGNKLTQNDLWRWAKEYEQLVFICGHYEGFDERIRTLADEEISLGDFILTGGELAAMTIINGVLRLLPGTIGSAESLVDESHADGLLEHPHYTRPEIFRGLNVPKVLLSGNHAAISTWRQEKREQRTKERRPDLY 225
>gi|147678054|ref|YP_001212269.1| tRNA-(guanine-N1)-methyltransferase [Pelotomaculum thermopropionicum SI] >gi|189036091|sp|A5D1J4|TRMD_PELTS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|146274151|dbj|BAF59900.1| tRNA-(guanine-N1)-methyltransferase [Pelotomaculum thermopropionicum SI] (251 aa)
Score = 515, Expect = 1.1e-50, Identities = 102/219 (46%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK----TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +L+LF   F    ++SI+K+A    LV+I ++N R+FS + H+ VDD PYGGGAGMV+  + +  A+ HV     +   +VVL+ P G  + Q  A      E ++L+CGHYEG DER+    V  EISIGDY+LTGGE+ AM ++D+V RL+P V+    S+  ESF N LL+YP++T+P  F G KVPEVLLSG+H+EI K R+   + +T   R ++ 
  S:     1 MKIDILTLFPEMFAGPFSSSILKRAQERGLVEIGLINIRDFSTNKHHTVDDAPYGGGAGMVMGPEALFGAVEHVARKYGSKPGRVVLMCPQGIPFTQAYAADLAREETIVLVCGHYEGIDERVREALVTDEISIGDYVLTGGELPAMVVVDAVARLVPGVLGEALSVMEESFSNGLLEYPHFTRPREFRGLKVPEVLLSGHHEEIRKWRRRQSLLRTLERRPEML 225
>gi|125718118|ref|YP_001035251.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus sanguinis SK36] >gi|166200455|sp|A3CNE6|TRMD_STRSV tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|125498035|gb|ABN44701.1| tRNA (Guanine-N(1)-)-methyltransferase, putative [Streptococcus sanguinis SK36] (240 aa)
Score = 515, Expect = 1.3e-50, Identities = 109/222 (49%), Positives = 145/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR N  K  H  VDD PYGGG GM+L  QPI DA + ++    +V+LL P+G+T++Q  A +    E LI ICGHYEG+DERI   V  EIS+GDYILTGGE+AAM ++D+ +RLIP VI    S   +SF + LL+YP YT+PY++ G  VPEVL+SG+H+ I K R    + KT + R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKAREKGLLEINYHNFRENAEKSRH--VDDEPYGGGQGMLLRAQPIFDAYDDIEKKQPRVILLDPAGRTFDQAYAEELAKEEELIFICGHYEGYDERIKTLVTDEISLGDYILTGGELAAMTMIDATVRLIPEVIGKEASHTDDSFSSGLLEYPQYTRPYDYRGMVVPEVLMSGHHENIRKWRLYESLKKTYLRRPDLLKHY 221
>gi|27364981|ref|NP_760509.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio vulnificus CMCP6] >gi|37680970|ref|NP_935579.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio vulnificus YJ016] >gi|30316205|sp|Q8CWK5|TRMD_VIBVU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46577341|sp|Q7M7J0|TRMD_VIBVY tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|27361127|gb|AAO10036.1|AE016802_79 tRNA-(guanine-N1)-methyltransferase [Vibrio vulnificus CMCP6] >gi|37199720|dbj|BAC95550.1| tRNA-(guanine-N1)-methyltransferase [Vibrio vulnificus YJ016] (249 aa)
Score = 514, Expect = 1.4e-50, Identities = 102/219 (46%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +QQ   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGEI AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +G +VPEVL+SGNHKEI + R +  + +T   R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKQASPGKTKVIYLSPQGRKLDQQGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGEIPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDGKEVPEVLMSGNHKEIRRWRLKQSLGRTWQRRPELL 224
>gi|27467833|ref|NP_764470.1| tRNA (guanine-N1)-mehtyltransferase [Staphylococcus epidermidis ATCC 12228] >gi|38258565|sp|Q8CQL4|TRMD_STAES tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|27315378|gb|AAO04512.1|AE016747_9 tRNA (guanine-N1)-mehtyltransferase [Staphylococcus epidermidis ATCC 12228] (245 aa)
Score = 514, Expect = 1.4e-50, Identities = 100/222 (45%), Positives = 152/222 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDA---INHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI  L+LF   F    N SI+K+A    ++++  +NFR++S + HN+VDD P+GGG GMVL  +P+ +A   INH    +++V+L+ P G+ + Q+IA +    +H++ ICGHYEG+DERI  + V  EIS+GDY+LTGGE+ AM + D+++RLIP V+ +  S + +SF + LL++P YT+P  +    VPEVLLSGNH  I++ R E ++ +T   R DL  +Y
  S:     1 MKIDYLTLFPEMFEGVLNHSILKRAQDKGIINVNTINFRDYSINKHNQVDDYPFGGGQGMVLKPEPVFNAMEDINH--NEHTRVILMCPQGRPFTQEIAQELSEAKHIVFICGHYEGYDERIRKHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNQASHQDDSFSDGLLEFPQYTRPREYKNMSVPEVLLSGNHAHIDQWRHEQKLIRTYEKRPDLLEQY 225
>gi|166031986|ref|ZP_02234815.1| hypothetical protein DORFOR_01688 [Dorea formicigenerans ATCC 27755] >gi|166028439|gb|EDR47196.1| hypothetical protein DORFOR_01688 [Dorea formicigenerans ATCC 27755] (258 aa)
Score = 514, Expect = 1.5e-50, Identities = 103/221 (46%), Positives = 153/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--------------SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +++LF +   +  NTSII +A+   L+DIE VN R+++ + HN VDD PYGGGAGM++  +P+      VK                + +V+ L+P GKT+NQ +A +F   E L+ +CGHYEG DER++N V  DY +SIGDY+LTGGE+ AM ++D++ RL+P V+  + S E ESF +NLL+YP Y++P  ++  +VP +LLSG+H  I K R+E  + +T  NR DL  K
  S:     1 MQFYIMTLFPDMVMDGLNTSIIGRAMDKGLLDIEAVNIRDYAFNKHNSVDDYPYGGGAGMLMQAEPVYQCYEAVKKKIEVKALLSNPGTRKSPRVIYLSPQGKTFNQTMAEEFAQEEDLVFLCGHYEGIDERVLNEVVTDY-VSIGDYVLTGGELPAMIMIDAISRLVPGVLHNDVSAEFESFQDNLLEYPQYSRPEIWHDKQVPAILLSGHHANIEKWRREQSVIRTAKNRPDLIEK 237
>gi|118602313|ref|YP_903528.1| tRNA (Guanine37-N1) methyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567252|gb|ABL02057.1| tRNA (Guanine37-N1) methyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (224 aa)
Score = 514, Expect = 1.5e-50, Identities = 100/219 (45%), Positives = 147/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  V++LF + FN  K+  +I +AI  + + I     R+FS + +  +DD PYGGGAGMV+ ++PI D I+ +K SN  +KV+ L+P G+    ++A +  TF+ + L+CG YEG DERII + +D EISIGDY+++GGE+AAM ++D++ R IPNV+      ++SF  NLLDYP+YT+P   +   VPEVLLSG+   I+  R E  I KT+  RKDL 
  S:     1 MRFDVITLFPDMFNTIKDEGVIARAIKKSCLLIHTWQLRDFSNNKYKNIDDKPYGGGAGMVMKVKPIRDCIHKIKQSNPKTKVIYLSPQGQPLKHKLAKELSTFDSITLLCGRYEGVDERIIKHDIDMEISIGDYVISGGELAAMVLIDTISRQIPNVLGNADSLNDSFAKNLLDYPHYTRPEIIDKQAVPEVLLSGHQANIDTWRVEQSIKKTQEKRKDLL 222
>gi|15644317|ref|NP_229369.1| tRNA guanine-N1 methyltransferase [Thermotoga maritima MSB8] >gi|148270353|ref|YP_001244813.1| tRNA (guanine-N1)-methyltransferase [Thermotoga petrophila RKU-1] >gi|170289021|ref|YP_001739259.1| tRNA (guanine-N1)-methyltransferase [Thermotoga sp. RQ2] >gi|166200461|sp|A5IM14|TRMD_THEP1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|26401035|sp|Q9X1Q5|TRMD_THEMA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|4982138|gb|AAD36636.1|AE001802_5 tRNA guanine-N1 methyltransferase [Thermotoga maritima MSB8] >gi|147735897|gb|ABQ47237.1| tRNA (Guanine37-N(1)-) methyltransferase [Thermotoga petrophila RKU-1] >gi|170176524|gb|ACB09576.1| tRNA (guanine-N1)-methyltransferase [Thermotoga sp. RQ2] (245 aa)
Score = 514, Expect = 1.5e-50, Identities = 95/220 (43%), Positives = 141/220 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFI 220
           M+IT++++F       K   +I +A+   +V+I + N R+++ D H  VDD  YGGG GMV+  +P          K     V+L +P G+ +N +IA +    + +++ CG YEG DER+++ VD EISIGDYILTGGE+ AM I D+V+RL+P V+   S+E ESF   LLD+P YT+PY + G KVP+VLLSG+H+++   R++  I KT   R DLF+
  S:     1 MRITIVTIFPEMVEVIKKYGVIARAVERGIVEINVENLRDYTTDRHRTVDDYQYGGGYGMVMKPEPFFRFYESYVEKYGKPYVILTSPQGRIFNYKIAEELSKKDDIVIFCGRYEGIDERVMSIVDDEISIGDYILTGGELPAMVITDAVVRLVPGVVERESVERESFHQGLLDHPVYTRPYEYKGMKVPDVLLSGDHEKVELWRRKESIKKTLAKRPDLFL 222
>gi|29840414|ref|NP_829520.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila caviae GPIC] >gi|34222815|sp|Q820E4|TRMD_CHLCV tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|29834763|gb|AAP05398.1| tRNA (guanine-N1)-methyltransferase [Chlamydophila caviae GPIC] (355 aa)
Score = 514, Expect = 1.6e-50, Identities = 101/226 (44%), Positives = 152/226 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL--KEN 226
           M+I +LSLF ++F+    +SI+ KAI N L+ I+  + R+F      +VDD P+    GM+L  +P+V AI H+K S+S+V+ L+P GK    Q + +     HLI +CGHYEG DER + + VD EISIGDY+LT G IAA+ ++D++ R IP V+ +  S E +S +N LL+ P YT+P  F G +VPEVLL G+H+ + + RK+  +++T+  R DL+I+YL  +EN
  S:     1 MEIEILSLFPDYFDSPLRSSILGKAIKNGLLKIQSRDIRDFGLGKWKQVDDAPFNND-GMLLMAEPVVQAIRHIKRSDSRVIHLSPQGKPLTAQKSRELAKCSHLIFLCGHYEGIDERALESEVDEEISIGDYVLTNGGIAALVVIDALSRFIPGVLGNQESAEKDSLENGLLEGPQYTRPRVFEGKEVPEVLLQGDHQAVARWRKQVSLDRTRERRPDLYIRYLYDREN 229
>gi|196237889|ref|ZP_03136665.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 7425] >gi|196217679|gb|EDY12322.1| tRNA (guanine-N1)-methyltransferase [Cyanothece sp. PCC 7425] (240 aa)
Score = 512, Expect = 2.4e-50, Identities = 93/223 (41%), Positives = 154/223 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M+  V++LF +FF     + ++ KA+A  + ++ ++N R+F+ D H++VDD  YGGG GMVL  +PI  A+  +      +V+L++P G+  +Q +       F+ L++ICGHYEG DER++++ V  EIS+GD++LT GEI A+ +L+ VIRL+P  +    SL++ESF + LLD+P+YT+P +F G+ VP+VL SG+H E+++ R+  QI +T+  R DL+ ++L
  S:     1 MRFDVVTLFPDFFTSPLASGLLGKALAKQIAEVYLLNPRDFTTDKHHRVDDESYGGGVGMVLKPEPIFAAVESLPVLPRREVILMSPQGERLDQALLQSLADNFDQLVVICGHYEGVDERVVDHLVTREISLGDFVLTCGEIPALTLLNGVIRLLPGTVGKAESLQNESFIDGLLDFPHYTRPADFRGWPVPQVLRSGHHAEVDRWRRTQQIQRTRDRRPDLYQRWL 227
>gi|153810634|ref|ZP_01963302.1| hypothetical protein RUMOBE_01018 [Ruminococcus obeum ATCC 29174] >gi|149833030|gb|EDM88112.1| hypothetical protein RUMOBE_01018 [Ruminococcus obeum ATCC 29174] (254 aa)
Score = 512, Expect = 2.6e-50, Identities = 100/221 (45%), Positives = 147/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   VL+LF     +  +TSII +AIA   + I+ +N R+++ + H KVDD PYGGGAGM++  +P+  A   V+       +VV LTP G+ ++Q +A +    + L+ +CGHYEG DER+++ +  DY +SIGDY+LTGGE+ AM ++DS+ R++P V+S   S E+ESF  NLL+YP Y++P  ++G KVP VLLSG+H  I   R+E  I +T   R DL  K
  S:     1 MNFHVLTLFPEMIEQGMHTSIIGRAIAGGYLSIDAINIRDYAFNKHQKVDDYPYGGGAGMLMQAEPVYLAYESVQKKLGYRPRVVYLTPQGEVFHQTMAKELAKEKDLVFLCGHYEGIDERVLDEIVTDY-VSIGDYVLTGGELPAMVMMDSISRMVPGVLSNQESGETESFAENLLEYPQYSRPEEWHGQKVPPVLLSGHHANIEAWRREQSILRTAKRRPDLLKK 226
>gi|124026405|ref|YP_001015520.1| putative bifuntional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. NATL1A] >gi|123961473|gb|ABM76256.1| putative bifuntional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. NATL1A] (408 aa)
Score = 510, Expect = 4.2e-50, Identities = 103/219 (47%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++  V+SLF   F  F N  +IKKA    +  I I N R+ + D++ KVDD PYGGGAGMVL  +P     + +   N K ++L+TP G+  +Q   +++   + LILICG YEGFDERI +  D EISIGD++LTGGEI A+ +++ V+RL+P  + S  SLE ES +  LL++P YT+P  F G KVP+VLLSGNHK I + R++ +  +TK  R DLF
  S:     4 LRFDVVSLFPEAFKNFFNHGLIKKAFEEKIASIHIHNPRDHAMDNYRKVDDEPYGGGAGMVLKPEPYFSVFDQIPKLNKKRILLMTPQGRKISQPDFSRWSKEDQLILICGSYEGFDERIRSLADEEISIGDFVLTGGEIPAITLINGVVRLLPGTLGSAESLEEESHNEFLLEHPQYTRPAEFRGVKVPDVLLSGNHKLIREWRQKQREIRTKSRRPDLF 224
>gi|62185239|ref|YP_220024.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila abortus S26/3] >gi|81175040|sp|Q5L5L8|TRMD_CHLAB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|62148306|emb|CAH64073.1| putative tRNA(guanine-N(1)-)-methyltransferase [Chlamydophila abortus S26/3] (355 aa)
Score = 510, Expect = 4.2e-50, Identities = 103/226 (45%), Positives = 150/226 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL--KEN 226
           MKI +LSLF  +F+    +SI+ +AI   L+DI+  + R F      +VDD P+    GM+L  +P+V AI HVK S+SKVV L+P G+    + + +     HLI +CGHYEG DER + + VD EISIGDY+LT G IAA+ ++D++ R IP V+ +  S + +S +N LL+ P YT+P  F G +VPEVLL G+H+ I K RK+  +++T+  R DL+I+YL  +EN
  S:     1 MKIDILSLFPEYFDSPLRSSILGRAIKRGLLDIQSRDIREFGLGKWKQVDDAPFNHD-GMLLMAEPVVKAIRHVKRSDSKVVYLSPQGQLLTAKKSRELAQCSHLIFLCGHYEGIDERALESEVDEEISIGDYVLTNGGIAALVVIDALSRFIPGVLGNQESADKDSMENGLLEGPQYTRPRVFEGREVPEVLLHGDHQAIAKWRKQISLDRTRERRPDLYIRYLYDREN 229
>gi|114567014|ref|YP_754168.1| tRNA (guanine-N(1)-)-methyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317987|sp|Q0AWV7|TRMD_SYNWW tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|114337949|gb|ABI68797.1| tRNA (Guanine37-N(1)-) methyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (244 aa)
Score = 510, Expect = 4.5e-50, Identities = 104/221 (47%), Positives = 146/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI +L+LF   F    N SIIK+A    ++ I I N R+F++D   +VDD PYGGGAGMVL    +  AI  VK  ++ V+ ++P GK  NQ    +    + L+++CGHYEG DER++  VD EISIGDYILTGGE+ AM ++D++ RLIP V+   NS   ESF  +LL+YP YT+P ++   +VPEVLLSG+H+ I + RK+  + +T + R DL +K
  S:     1 MKIDILTLFPEMFVSPFNESIIKRAREQGIITINITNIRDFAQDRQQQVDDYPYGGGAGMVLKANVLGTAIEEVKGPDTWVLYMSPQGKPLNQDRVWELARRKELLIVCGHYEGIDERVMAMVDEEISIGDYILTGGELPAMVLVDAIARLIPGVLGDENSAMEESFSCSLLEYPQYTRPASYGEQEVPEVLLSGHHENIRRWRKKQSLLRTLLKRPDLLLK 222
>gi|127511998|ref|YP_001093195.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella loihica PV-4] >gi|166200447|sp|A3QBT8|TRMD_SHELP tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|126637293|gb|ABO22936.1| tRNA (guanine-N1)-methyltransferase [Shewanella loihica PV-4] (248 aa)
Score = 510, Expect = 4.6e-50, Identities = 98/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A++N L++++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +    +KV+ L+P G+   QQ   +    E LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH+ I + R +  + +T + R +LF
  S:     1 MWLGVVTLFPEMFRAVTDFGVTGRAVSNGLLELQTWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKVAAGDKAKVIYLSPQGRKLTQQGVEELAKSERLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGIDVPAVLLSGNHENIRRWRLQQSLGRTLLRRPELF 224
>gi|114777205|ref|ZP_01452216.1| tRNA (guanine-N1-)-methyltransferase [Mariprofundus ferrooxydans PV-1] >gi|114552350|gb|EAU54833.1| tRNA (guanine-N1-)-methyltransferase [Mariprofundus ferrooxydans PV-1] (221 aa)
Score = 510, Expect = 4.8e-50, Identities = 98/208 (47%), Positives = 143/208 (68%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK--TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESF-DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTK 212
           +L+LF  FF+   + SI K+AIA  LV ++ +  R+F+ D H+ VDDTPYGGG GM++   P+V +I   +    ++ VV+LTPSG  + Q  A ++     + L+CG YEGFDERI +YVD ++S+GDY+L+GGE AAM +LDSVIRL+P+V+ S  S   +SF +  +LD+P+YT+P  F G  VP VLLSGNH  I + R+E    +++
  S:     6 ILTLFPEFFDSPLSCSIPKRAIATGLVAVDCIQIRDFATDKHHTVDDTPYGGGPGMLMKPDPVVASIRAARERQPDTHVVMLTPSGTRFTQAKALEYTEKTSVTLLCGRYEGFDERICDYVDEQLSLGDYVLSGGEPAAMCVLDSVIRLLPDVLGSAESAVLDSFTEEGILDWPHYTRPEVFEGKAVPPVLLSGNHANIERWRREQAQQRSR 217
>gi|158320500|ref|YP_001513007.1| tRNA (guanine-N1)-methyltransferase [Alkaliphilus oremlandii OhILAs] >gi|166988158|sp|A8MHC4|TRMD_ALKOO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|158140699|gb|ABW19011.1| tRNA (guanine-N1)-methyltransferase [Alkaliphilus oremlandii OhILAs] (249 aa)
Score = 510, Expect = 4.8e-50, Identities = 107/223 (47%), Positives = 150/223 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAI----------NHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M I V++LF   F+     SII++A  N ++ I+ VN R+++++ H KVDD P+GGG GMV+T QPIV             NHV+    KV+ L+P GK ++Q++A +      LIL+CGHYEG D+R+I+  V  EISIGDY+LTGGEI AM ++D+V RLIP V+S + S E ESF + LL+YP YT+P  F G  VP+VL SGNH +I + R+   +  T   R DL   ++
  S:     1 MIIKVMTLFPEMFSGPLGNSIIQRAQENRILHIQCVNIRDYAENKHKKVDDYPFGGGPGMVMTPQPIVSCYESIVKEFQDKNHVE--QPKVIYLSPKGKKFDQEMAERLSEENALILLCGHYEGIDQRVIDEIVTDEISIGDYVLTGGEIPAMVLIDAVARLIPGVLSQDASFEEESFYSGLLEYPQYTRPRVFRGRSVPDVLTSGNHSKIQEWRRNQSLELTFHRRPDLLKDFI 233
>gi|167214674|ref|ZP_02284981.1| tRNA (guanine-N1)-methyltransferase [Listeria monocytogenes FSL R2-503] (211 aa)
Score = 509, Expect = 6.1e-50, Identities = 95/188 (50%), Positives = 136/188 (72%)
  Q:    35 IVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT----SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           + +FR +++  H+ VDD PYGGGAGM+L  QPI DA+  VK     +  +V+L+ P+GK ++Q++A +F   EHL+ ICGHYEG+DERI  + V  E+SIGDYILTGGEI AM ++DSVIRL+P V+ + +S  ++SF   LL++P+YT+P +F G KVP++LLSGNH  I + R +  + +T   R DL   Y
  S:     1 MTDFREYAEGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFAEEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGNKDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRPDLLKNY 194
>gi|194246828|ref|YP_002004467.1| tRNA (guanine-N(1)-)-methyltransferase [Candidatus Phytoplasma mali] >gi|193807185|emb|CAP18626.1| tRNA (guanine-N(1)-)-methyltransferase [Candidatus Phytoplasma mali] (243 aa)
Score = 508, Expect = 6.8e-50, Identities = 104/221 (47%), Positives = 147/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I ++++F  FF+ F   SIIK+AI  N +  ++ + RN+S + HN+VDD+PYGGGAGM+L   P  + +  +K S SKV+LL+P G   NQ++A ++    +HLI++ G+YEG D RI+NY+D EISIGDYILTGGEIA + ++D ++RL+P VI+  S   +S   +LL YP YTKP  +   KVPE+LLSGNHK I   R    +  T   R D+  K
  S:     1 MIIEIITIFPKFFDSFFEHSIIKRAIKKNKIIFQVHDLRNYSNNKHNQVDDSPYGGGAGMLLKFPPFYECLKKIKKSFSKVILLSPQGTLLNQKMAFEYVNEIKHLIILNGNYEGIDARILNYIDAEISIGDYILTGGEIATIVLIDVLVRLLPGVINSESYLEDSHQKDLLKYPQYTKPKIYQNQKVPEILLSGNHKNIKDWRYNQSLKNTFFKRPDILKK 222
>gi|159899501|ref|YP_001545748.1| tRNA (guanine-N1)-methyltransferase [Herpetosiphon aurantiacus ATCC 23779] >gi|159892540|gb|ABX05620.1| tRNA (guanine-N1)-methyltransferase [Herpetosiphon aurantiacus ATCC 23779] (254 aa)
Score = 508, Expect = 7.7e-50, Identities = 97/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  +L+LF   F      SI+K+A    L+   + + R+++ D H  VDD+P GGGAGMV+   P+      V +++   + VVL+TPSG+ +NQ IA ++     L+L+CGHYEG DER I  YV  ++S+GD++LTGGE+AAM I+D+V RL+P V+   SL  ES D+ LL+YP+YTKP  +NG  VP +LLSG+H +I + R E ++ +T   R D+ 
  S:     1 MRFDILTLFPAMFTGPLTESILKRAAQAELLQFHLHDIRDYATDKHKMVDDSPTGGGAGMVMKPGPLALCTQTVLSADPNPAPVVLMTPSGRVFNQTIAREWAQLPRLVLVCGHYEGIDERYIERYVTDQVSLGDFVLTGGELAAMTIVDAVGRLVPEVLDPESLLHESHDDGLLEYPHYTKPAEWNGVAVPPILLSGHHAKIAQWRHEQRLRRTLERRPDML 223
>gi|163722577|ref|ZP_02130115.1| tRNA (guanine-N1)-methyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161404331|gb|EDQ28561.1| tRNA (guanine-N1)-methyltransferase [Desulfatibacillum alkenivorans AK-01] (262 aa)
Score = 507, Expect = 8.5e-50, Identities = 98/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   VL+LF   F  F    I+++A+   LVDIE +N R+F++  H+  DD PYGGG GMVL  +P+  AI   K   ++++VV L P G+ ++Q+ A +    + +I++CG YEG DERI    +D EISIGDYIL+GGE AAM ++D++IRLIP  + + +S E ESF N LL++ ++T+P  F G + PE+LLSG+H +I++ R    +  T  NR DL 
  S:     1 MNFVVLTLFPLMFPAFAGHGIVRRAVEQGLVDIEALNIRDFAEGRHSTTDDRPYGGGNGMVLKPEPLAKAIRAAKEVHTDARVVFLGPRGRLFDQETAARLAGGKDIIMVCGRYEGIDERIAATLIDEEISIGDYILSGGETAAMVVMDAIIRLIPGALGNESSAEQESFSNQLLEHSHFTRPPVFEGMETPEILLSGDHGKIDQWRTRASLLYTLANRPDLL 223
>gi|86606429|ref|YP_475192.1| tRNA (guanine-N(1)-)-methyltransferase [Synechococcus sp. JA-3-3Ab] >gi|119371007|sp|Q2JTR0|TRMD_SYNJA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|86554971|gb|ABC99929.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. JA-3-3Ab] (253 aa)
Score = 507, Expect = 8.5e-50, Identities = 95/221 (42%), Positives = 143/221 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV-DYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  V++LF  FF       ++ KA+   + ++   N R+F+ D H +VDD PYGGG GMVL  +P   A+  + +    +++LLTP G+  NQ +  +      LIL+CG YEGFDERI  ++   E+S+GD++LTGGEI A+A+++ V+RL+P  +  ++SL SESF+  LL+YP YT+P  F G+KVP VLLSG+H+ I + R + Q+ +T   R DL  K
  S:     1 MRFDVITLFPEFFATPLRIGLVGKALEQGIAEVHCTNPRDFATDKHRRVDDEPYGGGVGMVLKPEPFFAAVASLPRLDPCEIILLTPQGQPLNQALLQELAQKAQLILLCGQYEGFDERIRQHLATREVSLGDFVLTGGEIPALALINGVVRLLPGTVGKIDSLRSESFETGLLEYPQYTRPPEFQGHKVPPVLLSGDHRAIARWRLQQQLVRTWRRRPDLLAK 224
>gi|151572658|gb|EDN38312.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. novicida GA99-3548] (254 aa)
Score = 506, Expect = 1.3e-49, Identities = 104/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRLIP V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     3 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLIPEVLGNKESVIEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 226
>gi|151571205|gb|EDN36859.1| tRNA (tRNA methyltransferase) [Francisella tularensis subsp. novicida GA99-3549] (252 aa)
Score = 506, Expect = 1.3e-49, Identities = 104/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRLIP V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     1 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLIPEVLGNKESVIEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 224
>gi|59711158|ref|YP_203934.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio fischeri ES114] >gi|163730706|ref|ZP_02138178.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio fischeri MJ11] >gi|66774170|sp|Q5E7F0|TRMD_VIBF1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|59479259|gb|AAW85046.1| tRNA (guanine-1-)-methyltransferase [Vibrio fischeri ES114] >gi|161396103|gb|EDQ20400.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio fischeri MJ11] (249 aa)
Score = 505, Expect = 1.4e-49, Identities = 101/219 (46%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +AI   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   + ++   +KV+ L+P G+T NQ    +  T E+LILICG YEG DERII + VD E SIGD++LTGGE+ AM ++DSV R +P V+    S E +SF + LLD P+YT+P   +G +VP VL SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTSQAIKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAITAAREASPGKTKVIYLSPQGRTLNQAGVEELATNENLILICGRYEGVDERIIQSEVDEEWSIGDFVLTGGELPAMTLIDSVSRFVPGVLGDFASAEEDSFADGLLDCPHYTRPEVLDGKEVPSVLKSGNHKDIARWRMKQSLGRTWLRRPELL 224
>gi|157149743|ref|YP_001450596.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus gordonii str. Challis substr. CH1] >gi|189036191|sp|A8AXT6|TRMD_STRGC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|157074537|gb|ABV09220.1| tRNA (guanine-N1)-methyltransferase [Streptococcus gordonii str. Challis substr. CH1] (243 aa)
Score = 505, Expect = 1.6e-49, Identities = 108/222 (48%), Positives = 144/222 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFR-NFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF   F   ++ SI+ KA    L++I   NFR N  K  H  VDD PYGGG GM+L  QPI DA + ++    +V+LL P+G+T++Q  A +    E LI ICGHYEG+DERI   V  EIS+GDY+LTGGE+AAM ++D+ +RLIP VI    S   +SF + LL+YP YT+PY + G  VPEVL+SG+H+ I K R    + KT + R DL   Y
  S:     1 MKIDILTLFPEMFAPLEH-SIVGKARKKGLLEINYHNFRENAEKSRH--VDDEPYGGGQGMLLRAQPIFDAYDAIEKKQPRVILLDPAGRTFDQAYAEELAKEEELIFICGHYEGYDERIKMLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKEASHTDDSFSSGLLEYPQYTRPYEYRGMVVPEVLMSGHHENIRKWRLYESLKKTYLRRPDLLEDY 221
>gi|169191334|ref|ZP_02851194.1| tRNA (guanine-N1)-methyltransferase [Paenibacillus sp. JDR-2] >gi|169002045|gb|EDS48948.1| tRNA (guanine-N1)-methyltransferase [Paenibacillus sp. JDR-2] (249 aa)
Score = 505, Expect = 1.7e-49, Identities = 103/221 (46%), Positives = 149/221 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-----KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+I VL+LF   F+     SI+ KA    +V +E +NFR +S + HN VDD PYGGG GMVL  +P+  A+  +       +  +V+L+ P G+++ Q+ A +    EHL+LICGHYEG+DERI  Y V  E+SIGDY+LTGGEI AM ++DSV+RL+P V+ +  S  ++S+   LL+YP+YT+P  F  + VP+VL+SGNH +I+  R+E  + +T   R DL  K
  S:     2 MRIDVLTLFPEMFDGVFGASILGKAKDKGIVSLEAINFREYSNNKHNTVDDYPYGGGGGMVLKPEPVFAAVEDLMAKKESAARPRVILMCPQGESFTQKKAEELAKEEHLVLICGHYEGYDERIREYLVTDELSIGDYVLTGGEIPAMTVIDSVVRLLPGVLGNETSAVTDSYSTGLLEYPHYTRPPVFRDWAVPDVLVSGNHAKIDTWRREQSLLRTLQRRPDLLEK 229
>gi|72382686|ref|YP_292041.1| tRNA (Guanine37-N(1)-) methyltransferase [Prochlorococcus marinus str. NATL2A] >gi|72002536|gb|AAZ58338.1| tRNA (Guanine37-N(1)-) methyltransferase [Prochlorococcus marinus str. NATL2A] (408 aa)
Score = 505, Expect = 1.8e-49, Identities = 102/219 (46%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++  V+SLF   F  F N  +IKKA    +  I I N R+ + D++ KVDD PYGGGAGMVL  +P     + +   N K ++L+TP G+  +Q   +++   + LILICG YEGFDERI +  D EISIGD++LTGGEI A+ +++ V+RL+P  + S  SL+ ES +  LL++P YT+P  F G KVP+VLLSGNHK I + R++ +  +TK  R DLF
  S:     4 LRFDVVSLFPEAFKNFFNHGLIKKAFEEKIASIHIHNPRDHAMDNYRKVDDEPYGGGAGMVLKPEPYFSVFDQIPKLNKKRILLMTPQGRKISQPDFSRWSKEDQLILICGSYEGFDERIRSLADEEISIGDFVLTGGEIPAITLINGVVRLLPGTLGSAESLKEESHNEFLLEHPQYTRPAEFRGMKVPDVLLSGNHKLIREWRQKQREIRTKSRRPDLF 224
>gi|54114555|gb|AAV29911.1| NT02FT0287 [synthetic construct] (254 aa)
Score = 505, Expect = 1.8e-49, Identities = 103/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     3 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 226
>gi|89257005|ref|YP_514367.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. holarctica] >gi|134301361|ref|YP_001121329.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|167009385|ref|ZP_02274316.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. holarctica FSC200] >gi|187931091|ref|YP_001891075.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. mediasiatica FSC147] >gi|166200422|sp|A7NEB1|TRMD_FRATF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166200424|sp|A4IWA7|TRMD_FRATW tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119382742|sp|Q2A1N5|TRMD_FRATH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|89144836|emb|CAJ80175.1| tRNA (Guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. holarctica LVS] >gi|134049138|gb|ABO46209.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|187712000|gb|ACD30297.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. mediasiatica FSC147] (252 aa)
Score = 504, Expect = 1.9e-49, Identities = 103/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     1 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 224
>gi|56707322|ref|YP_169218.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669792|ref|YP_666349.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. tularensis FSC198] >gi|169656744|ref|YP_001429270.2| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|85543859|sp|Q5NIC4|TRMD_FRATT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|118575142|sp|Q14JS7|TRMD_FRAT1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|56603814|emb|CAG44785.1| tRNA (Guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320125|emb|CAL08168.1| tRNA (Guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. tularensis FSC 198] >gi|134254068|gb|EBA53162.1| hypothetical protein FTHG_01615 [Francisella tularensis subsp. holarctica 257] >gi|151568245|gb|EDN33899.1| tRNA (Guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. tularensis FSC033] >gi|164551812|gb|ABU62314.2| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. holarctica FTNF002-00] (254 aa)
Score = 504, Expect = 1.9e-49, Identities = 103/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     3 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 226
>gi|66880455|ref|ZP_00405436.1| COG0336: tRNA-(guanine-N1)-methyltransferase [Mycoplasma genitalium G-37] (182 aa)
Score = 504, Expect = 1.9e-49, Identities = 93/176 (52%), Positives = 131/176 (74%)
  Q:    49 VDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           +DD  YGGG+GMVL  +PI++ +N  K  NS VVLL+P G+ ++Q  A +   +EHLIL+ GHYEGFD+RI  Y+D  +S+GD++L+GGE+ A++++D+ +RLI  VI+  SL  ESF++NLLD+P YT+PY+  G KVPEVLLSG+H++I   RKE QI KT   R DL+ KYL+
  S:     1 MDDMAYGGGSGMVLKAEPIINCLNFYKAPNSHVVLLSPEGEQFSQNCAKKLTKYEHLILLSGHYEGFDQRIYKYIDQIVSLGDFVLSGGELVALSVIDATVRLIKGVINDQSLICESFNDNLLDFPVYTRPYDLKGDKVPEVLLSGDHQKIESFRKEQQILKTAKYRPDLYKKYLE 176
>gi|90580369|ref|ZP_01236176.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio angustum S14] >gi|90438671|gb|EAS63855.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio angustum S14] (248 aa)
Score = 504, Expect = 2.0e-49, Identities = 98/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F+   N  +  +A+   L+ ++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K S    +KV+ L+P G+  +Q    +    E+LILICG YEG DERII   VD E SIGD++LTGGE+ AM ++D+V+R +P V+    S E +SF N LLD P+YT+P   +G +VP VL+SGNHK+I++ R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFSSITNFGVTGQAVKKGLLTVDTWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKQSAKGKAKVIYLSPQGRKLDQAGVEELAQNENLILICGRYEGVDERIIQQEVDEEWSIGDFVLTGGELPAMTLVDAVVRFVPGVLGDFASAEEDSFANGLLDCPHYTRPELLDGQEVPSVLMSGNHKDISRWRLKQSLGRTWLRRPELL 224
>gi|15639893|ref|NP_219343.1| tRNA (guanine-N(1)-)-methyltransferase [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026131|ref|YP_001933903.1| tRNA (guanine-N1)-methyltransferase [Treponema pallidum subsp. pallidum SS14] >gi|6136045|sp|O83878|TRMD_TREPA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|3323221|gb|AAC65860.1| tRNA (guanine-N1)-methyltransferase (trmD) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018706|gb|ACD71324.1| tRNA (guanine-N1)-methyltransferase [Treponema pallidum subsp. pallidum SS14] (250 aa)
Score = 504, Expect = 2.3e-49, Identities = 98/217 (45%), Positives = 138/217 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKD 217
           M I VL+LF      + +TSI+ +A+++ ++   IVN R+F+ D H   D  PYGGG GM++  +P+  A++ V     +VV +TPSGK + Q  A        L+LICG YEG D+RII+ YVD E+ IG+Y+L+ GEIAA+ ++D+V R +  VI   SLE ESF N+L++YP YT+P  F+   VP VLLSG+H  I   R   QI KT+ NR D
  S:     1 MNIDVLTLFPAIPRVYFSTSIMARAVSDGIIHYNIVNIRDFAHDKHKHCDAPPYGGGPGMLMRSEPLGKALDSVDAPKKRVVYVTPSGKLFEQGYARSLAQERALVLICGRYEGIDQRIIDEYVDDEVCIGNYVLSSGEIAALVLIDAVSRCVSGVIRHESLEEESFVNSLVEYPQYTRPRCFHNRDVPPVLLSGHHAHIRTWRLARQIEKTRRNRPD 218
>gi|27904847|ref|NP_777973.1| tRNA (guanine-N1)-methyltransferase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|29839461|sp|P59518|TRMD_BUCBP tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|27904245|gb|AAO27078.1| tRNA (Guanine-N1)-methyltransferase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (250 aa)
Score = 504, Expect = 2.3e-49, Identities = 101/223 (45%), Positives = 150/223 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII--NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M I V+S+F   F+  K+  I K+AI  +LV I ++N R F+K+ +  +DD PYGGG GM++T +P+  AIN  K+ +S   KV  L+P GK  +Q    +    +H+IL+CG YEG DER++    +D EISIGDY+L+GGE+ AM ++DS+ R+ P V+ +  +++ +SF N LLDYP+YT+P  FN  K+P +LLSGNH EI + R +  + KT + R DL  K +
  S:     1 MLINVISIFPKMFDIIKDYGITKRAIQKHLVKINVLNPRKFTKNKYKNIDDRPYGGGPGMIMTAEPLFLAINQAKSLSSNPVKVFYLSPQGKKLDQSKIMELSHQKHIILLCGRYEGIDERLLISKIIDEEISIGDYVLSGGELPAMVLIDSICRVTPGVLKNSKAIQEDSFYNGLLDYPHYTRPKCFNCIKIPNILLSGNHSEIKRWRLKQSLTKTWLKRPDLLNKLI 229
>gi|118579528|ref|YP_900778.1| tRNA (guanine-N1)-methyltransferase [Pelobacter propionicus DSM 2379] >gi|118502238|gb|ABK98720.1| tRNA (Guanine37-N1) methyltransferase [Pelobacter propionicus DSM 2379] (248 aa)
Score = 503, Expect = 2.6e-49, Identities = 101/221 (45%), Positives = 144/221 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   +L+LF   F    + SII++A    L+DI + N R+++ D H   DD PYGGGAGMV+ ++P+   I  VKT    S VV+ +P G+  +  +A +    + +I+ICG YEG DERI + YV+ +IS+GD++L+GGEIAAMAI+D+V RLIP  +  + S  ++SF + LL+YP YT+P  F G  VPE+LLSGNH+ I K R+   + KT   R DL  K
  S:     1 MIFDILTLFPGMFRGPFDESIIRRAREKQLIDISLHNIRDYALDRHQVTDDAPYGGGAGMVMKVEPLSACIQAVKTLRPASTVVMTSPQGRPLSHGVAQELSRRQGMIIICGRYEGVDERIRDLYVEDDISLGDFVLSGGEIAAMAIVDAVTRLIPGALGCDESAATDSFCDGLLEYPQYTRPPEFMGLSVPEILLSGNHELIRKWRRAQSLGKTARLRPDLLAK 225
>gi|115315365|ref|YP_764088.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|115130264|gb|ABI83451.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. holarctica OSU18] (254 aa)
Score = 503, Expect = 2.7e-49, Identities = 103/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     3 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLDCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 226
>gi|77919815|ref|YP_357630.1| tRNA(guanine-N1)-methyltransferase [Pelobacter carbinolicus DSM 2380] >gi|119364583|sp|Q3A2E7|TRMD_PELCD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|77545898|gb|ABA89460.1| tRNA (Guanine37-N1) methyltransferase [Pelobacter carbinolicus DSM 2380] (247 aa)
Score = 503, Expect = 2.8e-49, Identities = 99/219 (45%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   VL+LF   F      SI+ KA+   LV I   + R++++  H   DD PYGGG GMVL  +P+  A+  ++    +S+V+L+TP GK + Q+ A Q    E L+ +CG YEGFDERI + VD E S+GD++LTGGE+AAM I+D+V RL+P V+ + +S  S+S+ + LL+Y  YT+P  F G KVP+VLLSGNH  I + R++ Q+ +T + R DL 
  S:     1 MFFDVLTLFPGMFASPFADSIMGKAVKRGLVQITAHHLRDWAEGKHQITDDVPYGGGEGMVLKPEPVARALRDLRQRRPHSRVLLMTPQGKPFCQESARQLAGEESLVFVCGRYEGFDERIRSMVDDEFSLGDFVLTGGELAAMTIIDAVGRLVPGVLGNRDSAASDSYSDGLLEYAQYTRPAEFEGMKVPDVLLSGNHAAIARWRRQQQLLRTWLRRPDLL 222
>gi|167747199|ref|ZP_02419326.1| hypothetical protein ANACAC_01913 [Anaerostipes caccae DSM 14662] >gi|167654159|gb|EDR98288.1| hypothetical protein ANACAC_01913 [Anaerostipes caccae DSM 14662] (229 aa)
Score = 503, Expect = 2.8e-49, Identities = 105/220 (47%), Positives = 148/220 (67%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           K  VL+LF        +TSI+ +A     + +E VN R+F++D H KVDD PYGGGAGMV+  +PI  A  H++    K   V+ +TP GK ++Q++A +    E L+ +CGHYEG DER++  +  DY +SIGDY+LTGGE+ AM ++D++ RL+P V++  +S E ESF+N +L+YP YT+P  F G KVPEVLLSG+H  I + RKE    +TK  R DL  K
  S:     3 KFHVLTLFPEMIESGCSTSILGRAKEAGHIGVEAVNIRDFTRDKHKKVDDYPYGGGAGMVMQAEPIYLAYQHIEQKMEKKPRVIYVTPQGKVFHQEMAKELAEEEELVFLCGHYEGVDERVLEEIVTDY-VSIGDYVLTGGELPAMVMIDAISRLVPGVLNNGDSAEYESFENGMLEYPQYTRPPEFLGRKVPEVLLSGHHGRIEEWRKEQSYLRTKERRPDLLDK 227
>gi|89075047|ref|ZP_01161488.1| tRNA (guanine-N(1)-)-methyltransferase [Photobacterium sp. SKA34] >gi|89049134|gb|EAR54699.1| tRNA (guanine-N(1)-)-methyltransferase [Photobacterium sp. SKA34] (248 aa)
Score = 503, Expect = 2.9e-49, Identities = 97/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F+   N  +  +A+   L+ ++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K S    +K++ L+P G+  +Q    +    E+LILICG YEG DERII   VD E SIGD++LTGGE+ AM ++D+V+R +P V+    S E +SF N LLD P+YT+P   +G +VP VL+SGNHK+I++ R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFSSITNFGVTGQAVKKGLLTVDTWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKQSAKGKAKIIYLSPQGRKLDQAGVEELAQNENLILICGRYEGVDERIIQQEVDEEWSIGDFVLTGGELPAMTLVDAVVRFVPGVLGDFASAEEDSFANGLLDCPHYTRPELLDGQEVPSVLMSGNHKDISRWRLKQSLGRTWLRRPELL 224
>gi|118498128|ref|YP_899178.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. novicida U112] >gi|194323355|ref|ZP_03057139.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. novicida FTE] >gi|166200423|sp|A0Q859|TRMD_FRATN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|118424034|gb|ABK90424.1| tRNA (Guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. novicida U112] >gi|194322719|gb|EDX20199.1| tRNA (guanine-N1)-methyltransferase [Francisella tularensis subsp. novicida FTE] (252 aa)
Score = 503, Expect = 3.0e-49, Identities = 104/218 (47%), Positives = 147/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRLIP V+ +  S+  +SF + LLDYP+YTKP    NG  VP VLLSGNHKEI K R++ ++ +T   RKDL
  S:     1 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLIPEVLGNKESVIEDSFYDGLLDYPHYTKPAVLPNGNAVPGVLLSGNHKEIAKWRRKQKLIRTYERRKDL 224
>gi|22299154|ref|NP_682401.1| tRNA (guanine-N(1)-)-methyltransferase [Thermosynechococcus elongatus BP-1] >gi|38258579|sp|Q8CWM2|TRMD_SYNEL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|22295336|dbj|BAC09163.1| tRNA methyltransferase [Thermosynechococcus elongatus BP-1] (237 aa)
Score = 503, Expect = 3.0e-49, Identities = 94/223 (42%), Positives = 148/223 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQ-IANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M+  +++LF  FF    ++ ++ KA+A  + ++ + N R+FS D H +VDD PYGGG GMV+  +P+  A+  +      +V+ +TP G+   QQ + +  +  + L+++CGHYEG DER++ + V  EISIGD++LT GEI A+ IL+ V+RL+P  +    SL  +SF++ LLDYP+YT+P  F G+ VP VLLSG+H EI   R+  QI +T+  R DL+ ++L
  S:     1 MRFDIITLFPEFFASPLSSGLMAKALARGIAEVVLTNPRHFSTDKHQRVDDEPYGGGVGMVMKPEPLFAAVESLPALPRREVIYVTPQGQPLTQQHLWHWSRERDQLVILCGHYEGVDERVVEHLVTQEISIGDFVLTCGEIPALVILNGVLRLLPGTVGKAASLHQDSFEDGLLDYPHYTRPAEFRGWTVPPVLLSGHHGEIAAWRRAQQIERTRQRRPDLYARWL 227
>gi|91201022|emb|CAJ74080.1| strongly similar to tRNA (guanine-N(1)-)-methyltransferase [Candidatus Kuenenia stuttgartiensis] (226 aa)
Score = 502, Expect = 3.5e-49, Identities = 103/221 (46%), Positives = 148/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQI----NKTKINRKDLFIK 221
           M+I +L+LF   F      SI+K A    LV   I N R+++ ++   VDD PYGGG GMV+  +P+ +A+  ++      +K +LLTP G+ + Q IA +     +L+LICGHYEGFDERI   +D +E+SIGDYIL+GGE++AM ++D+V+RLIP V+   NS+  ESF + LL+YP YT+P  + G KVPE+L SG+H++I    KEWQ      +T+  R DL  K
  S:     1 MRIDILTLFPGIFENVLGHSILKIAREKALVQYNIFNIRDYA-ENQRCVDDRPYGGGPGMVMKPEPVFNAVEAIERQTNIPAKKILLTPQGRCFTQAIAKELAKEAYLMLICGHYEGFDERIRTGLDVFELSIGDYILSGGELSAMVVIDAVVRLIPGVLGDKNSITEESFHDGLLEYPQYTRPAEYRGMKVPEILRSGHHQKI----KEWQRYLAEKRTREKRPDLLNK 225
>gi|78224064|ref|YP_385811.1| tRNA (Guanine37-N1) methyltransferase [Geobacter metallireducens GS-15] >gi|119382743|sp|Q39RN8|TRMD_GEOMG tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|78195319|gb|ABB33086.1| tRNA (Guanine37-N1) methyltransferase [Geobacter metallireducens GS-15] (245 aa)
Score = 502, Expect = 3.7e-49, Identities = 95/221 (42%), Positives = 143/221 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MK  +L+LF   F      SII++A+   L+DI +   R+F+ D H  VDD PYGGG GMV+ ++PI   +  VK    K  V+L +P G+ ++   A +    + +I+ICG YEG DER+   +V+ E SIGD++LTGGE+AAM ++D+ +R +P V+ S  S E+++F + LL+YP+YT+P  F G+ VP VLLSGNH E+ + R+   + +T  +R DL  K
  S:     1 MKFDILTLFPAMFEGPLTESIIRRAVEKGLLDIRLHQIRDFATDRHKVVDDAPYGGGDGMVMKVEPIAACLEAVKAERPKARVLLTSPRGRLFDNAAARELAQEQEVIIICGRYEGIDERVRELFVEDEFSIGDFVLTGGELAAMVMIDATVRFVPGVLGSPGSAETDTFSDGLLEYPHYTRPAEFRGHSVPAVLLSGNHAEVARWRRRKALEETIRSRPDLLEK 225
>gi|62258621|gb|AAX77809.1| unknown protein [synthetic construct] (289 aa)
Score = 502, Expect = 3.8e-49, Identities = 103/218 (47%), Positives = 148/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI ++ V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:    29 MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 252
>gi|46198978|ref|YP_004645.1| tRNA (guanine-N1)-methyltransferase [Thermus thermophilus HB27] >gi|84029285|sp|Q72JU8|TRMD_THET2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46196602|gb|AAS81018.1| tRNA (Guanine-N1)-methyltransferase [Thermus thermophilus HB27] (239 aa)
Score = 502, Expect = 3.9e-49, Identities = 95/218 (43%), Positives = 142/218 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+ TV++LF N    +   S++KKA+   L+ +E+V+ R F    H  VDDTPYGGGAGMV+     V A+     ++ +VVLL+P+G+ + Q++A +    EHL+L+ G YEGFD R+  +    +SIGDY+L GGE+AA+A+L++  RL+P VI    S   +SF   LLDYP YT+P  F G +VPEVLLSG+H+E+ + R++  + +T   R +L
  S:     1 MRYTVITLFPNLVRPWLEESLLKKALERGLIQVEVVDLRAFGLGRHRTVDDTPYGGGAGMVIRPDVAVAALERALPAD-EVVLLSPAGRPFTQKVAEELAGKEHLVLLAGRYEGFDARVEAFATRILSIGDYVLMGGEVAALAVLEATARLVPGVIGDPQSHREDSFVRGLLDYPQYTRPPEFRGLRVPEVLLSGHHQEVERWRRQEALRRTLALRPEL 218
>gi|152997769|ref|YP_001342604.1| tRNA (guanine-N1)-methyltransferase [Marinomonas sp. MWYL1] >gi|189036088|sp|A6W1U0|TRMD_MARMS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|150838693|gb|ABR72669.1| tRNA (guanine-N1)-methyltransferase [Marinomonas sp. MWYL1] (250 aa)
Score = 502, Expect = 4.1e-49, Identities = 97/219 (44%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MK++V+SLF   F       +  +AI + LV+++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K S  N+KV+ L+P G+T  Q+   Q       IL+ G YEG DER+I + +D E SIGD++L+GGE+ AM ++D+V R++P V+    S + +SF + LLD P+YT+P   NG  VP VLLSGNH+EI + R + ++ +T   R DL 
  S:     1 MKVSVISLFPEMFQAITQYGVTGRAIKSGLVEVDFFNPRDFTHDRHKTVDDRPYGGGPGMLMKVQPLKDAIASAKLSVPNAKVIYLSPQGRTLTQEGVQQLAKQAEFILVAGRYEGVDERLIQSEIDEEWSIGDFVLSGGELPAMVLMDAVSRMVPGVLGKQASADEDSFSDGLLDCPHYTRPEVLNGEPVPSVLLSGNHEEIRRWRLKQKLARTFQRRPDLL 223
>gi|182414914|ref|YP_001819980.1| tRNA (guanine-N1)-methyltransferase [Opitutus terrae PB90-1] >gi|177842128|gb|ACB76380.1| tRNA (guanine-N1)-methyltransferase [Opitutus terrae PB90-1] (224 aa)
Score = 501, Expect = 4.5e-49, Identities = 96/219 (43%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +KI VL+LF    + F   SI+ K IA   + + + + R ++ D H   DD P+GGGAGMV+  +P+  AI  ++T   + + LTP G  ++  +A +    +HL+++ GHYEG D+RI    +D EISIGDY+LT G +AA  ++D++ R IP V+    SL  ESF + LLD+P YT+P  F G  VPEVLLSGNH EI K R   Q+ KT+  R DL 
  S:     3 LKIDVLTLFPRMLDGFLAESILGKGIAAGRLGVTVHDLRGWTTDKHRTADDRPFGGGAGMVMKPEPVFAAIEQLQTPGCRRIYLTPDGVPFSMPLAKELSEQQHLVILSGHYEGIDQRIRERIIDQEISIGDYVLTNGTLAAAVVIDALARFIPGVLGEEKSLTHESFTSKLLDFPQYTRPAEFRGMSVPEVLLSGNHAEIEKWRHARQVEKTRQVRPDLL 223
>gi|183597519|ref|ZP_02959012.1| hypothetical protein PROSTU_00793 [Providencia stuartii ATCC 25827] >gi|188023165|gb|EDU61205.1| hypothetical protein PROSTU_00793 [Providencia stuartii ATCC 25827] (254 aa)
Score = 501, Expect = 5.1e-49, Identities = 100/219 (45%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ N L+ +E  N R+F+ D H  VDD PYGGG GM++ +QP+ DAIN  +T     +KV+ L+P G+  +Q    +  T E LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV R IP V+    S + +SF + LLD P+YT+P   +G  VP+VLLSGNH +I+  R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITEYGVTGRAVKNGLLSVECWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAINTARTEAGEGAKVIYLSPQGRKLSQAGVCELATNEKLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMVLIDSVSRFIPGVLGHEASAQEDSFADGLLDCPHYTRPEVLDGMHVPDVLLSGNHAKIDSWRMKQSLGRTWLRRPELL 224
>gi|119774028|ref|YP_926768.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella amazonensis SB2B] >gi|166200444|sp|A1S3Z2|TRMD_SHEAM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119766528|gb|ABL99098.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella amazonensis SB2B] (250 aa)
Score = 500, Expect = 5.5e-49, Identities = 96/219 (43%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +AI N L+++   N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   +T+    +KV+ L+P G+   Q+ A +    + LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++D+V RL+P V+    S E +SF + LLD P+YT+P + +G +VP VLL GNH++I + R +  + +T + R +LF
  S:     1 MWLGVITLFPEMFRAITDFGVTGRAIKNGLLELHTWNPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLKDAIQAARTAAGDGAKVIYLSPQGRKLTQRGATELAETQKLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDAVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGLEVPAVLLGGNHEDIRRWRLKQSLGRTFLRRPELF 224
>gi|55981001|ref|YP_144298.1| tRNA (guanine-N1)-methyltransferase [Thermus thermophilus HB8] >gi|84029286|sp|Q5SJH6|TRMD_THET8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|55772414|dbj|BAD70855.1| tRNA (guanine-N1)-methyltransferase [Thermus thermophilus HB8] (239 aa)
Score = 500, Expect = 5.7e-49, Identities = 95/218 (43%), Positives = 142/218 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+ TV++LF N    +   S++KKA+   L+ +E+V+ R F    H  VDDTPYGGGAGMV+     V A+     ++ +VVLL+P+G+ + Q++A +    EHL+L+ G YEGFD R+  +    +SIGDY+L GGE+AA+A+L++  RL+P VI    S   +SF   LLDYP YT+P  F G +VPEVLLSG+H+E+ + R++  + +T   R +L
  S:     1 MRYTVITLFPNLVRPWLEESLLKKALERGLIRVEVVDLRAFGLGRHRTVDDTPYGGGAGMVIRPDVAVAALERALPAD-EVVLLSPAGRPFTQKVAEELAGKEHLVLLAGRYEGFDARVEAFATRILSIGDYVLMGGEVAALAVLEATARLVPGVIGDPQSHREDSFVRGLLDYPQYTRPPEFRGLRVPEVLLSGHHQEVERWRRQEALRRTLALRPEL 218
>gi|157122814|gb|EDO66943.1| tRNA (Guanine-N(1)-)-methyltransferase [Francisella tularensis subsp. holarctica FSC022] (254 aa)
Score = 500, Expect = 5.7e-49, Identities = 103/218 (47%), Positives = 147/218 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  +  +AI +  V I   N R+++ D H  VDDT +GGGAGMV+  QP+  AI   K +    +KVV L+P G  +N + A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ +  S+  +SF + LLDYP+YTKP    NG  VP+VLLSGNHKEI K R++ ++ +T   RKDL
  S:     3 MKFGIISIFPEMFKAINDFGVTARAIKDFKVSISCFNPRDYTTDRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRKDL 226
>gi|157374300|ref|YP_001472900.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella sediminis HAW-EB3] >gi|189036101|sp|A8FSE9|TRMD_SHESH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|157316674|gb|ABV35772.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella sediminis HAW-EB3] (242 aa)
Score = 500, Expect = 6.5e-49, Identities = 96/219 (43%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M++ V++LF   F    +  +  +A+ N L++++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +   ++KV+ L+P G+   QQ   +    + LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P   +   VP VLLSGNH+ I + R +  + +T + R DL 
  S:     1 MRLGVVTLFPEMFRAVTDFGVTGRAVKNGLLELQTWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKAATGDSAKVIYLSPQGRKLTQQGVEELVKSDSLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKKASAEQDSFSDGLLDCPHYTRPETLDNLDVPAVLLSGNHEHIRRWRLQQSLGRTLLRRPDLL 224
>gi|192359118|ref|YP_001981924.1| tRNA (guanine-N1)-methyltransferase [Cellvibrio japonicus Ueda107] >gi|190685283|gb|ACE82961.1| tRNA (guanine-N1)-methyltransferase [Cellvibrio japonicus Ueda107] (258 aa)
Score = 500, Expect = 6.9e-49, Identities = 94/219 (42%), Positives = 147/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV-DYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +KI V+S+F + F    +  I  +AI  ++V++++   R+F+ D H+ VDD PYGGG GMV+ +QP+ DAI   K    S++KVV L+P G+  +QQ  +    + +L+L+ G YEG DER+++ V D E SIGDY+L+GGE+ AM ++D++ RL+P  +    S E +SF + LLD P+YT+P  F G +VP+VL+SGNH+ I + R +  + +T + R DL 
  S:    10 IKIAVVSIFPDMFKAIADFGITSRAIKQSMVELKVWTPRDFAHDRHSTVDDRPYGGGPGMVMMVQPVRDAILAAKAWAGSDAKVVYLSPQGRPLDQQGVSTLYAYGNLVLLAGRYEGIDERLLDTVIDEEWSIGDYVLSGGELPAMVLIDAITRLVPGALGHAQSAEQDSFTDGLLDCPHYTRPEEFEGLRVPDVLVSGNHEHIRRWRLKQALGRTWLKRPDLL 233
>gi|116750422|ref|YP_847109.1| tRNA (guanine-N1)-methyltransferase [Syntrophobacter fumaroxidans MPOB] >gi|116750464|ref|YP_847151.1| tRNA (guanine-N1)-methyltransferase [Syntrophobacter fumaroxidans MPOB] >gi|116699486|gb|ABK18674.1| tRNA (guanine-N1)-methyltransferase [Syntrophobacter fumaroxidans MPOB] >gi|116699528|gb|ABK18716.1| tRNA (Guanine37-N(1)-) methyltransferase [Syntrophobacter fumaroxidans MPOB] (252 aa)
Score = 499, Expect = 8.1e-49, Identities = 100/221 (45%), Positives = 143/221 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   +L++F   F+     SI+ KA    LV+I + N R+ + D H   DD P+GGG GMV+  +PIV A+  V  +   + V LLTP+G+ + Q +A +      LILICG YEG DERI  ++ D  ISIGDY+LTGGE+AAM ++D+V RLIP V+ + +S  +ESF   +L+YP YT+P  F G+ VP+VLLSG+H+ I + R+   + +TK  R DLF +
  S:     1 MIFDILTIFPGMFDAPLGESILGKARERGLVEIRVHNIRDHAFDKHQMTDDRPFGGGEGMVMKPEPIVAAVEAVAGEGPEAPVALLTPAGRLFTQDLAARLSLLPRLILICGRYEGVDERIAEHFADETISIGDYVLTGGELAAMVVVDAVTRLIPGVLGNASSAAAESFTEPILEYPQYTRPQEFRGHPVPDVLLSGHHEAIRRWRRGQALLRTKRLRPDLFAR 225
>gi|189485022|ref|YP_001955963.1| tRNA (guanine-N1-)-methyltransferase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170286981|dbj|BAG13502.1| tRNA (guanine-N1-)-methyltransferase [uncultured Termite group 1 bacterium phylotype Rs-D17] (233 aa)
Score = 499, Expect = 8.1e-49, Identities = 113/221 (51%), Positives = 153/221 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINH--VKTSNSK---------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MKI VL++F   F      S+I KAI   ++ I I++ R+FSKD H KVDD  +GGG GMV+ L+P+ DAI    VK  NS          V+ ++P G+  +  I      F+ L++ICGHYEG DER +NYVD EISIGDYILTGGEI AM ++DS  R++  V+   +S++++SF NNLLDYP+YT+P  F GYK+PEVLLSG+HK+I++ R +    +TK  R DL  K
  S:     1 MKIDVLTIFPGMFKGPLTESLIGKAIEKEILKINIIDIRSFSKDKHKKVDDKSFGGGCGMVMKLEPLYDAIKSTGVKKKNSTYKNPYTKPYVIYMSPQGRILSDSIVKNLAKFKQLVIICGHYEGVDERTMNYVDEEISIGDYILTGGEIPAMVLIDSTARMLTGVVKEKSSVKNDSFYNNLLDYPHYTRPAVFKGYKIPEVLLSGDHKKISEWRVQESYKRTKERRPDLLKK 233
>gi|160939141|ref|ZP_02086492.1| hypothetical protein CLOBOL_04035 [Clostridium bolteae ATCC BAA-613] >gi|158438104|gb|EDP15864.1| hypothetical protein CLOBOL_04035 [Clostridium bolteae ATCC BAA-613] (305 aa)
Score = 498, Expect = 9.4e-49, Identities = 95/219 (43%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   +L+LF +       TSI  +A+ +  + +E ++ R++SKD H  VDD PYGGGAGMV+   P+ +A   +        +++ +TP G+ +NQ IA +    E L+ +CGHYEG DER +  +  DY +S+GDY+LTGGE+ AM ++D + RL+P V++ + S E ESF ++LL+YP YT+P  F G +VPEVLLSG+HK I + R++  I +T   R DL 
  S:     1 MNFHILTLFPDMVMGGLGTSITGRAMESKTISVEAIDIRDYSKDKHRHVDDAPYGGGAGMVMQPGPVCEAYEALCGRIGRKPRLIYMTPQGRVFNQTIAEELAKEEDLVFLCGHYEGIDERALELIATDY-LSVGDYVLTGGELPAMVMIDCISRLVPGVLNNDASAEEESFHDSLLEYPQYTRPEVFRGMEVPEVLLSGHHKNIEEWRRQQSIKRTLERRPDLL 224
>gi|28899305|ref|NP_798910.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|153838723|ref|ZP_01991390.1| tRNA (guanine-N1)-methyltransferase [Vibrio parahaemolyticus AQ3810] >gi|34098476|sp|Q87LT0|TRMD_VIBPA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|28807529|dbj|BAC60794.1| tRNA (guanine-N1)-methyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|149747883|gb|EDM58761.1| tRNA (guanine-N1)-methyltransferase [Vibrio parahaemolyticus AQ3810] (247 aa)
Score = 498, Expect = 9.4e-49, Identities = 99/219 (45%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +Q+   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGEI AM ++DSV R IP V+    S E +SF N LLD P+YT+P   +  +VP VL+SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKKASPGKTKVIYLSPQGRKLDQKGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGEIPAMTLIDSVSRFIPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKEVPSVLMSGNHKDIRQWRLKQSLGRTWLRRPELL 224
>gi|196156516|ref|YP_002126005.1| tRNA (guanine-N(1)-)-methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|88772487|gb|EAR03772.1| tRNA (guanine-N(1)-)-methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|196112295|gb|ACG66011.1| tRNA (guanine-N(1)-)-methyltransferase [Alteromonas macleodii 'Deep ecotype'] (253 aa)
Score = 498, Expect = 1.0e-48, Identities = 97/215 (45%), Positives = 141/215 (65%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           V+SLF + F  F    +I +A+ +  V ++  N R+F+ D H  VDD PYGGG GM++ ++P+ DAI   K     NSKV+ L+P GK  +Q    +  + +  ILICG YEG DER+I ++VD E+SIGDY+L+GGE+ AM ++D+V RL+P V+    S   +SF + LLD P+YT+P   +G KVPEVLLSG+H++I + R    + +T   R DL 
  S:     9 VVSLFPDMFAPFTQQGVIGRAVKSGTVMVDTFNPRDFTHDRHRTVDDRPYGGGPGMLMMVKPLTDAIQAAKKVGGENSKVIYLSPQGKPLDQAGVQRLASIDRTILICGRYEGIDERVIESHVDEEVSIGDYVLSGGELPAMVLMDAVARLVPGVLGHKASAVEDSFTDGLLDCPHYTRPEILDGQKVPEVLLSGDHEKIRQWRLMQSLGRTLQRRPDLL 228
>gi|167758978|ref|ZP_02431105.1| hypothetical protein CLOSCI_01324 [Clostridium scindens ATCC 35704] >gi|167663385|gb|EDS07515.1| hypothetical protein CLOSCI_01324 [Clostridium scindens ATCC 35704] (244 aa)
Score = 498, Expect = 1.2e-48, Identities = 99/221 (44%), Positives = 148/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPI---VDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   +++LF +      NTSI  +AI   L+ I+ VN R+++ + HN VDD PYGGGAGM++  +P+    +AI        +VV L+P G+T+ Q +A ++   E L+L+CGHYEG DER++  +  DY +SIGDY+LTGGE+ AM ++D++ RL+P V+  + S E ESF +NLL+YP Y++P  ++  +VP+VLLSG+H  I   R+E  I +T  NR DL  K
  S:     1 MHFYIMTLFPDMVMNGLNTSITGRAIEKGLLSIDAVNIRDYAYNKHNSVDDYPYGGGAGMLMQAEPVYQTYEAICQKSGKRPRVVYLSPQGRTFCQTMAEEYAREEELVLLCGHYEGIDERVLEEIVTDY-VSIGDYVLTGGELPAMIMVDAISRLVPGVLHNDVSAEFESFQDNLLEYPQYSRPEIWHEKQVPQVLLSGHHANIEAWRREQSIIRTAKNRPDLLKK 226
>gi|55821404|ref|YP_139846.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus thermophilus LMG 18311] >gi|116628128|ref|YP_820747.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus thermophilus LMD-9] >gi|122267276|sp|Q03JS1|TRMD_STRTD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|84029282|sp|Q5M3J5|TRMD_STRT2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|55737389|gb|AAV61031.1| tRNA (guanine-N1)-methyltransferase [Streptococcus thermophilus LMG 18311] >gi|116101405|gb|ABJ66551.1| tRNA (Guanine37-N(1)-) methyltransferase [Streptococcus thermophilus LMD-9] (239 aa)
Score = 498, Expect = 1.2e-48, Identities = 102/222 (45%), Positives = 146/222 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF + F   ++ SI+ KA    +++I   NFR+ ++ + + VDD PYGGG GM+L  QPI D  + +  +  +V+LL P+G+T+NQ  A +    E L+ ICGHYEG+DERI   V  EIS+GD++LTGGE+AAM I+D+ +RLIP V+    S + +SF + LL++P YT+P  F G KVP+VLLSG+H  I + R E  + KT   R DL   Y
  S:     1 MKIDILTLFPDMFAPLEH-SIVGKAKDKGILEINYHNFRDNAEKARH-VDDEPYGGGQGMLLRAQPIFDTFDKLNVTKPRVILLDPAGRTFNQAYAEELAQEEELVFICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPEVLGKEASHKDDSFSSGLLEFPQYTRPAEFRGMKVPDVLLSGHHVNIRRWRMEQSLRKTWERRPDLLENY 221
>gi|196236278|ref|ZP_03135077.1| tRNA (guanine-N1)-methyltransferase [Thermus aquaticus Y51MC23] >gi|196219770|gb|EDY14390.1| tRNA (guanine-N1)-methyltransferase [Thermus aquaticus Y51MC23] (239 aa)
Score = 497, Expect = 1.3e-48, Identities = 93/211 (44%), Positives = 138/211 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKT 211
           M+ T ++LF +    +   S+I KA+   L+  E+V+ R F    H  VDDTPYGGGAGMV+     V AI     ++ +V+LL+P+G+ + Q++A +    EHL+L+CG YEGFD R+  +V   +SIGDY+L GGE+AA+A+L++  RL+P VI    S   +SF   LLDYP+YT+P  F G KVPEVLLSG+H+ + + R++  + +T
  S:     1 MRYTFITLFPDLIRPWLEESLIAKALQRGLLSAEVVDLRAFGLGRHRSVDDTPYGGGAGMVIRADVAVAAIESALPAD-EVILLSPAGRPFTQEVAEELSRKEHLVLLCGRYEGFDARVEAFVTRSLSIGDYVLMGGEVAALAVLEATARLVPGVIGDPMSHREDSFVRGLLDYPHYTRPPEFRGLKVPEVLLSGDHEAVARFRRKEALKRT 211
>gi|88855264|ref|ZP_01129929.1| tRNA-(guanine-N1)-methyltransferase [marine actinobacterium PHSC20C1] >gi|88815792|gb|EAR25649.1| tRNA-(guanine-N1)-methyltransferase [marine actinobacterium PHSC20C1] (228 aa)
Score = 497, Expect = 1.4e-48, Identities = 94/219 (42%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-----YEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++F +FF    + S++ KA    ++++ + + R+F+ D H  VDDTPYGGGAGMV+  +P  DA++ V T  + V++ TP+G  + Q  A +    +HL+  CG YEG D+R+I+Y        EIS+GDY+L GGE+A MA+++++ RL+P VI +  SL  ES +  LL+YP+YTKP  +    VP++LLSGNHK I   R E Q+ +T+  R DL 
  S:     1 MRIDIVTIFPDFFGVL-DISLLGKARERGIIELGVHDLRDFTHDRHRTVDDTPYGGGAGMVMRPEPWGDALDAVLTPETVVIVPTPAGVPFTQAAARELSEEKHLVFTCGRYEGIDQRVIDYAASTVRVREISLGDYVLNGGEVATMAMIEAIGRLVPGVIGNPESLTEESHEQGLLEYPSYTKPSTWRDRSVPDILLSGNHKAIADWRHEQQVERTRRVRPDLL 224
>gi|91228775|ref|ZP_01262685.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio alginolyticus 12G01] >gi|91187682|gb|EAS74004.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio alginolyticus 12G01] (253 aa)
Score = 497, Expect = 1.5e-48, Identities = 98/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +Q+   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGEI AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +  +VP VL+SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKAASPGKTKVIYLSPQGRKLDQKGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGEIPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKEVPAVLMSGNHKDIRQWRLKQSLGRTWLRRPELL 224
>gi|153835828|ref|ZP_01988495.1| tRNA (guanine-N1)-methyltransferase [Vibrio harveyi HY01] >gi|156975743|ref|YP_001446650.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|194538462|ref|YP_002073550.1| tRNA (guanine-N1)-methyltransferase [Vibrio sp. Ex25] >gi|166200462|sp|A7MYV2|TRMD_VIBHB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|148865852|gb|EDL66817.1| tRNA (guanine-N1)-methyltransferase [Vibrio harveyi HY01] >gi|151937017|gb|EDN55898.1| tRNA (guanine-N1)-methyltransferase [Vibrio sp. Ex25] >gi|156527337|gb|ABU72423.1| hypothetical protein VIBHAR_03478 [Vibrio harveyi ATCC BAA-1116] (247 aa)
Score = 497, Expect = 1.5e-48, Identities = 98/219 (44%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +Q+   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGEI AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +  +VP VL+SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKAASPGKTKVIYLSPQGRKLDQKGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGEIPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKEVPAVLMSGNHKDIRQWRLKQSLGRTWLRRPELL 224
>gi|187734756|ref|YP_001876868.1| tRNA (guanine-N1)-methyltransferase [Akkermansia muciniphila ATCC BAA-835] >gi|187424808|gb|ACD04087.1| tRNA (guanine-N1)-methyltransferase [Akkermansia muciniphila ATCC BAA-835] (239 aa)
Score = 496, Expect = 1.8e-48, Identities = 101/226 (44%), Positives = 144/226 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           + I VLSLF +        SI+ KA    L++I   N R+++ D H K DD   GGG GM+L  +PI  A+  ++   ++VVL+TP G+T+NQ +A +   +  HLI++CGHYEG D R++   VD E+SIGDYILT G IA++ ++D+V RLIP V+    S   ESF N LL+ P YTKP  F G  VPE+LL GNH  I K +    + +T++NR DL+ K+L+ +
  S:     5 LMIDVLSLFPDMVEAPLGGSILGKARDRGLLEIRCHNIRDWTTDKHRKTDDYLCGGGQGMLLKPEPIFAAVEELRRRETRVVLMTPQGRTFNQSLAAELAASGGHLIILCGHYEGVDHRVVEELVDMELSIGDYILTNGAIASVVVIDAVARLIPGVLGDERSSVEESFSNGLLEAPAYTKPNVFRGLAVPEILLGGNHPAIEKWKHGKSLERTRLNRPDLWRKWLESH 233
>gi|118726864|ref|ZP_01575480.1| tRNA (guanine-N1)-methyltransferase [Clostridium cellulolyticum H10] >gi|118663756|gb|EAV70401.1| tRNA (guanine-N1)-methyltransferase [Clostridium cellulolyticum H10] (233 aa)
Score = 496, Expect = 2.1e-48, Identities = 111/226 (49%), Positives = 147/226 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHY-EGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           MK  VL+LF   FN     SII +A  N LV++  VN R++SKD H KVDD P+GGG GMV+  QP++D   AI+       KV+ ++P GK   Q++A +    EHLIL+CGHY    +  I   +D EISIGDY+LTGGE+ AM ++D V RLIP V+S   S   ES  N LL+YP YT+P ++NG KVPEVLLSG+H  I K R +  +++T+  R DLF K   +N
  S:     1 MKFDVLTLFPELFNTVMGESIIGRAQKNRLVEVNAVNIRDYSKDKHKKVDDYPFGGGNGMVMMCQPVIDAYKAISEGMEQKPKVIYMSPQGKVLTQEMAKELSKQEHLILLCGHYEGIDERIIEEIIDEEISIGDYVLTGGELPAMVLIDCVSRLIPGVLSTEGSFSDESHFNGLLEYPQYTRPADYNGNKVPEVLLSGHHANIEKWRMQQSLDRTRDKRPDLFNKLPNKN 231
>gi|167630254|ref|YP_001680753.1| tRNA (guanine-n1)-methyltransferase [Heliobacterium modesticaldum Ice1] >gi|167592994|gb|ABZ84742.1| tRNA (guanine-n1)-methyltransferase [Heliobacterium modesticaldum Ice1] (270 aa)
Score = 495, Expect = 2.3e-48, Identities = 98/220 (44%), Positives = 139/220 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-------KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFI 220
           MKI VL++F   F    + SII +A    ++     + R ++ + H +VDDTP+GGGAGMV+  QP  DA+  +           S+VVLLTP G  ++Q  A +    + L+LICG YEG D+R+   +VD EISIGDY+LTGGE+ AM ++D+V+RL+P  +    S E ESF + LL+YP YTKP  F G + P  LLSG+H  I + R++    +T  NR +L I
  S:     1 MKIDVLTIFPEMFTGPMDVSIIGRAREKGILSFNAHDVRAYTTNKHRRVDDTPFGGGAGMVMNAQPFFDALAAILGPRELRDPLRSRVVLLTPQGAVFSQAKARELSGLQQLVLICGRYEGIDDRVRQAWVDEEISIGDYVLTGGELPAMVVIDAVVRLLPGALGDETSAEEESFSDGLLEYPQYTKPALFRGMEAPPELLSGHHAAIRRWRRKEAFKRTYQNRPELLI 229
>gi|169335118|ref|ZP_02862311.1| hypothetical protein ANASTE_01525 [Anaerofustis stercorihominis DSM 17244] >gi|169257856|gb|EDS71822.1| hypothetical protein ANASTE_01525 [Anaerofustis stercorihominis DSM 17244] (222 aa)
Score = 493, Expect = 4.0e-48, Identities = 95/219 (43%), Positives = 146/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   VL+L+      +K   II + + ++ + I  +N R++SKD H +VDD  YGGGAGM++  +P+ D +  +K   +  V+  +P G+T+N +IA ++   + +IL+CGHYEG D+R ++  VD EISIGDYILTGG IA+M  +D+V R +  V+ +  S ++ESF++ LL+   YT+P  F G KVPEVL+SG+HK+I +  KE  + +TKI R+DL 
  S:     1 MIYNVLTLYPEMIEAYKEVGIIGRGVKSDRLQINAINIRDYSKDKHKRVDDEIYGGGAGMLMKAEPVYDCVKDIKKDRDVPVIYFSPRGRTFNSEIAKEYANLDEVILLCGHYEGIDQRAVDLCVDEEISIGDYILTGGHIASMVFMDTVSRYVDGVLGNSESYQNESFEDGLLEANQYTRPEEFMGMKVPEVLMSGHHKKIEEYYKEEALKETKIRREDLL 222
>gi|109897900|ref|YP_661155.1| tRNA (guanine-N1)-methyltransferase [Pseudoalteromonas atlantica T6c] >gi|123064747|sp|Q15VI7|TRMD_PSEA6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|109700181|gb|ABG40101.1| tRNA (Guanine37-N(1)-) methyltransferase [Pseudoalteromonas atlantica T6c] (265 aa)
Score = 493, Expect = 4.1e-48, Identities = 94/215 (43%), Positives = 138/215 (64%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           V+SLF   F  F    +  +A+ +  + ++  N R+F+ D H  VDD PYGGG GM++ +QP++DAI   K +    +KV+ L+P GKT  Q+   Q    E +IL+ G YEG DER+I   +D E S+GDYIL+GGE+ AM ++D+V RL+P V+    S E +SF + LLD P+YT+P N NG  VP VLLSG+H++I + R +  + +T   R +L 
  S:    11 VVSLFPEMFQTFTEQGVTGRAVKSGKLKVDFFNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLLDAIRAAKQAAEKKTKVIYLSPQGKTLTQRGVKQLSENESVILVAGRYEGIDERVIEAEIDEEWSVGDYILSGGELPAMILMDAVARLVPGVLGHAQSAEQDSFSDGLLDCPHYTRPENLNGQSVPSVLLSGDHQKIKQWRDKQSLGRTWQRRPELL 230
>gi|170079002|ref|YP_001735640.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. PCC 7002] >gi|169886671|gb|ACB00385.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. PCC 7002] (236 aa)
Score = 493, Expect = 4.3e-48, Identities = 92/219 (42%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +   +++LF +FF     + ++ KA+   +  +   N R+F+ D H  VDD PYGGGAGM+L  +P+  A+  +     + V+L+TP G+  +QQ+  +  T++ L+LICGHYEG DER+  + V  EIS+GD++LT GEI A+ +L+ VIRL+P  +    SL+++SF   LLDYP YT+P  F  ++VP VL SGNH++I + R   QI +T+  R DL+
  S:     3 LHFDLVTLFPDFFTSPLQSGLLGKALGKGIATVNFTNPRDFTTDKHRSVDDEPYGGGAGMLLKPEPLFAAVESLPVQPKREVILMTPQGQRLDQQLLAELTTYDQLVLICGHYEGVDERVREHLVTREISLGDFVLTCGEIPALTLLNGVIRLLPGTVGKEASLKADSFQVPLLDYPQYTRPAKFREWEVPAVLRSGNHQKIAEWRLSQQIQRTQARRPDLW 224
>gi|52424497|ref|YP_087634.1| tRNA (guanine-N(1)-)-methyltransferase [Mannheimia succiniciproducens MBEL55E] >gi|84029224|sp|Q65VG1|TRMD_MANSM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|52306549|gb|AAU37049.1| TrmD protein [Mannheimia succiniciproducens MBEL55E] (255 aa)
Score = 493, Expect = 4.5e-48, Identities = 97/221 (43%), Positives = 137/221 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I ++SLF   F       +  +A+  NL+ +   N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K       KV+ L+P G+  +Q    +    E LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R +P V+    S E +SF   LLD P+YT+P   +GY VP VL+SGNH+EI K R +  + +T + R +L  K
  S:     1 MWIGIISLFPEMFKAITEFGVTGRAVKQNLLQVSCWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKAEAGDGVKVIYLSPQGRKLDQTGVTELAANEKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFVPGVLGKQASAEEDSFAEGLLDCPHYTRPEVLDGYVVPPVLMSGNHEEIRKWRLKQSLERTWLRRPELLEK 226
>gi|167627277|ref|YP_001677777.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189036083|sp|B0TX18|TRMD_FRAP2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|167597278|gb|ABZ87276.1| tRNA (guanine-N(1)-)-methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] (255 aa)
Score = 492, Expect = 4.8e-48, Identities = 103/218 (47%), Positives = 150/218 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF-NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           MK  ++S+F   F    +  I  +AI ++ V I+  N R+++ D H  VDDT +GGGAGMV+  +P+  AI   K++   N+KVV L+P G  +N   A +    + LIL+CG YEG DER+I +YVD EIS+GD++L+GGE+ AM ++DS+IRL+P V+ + +S+  +SF + LLDYP+YTKP    +G  VP VLLSGNHKEI K R++ ++ +T   RKDL
  S:     1 MKFGIISIFPEMFKAINDFGITARAIKDSKVSIKCFNPRDYTTDKHATVDDTSFGGGAGMVMKYEPLSQAIKDAKSTLGYNTKVVYLSPQGSVFNHNKALELLENDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNKDSMIEDSFYDGLLDYPHYTKPAVLPDGNAVPSVLLSGNHKEIAKWRRKQKLIRTYERRKDL 224
>gi|159903868|ref|YP_001551212.1| tRNA-(guanine-N1)-methyltransferase [Prochlorococcus marinus str. MIT 9211] >gi|159889044|gb|ABX09258.1| tRNA-(guanine-N1)-methyltransferase [Prochlorococcus marinus str. MIT 9211] (236 aa)
Score = 492, Expect = 4.8e-48, Identities = 95/224 (42%), Positives = 149/224 (66%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-NSKVVLLTPSGKTYNQQ-IANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           +  V+SL    F+ FK   ++ +A ++ + ++ + N R F+ D++ KVDD PYGGGAGMVL  +P   A + V  S   +V+L++P G+T +Q+ +    + ++ L+LICGHYEGFDERI    D E+SIGD +LTGGE+ AM +++ V+RL+P  +    SL  ES  + LL++P+YT+P  F G +VP VL SGNH+ I+K R++ +  +TK  R DL+ ++L +
  S:     5 RFDVISLAPEAFSSFKELGVVGRAFSSGIAELHVHNPREFAYDNYRKVDDQPYGGGAGMVLKPEPFFAAFDSVPFSLKRRVLLMSPQGQTLSQEKLWRWSEEYKQLVLICGHYEGFDERIRTIADEEVSIGDVVLTGGELPAMTVVNGVVRLLPGTVGDPQSLIEESHSDILLEHPHYTRPAKFRGMEVPSVLRSGNHQAISKWRQDQRELRTKYRRPDLYDRWLSK 231
>gi|71066571|ref|YP_265298.1| tRNA (Guanine37-N(1)-) methyltransferase [Psychrobacter arcticus 273-4] >gi|119370987|sp|Q4FQ44|TRMD_PSYA2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|71039556|gb|AAZ19864.1| tRNA (Guanine37-N(1)-) methyltransferase [Psychrobacter arcticus 273-4] (254 aa)
Score = 492, Expect = 4.8e-48, Identities = 93/223 (41%), Positives = 147/223 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-----------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M   V+S+F   F   +   I  +A+A   V IE +N R+++ D++ ++D+ PYGGG GMV+  +P+  AI   +   S+           V+ ++P G+T ++        ++ +I++CG YEG DER+++ YVD EIS+GDY+LTGGE+ AM ++DSVIR +PN++  + S E +SF + LLD P+YTKP+ F G  VPEVLLSG+H  I + R   Q+ +T+  R DL+  ++
  S:     1 MYFAVISIFPEMFATIREFGITGRAVAQKQVTIECINPRDYTSDNYRRIDERPYGGGPGMVMMAEPLSQAIEDARLRASQYGCRVDKAHCPVIYMSPQGQTLSESSVVDMTEYDGMIILCGRYEGIDERLLSQYVDMEISLGDYVLTGGELPAMVLMDSVIRRLPNIMGDDKSAEQDSFVDGLLDCPHYTKPHEFAGMAVPEVLLSGHHANIAQWRFRQQVERTQTRRPDLWQAFM 236
>gi|160880537|ref|YP_001559505.1| tRNA (guanine-N1)-methyltransferase [Clostridium phytofermentans ISDg] >gi|189036077|sp|A9KLM2|TRMD_CLOPH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|160429203|gb|ABX42766.1| tRNA (guanine-N1)-methyltransferase [Clostridium phytofermentans ISDg] (275 aa)
Score = 492, Expect = 4.9e-48, Identities = 104/219 (47%), Positives = 149/219 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-----------------------------KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   V++LF +  ++  NTSII +A+   L+ I  ++ R FS+D H +VDD PYGGGAGMV+   P+     HV                             +T   +V+ LTP GK ++Q++A +F   + L+ +CGHYEG DER+++ +  DY +SIGDYILTGGE+  M ++D++ RLIP V++ N S E ES  +NLL+YP YT+P  F   KVP+VLLSG+H  I K R+E  I +T  NR +L 
  S:     1 MNYHVMTLFPDMIHQAMNTSIIGRAMEKGLLTINAIDIREFSEDKHRRVDDYPYGGGAGMVMAPGPVYRTYEHVMKMIDHNKEMLAQDKTMKIPEESVSERKNETRRPRVIYLTPQGKVFHQKMAEEFAKEDDLVFLCGHYEGIDERVLDQIVTDY-VSIGDYILTGGELPVMVMMDAISRLIPGVLNNNASAEFESLQDNLLEYPQYTRPEVFMEQKVPDVLLSGHHANIEKWRREQSIIRTLKNRPELL 250
>gi|148657786|ref|YP_001277991.1| tRNA (guanine-N1)-methyltransferase [Roseiflexus sp. RS-1] >gi|148569896|gb|ABQ92041.1| tRNA (Guanine37-N(1)-) methyltransferase [Roseiflexus sp. RS-1] (280 aa)
Score = 492, Expect = 5.2e-48, Identities = 92/199 (46%), Positives = 133/199 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--------KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEI 199
           M+  VL+LF   F    N SI+K+AI   ++++ + + R ++ D H   DD PYGGGAGMV+  +P+   I  V        ++    V+L+TP G+ + Q+IA +  T+  L+L+CG YEG DER+    +D EISIGDY+LTGGE+AAM I+D+V RL+P VI   S+  ESF + LL+YP YT+P  + G  VP VL+SG+H E+
  S:    18 MRFDVLTLFPGMFAGPLNESILKRAIQAGVINVVLHDIRAYATDRHRTTDDAPYGGGAGMVMKPEPLAACIRAVLSMAPETEESPKPPVILMTPDGEPFTQRIAAELATYPRLVLVCGRYEGVDERVREALIDREISIGDYVLTGGELAAMVIIDAVARLVPGVIDAESIADESFSDGLLEYPQYTRPAVWEGRAVPPVLVSGHHGEV 225
>gi|90416164|ref|ZP_01224096.1| tRNA (guanine-N(1)-)-methyltransferase [marine gamma proteobacterium HTCC2207] >gi|90331889|gb|EAS47103.1| tRNA (guanine-N(1)-)-methyltransferase [marine gamma proteobacterium HTCC2207] (250 aa)
Score = 492, Expect = 5.7e-48, Identities = 97/219 (44%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI +++LF   F+      I  +A+ N L+  +  N R+F++D H  VD  PYGGG GMV+ ++P+  AI   K     ++KVV L+P G+  NQ   N+F T + L+LI G YEG DER+I   VD E SIGDY+L+GGE+ AM ++D++IR IP  +   +S + +SF   LLD P+YT+P ++ G +VPEVLLSGNH++I + R +  + +T+  R DL 
  S:     1 MKIALITLFPEMFSSLTEYGISGRAVKNGLLACQSFNPRDFTEDRHQTVDARPYGGGPGMVMMVEPLRRAITAAKQWAGDDAKVVYLSPQGQVLNQGAVNKFATQQSLVLIAGRYEGIDERLIEQEVDEEWSIGDYVLSGGELPAMVLMDALIRQIPGALGHKDSADQDSFAEGLLDCPHYTRPEDYQGQEVPEVLLSGNHEKIRRWRLQQALMRTQQRRPDLL 224
>gi|86146310|ref|ZP_01064634.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio sp. MED222] >gi|85835789|gb|EAQ53923.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio sp. MED222] (246 aa)
Score = 490, Expect = 8.6e-48, Identities = 97/219 (44%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + ++SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K +    +KV+ L+P G+  +QQ   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +   VP VL SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGIISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIQTAKQAAPGKTKVIYLSPQGRKLDQQGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGELPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKDVPSVLKSGNHKDIRRWRLKQSLGRTWLRRPELL 224
>gi|160933333|ref|ZP_02080721.1| hypothetical protein CLOLEP_02178 [Clostridium leptum DSM 753] >gi|156867210|gb|EDO60582.1| hypothetical protein CLOLEP_02178 [Clostridium leptum DSM 753] (245 aa)
Score = 490, Expect = 9.2e-48, Identities = 93/219 (42%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV---KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNS-LESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +++LF          SI+ +A     +++     R ++ D HN+VDDTPYGGG GM+L  +PI D   HV         ++ ++P GKT  QQ A +   ++ L ++CGHYEG DER++  YVD EISIGDY+LTGGE+ A+ + D+V R++P V+S +   E ES  + LL+YP+YTKP  + G  VPEVLLSG+H  I K R++  + +T   R ++ 
  S:     1 MRIDIITLFPELCEAVMGESIVGRARKKGAIEVYCHQLREYTYDKHNRVDDTPYGGGMGMLLMAEPIADCFEHVCELAGRRPHLIYMSPQGKTLTQQRARELAGYDSLAILCGHYEGVDERVLEEYVDEEISIGDYVLTGGELPALVLADAVSRMVPGVLSSDECFEEESHFSGLLEYPHYTKPAVWRGKPVPEVLLSGHHGNIEKWRRQQALLRTAKKRPEML 224
>gi|163803446|ref|ZP_02197319.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio campbellii AND4] >gi|159172747|gb|EDP57595.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio campbellii AND4] (246 aa)
Score = 489, Expect = 1.1e-47, Identities = 97/219 (44%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K ++   +KV+ L+P G+  +Q+   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +  +VP VL SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIKTAKQASPGKTKVIYLSPQGRKLDQKGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGELPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKEVPSVLKSGNHKDIRRWRLKQSLGRTWLRRPELL 224
>gi|55823329|ref|YP_141770.1| tRNA (guanine-N(1)-)-methyltransferase [Streptococcus thermophilus CNRZ1066] >gi|84029281|sp|Q5LYY2|TRMD_STRT1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|55739314|gb|AAV62955.1| tRNA (guanine-N1)-methyltransferase [Streptococcus thermophilus CNRZ1066] (239 aa)
Score = 489, Expect = 1.1e-47, Identities = 101/222 (45%), Positives = 144/222 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           MKI +L+LF + F   +  SI+ KA    +++I   NFR+ ++ + + VDD PYGGG GM+L  QPI D  + +  +  +V+LL P+G+T+NQ  A +    E L+ ICGHYEG+DER    V  EIS+GD++LTGGE+AAM I+D+ +RLIP V+    S + +SF + LL++P YT+P  F G KVP+VLLSG+H  I + R E  + KT   R DL   Y
  S:     1 MKIDILTLFPDMFAPLE-YSIVGKAKDKGILEINYHNFRDNAEKARH-VDDEPYGGGQGMLLRAQPIFDTFDKLNVTKPRVILLDPAGRTFNQAYAEELAQEEELVFICGHYEGYDERTKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPEVLGKEASHKDDSFSSGLLEFPQYTRPAEFRGMKVPDVLLSGHHVNIRRWRMEQSLRKTWERRPDLLENY 221
>gi|157413841|ref|YP_001484707.1| tRNA-(guanine-N1)-methyltransferase [Prochlorococcus marinus str. MIT 9215] >gi|166988164|sp|A8G690|TRMD_PROM2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|157388416|gb|ABV51121.1| tRNA-(guanine-N1)-methyltransferase [Prochlorococcus marinus str. MIT 9215] (245 aa)
Score = 489, Expect = 1.1e-47, Identities = 96/214 (44%), Positives = 143/214 (66%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           V++LF   F    N  +I KA+  NL+D+ + + R + + S+ +VDD PYGGGAGMVL  +PI  A   + K   SK +L++P GK   Q+   ++ + + LI+ICG YEGFDER+    D E+S+GDY+L+GGEI A++I++ + R++P  +   +SL  ES ++ LL+YP+YT+P  F   KVP+VL++GNHKEI   RKE  +N+T   RKDL
  S:     8 VITLFPKAFELINNLGVITKALDKNLIDVNLHDLREYGEGSYRQVDDKPYGGGAGMVLKPEPIFKAYESIRKLPKSKTLLMSPQGKVLKQEDFLRWSSLDQLIIICGQYEGFDERVRCLADEEVSMGDYVLSGGEIPAVSIINGLTRILPGTLGDPDSLIDESHNSYLLEYPHYTRPRVFKDMKVPDVLINGNHKEIELWRKEQMLNRTFQRRKDL 223
>gi|167730403|emb|CAO81315.1| tRNA (guanine-1-)-methyltransferase [Candidatus Cloacamonas acidaminovorans] (223 aa)
Score = 489, Expect = 1.1e-47, Identities = 103/218 (47%), Positives = 140/218 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDA-INHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M   VLSLF + F+ F N+SII +A    L+ + + ++R FS + H+KVDD PYGG AGMV+  QPI  A I  ++  N+ VV  TP G+   Q+I   + +++ +IL+CGHY+  D+R+ +  V  EIS+GDY+LTGGEI A+A +D V RL+P V+S   S  S+SF N  L +P YT+P  F G  +PEVLLSGNHKEI K   E     T   R DL
  S:     1 MIFEVLSLFPDAFSGFLNSSIIARAREKKLLAVNLTDYRQFSLNKHHKVDDYPYGGFAGMVIQAQPIYSALIELLEKGNAPVVYFTPQGRPLTQKILESYSSYKRIILLCGHYKEIDQRVRDLCVSDEISLGDYVLTGGEIPALAFIDGVSRLLPGVLSDRESANSDSFSNEGLGFPCYTRPEIFMGLGIPEVLLSGNHKEIKKWALEQGKRLTVTRRPDL 221
>gi|189501479|ref|YP_001957196.1| tRNA (guanine-N1)-methyltransferase [Candidatus Amoebophilus asiaticus 5a2] >gi|189496920|gb|ACE05467.1| tRNA (guanine-N1)-methyltransferase [Candidatus Amoebophilus asiaticus 5a2] (231 aa)
Score = 489, Expect = 1.2e-47, Identities = 95/222 (42%), Positives = 147/222 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M++ +L+            SI+K+AI  NL+++ I + R++S D H KVDD  YGG AGMVL + PI   IN +  K +  +++ + P G+   QQ+ANQ    E+L+++CGHY+G DER+  ++V   ISIGDY+L+GGE+AA  ++D+++RL+P V+S   S  ++SF +NL+  P YT+PYNF G  VP++LLSGN K I +   +  I +TK  R +L+ K+
  S:     1 MRVDILTCLPKLLESPFAHSILKRAIDRNLLNLHIHDLRDYSLDKHKKVDDYAYGGAAGMVLAIPPIASCINQLKEKVAYQEIIYMAPDGELLTQQLANQLSMQENLLILCGHYKGVDERVRQHFVTRAISIGDYVLSGGELAAAVLVDAIVRLLPGVLSDETSALTDSFQDNLVAPPVYTRPYNFQGMCVPDILLSGNEKAIREWEYQTAIERTKQLRPELYNKF 226
>gi|54310149|ref|YP_131169.1| tRNA (guanine-N(1)-)-methyltransferase [Photobacterium profundum SS9] >gi|90414891|ref|ZP_01222856.1| tRNA (guanine-N(1)-)-methyltransferase [Photobacterium profundum 3TCK] >gi|84029231|sp|Q6LMV9|TRMD_PHOPR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46914588|emb|CAG21367.1| putative tRNA (guanine-N1)-methyltransferase [Photobacterium profundum SS9] >gi|90324005|gb|EAS40599.1| tRNA (guanine-N(1)-)-methyltransferase [Photobacterium profundum 3TCK] (249 aa)
Score = 488, Expect = 1.4e-47, Identities = 97/219 (44%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    N  +  +A+   L+ I+  N R+F++D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    E LILICG YEG DERII   VD E SIGD++LTGGE+ AM ++D+V+R +P V+    S E +SF N LLD P+YT+P   +G+ VP+VL+SGNHK+I++ R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFTSITNFGVTGQAVKKGLLSIDTWNPRDFTEDKHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKKSAKGKAKVIYLSPQGRKLDQAGVEELAQNESLILICGRYEGVDERIIQQEVDEEWSIGDFVLTGGELPAMTLVDAVVRFVPGVLGDFASAEEDSFANGLLDCPHYTRPDVLDGHAVPKVLMSGNHKDISRWRLKQSLGRTWLRRPELL 224
>gi|42523587|ref|NP_968967.1| tRNA methyltransferase [Bdellovibrio bacteriovorus HD100] >gi|84029202|sp|Q6ML97|TRMD_BDEBA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|39575793|emb|CAE79960.1| tRNA methyltransferase [Bdellovibrio bacteriovorus HD100] (275 aa)
Score = 488, Expect = 1.6e-47, Identities = 96/225 (42%), Positives = 141/225 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           +KI V++LF        +  ++ +A+  +L+ ++    R F+ D H  VDD P+GGG GM++  + +  +I  V+  NSKV+ L+P G       A +    EHL+LICG Y G D+RIIN YVD EISIGDY+L+GGE+ A+ ++D++ R IP V+  V+S + +SF   LL++PN+T+P  + G  VPEVLLSGNHK I   +++     T   R DLFI YL E
  S:     2 LKIDVITLFPEMIQGAVSHGVLGQALKGDLLSVQAHTPREFASDKHRTVDDRPFGGGDGMIMLSETLEKSIQKVQHKNSKVIYLSPQGSVLTDDKARELSQAEHLVLICGRYGGIDQRIINTYVDEEISIGDYVLSGGELGALVVIDALSRFIPGVLGHVDSADKDSFSEGLLEHPNFTRPREYLGQDVPEVLLSGNHKLIADWKEKVSALVTLKKRPDLFIIYLAE 228
>gi|93007144|ref|YP_581581.1| tRNA (guanine-N1)-methyltransferase [Psychrobacter cryohalolentis K5] >gi|119370988|sp|Q1Q8A6|TRMD_PSYCK tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|92394822|gb|ABE76097.1| tRNA (Guanine37-N(1)-) methyltransferase [Psychrobacter cryohalolentis K5] (254 aa)
Score = 488, Expect = 1.6e-47, Identities = 93/219 (42%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-----------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   V+S+F   F   +   I  +A+    V IE +N R+F+ D++ ++D+ PYGGG GMV+  +P+  AI   +   S+           V+ ++P G+T ++        ++ +I++CG YEG DER+++ YVD EIS+GDY+LTGGE+ AM ++DSVIR +P+++  + S E +SF + LLD P+YTKP+ F G  VPEVLLSG+H  I K R   Q+ +T+  R DL+
  S:     1 MYFAVISIFPEMFATIREFGITGRAVTQKQVTIECINPRDFTSDNYRRIDERPYGGGPGMVMMAEPLSQAIEDARLRASQHGCRVDKAHCPVIYMSPQGQTLSESSVVDMTEYDGMIILCGRYEGIDERLLSQYVDMEISLGDYVLTGGELPAMVLMDSVIRRLPDIMGDDKSAEQDSFVDGLLDCPHYTKPHEFAGMAVPEVLLSGHHANIAKWRFSQQVERTQARRPDLW 232
>gi|114772324|ref|ZP_01449701.1| tRNA (guanine-N(1)-)-methyltransferase [alpha proteobacterium HTCC2255] (254 aa)
Score = 488, Expect = 1.7e-47, Identities = 93/218 (42%), Positives = 140/218 (64%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           + ++++LF   F+   +  ++ +A+ + LV+++  N R+++ D H  VDD PYGGG GM++ +QP+ DAIN  K        VV L+P G+  N Q         HLIL+ G YEG DER+I+  VD E S+GD++L+GGEI AM ++D++ RL+P V+    S + +SF   LLD P+YT+P   NG +VPEVLLSGNH++I + R E  + +T   R DL 
  S:     4 RFSIVTLFPEMFSGCLSQGVMGRAVKSGLVEVDFYNPRDYTHDKHRTVDDRPYGGGPGMLMMVQPLTDAINAAKACADETHTVVYLSPQGRKLNHQGVADLTQRGHLILVAGRYEGIDERVIDALVDEEWSVGDFVLSGGEIPAMLMMDAITRLVPGVLGHTQSAQQDSFAEGLLDCPHYTRPEVLNGQQVPEVLLSGNHEKIRQWRLEQSLGRTWQRRPDLL 226
>gi|89898162|ref|YP_515272.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydophila felis Fe/C-56] >gi|119382728|sp|Q255B1|TRMD_CHLFF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|89331534|dbj|BAE81127.1| tRNA/rRNA methyltransferase [Chlamydophila felis Fe/C-56] (355 aa)
Score = 487, Expect = 1.8e-47, Identities = 95/223 (42%), Positives = 144/223 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M+I +LSLF ++F+    +SI+ +AI N L+ I+  + R F      +VDD P+    GM+L  +P+V AI +VK   S+V+ L+P G     Q + +     HLI +CGHYEG DER +   VD EISIGDY+LT G IAA+ ++D++ R IP V+ +  S E +S +N LL+ P YT+P  F G +VP+VLL G+H+ I + RK+  +++T+  R DL+++YL
  S:     1 MEIDILSLFPDYFDSPLRSSILGRAIKNGLLKIQSRDIREFGLGKWKQVDDAPFNND-GMLLMAEPVVQAIRYVKRRESRVIHLSPQGVPLTAQKSRELAKCSHLIFLCGHYEGIDERALEIEVDEEISIGDYVLTNGGIAALVVIDALSRFIPGVLGNQESAEKDSLENGLLEGPQYTRPRVFEGREVPQVLLQGDHQAIARWRKQVSLDRTRERRPDLYVRYL 224
>gi|119470052|ref|ZP_01612857.1| tRNA (guanine-7-)-methyltransferase [Alteromonadales bacterium TW-7] >gi|119446762|gb|EAW28035.1| tRNA (guanine-7-)-methyltransferase [Alteromonadales bacterium TW-7] (249 aa)
Score = 487, Expect = 1.9e-47, Identities = 96/219 (43%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF + F+      +  +A+ N L++    N R+++ D H  VDD PYGGG GM++ ++P+  AI   K +    +KV+ ++P G+  +QQ A++    + LILI G YEG DERII +YVD E SIGD+IL+GGE+ AM ++D+V RL+P V+  N S E +SF + LLD P+YT+P   +  +VP VLLSGNH+ I + R +  + +T I R DL 
  S:     1 MWVGVISLFPDMFDAITQQGVTGRAVKNGLINFNCWNPRDYALDKHRTVDDRPYGGGPGMLMMVKPLEKAILDAKKAAGDGAKVIYMSPQGRKLDQQGASELANSDKLILIAGRYEGIDERIIESYVDEEWSIGDFILSGGELPAMTLIDAVARLVPGVLGHNQSAEQDSFSDGLLDCPHYTRPETLDDKQVPAVLLSGNHQAIARWRLKQSLGRTWIRRPDLL 224
>gi|154483572|ref|ZP_02026020.1| hypothetical protein EUBVEN_01276 [Eubacterium ventriosum ATCC 27560] >gi|149735482|gb|EDM51368.1| hypothetical protein EUBVEN_01276 [Eubacterium ventriosum ATCC 27560] (242 aa)
Score = 487, Expect = 2.0e-47, Identities = 96/221 (43%), Positives = 144/221 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   VL+LF     +  NTSI  +AI   L+ +  +N R+++ + H +VDD PYGGGAGMV+   P+  +   V        +V+ LTP GK +NQ +A +F   E L+ +CGHYEG DER++   V   +SIGDY+LTGGE+ +M ++D++ RL+P V++ + S E ESF++NLL+YP YT+P +F   +VP +LLSGNH ++ + R++  I +T   R DL  K
  S:     1 MNFHVLTLFPKMIEQGINTSITGRAIEKGLISLNAINIRDYAGNKHGQVDDYPYGGGAGMVMQPGPVYRSYESVTEKIGYKPRVIYLTPQGKVFNQSMAEEFSEEEDLVFLCGHYEGIDERVLEMIVTDNVSIGDYVLTGGELPSMVMIDAISRLVPGVLNNDVSAEFESFNDNLLEYPQYTRPASFMEREVPPILLSGNHPKVEEWRRQQSILRTMERRPDLMKK 226
>gi|148979277|ref|ZP_01815431.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrionales bacterium SWAT-3] >gi|145961925|gb|EDK27216.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrionales bacterium SWAT-3] (246 aa)
Score = 487, Expect = 2.0e-47, Identities = 96/219 (43%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V+SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K ++   +KV+ L+P G+  +Q+   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +  +VP VL SGNH++I + R +  + +T + R +L 
  S:     1 MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIQTAKQASPGKTKVIYLSPQGRKLDQKGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGELPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKEVPSVLKSGNHRDIRRWRLKQSLGRTWLRRPELL 224
>gi|153854841|ref|ZP_01996064.1| hypothetical protein DORLON_02069 [Dorea longicatena DSM 13814] >gi|149752543|gb|EDM62474.1| hypothetical protein DORLON_02069 [Dorea longicatena DSM 13814] (271 aa)
Score = 486, Expect = 2.7e-47, Identities = 100/221 (45%), Positives = 152/221 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPI---VDAINHVKTS-----------------------NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   +++LF     +  NTSII +A+   L+ IE +N R+++ + H+ VDD PYGGGAGM++  +P+    DA+    T                         ++V+ L+P GKT+NQ +A +F   E L+ +CGHYEG DER++  +  DY +SIGDY+LTGGE+ AM ++D++ RL+P V+  + S E ESF +NLL+YP Y++P  ++  KVPE+L+SG+H  I K R+E  + +T  NR DL  K
  S:     1 MNFYIMTLFPEMVMDGLNTSIIGRAVNKGLLSIEALNIRDYAFNKHHSVDDYPYGGGAGMLMQAEPVYQCYDALARQITERKAKATEEKLASGEKKEMSGEQKRTRVIYLSPQGKTFNQSMAEEFAQEEDLVFLCGHYEGIDERVLEEIVTDY-VSIGDYVLTGGELPAMIMIDAISRLVPGVLHNDVSAEFESFQDNLLEYPQYSRPEVWHDRKVPEILMSGHHANIEKWRREQSVIRTAKNRPDLLEK 249
>gi|84394292|ref|ZP_00993017.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio splendidus 12B01] >gi|84375095|gb|EAP92017.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio splendidus 12B01] (246 aa)
Score = 486, Expect = 2.8e-47, Identities = 96/219 (43%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + ++SLF   F    +  +  +A+   L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K +    +KV+ L+P G+  +Q+   +  T E+L+LICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R +P V+    S E +SF N LLD P+YT+P   +   VP VL SGNHK+I + R +  + +T + R +L 
  S:     1 MWVGIISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIQTAKQAAPGKTKVIYLSPQGRKLDQKGVEELATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGELPAMTLIDSVSRFVPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDDKDVPSVLKSGNHKDIRRWRLKQSLGRTWLRRPELL 224
>gi|85058526|ref|YP_454228.1| tRNA (guanine-N(1)-)-methyltransferase [Sodalis glossinidius str. 'morsitans'] >gi|118575158|sp|Q2NVK2|TRMD_SODGM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|84779046|dbj|BAE73823.1| tRNA (guanine-N1)-methyltransferase [Sodalis glossinidius str. 'morsitans'] (251 aa)
Score = 486, Expect = 2.9e-47, Identities = 95/219 (43%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F    +  +  +A+ N L++++  + R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K      +KV+ L+P G+  +QQ  ++      +IL+CG YEG DER+I   +D E S+GDY+L+GGE+AAMA++DSV R IP V+   +  +E SF   LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITDYGVTGRAVKNGLLNVQCWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLQDAIHEAKNKAGEGTKVIYLSPQGRKLDQQGVSELAANPKMILVCGRYEGIDERLIATEIDEEWSMGDYVLSGGELAAMALIDSVSRFIPGVLGHEASSAEDSFARGLLDCPHYTRPEVLAGMEVPSVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|94985586|ref|YP_604950.1| tRNA (guanine-N1)-methyltransferase [Deinococcus geothermalis DSM 11300] >gi|119382735|sp|Q1IYA3|TRMD_DEIGD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|94555867|gb|ABF45781.1| tRNA (guanine-N1)-methyltransferase [Deinococcus geothermalis DSM 11300] (265 aa)
Score = 485, Expect = 3.0e-47, Identities = 89/219 (40%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +  + L+LF      F + +++ KA A  L+D+++VN R+F+++ H KVDDTPYGGGAGMV+ +  +  A+  +  ++ +V+LLTP+G+ + QQ+A +     HL  +CG YEGFD R+      E+S+GD+++ GGE AA  +L++V RL+P V+   +S  ++SF + LLDYP YT+P  + G  VPEVL  GNH  + + R+E  + +T   R DL 
  S:     2 LTFSFLTLFPELLAPFASEALVGKARARGLLDVQLVNMRDFAENKHLKVDDTPYGGGAGMVIRVDVVERALASLPPAD-EVILLTPAGERFTQQMAEELSRTTHLAFLCGRYEGFDARVERLATRELSLGDFVMMGGEAAAACVLEAVARLVPGVLGDEDSHRADSFSSGLLDYPEYTRPAEWRGEGVPEVLKGGNHAAVARWRREQALARTLARRPDLL 220
>gi|47459264|ref|YP_016126.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma mobile 163K] >gi|84029227|sp|Q6KHL5|TRMD_MYCMO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|47458593|gb|AAT27915.1| tRNA (guanine-N1)-methyltransferase [Mycoplasma mobile 163K] (194 aa)
Score = 485, Expect = 3.1e-47, Identities = 100/189 (52%), Positives = 130/189 (68%)
  Q:    30 LVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           +++IEI++FRNF+     KVDD  YGGG+GM+L ++PI  A+ + K    K +LL+P GK + Q  A +    E+L  ICG YEGFDERI N +D E SIGDY+LTGGE+A+M I DS IRLIP VI   S +++SF NNLLDYP YT+P  +    VPEVLL+GNHKEI + R++    KT  NR DL
  S:     1 MINIEIIDFRNFAYGKQKKVDDEIYGGGSGMLLKIEPIDLALENTK---GKRILLSPQGKPFTQDDALKLSKEENLTFICGRYEGFDERIRNLIDEEYSIGDYVLTGGELASMVIADSTIRLIPGVIKEESYKNDSFQNNLLDYPQYTRPATYKNMNVPEVLLNGNHKEIKQWREQKAYEKTLKNRPDL 186
>gi|169632274|ref|YP_001706010.1| tRNA (guanine-1-)-methyltransferase. [Acinetobacter baumannii SDF] >gi|169151066|emb|CAO99722.1| tRNA (guanine-1-)-methyltransferase. [Acinetobacter baumannii] (246 aa)
Score = 485, Expect = 3.4e-47, Identities = 99/218 (45%), Positives = 140/218 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M   V++LF   F       I  +A   ++V +  +N R+F++ S+ +VD+ P+GGG GMV+  +P+  AINH K   S+       VV ++P GKT N+Q   QF  ++ LI++CG YEG DER+I +YVD E SIGDY+L+GGE+ AM +LDS+IR +PNV+S   S   +SF + LLD P YTKP  F G  VPE+L SG+H  I K R   +  +T   R +L
  S:     1 MFFAVITLFPEMFEAITAYGISGRAAKRDIVQVTCINPRDFAEGSYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASQAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNVMSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLERRPEL 227
>gi|154503292|ref|ZP_02040352.1| hypothetical protein RUMGNA_01116 [Ruminococcus gnavus ATCC 29149] >gi|153795959|gb|EDN78379.1| hypothetical protein RUMGNA_01116 [Ruminococcus gnavus ATCC 29149] (252 aa)
Score = 485, Expect = 3.7e-47, Identities = 103/224 (45%), Positives = 151/224 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPI---VDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           M   +L+LF +   +   TSII +A+ N L+ IE VN R+++ + H  VDD PYGGGAGM++  +P+    +AI        +VV L+P G T++Q +A +    E L+L+CGHYEG DER++  +  DY +SIGDY+LTGGE+ AM ++D++ RLIP V+  + S E ESF ++LL+YP Y++P  ++G KVP +LLSG+H  I K R+E  I +TK  R DL  K +K
  S:     1 MNFHILTLFPDMVMQGLGTSIIGRAVNNGLLSIEAVNIRDYAFNKHQSVDDYPYGGGAGMLMQAEPVYQAYEAIAEKVKKKPRVVYLSPQGATFSQTMAEELAKEEELVLLCGHYEGIDERVLEEIVTDY-VSIGDYVLTGGELPAMVMVDAISRLIPGVLHNDVSAEFESFQDDLLEYPQYSRPEEWHGKKVPPILLSGHHANIEKWRREQSIIRTKERRPDLLEKCMK 229
>gi|56460825|ref|YP_156106.1| tRNA (guanine-N(1)-)-methyltransferase [Idiomarina loihiensis L2TR] >gi|84029216|sp|Q5QUV0|TRMD_IDILO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|56179835|gb|AAV82557.1| tRNA-(guanine-N1)-methyltransferase [Idiomarina loihiensis L2TR] (252 aa)
Score = 484, Expect = 4.4e-47, Identities = 94/218 (43%), Positives = 142/218 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           +++ V+SLF   F+   +  +  +AI   L+ + + N R+F+ D H  VDD PYGGG GM++ +QP+VDAIN  K S   ++ V+ L+P G+  +          + +ILI G YEG DER+I  YVD E SIGDY+L+GGE+ AM ++D+V RLIP V+   +S   +SF + LLD P+YT+P  +N  +VP VLLSG+H++I + R +  + KT + R +L
  S:     5 LQVGVISLFPEMFSAVTDYGVTGRAIKEGLLTVSVWNPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLVDAINAAKQSLGEDTPVIYLSPQGQKLDHSGVQHLSGNDRMILIAGRYEGIDERVIKQYVDAEWSIGDYVLSGGELPAMVLIDAVSRLIPGVLGHQDSAAEDSFASGLLDCPHYTRPETYNEQQVPPVLLSGDHEKIRRWRLQQSLGKTWLQRPEL 227
>gi|58584488|ref|YP_198061.1| tRNA-(guanine-N1)-methyltransferase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75508003|sp|Q5GT55|TRMD_WOLTR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|58418804|gb|AAW70819.1| tRNA-(guanine-N1)-methyltransferase [Wolbachia endosymbiont strain TRS of Brugia malayi] (235 aa)
Score = 484, Expect = 4.4e-47, Identities = 92/217 (42%), Positives = 148/217 (68%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN---SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +T+L++F   F  F N S+  KA+   + +++++N R F+KD H  VD  PYGGGAGM++    + DA++ V ++  ++K + +TPSG  ++Q IA +   F H+ ++CG +EG D+R+I+ Y  YE+SIGDYIL+GGE AAM ILD  +RL+P V++ +   + ES S+   +L+YP YT+P  +  ++VP++LLSGNHK+I+  R++     TK  R +L 
  S:     4 VTILTIFPEMFPGFLNYSLAGKALEKKIWNLQVINIRFFAKDRHLTVDHIPYGGGAGMIMRPDVVGDAVDSVLSTHKDTKFIYMTPSGTKFDQSIARELVGFPHITILCGRFEGIDQRVIDEYTPYELSIGDYILSGGEPAAMVILDVCVRLLPGVVNNSGSITEESFSYSGGVLEYPQYTRPKQWRKHRVPKILLSGNHKKISDWRQKQSQVITKRRRPELL 226
>gi|169794513|ref|YP_001712306.1| tRNA (guanine-1-)-methyltransferase. [Acinetobacter baumannii AYE] >gi|169147440|emb|CAM85301.1| tRNA (guanine-1-)-methyltransferase. [Acinetobacter baumannii] (246 aa)
Score = 484, Expect = 4.5e-47, Identities = 98/218 (44%), Positives = 141/218 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M   V++LF   F+      I  +A   ++V +  +N R+F++ ++ +VD+ P+GGG GMV+  +P+  AINH K   S+       VV ++P GKT N+Q   QF  ++ LI++CG YEG DER+I +YVD E SIGDY+L+GGE+ AM +LDS+IR +PNV+S   S   +SF + LLD P YTKP  F G  VPE+L SG+H  I K R   +  +T   R +L
  S:     1 MFFAVITLFPEMFDAITAYGISGRAAKRDIVQVTCINPRDFAEGNYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASRAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNVMSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLERRPEL 227
>gi|148652018|ref|YP_001279111.1| tRNA (guanine-N1)-methyltransferase [Psychrobacter sp. PRwf-1] >gi|172048454|sp|A5WBX0|TRMD_PSYWF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|148571102|gb|ABQ93161.1| tRNA (Guanine37-N(1)-) methyltransferase [Psychrobacter sp. PRwf-1] (253 aa)
Score = 484, Expect = 4.5e-47, Identities = 95/219 (43%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-----------KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M   V+++    F       I  +A+ N  V I+ +N R+F+ D++ ++D+ P+GGG GMV+  +P+  AI + K+  S            VV L+P G   ++      + +E +IL+CG YEG DER++  YVD EISIGD++LTGGE+ AM ++DSVIR +P+V+    S E +SF   LLD P+YTKP++F G +VPEVLLSG+H  I   R   Q+ +TK  R DL+
  S:     1 MYFAVITILPEMFTAISEYGITGRAVQNKQVVIDCINPRDFTTDNYRRIDERPFGGGPGMVMMAEPLAKAIAYAKSQASLHGCITDSEHCPVVYLSPQGDKLDEAAVVSMRHYEAMILLCGRYEGIDERLLARYVDMEISIGDFVLTGGELPAMVLMDSVIRRLPDVMGDAKSAEQDSFVEGLLDCPHYTKPHDFEGLQVPEVLLSGHHANIATWRFMQQVERTKQRRPDLW 232
>gi|160901807|ref|YP_001567388.1| tRNA (guanine-N1)-methyltransferase [Petrotoga mobilis SJ95] >gi|160359451|gb|ABX31065.1| tRNA (guanine-N1)-methyltransferase [Petrotoga mobilis SJ95] (263 aa)
Score = 484, Expect = 5.1e-47, Identities = 102/220 (46%), Positives = 147/220 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN-HVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFI 220
           +KI+VL++F   F+  +N  +IKKAI   LV+I+I+N R+++ D H   D   YGG  GMV+  +P     + ++ + N K  VVL +P G+ +N  +A +    E L+  CG YEG DER+   VD E+SIGDY+LTGGEI  M I+++++R +P VI S  S+E++SF N LLDY +YTKP NF G +VPE+LLSG+H+ I   RK+  + KT + R DLFI
  S:     7 IKISVLTIFPGMFDIIRNYGVIKKAIEKKLVEIDILNLRDYTTDKHKVTDKPGYGGENGMVMLAEPFYRFYDEYILSKNHKPYVVLPSPQGEVFNNDLAFELAKKEELVFFCGRYEGIDERVRKIVDKEVSIGDYVLTGGEIPTMVIIETLLRFLPGVIGSKTSVENDSFYNGLLDYSHYTKPQNFRGMQVPEILLSGDHERIRIFRKKDSLLKTILKRPDLFI 230
>gi|150025917|ref|YP_001296743.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacterium psychrophilum JIP02/86] >gi|166200421|sp|A6H0R6|TRMD_FLAPJ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|149772458|emb|CAL43940.1| tRNA (Guanine-N(1)-methyltransferase [Flavobacterium psychrophilum JIP02/86] (225 aa)
Score = 483, Expect = 5.1e-47, Identities = 92/219 (42%), Positives = 147/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++   N R+++ +    VDD P+GGGAGMV+ +QPI D I H+K+  +  +V+ +TP G+T NQ++ N      ++I++CGHY+G D+R+ + ++  EISIGDY+L+GGE+ A+ + D++IRLIP V+S   S  ++SF +NLL  P YT+P ++ G+KVPEVL SG+  +I+K R++     TK  R DL 
  S:     1 MRIDIITILPELLRSPFEASIMKRAIDKGLVEVYFHNLRDYTTNKQKSVDDYPFGGGAGMVMNVQPIDDCITHLKSERTYDEVIYMTPDGETLNQKMTNSMSLLGNIIILCGHYKGVDQRVRDHFITREISIGDYVLSGGELGALVLCDALIRLIPGVLSDETSALTDSFQDNLLSGPIYTRPADYKGWKVPEVLTSGHFAKIDKWREDMAYEHTKNRRPDLL 223
>gi|126696803|ref|YP_001091689.1| putative bifunctional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. MIT 9301] >gi|126543846|gb|ABO18088.1| putative bifunctional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. MIT 9301] (406 aa)
Score = 483, Expect = 5.5e-47, Identities = 96/214 (44%), Positives = 139/214 (64%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           V++LF   F    N  +I KA+  NL+D+ + + R + + S+ +VDD PYGGGAGMVL  +PI  A   + K   SK +L+TP GK   Q+   ++ T + +I+ICG YEGFDERI    D EISIGDY+L+GGEI A++I++ + RL+P  +   +SL  ES +++LL+YP YT+P  F   KVP++L+SGNH+EI   R+     +T   R DL
  S:     8 VITLFPKAFELINNLGVITKALDKNLIDLNLHDLREYGEGSYRQVDDKPYGGGAGMVLKPEPIYKAYESIRKLPKSKTLLMTPQGKVLKQKDLARWSTLDQIIIICGQYEGFDERIRCLADEEISIGDYVLSGGEIPAISIINGLTRLLPGTLGDPDSLVDESHNSSLLEYPQYTRPITFKDMKVPDILVSGNHEEIKSWRRRKSFERTLERRSDL 223
>gi|110636545|ref|YP_676752.1| tRNA (guanine-N(1)-)-methyltransferase [Cytophaga hutchinsonii ATCC 33406] >gi|118575140|sp|Q11YV4|TRMD_CYTH3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|110279226|gb|ABG57412.1| tRNA (Guanine37-N1) methyltransferase [Cytophaga hutchinsonii ATCC 33406] (235 aa)
Score = 483, Expect = 5.5e-47, Identities = 95/224 (42%), Positives = 147/224 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLK 224
           M+I +++      + F   SI+K+A    + ++ + + R ++   H +VDD  YGG AGMVL ++PI   I  +K       V+ +TP GKT++QQ AN+F  ++++I++CGHY+G DER    ++ +EISIGDY+L+GGE+AA  + D++IRLIP V+S   S  ++SF ++LL    YT+P ++ G  VPE+LLSGN KEI K R E  + +TK  R DL+ K+ K
  S:     1 MRIDIITCLPKLLDSFFGHSILKRAQEKGIAEVVVHDLRTYTLFKHKQVDDYSYGGSAGMVLMVEPIDRCITALKAEREYDAVIYMTPDGKTFDQQTANRFSLYKNIIILCGHYKGVDERARQAFITHEISIGDYVLSGGELAAAVVSDALIRLIPGVLSDETSALTDSFQDSLLAPAVYTRPADYKGMIVPEILLSGNEKEIEKWRFENALERTKERRPDLYQKFTK 228
>gi|149911442|ref|ZP_01900059.1| tRNA (guanine-N(1)-)-methyltransferase [Moritella sp. PE36] >gi|149805473|gb|EDM65480.1| tRNA (guanine-N(1)-)-methyltransferase [Moritella sp. PE36] (237 aa)
Score = 483, Expect = 5.7e-47, Identities = 96/207 (46%), Positives = 136/207 (65%)
  Q:    13 FNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           FN      +I +AI  +L+  +  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +    +KV+ L+P G+  +Q       T E +I ICG YEG DERII + VD E SIGD++LTGGE+AAM I+D+V R+IP V+    S E +SF + LLD P+YT+P   +G  VP+VLLSGNH +I++ R++  + +T   R DL 
  S:     2 FNAITEQGVIGRAIKRDLLKFQTWNPRDFAHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKQAAGGEAKVIYLSPQGRKLDQAGVLDLATNEKMIFICGRYEGIDERIIQSEVDEEWSIGDFVLTGGELAAMTIIDAVSRMIPGVLGTQASAEQDSFADGLLDCPHYTRPEVLDGLAVPKVLLSGNHSKISQYRQKQSLARTLERRPDLL 213
>gi|126663570|ref|ZP_01734567.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacteria bacterium BAL38] >gi|126624518|gb|EAZ95209.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacteria bacterium BAL38] (225 aa)
Score = 483, Expect = 5.8e-47, Identities = 93/219 (42%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++   N R+++ +    VDD  +GGGAGMV+++QPI   I+ +K+  +  +++ +TP G+T NQ++AN    +E+++++CGHY+G D+R+ + ++  EISIGDY+L+GGEI A+   D++IRLIP V+S   S  ++SF +NLL  P YT+P ++NG KVPEVLLSGN  +I K R++     TK  R DL 
  S:     1 MRIDIITVLPELMRSPFEASIMKRAIEKGLVEVHFHNLRDYTTNKQRSVDDYQFGGGAGMVMSVQPIDTCISKLKSERTYDEIIYMTPDGETLNQKMANSISMYENIMILCGHYKGVDQRVRDMHITREISIGDYVLSGGEIGAIVFCDAIIRLIPGVLSDETSALTDSFQDNLLSPPIYTRPADYNGLKVPEVLLSGNFAKIEKWREDMAYEHTKNRRPDLL 223
>gi|46143633|ref|ZP_00134828.2| COG0336: tRNA-(guanine-N1)-methyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209252|ref|YP_001054477.1| tRNA (guanine-N(1)-)-methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|165977225|ref|YP_001652818.1| tRNA (guanine-N(1)-)-methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190151143|ref|YP_001969668.1| tRNA (guanine-N(1)-)-methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166231331|sp|A3N386|TRMD_ACTP2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|126098044|gb|ABN74872.1| tRNA (guanine-N(1)-)-methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|165877326|gb|ABY70374.1| tRNA (guanine-N1)-methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916274|gb|ACE62526.1| tRNA (guanine-N(1)-)-methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (251 aa)
Score = 483, Expect = 6.1e-47, Identities = 96/219 (43%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-------NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+  +L+ I+  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +        +KV+ L+P G+  +QQ      + + LILICG YEG DER+I   VD E SIGDY+LTGGE+ AM ++D+V R +P V+    S + +SF   LLD P+YT+P   +G  VPEVL+SG+H+ I K R E  + +T + R +L 
  S:     1 MWIGIISLFPEMFKAITDFGVTGRAVKQDLLQIQCWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKQAAKAEDGVEAKVIYLSPQGRKLDQQGVKTLASNQKLILICGRYEGVDERLIQTEVDEEWSIGDYVLTGGELPAMTLIDAVARFVPGVLGKQASADEDSFATGLLDCPHYTRPEMLDGIPVPEVLMSGHHENIRKWRLEQSLERTWLRRPELL 228
>gi|193078539|gb|ABO13559.2| tRNA (guanine-1-)-methyltransferase [Acinetobacter baumannii ATCC 17978] (246 aa)
Score = 483, Expect = 6.5e-47, Identities = 99/221 (44%), Positives = 141/221 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   V++LF   F       I  +A   ++V +  +N R+F++ ++ +VD+ P+GGG GMV+  +P+  AINH K   S+       VV ++P GKT N+Q   QF  ++ LI++CG YEG DER+I +YVD E SIGDY+L+GGE+ AM +LDS+IR +PNV+S   S   +SF + LLD P YTKP  F G  VPE+L SG+H  I K R   +  +T   R +L  K
  S:     1 MFFAVITLFPEMFEAITAYGISGRAAKRDIVQVTCINPRDFAEGNYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASQAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNVMSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLERRPELIEK 230
>gi|146299940|ref|YP_001194531.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacterium johnsoniae UW101] >gi|189036082|sp|A5FHV7|TRMD_FLAJO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|146154358|gb|ABQ05212.1| tRNA (Guanine37-N1) methyltransferase [Flavobacterium johnsoniae UW101] (226 aa)
Score = 482, Expect = 6.8e-47, Identities = 91/219 (41%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++   N R+++ +    VDD  +GGGAGMV+ +QPI D I H+K+     +++ ++P G+T NQ++AN+   +E++I++CGHY+G D+R+ + ++  EISIGDY+L+GGE+ A+ + D++IRLIP V+S   S  ++SF +NLL  P YT+P ++ G+KVPEVL SG+  +I K R++     TK  R DL 
  S:     1 MRIDIITVLPELLRSPFEASIMKRAIDKGLVEVHFHNLRDYTTNKQKSVDDYQFGGGAGMVMMIQPIDDCITHLKSEREYDEIIYMSPDGETLNQKMANKMSMYENIIILCGHYKGVDQRVRDHFITKEISIGDYVLSGGELGALVLSDALIRLIPGVLSDETSALTDSFQDNLLSGPIYTRPADYKGWKVPEVLTSGHAAKIEKWREDAAYEHTKNRRPDLL 223
>gi|153094597|gb|EDN75411.1| tRNA (guanine-N(1)-)-methyltransferase [Mannheimia haemolytica PHL213] (251 aa)
Score = 482, Expect = 7.4e-47, Identities = 97/219 (44%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-------NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+  NL+ +E  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +        +KV+ L+P G+  +Q       + + LILICG YEG DER+I   VD E SIGDY+LTGGE+ AM ++D+V R +P V+    ++LE +SF   LLD P+YT+P   +G  VPEVL+SG+H++I K R E  + +T + R +L 
  S:     1 MWIGIISLFPEMFKAITDFGVTGRAVKQNLLQVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKKAALAVEGGEAKVIYLSPQGRKLDQNGVQTLASNQKLILICGRYEGVDERLIQTEVDEEWSIGDYVLTGGELPAMTLIDAVARFVPGVLGKQASALE-DSFAEGLLDCPHYTRPEVLDGMPVPEVLMSGHHEQIRKWRLEQSLERTWLRRPELL 228
>gi|153827349|ref|ZP_01980016.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae MZO-2] >gi|149738744|gb|EDM53086.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae MZO-2] (247 aa)
Score = 482, Expect = 8.6e-47, Identities = 95/219 (43%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + ++SLF   F    +  +  +A+   L+ +E  N R+F+ D    VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +QQ   +    ++LILICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R IP V+    S E +SF N LLD P+YT+P   +G +VP VL SGNH++I + R +  + +T + R +L 
  S:     1 MWVGIVSLFPEMFRSVTDFGVTGQAVKKGLLSVEAWNPRDFAHDKRRTVDDKPYGGGPGMLMMVQPLRDAIHAAKQASPGKTKVIYLSPQGRKLDQQGVEELAQNQNLILICGRYEGVDERIIESEVDEEWSIGDFVMTGGELPAMTLIDSVSRFIPGVLGDFTSAEEDSFANGLLDCPHYTRPEVLDGKEVPAVLKSGNHEDIRRWRLKQSLGRTWLRRPELL 224
>gi|184159679|ref|YP_001848018.1| tRNA-(guanine-N1)-methyltransferase [Acinetobacter baumannii ACICU] >gi|183211273|gb|ACC58671.1| tRNA-(guanine-N1)-methyltransferase [Acinetobacter baumannii ACICU] (246 aa)
Score = 481, Expect = 9.0e-47, Identities = 98/218 (44%), Positives = 140/218 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M   V++LF   F       I  +A   ++V +  +N R+F++ ++ +VD+ P+GGG GMV+  +P+  AINH K   S+       VV ++P GKT N+Q   QF  ++ LI++CG YEG DER+I +YVD E SIGDY+L+GGE+ AM +LDS+IR +PNV+S   S   +SF + LLD P YTKP  F G  VPE+L SG+H  I K R   +  +T   R +L
  S:     1 MFFAVITLFPEMFEAITAYGISGRAAKRDIVQVTCINPRDFAEGNYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASQAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNVMSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLERRPEL 227
>gi|114564082|ref|YP_751596.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella frigidimarina NCIMB 400] >gi|122299045|sp|Q07Z07|TRMD_SHEFN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|114335375|gb|ABI72757.1| tRNA (guanine-N1)-methyltransferase [Shewanella frigidimarina NCIMB 400] (248 aa)
Score = 481, Expect = 9.3e-47, Identities = 98/219 (44%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L++++  N R+F+ D HN VDD PYGGG GM++ +QP+ DAI+  K      +KV+ L+P G+  +Q    +    E LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P   +G  VP VLLSG+H++I   R +  I +T + R +LF
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLEVQTWNPRDFTHDRHNTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGDRAKVIYLSPQGRKLDQHGVTELAKSECLILVCGRYEGVDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVARLVPGVLGKQASAEQDSFSDGLLDCPHYTRPEQLDGLDVPAVLLSGDHEKIRLWRLQQSIGRTFLRRPELF 224
>gi|167752275|ref|ZP_02424402.1| hypothetical protein ALIPUT_00519 [Alistipes putredinis DSM 17216] >gi|167660516|gb|EDS04646.1| hypothetical protein ALIPUT_00519 [Alistipes putredinis DSM 17216] (226 aa)
Score = 481, Expect = 1.1e-46, Identities = 99/219 (45%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +L++         N SI+K+A    LV+I I N R++++D H   DD P+GG AGMV+ ++PI   I  +K      +V+  +P G  Y+Q  AN+  T ++LI++CGHY+G D RI  + V  EISIGDY+LTGGE+AA  I DSVIR+IP  I    S  ++ F +NLL  P YT+P  FNG+KVP+VLLSGN   I++ ++E    +TK  R DL 
  S:     1 MRIDILTVVPELLASPLNESILKRAQEKGLVEIHIHNIRDYTEDKHRTTDDYPFGGEAGMVMKIEPIYRCIEALKAEREYDEVIYTSPDGIRYDQHEANRLSTLDNLIILCGHYKGIDYRIREHLVTREISIGDYVLTGGELAACIIADSVIRIIPGAIGDEASALTDCFQDNLLAPPVYTRPAEFNGWKVPDVLLSGNFARIDRWKEEQAWERTKRLRPDLL 223
>gi|32477731|ref|NP_870725.1| tRNA (guanine-N(1))-methyltransferase [Rhodopirellula baltica SH 1] >gi|46577374|sp|Q7TTY8|TRMD_RHOBA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|32448285|emb|CAD77802.1| tRNA (Guanine-N(1))-methyltransferase [Rhodopirellula baltica SH 1] (242 aa)
Score = 480, Expect = 1.2e-46, Identities = 96/226 (42%), Positives = 152/226 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDS-HNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLE-SESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+  V++LF   F+ +   S++ KAI   LV+I+  N R++++D+ H KVDD P+GGG GM+L ++P V  +  V       ++ +LLTP G+  +Q++A    T + ++L+CG YEGFD+R+++ +   EISIGD++L GGE+AAM I+D+V+RL+P V+    +SL+ S S  N +L++P YT+P  F G+ VP+VLLSG+H  I   R E    +T   R+DL  ++ K N
  S:     1 MRFDVVTLFPAIFDGYLTQSLLDKAIVRGLVEIQRHNLRDWAEDTPHRKVDDRPFGGGPGMLLQVEPTVTCVRDVDAMADVPARKILLTPQGRRLDQRLAEDLATSDRIMLMCGRYEGFDQRVLDILQPEEISIGDFVLNGGEVAAMTIIDAVVRLLPGVLGDEQSSLDDSFSRGNRMLEFPQYTRPREFEGHTVPDVLLSGDHAAIAAWRAEQSRARTIDRRRDLLPEHSKNN 234
>gi|94501754|ref|ZP_01308268.1| tRNA (guanine-N(1)-)-methyltransferase [Oceanobacter sp. RED65] >gi|94426154|gb|EAT11148.1| tRNA (guanine-N(1)-)-methyltransferase [Oceanobacter sp. RED65] (250 aa)
Score = 480, Expect = 1.2e-46, Identities = 97/221 (43%), Positives = 141/221 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  V+S+F   +    +  +  +A+   LV +++ N R+F+ D +  VDD PYGGG GM++ ++P+  AI   K    S SKVV L+P G+T  Q  A Q      LI + G YEG DER+I   +D EISIGDY+L+GGE+A+M ++DSVIRL+P V+  + S   +SF + LLD P+YT+P    G KVP+VLLSGNH++I + R +  + +T   R DL  K
  S:     1 MQFGVISIFPEMYQALTDFGVTGRAVDKGLVSVDVWNPRDFTIDKYQTVDDRPYGGGPGMLMKVEPLKYAIEAAKAKLGSQSKVVYLSPQGETLTQDKAQQLAQEASLIFLAGRYEGIDERLIETQIDEEISIGDYVLSGGELASMVVMDSVIRLVPEVLGHDMSAVEDSFVDGLLDCPHYTRPEEHEGRKVPDVLLSGNHEKIRQWRLKQALGRTWEKRPDLLAK 226
>gi|150422012|gb|EDN13983.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae AM-19226] (247 aa)
Score = 480, Expect = 1.3e-46, Identities = 95/219 (43%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + ++SLF   F    +  +  +A+   L+ +E  N R+F+ D    VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +QQ   +    ++LILICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R IP V+    S E +SF N LLD P+YT+P   +G +VP VL SGNH++I + R +  + +T + R +L 
  S:     1 MWVGIVSLFPEMFRSVTDFGVTGQAVKKGLLSVEAWNPRDFAHDKRRTVDDKPYGGGPGMLMMVQPLRDAIHAAKQASPGKTKVIYLSPQGRKLDQQGVEELAQNQNLILICGRYEGVDERIIESEVDEEWSIGDFVMTGGELPAMTLIDSVSRFIPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDGKEVPAVLKSGNHEDIRRWRLKQSLGRTWLRRPELL 224
>gi|15640585|ref|NP_230214.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|147675311|ref|YP_001216062.1| tRNA (guanine-N(1)-)-methyltransferase [Vibrio cholerae O395] >gi|153216301|ref|ZP_01950391.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae 1587] >gi|153224049|ref|ZP_01954194.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae MAK 757] >gi|153830219|ref|ZP_01982886.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae 623-39] >gi|194531379|ref|YP_002066837.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae MO10] >gi|172047729|sp|A5F9A9|TRMD_VIBC3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|26401013|sp|Q9KUF8|TRMD_VIBCH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|9654993|gb|AAF93731.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|124114343|gb|EAY33163.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae 1587] >gi|124117869|gb|EAY36612.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae MAK 757] >gi|125617307|gb|EAZ45879.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae MO10] >gi|146317194|gb|ABQ21733.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae O395] >gi|148874279|gb|EDL72414.1| tRNA (guanine-N1)-methyltransferase [Vibrio cholerae 623-39] (247 aa)
Score = 480, Expect = 1.3e-46, Identities = 95/219 (43%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + ++SLF   F    +  +  +A+   L+ +E  N R+F+ D    VDD PYGGG GM++ +QP+ DAI+  K ++   +KV+ L+P G+  +QQ   +    ++LILICG YEG DERII + VD E SIGD+++TGGE+ AM ++DSV R IP V+    S E +SF N LLD P+YT+P   +G +VP VL SGNH++I + R +  + +T + R +L 
  S:     1 MWVGIVSLFPEMFRSVTDFGVTGQAVKKGLLSVEAWNPRDFAHDKRRTVDDKPYGGGPGMLMMVQPLRDAIHAAKQASPGKTKVIYLSPQGRKLDQQGVEELAQNQNLILICGRYEGVDERIIESEVDEEWSIGDFVMTGGELPAMTLIDSVSRFIPGVLGDFASAEEDSFANGLLDCPHYTRPEVLDGKEVPAVLKSGNHEDIRRWRLKQSLGRTWLRRPELL 224
>gi|113460441|ref|YP_718503.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus somnus 129PT] >gi|170717940|ref|YP_001783520.1| tRNA (guanine-N1)-methyltransferase [Haemophilus somnus 2336] >gi|123327132|sp|Q0I1J8|TRMD_HAES1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|189036086|sp|B0UVM8|TRMD_HAES2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|112822484|gb|ABI24573.1| tRNA (Guanine37-N1) methyltransferase [Haemophilus somnus 129PT] >gi|168826069|gb|ACA31440.1| tRNA (guanine-N1)-methyltransferase [Haemophilus somnus 2336] (245 aa)
Score = 480, Expect = 1.3e-46, Identities = 93/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F       +  +A+  NL++I+  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K+      KV+ L+P G+  +Q    +    + +I +CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R +P V+    S + +SF   LLD P+YT+P   NG  VP VL+SGNH+EI K R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFKAITEYGVTGRAVRQNLLEIQYWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHCAKSVAGDGVKVIYLSPQGRKLDQNGVQELARNQKMIFVCGRYEGIDERLIETEIDEEWSIGDYVLTGGELPAMTLIDAVARFVPCVLGKQASAQEDSFAEGLLDCPHYTRPEQLNGLTVPPVLMSGNHEEIRKWRLKQSLQRTWLRRPELL 224
>gi|15603162|ref|NP_246235.1| tRNA (guanine-N(1)-)-methyltransferase [Pasteurella multocida subsp. multocida str. Pm70] >gi|26400834|sp|Q9CLE1|TRMD_PASMU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|12721658|gb|AAK03381.1| TrmD [Pasteurella multocida subsp. multocida str. Pm70] (245 aa)
Score = 479, Expect = 1.9e-46, Identities = 93/219 (42%), Positives = 134/219 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + ++SLF   F       +  +A+  NL+ +   N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K      +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   VD E S+GDY+LTGGE+ AM ++D+V R IP V+    S + +SF   LLD P+YT+P   +G  VP VL+SGNH+EI K R    + +T + R +L 
  S:     1 MLVGIISLFPEMFKAITEFGVTGRAVKQNLLQVRCWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIQAAKAEVGEGAKVIYLSPQGRKLDQAGVKELAQHQKLILLCGRYEGIDERLIETEVDEEWSVGDYVLTGGELPAMTLIDAVARFIPGVLGKQASADEDSFAEGLLDCPHYTRPEVLDGLAVPPVLMSGNHEEIRKWRLRQSLERTWLRRPELL 224
>gi|83644608|ref|YP_433043.1| tRNA (guanine-N1)-methyltransferase [Hahella chejuensis KCTC 2396] >gi|118575143|sp|Q2SL56|TRMD_HAHCH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|83632651|gb|ABC28618.1| tRNA (guanine-N1)-methyltransferase [Hahella chejuensis KCTC 2396] (258 aa)
Score = 477, Expect = 2.6e-46, Identities = 97/215 (45%), Positives = 144/215 (66%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           V++LF        +  ++ KAI  + +++   N R+++ D++  VDD PYGGG GM++ + P+  A+N  K+   + SKVV L+P G+  +Q +A    +   LIL+CG YEG DER+I + VD E S+GD++L+GGEIAAMAI+DSV RL P V+  N S E +SF+N+LLD P+YT+P  +   +VPEVLLSGNH++I + R E  + +T   R DL 
  S:    14 VITLFPEMLKSVTDFGVVGKAIKQSSIEVCTWNPRDYATDNYRTVDDRPYGGGPGMLMKVGPLEAALNAAKSVAPAGSKVVYLSPQGRRLDQALARSALSVPGLILLCGRYEGIDERLIEDEVDEEWSLGDFVLSGGEIAAMAIIDSVSRLAPGVLGHNESAEQDSFENSLLDCPHYTRPEIYRDKRVPEVLLSGNHEKIRRWRLEQSLLRTLQRRPDLL 233
>gi|189219285|ref|YP_001939926.1| tRNA-(guanine-N1)-methyltransferase [Methylokorus infernorum V4] >gi|189186143|gb|ACD83328.1| tRNA-(guanine-N1)-methyltransferase [Methylacidiphilum infernorum V4] (232 aa)
Score = 477, Expect = 2.8e-46, Identities = 97/219 (44%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I V++L            I+K+A+   L+++ +   R++++D H  VDD PYGGG GMVL  +PI +A+  +     K  VV  +PSG  ++QQ+A        LI ICG YEG D+R+I+  VD EI IGDYIL+ G IAA+ I+DSV+RLIP V+ + +S+  ESF++ LL+ P YT+P  F  ++VP VLLSG+H+ I   RK     KT+  RKDL+
  S:     1 MRIDVVTLNPRIIESASEEGILKQALKKGLLELFVHQLRDYARDKHKTVDDRPYGGGPGMVLKCEPIFEAVEAIGWCKDKDTVVCPSPSGIKFDQQLAKDLSKRNRLIFICGQYEGIDQRVIDQLVDLEICIGDYILSSGTIAALVIIDSVVRLIPGVLGNQDSILDESFEDFLLEGPQYTRPRKFRDWEVPAVLLSGDHRRILLWRKRLSEEKTEKMRKDLW 223
>gi|160889579|ref|ZP_02070582.1| hypothetical protein BACUNI_02005 [Bacteroides uniformis ATCC 8492] >gi|156861096|gb|EDO54527.1| hypothetical protein BACUNI_02005 [Bacteroides uniformis ATCC 8492] (225 aa)
Score = 477, Expect = 2.9e-46, Identities = 93/219 (42%), Positives = 146/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ +NQ +AN     ++LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D++IR+IP VIS   S  S+SF +NLL  P YT+P ++NG+KVP++LLSG+  +I +   +  + +T+  R DL 
  S:     1 MRIDIITVLPEMIEGFFNCSIMKRAQNKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINALKAERDYDEVIFTTPDGEQFNQPMANTLSLAQNLIILCGHFKGIDYRIREHLITKEISIGDYVLTGGELAAAVMADAIIRIIPGVISDEQSALSDSFQDNLLAAPVYTRPADYNGWKVPDILLSGHEAKIKEWELQQSLERTRRLRPDLL 223
>gi|158522317|ref|YP_001530187.1| tRNA (guanine-N1)-methyltransferase [Desulfococcus oleovorans Hxd3] >gi|158511143|gb|ABW68110.1| tRNA (guanine-N1)-methyltransferase [Desulfococcus oleovorans Hxd3] (279 aa)
Score = 477, Expect = 3.2e-46, Identities = 91/221 (41%), Positives = 140/221 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M  TVL++F    + F    I+++A+ +  +    V+ R+++KD H  VDD PYGGG+GMV+  +P+  AI   + +  +++ VLLTP G+ + Q+ A       E LIL+CG YEG DER+    +D EIS+GDY+L+GGE+ AM ++D+V RLIP  +   +S E E+F    +++ +YT+P  F G  VPEVL+SGNH  I   R E  + +T + R DL ++
  S:    30 MNFTVLTIFPEMVDAFSQHGIVRRAVESGTISCRTVDIRDYTKDRHRTVDDRPYGGGSGMVMKPEPLAAAIRDARNAYPSARTVLLTPQGRGFTQEAARHLADAAEDLILVCGRYEGIDERVCQGLIDDEISVGDYVLSGGEVPAMIVIDAVTRLIPGALGGEDSAEKETFVQGRIEHAHYTRPPVFEGEPVPEVLVSGNHARIEAWRLETSLVRTLLKRPDLLLE 255
>gi|167856650|ref|ZP_02479343.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus parasuis 29755] >gi|167852223|gb|EDS23544.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus parasuis 29755] (255 aa)
Score = 476, Expect = 4.0e-46, Identities = 94/219 (42%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-------NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+  NL+ ++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI   K +        +KV+ L+P G+  +Q         + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    ++LE +SF   LLD P+YT+P   +G  VP+VL+SG+H++I K R E  + +T + R +L 
  S:     1 MWIGIISLFPEMFKAITDFGVTGRAVKQNLLQVQCWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIREAKATACKEDGVEAKVIYLSPQGRKLDQAGVQTLAINQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASALE-DSFAEGLLDCPHYTRPEVLDGLPVPQVLMSGHHEQIRKWRLEQSLERTWLRRPELL 228
>gi|123969011|ref|YP_001009869.1| putative bifunctional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. AS9601] >gi|123199121|gb|ABM70762.1| putative bifunctional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. AS9601] (408 aa)
Score = 475, Expect = 4.9e-46, Identities = 94/214 (43%), Positives = 140/214 (65%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           V++LF   F    N  +I +A+   L+D+ + + R + + S+ +VDD PYGGGAGMVL  +PI  A   + K+S SK +L+TP GK   Q+   ++ T + +I+ICG YEGFDERI    D EIS+GDY+L+GGEI A++I++ + RL+P  +   +SL  ES ++ LL+YP YT+P  F   KVP++L+SGNH+EI   R++    +T   R DL
  S:     8 VITLFPKAFELINNLGVITRALDKKLIDVNLHDLREYGEGSYRQVDDKPYGGGAGMVLKPEPIYKAYESIRKSSKSKTLLMTPQGKILKQKDLARWSTLDQIIIICGQYEGFDERIRCLADEEISLGDYVLSGGEIPAISIINGLTRLLPGTLGDPDSLIDESHNSPLLEYPQYTRPLTFKDMKVPDILVSGNHEEIKSWRRKKSFERTLERRSDL 223
>gi|78779760|ref|YP_397872.1| tRNA (Guanine37-N(1)-) methyltransferase [Prochlorococcus marinus str. MIT 9312] >gi|119370983|sp|Q319K9|TRMD_PROM9 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|78713259|gb|ABB50436.1| tRNA (Guanine37-N(1)-) methyltransferase [Prochlorococcus marinus str. MIT 9312] (245 aa)
Score = 475, Expect = 4.9e-46, Identities = 96/216 (44%), Positives = 142/216 (65%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           I V++L    F   KN  +I +A+  NL+++ + + R + + S+ +VDD PYGGGAGMVL   PI  A   + K   SK +L+TP GK   Q+   ++ T + +I+ICG YEGFDER+    D EISIGDY+L+GGEI A++I++ + RL+P  +   +SL +ES ++ LL++P YT+P  F   KVP+VL++GNHKEI   R+E  + +T   RKDL
  S:     6 IDVITLLPKAFELIKNLGVITRALDKNLINVNLHDLREYGEGSYRQVDDKPYGGGAGMVLKPGPIFKAHESINKFPKSKTLLMTPQGKVLKQKDFVRWSTLDQIIIICGQYEGFDERVRCLADEEISIGDYVLSGGEIPALSIINGLTRLLPGTLGDPDSLVNESHNSPLLEHPQYTRPQIFRDMKVPDVLINGNHKEIELWREERMLKRTIKRRKDL 223
>gi|126665075|ref|ZP_01736058.1| tRNA (guanine-N(1)-)-methyltransferase [Marinobacter sp. ELB17] >gi|126630445|gb|EBA01060.1| tRNA (guanine-N(1)-)-methyltransferase [Marinobacter sp. ELB17] (252 aa)
Score = 475, Expect = 5.1e-46, Identities = 94/219 (42%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I  +SLF   F    +  I  +A+ + L+     N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  + +    + VV L+P G+T NQ +       + LIL+ G YEG DER+I   VD E+S+GD++L+GGE+AAMA++D+V RLIP V+    S E +SF + LLD P+YT+P  + G  VP+VLL G+H +I + R +  + +T   R DL 
  S:     1 MWIGAVSLFPEMFAAVTDYGITSRAVRDGLITFHSWNPRDFTHDRHRTVDDRPYGGGPGMLMKIQPLRDAIHAARQAAPGPACVVYLSPQGETLNQAVVESLAAEQRLILVAGRYEGVDERLITAEVDREVSLGDFVLSGGELAAMAVIDAVTRLIPGVLGHAQSAEQDSFADGLLDCPHYTRPEVYEGQAVPDVLLGGHHDQIRRWRLKQSLRRTSERRPDLL 224
>gi|153806307|ref|ZP_01958975.1| hypothetical protein BACCAC_00566 [Bacteroides caccae ATCC 43185] >gi|149130984|gb|EDM22190.1| hypothetical protein BACCAC_00566 [Bacteroides caccae ATCC 43185] (225 aa)
Score = 475, Expect = 5.2e-46, Identities = 93/219 (42%), Positives = 146/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ +NQ +AN     ++LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D+++R+IP VIS   S  S+SF +NLL  P YT+P ++NG+KVP++LLSG+  +I +   +  + +TK  R DL 
  S:     1 MRIDIITVLPEMIEGFFNCSIMKRAQNKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINALKAERDYDEVIFTTPDGEQFNQPMANSLSLAQNLIILCGHFKGIDFRIREHLITKEISIGDYVLTGGELAAAVMADAIVRIIPGVISDEQSALSDSFQDNLLAAPVYTRPADYNGWKVPDILLSGHEAKIKEWELQQSLERTKRLRPDLL 223
>gi|149372341|ref|ZP_01891529.1| tRNA (guanine-N(1)-)-methyltransferase [unidentified eubacterium SCB49] >gi|149354731|gb|EDM43294.1| tRNA (guanine-N(1)-)-methyltransferase [unidentified eubacterium SCB49] (225 aa)
Score = 475, Expect = 5.2e-46, Identities = 90/219 (41%), Positives = 152/219 (69%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++ + N R+FS +++N++DD  +GGGAGMV+ ++PI   I+ +K      +V+ +TP G+T NQ IANQ    E++I++CGHY+G D+R+ + ++  EIS+GD++L+GGE+AA  + D+VIRL+P V+ +  S  ++SF ++LL  P YT+P  + G+KVP++LLSG+++ I+K R+E    +T+  R DL 
  S:     1 MRIDIITVLPELLKSPFEASILKRAIEKGLVEVHMHNLRDFSTNNYNQIDDYQFGGGAGMVMMIEPIDKCISKLKAERDYDEVIYMTPDGETLNQGIANQLSCKENIIILCGHYKGVDQRVRDQFITREISVGDFVLSGGELAAAIVCDAVIRLLPGVLGNETSALTDSFQDDLLAPPIYTRPSEYKGWKVPDILLSGHNENIDKWREEQAFKRTEKLRPDLL 223
>gi|77359892|ref|YP_339467.1| tRNA (guanine-7-)-methyltransferase [Pseudoalteromonas haloplanktis TAC125] >gi|119370985|sp|Q3IEC7|TRMD_PSEHT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|76874803|emb|CAI86024.1| tRNA (guanine-7-)-methyltransferase [Pseudoalteromonas haloplanktis TAC125] (255 aa)
Score = 475, Expect = 5.5e-46, Identities = 96/217 (44%), Positives = 143/217 (65%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           + V+SLF + F+   +  +  +A+ + L+D    N R+++ D H  VDD PYGGG GM++ ++P+  AI   K      +KV+ ++P G+  +QQ A++  + + LILI G YEG DERII +YVD E SIGD+IL+GGE+ AM ++D+V RL+P V+  N S E +SF + LLD P+YT+P   +  +VP VLLSGNH+EI K R    + +T + R DL 
  S:     9 VGVISLFPDMFDAITDQGVTGRAVKSGLIDFNCWNPRDYALDKHRTVDDRPYGGGPGMLMMVEPLKKAIAEAKKAAGDGAKVIYMSPQGRKLDQQGASELASSKKLILIAGRYEGIDERIIESYVDEEWSIGDFILSGGELPAMTLIDAVARLVPGVLGHNQSAEQDSFSDGLLDCPHYTRPETLDDKQVPAVLLSGNHQEIAKWRLMQSLGRTWLRRPDLL 230
>gi|196228969|ref|ZP_03127835.1| tRNA (guanine-N1)-methyltransferase [Chthoniobacter flavus Ellin428] >gi|196227250|gb|EDY21754.1| tRNA (guanine-N1)-methyltransferase [Chthoniobacter flavus Ellin428] (262 aa)
Score = 475, Expect = 5.6e-46, Identities = 101/219 (46%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS----------------------------NSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +L+LF          S+I KA    LV I++ N R +++D H   DD PYGG  GMV+  +PI  A+  +K                               S V+ LTP GK ++Q+ A +  +   HLIL+CGHYEG D+R+I++ VD EISIGDY+LT G IAA  I D+V+RL+P V+   NS   +SF + L++ P YT+P  F G++VP++LLSGNH  I K R+E  ++KT+  R DL 
  S:     1 MRIDILTLFPTIAGIPLGESMIGKAQQRGLVTIQVHNIREWARDKHRTTDDAPYGGSQGMVMKCEPIFAAVEELKQKWNGEWSRKAGTNDEPAADAAAESFDVRHPSFVIYLTPGGKPFDQKAATRLAQPGSHLILLCGHYEGIDQRVIDHLVDEEISIGDYVLTNGAIAAAVITDAVVRLLPGVLGDENSAPDDSFASGLIEGPQYTRPVEFRGWRVPDILLSGNHGAIAKWRREQALDKTRRVRPDLL 250
>gi|15807007|ref|NP_295734.1| tRNA (guanine-N1)-methyltransferase [Deinococcus radiodurans R1] >gi|26400848|sp|Q9RSW0|TRMD_DEIRA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|6459797|gb|AAF11558.1|AE002038_7 tRNA (guanine-N1)-methyltransferase [Deinococcus radiodurans R1] (279 aa)
Score = 474, Expect = 5.6e-46, Identities = 87/219 (39%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQ---PIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +  + L+LF      F   +I+ KA    L+D+ +VN R+++++ H KVDDTPYGGGAGMV+ +      +DA         +V+L TP+G+ + QQ+A +    +HL+ +CG YEGFD R+   V  E+S+GD+++ GGE AA  +L++V RL P V+    S + +SF + LLDYP YT+P  + G+ VP+VL  GNH  + + R++  + +T   R DL 
  S:     2 LTFSFLTLFPELLTPFAQEAIVGKARERGLIDVRLVNLRDYAQNKHLKVDDTPYGGGAGMVIRVDVAARALDAACQAGPRPDEVILFTPAGERFTQQVAEELANKQHLVFLCGRYEGFDARVEGLVTRELSLGDFVMMGGEAAAACVLEAVARLRPGVLGDEASHQQDSFSSGLLDYPEYTRPPEWEGHSVPDVLRGGNHAAVARWRRDQALERTLRRRPDLL 224
>gi|152978199|ref|YP_001343828.1| tRNA (guanine-N(1)-)-methyltransferase [Actinobacillus succinogenes 130Z] >gi|171704202|sp|A6VLP6|TRMD_ACTSZ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|150839922|gb|ABR73893.1| tRNA (guanine-N1)-methyltransferase [Actinobacillus succinogenes 130Z] (245 aa)
Score = 474, Expect = 5.9e-46, Identities = 94/221 (42%), Positives = 134/221 (60%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I +++LF   F       +  +A+  NL+ +   N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K       KV+ L+P G+   Q    +    + LIL+CG YEG DER+I   VD E SIGDY+LTGGE+ AM ++D+V R IP V+    S + +SF   LLD P+YT+P   +G  VP VL+SGNH++I K R    + +T + R +L  K
  S:     1 MFIGIVTLFPEMFKAITEFGVTGRAVKQNLLQVRCYNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHSAKAEAGEGVKVIYLSPQGRKLEQSGVTELAQNKKLILVCGRYEGIDERLIQTEVDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASADEDSFAAGLLDCPHYTRPEELDGLTVPPVLMSGNHEQIRKWRLTQSLERTWLRRPELLEK 226
>gi|88797970|ref|ZP_01113557.1| tRNA (guanine-N(1)-)-methyltransferase [Reinekea sp. MED297] >gi|88779167|gb|EAR10355.1| tRNA (guanine-N(1)-)-methyltransferase [Reinekea sp. MED297] (258 aa)
Score = 474, Expect = 6.0e-46, Identities = 91/219 (41%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++  +++LF   FN F +  +  +A+ N L+ ++  N R+F+ D H  VDD P+GGG GM++ +QP+ DAI+  K ++   SKV+ ++P G+  +QQ A +    E LI +CG YEG DER+I   +D E S+GD++L+GGE+AAM  +D++ RLIP V+    S   +SF + LLD P+YT+P       VPEVLLSG+H  I + R +  + +T + R DL 
  S:    11 LQFGLVTLFPEMFNAFTDYGVSGRAVKNGLISVDCWNPRDFTHDRHRTVDDRPFGGGPGMLMKVQPLRDAIHAAKAASERPSKVIYMSPQGRKLDQQGAGELVRNERLIFVCGRYEGIDERLIETEIDEEWSLGDFVLSGGEMAAMTFMDTLCRLIPGVLGHEQSSVEDSFYDGLLDCPHYTRPEVLEDLTVPEVLLSGHHDNIRRWRAKQALGRTWLRRPDLL 234
>gi|33152925|ref|NP_874278.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus ducreyi 35000HP] >gi|46577375|sp|Q7U331|TRMD_HAEDU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|33149150|gb|AAP96667.1| tRNA (guanine-N1)-methyltransferase [Haemophilus ducreyi 35000HP] (251 aa)
Score = 474, Expect = 6.3e-46, Identities = 97/219 (44%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-------SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +AI  NL+ IE  N R+F+ D H+ VDD PYGGG GM++ +QP+ DAI   K          +KV+ L+P G+  +QQ   +      LILICG YEG DER+I + VD E SIGDY+LTGGE+ AM ++D++ R +P V+    ++LE +SF   LLD P+YT+P   +   VP+VL+SGNH++I K R    + +T + R +L 
  S:     1 MWIGIISLFPEMFKAITDFGVTGRAIKQNLLQIECWNPRDFTFDKHHTVDDRPYGGGPGMLMMVQPLRDAIQVAKQVARSEDGVEAKVIYLSPQGRKLDQQGVRELSANRKLILICGRYEGVDERLIQSEVDEEWSIGDYVLTGGELPAMTLIDAIARFVPGVLGKQASALE-DSFAEGLLDCPHYTRPEVLDNMPVPQVLMSGNHEQIRKWRLAQSLERTWLRRPELL 228
>gi|145631329|ref|ZP_01787101.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 22.4-21] >gi|144983114|gb|EDJ90614.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae R3021] (246 aa)
Score = 474, Expect = 7.3e-46, Identities = 96/219 (43%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N RNF+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+EI K R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRNFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQDGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL 224
>gi|189465637|ref|ZP_03014422.1| hypothetical protein BACINT_01997 [Bacteroides intestinalis DSM 17393] >gi|189437911|gb|EDV06896.1| hypothetical protein BACINT_01997 [Bacteroides intestinalis DSM 17393] (247 aa)
Score = 473, Expect = 8.2e-46, Identities = 93/219 (42%), Positives = 146/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ +NQ +AN     ++LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D+++R+IP VIS   S  S+SF +NLL  P YT+P ++NG+KVPE+LLSG+  +I +   +  + +T+  R DL 
  S:    22 MRIDIITVLPEMIEGFFNCSIMKRAQNKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINALKAEREYDEVIFTTPDGEQFNQPMANTLSLTQNLIILCGHFKGIDYRIREHLITKEISIGDYVLTGGELAAAVMADAIVRIIPGVISDEQSALSDSFQDNLLAAPVYTRPADYNGWKVPEILLSGHEAKIKEWELQQSLERTRRLRPDLL 244
>gi|125973284|ref|YP_001037194.1| tRNA (Guanine37-N1) methyltransferase [Clostridium thermocellum ATCC 27405] >gi|125713509|gb|ABN52001.1| tRNA (Guanine37-N1) methyltransferase [Clostridium thermocellum ATCC 27405] (247 aa)
Score = 473, Expect = 8.5e-46, Identities = 110/221 (49%), Positives = 146/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDA---INHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFD-NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  VL+LF   F+     SII +A  NN++ I  +N R+FS + H KVDD PYGGG GMV+  QPI DA   I    +   +V+ L+P G+  NQQI  +     HLIL+CGHYEG DERII   VD EISIGDY+LTGGE+ AM ++DSV RLIP V+S     S+      LL+YP YT+PY F   KVP+VL+SG+H+ IN+ R++  + +T + R DLF +
  S:     2 MRFDVLTLFPEVFDAVLGESIIGRARKNNIIQINTINIRDFSTNKHRKVDDYPYGGGGGMVMMAQPIYDAYLSIAEKLSYKPRVIYLSPQGRVLNQQIVKELSKENHLILLCGHYEGVDERIIEEIVDDEISIGDYVLTGGELPAMVLIDSVSRLIPGVLSSEESYSQESHYEGLLEYPQYTRPYEFCNRKVPDVLMSGHHENINRWRRQQSLKRTYLKRPDLFAR 227
>gi|87311717|ref|ZP_01093833.1| tRNA (Guanine-N(1))-methyltransferase [Blastopirellula marina DSM 3645] >gi|87285611|gb|EAQ77529.1| tRNA (Guanine-N(1))-methyltransferase [Blastopirellula marina DSM 3645] (235 aa)
Score = 473, Expect = 9.0e-46, Identities = 95/219 (43%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSL---ESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  VL+LF   F+ +   S++ KAI   LV +   + R ++ D HN+VDD P+GGGAGMV+  +P+V+ +  V+   S   ++++LTP G+  +Q +  +      L+L+CG YEGFD+R+ + +   EISIGDY+L GGE+AAMAI+D+VIRLIP V+   +    +S S  N LL++P+YT+P  + G   P+VLLSG+H +I   RK+  I +T   R DL 
  S:     1 MRFDVLTLFPEIFSSYLGQSLLAKAIEGELVKVYPHDMRKWANDKHNRVDDRPFGGGAGMVIRAEPVVECVEAVRQEGSQPGRLIMLTPQGRRLDQPLVEELSLEPRLLLLCGRYEGFDQRVSDLLQPEEISIGDYVLNGGEVAAMAIIDAVIRLIPGVLGDETSSVDDSFSSGNRLLEFPHYTRPRVYRGLAAPDVLLSGDHAQIAAWRKQQSIERTTRRRADLL 226
>gi|91762616|ref|ZP_01264581.1| tRNA (Guanine-N(1)-)-methyltransferase [Candidatus Pelagibacter ubique HTCC1002] >gi|91718418|gb|EAS85068.1| tRNA (Guanine-N(1)-)-methyltransferase [Candidatus Pelagibacter ubique HTCC1002] (228 aa)
Score = 473, Expect = 9.1e-46, Identities = 94/220 (42%), Positives = 148/220 (67%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINK----TKINRKDLFIKYLK 224
           + +L+ +FF    N  +  KA+ N + D+++VNFR  ++D H  VDDTP+GGG+GM+L    +  +++  K    ++  L+P GK  +Q++A +    + + LICGH+EG DER+++  +  E+SIGD+IL+GGE AA  +LDSV+RL+P V+ +  S   ESF+N LL+YP YTKP  +    VPEVLLSG+H +I    K+W++++    T++ R DL+ KY K
  S:     6 IFTLYPDFFPGPLNKGLYGKALTNKIWDLKVVNFREAAEDKHKTVDDTPFGGGSGMLLKADILAKSLDENKKEGERIFYLSPKGKKLDQKLALELSKEKSISLICGHFEGVDERLLSTRNIEELSIGDFILSGGETAAFVVLDSVLRLLPGVLGNEQSKHDESFENGLLEYPQYTKPQIWEEKSVPEVLLSGDHNKI----KDWRLSQSEAITRVRRPDLWEKYKK 227
>gi|148825534|ref|YP_001290287.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittEE] >gi|166200426|sp|A5UAV3|TRMD_HAEIE tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|148715694|gb|ABQ97904.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittEE] (246 aa)
Score = 472, Expect = 1.1e-45, Identities = 96/219 (43%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N RNF+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+EI K R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRNFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL 224
>gi|68248807|ref|YP_247919.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 86-028NP] >gi|81175042|sp|Q4QNY8|TRMD_HAEI8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|68057006|gb|AAX87259.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 86-028NP] (246 aa)
Score = 472, Expect = 1.2e-45, Identities = 96/219 (43%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N RNF+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+EI K R +  + +T   R +L 
  S:     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRNFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQDGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWFRRPELL 224
>gi|160884626|ref|ZP_02065629.1| hypothetical protein BACOVA_02615 [Bacteroides ovatus ATCC 8483] >gi|156110365|gb|EDO12110.1| hypothetical protein BACOVA_02615 [Bacteroides ovatus ATCC 8483] (225 aa)
Score = 471, Expect = 1.5e-45, Identities = 91/219 (41%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ +NQ +AN     ++LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D+++R+IP VIS   S  S+SF +NLL  P YT+P ++ G+KVP++LLSG+  +I +   +  + +T+  R DL 
  S:     1 MRIDIITVLPEMIEGFFNCSIMKRAQDKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINALKAERDYDEVIFTTPDGEQFNQPMANTLSLAQNLIILCGHFKGIDYRIREHLITKEISIGDYVLTGGELAAAVMADAIVRIIPGVISDEQSALSDSFQDNLLAAPVYTRPADYKGWKVPDILLSGHEAKIKEWELQQSLERTRKLRPDLL 223
>gi|71891962|ref|YP_277692.1| tRNA(guanine-N1)methyltransferase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|118575134|sp|Q493M1|TRMD_BLOPB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|71796068|gb|AAZ40819.1| tRNA(guanine-N1)methyltransferase [Candidatus Blochmannia pennsylvanicus str. BPEN] (255 aa)
Score = 471, Expect = 1.5e-45, Identities = 96/219 (43%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEH--LILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF + F       I+ +AI   ++ I++ N R F+ D H+ VD  PYGGG GM++ ++P+ +AIN  K    +N KV+ L+P G+   Q+   +   ++H  LIL+CG Y+G DER+I   +D E SIGDYIL+GGE+AAM ++D++ R++P V+ + +S ES+SF    LD P+YT+P  F+G KVP VLLSGNH EI++ +++  + +T I R DL 
  S:     1 MLLGVITLFPDMFQSIVRYGIVGRAIRRGILSIKLWNPRLFTYDRHHSVDARPYGGGPGMLMMIEPLRNAINQAKDELGNNIKVIYLSPQGRKLKQKYVYKL-AYDHQKLILVCGRYQGIDERLIQTEIDEEWSIGDYILSGGELAAMVLIDTISRVLPGVLGNQDSKESDSFSKERLDCPHYTRPETFDGMKVPSVLLSGNHDEIHRWKQKQALGRTWIKRPDLL 225
>gi|148242826|ref|YP_001227983.1| tRNA-(guanine-N1)-methyltransferase [Synechococcus sp. RCC307] >gi|166200459|sp|A5GUS1|TRMD_SYNR3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|147851136|emb|CAK28630.1| tRNA-(guanine-N1)-methyltransferase [Synechococcus sp. RCC307] (237 aa)
Score = 471, Expect = 1.6e-45, Identities = 91/225 (40%), Positives = 141/225 (62%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-VVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           ++ V+SL    F+  +   +I +A    + ++   N R+++ D + KVDD PYGGGAGMVL  +P+  A   +    S+ V+L+TP GK   Q    ++ T +E L+L+CGHYEGFDERI +  D E+S+GD++LTGGE+ AM I++  +RL P  + + +SL  ES    LL++P+YT+P  F    VP VL SG+H  I + R E Q  +T++ R DL+ ++  E+
  S:     5 RLDVVSLVPEVFDSLRGLGVIGRAFHAGIAELHTHNPRDYATDRYRKVDDEPYGGGAGMVLKPEPVFAAFEAIPVQPSRRVLLMTPQGKPLQQADLRRWATDYEQLVLLCGHYEGFDERIRSLADEEVSLGDFVLTGGELPAMTIINGTVRLRPGTVGTADSLVEESHSAGLLEHPHYTRPATFREMDVPAVLRSGDHGAIARWRAEQQKERTQLRRPDLWAQWQAEH 232
>gi|71082960|ref|YP_265679.1| tRNA (guanine-N(1)-)-methyltransferase [Candidatus Pelagibacter ubique HTCC1062] >gi|81175043|sp|Q4FP13|TRMD_PELUB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|71062073|gb|AAZ21076.1| tRNA (Guanine-N(1)-)-methyltransferase [Candidatus Pelagibacter ubique HTCC1062] (228 aa)
Score = 471, Expect = 1.6e-45, Identities = 94/220 (42%), Positives = 148/220 (67%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINK----TKINRKDLFIKYLK 224
           + +L+ +FF    N  +  KA+ N + D+++VNFR  ++D H  VDDTP+GGG+GM+L    +  +++  K    ++  L+P GK  +Q++A +    + + LICGH+EG DER+++  +  E+SIGD+IL+GGE AA  +LDSV+RL+P V+ +  S   ESF+N LL+YP YTKP  +    VPEVLLSG+H +I    K+W++++    T++ R DL+ KY K
  S:     6 IFTLYPDFFPGPLNKGLYGKALTNKIWDLKVVNFREAAEDKHKTVDDTPFGGGSGMLLKADILAKSLDENKKEGERIFYLSPKGKKLDQKLALELSKEKSISLICGHFEGVDERLLSTRNIEELSIGDFILSGGETAAFVVLDSVLRLLPGVLGNEQSKNDESFENGLLEYPQYTKPQIWEEKSVPEVLLSGDHNKI----KDWRLSQSEAITRVRRPDLWEKYKK 227
>gi|117621055|ref|YP_855210.1| tRNA (guanine-N1)-methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166231332|sp|A0KG25|TRMD_AERHH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|117562462|gb|ABK39410.1| tRNA (guanine-N1)-methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (249 aa)
Score = 470, Expect = 1.7e-45, Identities = 95/218 (43%), Positives = 137/218 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M I V+SLF   F       +  +A+ + L+ IE  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +    +KV+ L+P G+   Q    +  T + LIL+ G YEG DER+I   VD E SIGDY+L+GGE+ AM ++D+V RL+P V+    S E +SF + LLD+P+YT+P   +G  VPE L SGNH+ I + R +  + +T   R +L
  S:     1 MWIGVISLFPEMFRAITEHGVTGRAVKSGLLQIECWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKQAAGDGAKVIYLSPQGRKLTQAGVTELATNQKLILVAGRYEGIDERVIQTEVDEEWSIGDYVLSGGELPAMTLIDAVSRLVPGVLGDQASAEQDSFTDGLLDHPHYTRPELLDGLAVPEALTSGNHEVIRRWRLKQSLGRTWQRRPEL 223
>gi|187251150|ref|YP_001875632.1| tRNA (guanine-N1)-methyltransferase [Elusimicrobium minutum Pei191] >gi|186971310|gb|ACC98295.1| tRNA (guanine-N1)-methyltransferase [Elusimicrobium minutum Pei191] (237 aa)
Score = 470, Expect = 1.7e-45, Identities = 92/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSL-ESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +KI V++ F +  +     SI  +A    ++++   N R+F KD H  +DD  YGGGAGM++  +P+  AI  ++   S V+  +P GK +NQ +A +    +HLI +CGHYEG D RI    D E+S+GD+ILTGGE AA+ ++D++ RL+P V   + + E ESF+NNLL+ P YT+P  +   +VP VLLSGNHKEI   +++  +  TK  R DL 
  S:     3 IKIDVVTPFPDIVDGPLGQSIPGRARKEKILNLGFCNPRDFVKDKHKSIDDRVYGGGAGMLMKAEPLYQAIKKLRKKGSVVIYTSPRGKVFNQTLAKKLSLKKHLIFVCGHYEGVDARIYPEFDLEVSLGDFILTGGESAAVVMIDAITRLLPGVFKKSGVTELESFENNLLEPPQYTRPEVWRRKRVPAVLLSGNHKEIETWKQKEAVKITKKFRPDLL 222
>gi|24372937|ref|NP_716979.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella oneidensis MR-1] >gi|38258581|sp|Q8CX44|TRMD_SHEON tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|24347073|gb|AAN54424.1|AE015579_13 tRNA (guanine-N1)-methyltransferase [Shewanella oneidensis MR-1] (248 aa)
Score = 470, Expect = 1.8e-45, Identities = 93/219 (42%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L+++   N R+F+ D H+ VDD PYGGG GM++ +QP+ DAI+  +     ++KV+ L+P G+  +QQ   +      LIL+CG YEG DERII   VD E S+GDY+L+GGE+ AM ++D+V RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH++I   R +  + +T + R +L 
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHSTVDDRPYGGGPGMLMMVQPLRDAIHAARAAAGEDAKVIYLSPQGRKLDQQGVTELAKSSRLILVCGRYEGIDERIIQTEVDEEWSVGDYVLSGGELPAMTMIDAVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGLDVPAVLLSGNHEQIRLWRLQQSLGRTLLRRPELL 224
>gi|28493425|ref|NP_787586.1| tRNA (guanine-N1-)-methyltransferase [Tropheryma whipplei str. Twist] >gi|46577425|sp|Q820Y0|TRMD_TROWT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|28476466|gb|AAO44555.1| tRNA (guanine-N1-)-methyltransferase [Tropheryma whipplei str. Twist] (234 aa)
Score = 470, Expect = 1.8e-45, Identities = 96/225 (42%), Positives = 141/225 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-----ISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+   +S+F  +F+   + S+I KA  N L+D+ + N R +S+    +VD +PYGGG GMV++ +P   AI H+ T  S VV  +PSG+ Y+  +A    +  H++  CG YEG D RI  +         ISIGDY+L GGEIAA+AIL+  +R IP V+ +  SL  ES+  NLL+YP YTKP  + G +VP++LLSGNH  I + R + Q+  T+  R DL+  ++ E
  S:     4 MRCDFVSIFPEYFDVL-DISLIGKARRNGLLDLRVHNLREYSEAG--RVDSSPYGGGPGMVMSAEPWARAIEHIATGESLVVFPSPSGQPYSHDLAQSLSSEMHIVFCCGRYEGIDNRIYEWTATRLRSSGISIGDYVLNGGEIAALAILEGFVRFIPGVLGNPESLVEESYQYNLLEYPVYTKPAVWRGLEVPDILLSGNHDLIREWRYKKQLEITQKTRPDLYSTHIYE 231
>gi|29346303|ref|NP_809806.1| tRNA (guanine-N(1)-)-methyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|46577465|sp|Q8A9C2|TRMD_BACTN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|29338198|gb|AAO76000.1| tRNA (Guanine-N(1)-methyltransferase [Bacteroides thetaiotaomicron VPI-5482] (225 aa)
Score = 470, Expect = 1.8e-45, Identities = 92/219 (42%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ +NQ +AN     ++LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D+++R+IP VIS   S  S+SF +NLL  P YT+P ++ G+KVP++LLSG+  +I +   +  + +TK  R DL 
  S:     1 MRIDIITVLPEMIEGFFNCSIMKRAQNKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINALKAERDYDEVIFTTPDGEQFNQPMANSLSLAQNLIILCGHFKGIDYRIREHLITKEISIGDYVLTGGELAAAVMADAIVRIIPGVISDEQSALSDSFQDNLLAAPVYTRPADYKGWKVPDILLSGHEAKIKEWELQQSLERTKKLRPDLL 223
>gi|66044532|ref|YP_234373.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas syringae pv. syringae B728a] >gi|71735324|ref|YP_273614.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|81175045|sp|Q4ZWY7|TRMD_PSEU2 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119370984|sp|Q48LV8|TRMD_PSE14 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|63255239|gb|AAY36335.1| tRNA (guanine-N1-)-methyltransferase [Pseudomonas syringae pv. syringae B728a] >gi|71555877|gb|AAZ35088.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] (250 aa)
Score = 470, Expect = 1.8e-45, Identities = 91/219 (41%), Positives = 139/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++I V+SLF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+  NQ    +    E +ILI G YEG DER I+ +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRIEVISLFPEMFSAISEYGITSRAVKQGLLQLTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVQARQAAGDAAKVIYLSPQGRQLNQSAVRELAQEEAIILIAGRYEGIDERFIDAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRLQQSLGRTYERRADLL 227
>gi|189461357|ref|ZP_03010142.1| hypothetical protein BACCOP_02012 [Bacteroides coprocola DSM 17136] >gi|189431886|gb|EDV00871.1| hypothetical protein BACCOP_02012 [Bacteroides coprocola DSM 17136] (226 aa)
Score = 470, Expect = 1.9e-45, Identities = 93/219 (42%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+ +A    + +I I N R+++ D + KVDD P+GG AGMV+ ++PI   I+ +K      +V+  TP G+ +NQ++AN     E+LI++CGH++G D RI  +++  EISIGDY+LTGGE+AA  I D+++R+IP VIS   S  S+SF +NLL  P YT+P  +NG+KVP+VLLSG+  +I +   +  + +T+  R DL 
  S:     1 MRIDIITVLPEMIEGFFNCSIMSRAQKKGIAEIHIHNLRDYAYDRYRKVDDYPFGGCAGMVMKIEPIDRCISALKAERHYDEVIFTTPDGEQFNQKMANTLSMSENLIILCGHFKGIDYRIREHFITKEISIGDYVLTGGELAAAVISDAIVRIIPGVISDEQSALSDSFQDNLLAPPVYTRPAEYNGWKVPDVLLSGHEAKIREWEFQQSLERTQRLRPDLL 223
>gi|126173450|ref|YP_001049599.1| tRNA (guanine-N1)-methyltransferase [Shewanella baltica OS155] >gi|149117256|ref|ZP_01843955.1| tRNA (guanine-N1)-methyltransferase [Shewanella baltica OS223] >gi|152999789|ref|YP_001365470.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella baltica OS185] >gi|166200445|sp|A3D1W7|TRMD_SHEB5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166200446|sp|A6WKR8|TRMD_SHEB8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|125996655|gb|ABN60730.1| tRNA (Guanine37-N(1)-) methyltransferase [Shewanella baltica OS155] >gi|146862667|gb|EDK48307.1| tRNA (guanine-N1)-methyltransferase [Shewanella baltica OS223] >gi|151364407|gb|ABS07407.1| tRNA (guanine-N1)-methyltransferase [Shewanella baltica OS185] (248 aa)
Score = 470, Expect = 1.9e-45, Identities = 95/219 (43%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L+++   N R+F+ D HN VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +QQ   +      LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH++I   R +  + +T + R +L 
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHNTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQQGVTELAQSSRLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGVDVPAVLLSGNHEQIRLWRLQQSLGRTLLRRPELL 224
>gi|70728478|ref|YP_258227.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas fluorescens Pf-5] >gi|81175044|sp|Q4KHQ6|TRMD_PSEF5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|68342777|gb|AAY90383.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas fluorescens Pf-5] (250 aa)
Score = 470, Expect = 1.9e-45, Identities = 90/219 (41%), Positives = 139/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +++ V+SLF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+  NQ    +    + LILI G YEG DER I+ +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRVEVISLFPEMFSAISEYGITSRAVKQGLLQLTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVQARNAAGEGAKVIYLSPQGRQLNQSAVRELANEDALILIAGRYEGIDERFIDAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRLQQSLGRTYERRADLL 227
>gi|160874408|ref|YP_001553724.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella baltica OS195] >gi|189036098|sp|A9L5P7|TRMD_SHEB9 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|160859930|gb|ABX48464.1| tRNA (guanine-N1)-methyltransferase [Shewanella baltica OS195] (248 aa)
Score = 470, Expect = 1.9e-45, Identities = 95/219 (43%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L+++   N R+F+ D HN VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +QQ   +      LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH++I   R +  + +T + R +L 
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHNTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQQGVTELAQSSRLILVCGRYEGIDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGVDVPAVLLSGNHEQIRLWRLQQSLGRTLLRRPELL 224
>gi|67156466|ref|ZP_00418059.1| tRNA (guanine-N1-)-methyltransferase [Azotobacter vinelandii AvOP] >gi|67086225|gb|EAM05695.1| tRNA (guanine-N1-)-methyltransferase [Azotobacter vinelandii AvOP] (247 aa)
Score = 470, Expect = 2.0e-45, Identities = 93/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAI---NHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M++ V+S+F   F   ++  I  +A+   L+ +   N R+F++D H  VDD P+GGG GMV+ +QP+  A+          +KV+ L+P G+   QQ   +    E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +   +S E +SF + LLD P+YT+P  + G +VPEVLLSGNH+ I + R +  + +T   R DL 
  S:     1 MQVEVISIFPEMFAAIRDFGITSRAVKQGLLRLNCWNPRSFTEDRHQTVDDRPFGGGPGMVMKIQPLERALVAARAAIGGRAKVIYLSPQGRRLKQQAVRELAREEALILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHADSAEEDSFTDGLLDCPHYTRPEVYEGKRVPEVLLSGNHEHIRRWRLQQSLGRTWERRADLL 224
>gi|139439745|ref|ZP_01773136.1| Hypothetical protein COLAER_02167 [Collinsella aerofaciens ATCC 25986] >gi|133774895|gb|EBA38715.1| Hypothetical protein COLAER_02167 [Collinsella aerofaciens ATCC 25986] (252 aa)
Score = 469, Expect = 2.3e-45, Identities = 92/218 (42%), Positives = 133/218 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-----SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M I  LS+F   F    +TSI+ +A    L D +  N R+++ D H  VDD PYGGG GM++ ++PI +AI  + +   K  VV  TP G+ + Q +A +    E L+ +C  YEG DER   Y D  +SIGDY+LTGGE+ AM + D+V+RLIP  +     +V+   S + D  LL+Y  YT+P  FNG  VP VL+SG+H +++  R++  I +T   R DL
  S:     1 MLIETLSVFPEMFEPVMSTSILGRARKAGLFDFKAYNLRDWTHDRHRTVDDEPYGGGQGMLMKVEPIAEAIEAISSEGPKPTVVFFTPCGEPFTQHVAERLLKSERLLFVCSRYEGVDERAYAYADERLSIGDYVLTGGELPAMVVADAVVRLIPGALGDEMSNVDESFSTAEDGGLLEYAQYTRPAEFNGEGVPPVLVSGDHAKVDAWRRKNAIERTCRWRPDL 225
>gi|170725617|ref|YP_001759643.1| tRNA (guanine-N1)-methyltransferase [Shewanella woodyi ATCC 51908] >gi|169810964|gb|ACA85548.1| tRNA (guanine-N1)-methyltransferase [Shewanella woodyi ATCC 51908] (248 aa)
Score = 469, Expect = 2.3e-45, Identities = 95/219 (43%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+   L++++  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K     ++KV+ L+P G+   QQ   +    + LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P   +G  VP VLLSGNH+ I + R +  + +T + R +L 
  S:     1 MWLGVVTLFPEMFRAVTDFGVTGRAVNKGLLELQTWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGDSAKVIYLSPQGRKLTQQGVEELAKSDSLILVCGRYEGVDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPETLDGLDVPAVLLSGNHEHIRRWRLQQSLGRTLLRRPELL 224
>gi|194681772|emb|CAR40985.1| tRNA (guanine-N1)-methyltransferase; trna (guanine-n(1)-)-methyltransferase (ec 2.1.1.31) (m1g-methyltransferase) (trna [gm37] methyltransferase) [Proteus mirabilis HI4320] (250 aa)
Score = 469, Expect = 2.3e-45, Identities = 92/219 (42%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINH---VKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ + L+++E  + R+F+ D H+ VDD PYGGG GM++ +QP+ +AI+         +KV+ L+P G+  +QQ   +  T E LIL+CG YEG DER+I   +D E S+GDY+L+GGE+ AM ++D+V R +P V+    S + +SF   LLD+P+YT+P   +G  VP VLLSGNH  IN+ R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITEYGVTGRAVKHGLLNVECWDPRDFTYDRHHTVDDRPYGGGPGMLMMVQPLREAIHQAKAAAGDGAKVIYLSPQGRKLDQQGVCELATNEKLILVCGRYEGIDERVIQTEIDEEWSVGDYVLSGGELPAMIMIDAVARFVPGVLGHAASAKEDSFAEGLLDHPHYTRPEVLDGMAVPAVLLSGNHAHINRWRMKQSLGRTWLRRPELL 224
>gi|160871788|ref|ZP_02061920.1| tRNA (guanine-N1)-methyltransferase [Rickettsiella grylli] >gi|159120587|gb|EDP45925.1| tRNA (guanine-N1)-methyltransferase [Rickettsiella grylli] (248 aa)
Score = 469, Expect = 2.5e-45, Identities = 100/223 (44%), Positives = 134/223 (60%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M I ++SLF   F    N SI  +A    L+ +  +N R+F++D HN VDD PYGGG GMV+  +P+  AI   KT   +      V  L+P GKT NQ I  +      LILI G YEG D R+IN  VD E SIGD+IL+GGE+AAM ++D++ RL P  +    S   +SF + LLDYP+YT+P +     VP VLL GNH  I + R +  + +T   R DL  KY+
  S:     1 MDIQIISLFPEMFTPL-NVSIPGRAQKKGLITLSFLNPRDFAQDKHNTVDDRPYGGGPGMVMKFEPLHAAIKMAKTRQKRLHIPPLVSYLSPQGKTLNQSIIQKLSRRRGLILIAGRYEGIDHRLINTDVDEEWSIGDFILSGGELAAMCLIDAITRLQPGALGDEKSASQDSFHSALLDYPHYTRPASLEEKNVPAVLLQGNHTAIARWRLKHALGRTWQQRPDLLKKYI 230
>gi|145297738|ref|YP_001140579.1| tRNA (guanine-N1)-methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] >gi|166231333|sp|A4SIV9|TRMD_AERS4 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|142850510|gb|ABO88831.1| tRNA (guanine-N1)-methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] (249 aa)
Score = 469, Expect = 2.6e-45, Identities = 95/218 (43%), Positives = 136/218 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M I V+SLF   F       +  +A+ + L+ IE  N R F+ D H  VDD PYGGG GM++ +QP+ DAI+  K +    +KV+ L+P G+   Q    +  T + LIL+ G YEG DER+I   VD E SIGDY+L+GGE+ AM ++D+V RL+P V+    S E +SF + LLD+P+YT+P   +G  VPE L SGNH+ I + R +  + +T   R +L
  S:     1 MWIGVISLFPEMFRAITEHGVTGRAVKSGLLQIECWNPREFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKQAAGDGAKVIYLSPQGRKLTQAGVTELATNQKLILVAGRYEGIDERVIQTEVDEEWSIGDYVLSGGELPAMTLIDAVSRLVPGVLGDQASAEQDSFTDGLLDHPHYTRPELLDGLAVPEALTSGNHEVIRRWRLKQSLGRTWQRRPEL 223
>gi|145628509|ref|ZP_01784309.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 22.1-21] >gi|145639739|ref|ZP_01795341.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittII] >gi|144978979|gb|EDJ88665.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 22.1-21] >gi|145271107|gb|EDK11022.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittII] (246 aa)
Score = 468, Expect = 3.0e-45, Identities = 95/219 (43%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+EI K R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLHVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQDGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEKDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL 224
>gi|167763097|ref|ZP_02435224.1| hypothetical protein BACSTE_01464 [Bacteroides stercoris ATCC 43183] >gi|167699437|gb|EDS16016.1| hypothetical protein BACSTE_01464 [Bacteroides stercoris ATCC 43183] (253 aa)
Score = 468, Expect = 3.0e-45, Identities = 92/219 (42%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ +NQ +AN     ++LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D+++R+IP VIS   S  S+SF +NLL  P YT+P ++ G+KVPE+LLSG+  +I +   +  + +T+  R DL 
  S:    29 MRIDIITVLPEMIEGFFNCSIMKRAQNKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINALKAEREYDEVIFTTPDGEQFNQPMANTLSLAKNLIILCGHFKGIDYRIREHLITKEISIGDYVLTGGELAAAVMADAIVRIIPGVISDEQSALSDSFQDNLLAAPVYTRPADYKGWKVPEILLSGHEAKIKEWELQQSLERTRKLRPDLL 251
>gi|156741317|ref|YP_001431446.1| tRNA (guanine-N1)-methyltransferase [Roseiflexus castenholzii DSM 13941] >gi|156232645|gb|ABU57428.1| tRNA (guanine-N1)-methyltransferase [Roseiflexus castenholzii DSM 13941] (298 aa)
Score = 468, Expect = 3.0e-45, Identities = 91/199 (45%), Positives = 130/199 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSK--------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEI 199
           M+  VL+LF   F    + SI+K+AI    + + + + R ++ D H   DD PYGGGAGMV+  +P+   I  V   T N          V+L+TP G+ + Q+IA +  T   L+L+CG YEG DER+    +D E+SIGDY+LTGGE+AAM ++D+V RL+P VI   S   ESF + LL+YP YT+P  + G +VP VL+SG+H E+
  S:    18 MRFDVLTLFPGMFTGPLSESILKRAIQAGRISVVLHDIRAYATDRHRTTDDAPYGGGAGMVMKPEPLAACIRAVLAMTDNDTGESAPKPPVILMTPDGEPFTQRIAAELATCPRLVLVCGRYEGVDERVRAALIDRELSIGDYVLTGGELAAMVVIDAVARLVPGVIDAESAAEESFSDGLLEYPQYTRPAVWEGREVPPVLVSGHHGEV 227
>gi|89900197|ref|YP_522668.1| tRNA (guanine-N1)-methyltransferase [Rhodoferax ferrireducens T118] >gi|118575152|sp|Q21YL6|TRMD_RHOFD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|89344934|gb|ABD69137.1| tRNA (Guanine37-N(1)-) methyltransferase [Rhodoferax ferrireducens T118] (248 aa)
Score = 468, Expect = 3.1e-45, Identities = 90/218 (41%), Positives = 150/218 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFD---NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+  +++LF   F  F  + I ++A  + LVD+++ N R+F+  ++ +VDD P+GGG GMV+  +P+   +  +++  ++   V+L +P+G+T N  +  ++   +  ILICG YEG D+R I+ YV  +IS+GD++L+GGEIAAMA+LD+V RL P V+ + +S + +SF+   + LLD P+YT+P N+ G  VPEVLLSG+H +I + R+E ++  T   R +L
  S:     1 MRFDIVTLFPELFAPFLTSGITRRAFESGLVDVQLANPRDFAAGNYRRVDDRPFGGGPGMVMMAEPLAQCLKSIQSQRTEIAPVLLFSPAGQTLNHAMVQRWSDSQGAILICGRYEGLDQRFIDAYVTEQISLGDFVLSGGEIAAMALLDAVARLQPGVLNAADSHQQDSFNPVLDGLLDCPHYTRPENWLGRPVPEVLLSGHHVQIERWRREQRLALTLRLRPEL 226
>gi|28868682|ref|NP_791301.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas syringae pv. tomato str. DC3000] >gi|38258473|sp|Q886V0|TRMD_PSESM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|28851921|gb|AAO54996.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas syringae pv. tomato str. DC3000] (250 aa)
Score = 468, Expect = 3.4e-45, Identities = 91/219 (41%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           ++I V+SLF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+  NQ    +    E +ILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRIEVISLFPEMFSAISEYGITSRAVKQGLLQLTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVQARQAAGDAAKVIYLSPQGRQLNQAAVRELAQEEAIILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRLQQSLGRTYERRADLL 227
>gi|16272165|ref|NP_438371.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae Rd KW20] >gi|46128945|ref|ZP_00154679.2| COG0336: tRNA-(guanine-N1)-methyltransferase [Haemophilus influenzae R2846] >gi|145635638|ref|ZP_01791335.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittAA] >gi|145637366|ref|ZP_01793026.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittHH] >gi|148827340|ref|YP_001292093.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittGG] >gi|166200427|sp|A5UG04|TRMD_HAEIG tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|1174776|sp|P43912|TRMD_HAEIN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|1573162|gb|AAC21871.1| tRNA (guanine-N1)-methyltransferase (trmD) [Haemophilus influenzae Rd KW20] >gi|145267111|gb|EDK07118.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittAA] >gi|145269458|gb|EDK09401.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittHH] >gi|148718582|gb|ABQ99709.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae PittGG] (246 aa)
Score = 467, Expect = 4.0e-45, Identities = 95/219 (43%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+EI K R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL 224
>gi|33358175|pdb|1UAJ|A Chain A, Crystal Structure Of Trna(M1g37)methyltransferase: Insight Into Trna Recognition >gi|33358176|pdb|1UAK|A Chain A, Crystal Structure Of Trna(M1g37)methyltransferase: Insight Into Trna Recognition >gi|33358177|pdb|1UAL|A Chain A, Crystal Structure Of Trna(M1g37)methyltransferase: Insight Into Trna Recognition >gi|33358178|pdb|1UAM|A Chain A, Crystal Structure Of Trna(M1g37)methyltransferase: Insight Into Trna Recognition (274 aa)
Score = 467, Expect = 4.1e-45, Identities = 95/219 (43%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+EI K R +  + +T + R +L 
  S:    21 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL 244
>gi|89891850|ref|ZP_01203351.1| tRNA-(guanine-N1)-methyltransferase [Flavobacteria bacterium BBFL7] >gi|89515755|gb|EAS18556.1| tRNA-(guanine-N1)-methyltransferase [Flavobacteria bacterium BBFL7] (226 aa)
Score = 467, Expect = 4.3e-45, Identities = 92/219 (42%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++ + + R +  + +N+VDD  YGGGAGMV+ ++P+   I  +K      +++ +TP G+T NQ IAN     E+L++ICGHY+G D+R+ + ++  EISIGDY+L+GGE+ A  + DS+IRLIP VIS   S  ++SF + LL  P YT+P  + G+KVP++LLSGN   I++ R++  I +TK  R DL 
  S:     1 MRIDIITVLPELIKSPFEASILKRAIEKGLVEVHMHDLRKYGLNKYNQVDDYQYGGGAGMVMMIEPLDKIITDLKKERQYDEIIYMTPDGETLNQGIANHISLKENLMIICGHYKGIDQRVRDMFITKEISIGDYVLSGGELGAAVLCDSIIRLIPGVISDETSALTDSFQDGLLAPPVYTRPAEYKGHKVPDILLSGNLPAIDQWREDQAIQRTKDRRPDLL 223
>gi|53713693|ref|YP_099685.1| tRNA (guanine-N(1)-)-methyltransferase [Bacteroides fragilis YCH46] >gi|60681964|ref|YP_212108.1| tRNA (guanine-N(1)-)-methyltransferase [Bacteroides fragilis NCTC 9343] >gi|81175039|sp|Q5LCI1|TRMD_BACFN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|84029196|sp|Q64TM8|TRMD_BACFR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|52216558|dbj|BAD49151.1| tRNA (Guanine-N(1)-)-methyltransferase [Bacteroides fragilis YCH46] >gi|60493398|emb|CAH08184.1| putative tRNA (guanine-N(1)-)-methyltransferase [Bacteroides fragilis NCTC 9343] (225 aa)
Score = 467, Expect = 4.7e-45, Identities = 91/219 (41%), Positives = 144/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++       F N SI+K+A    L +I I N R++++D + +VDD P+GG AGMV+ ++PI   IN +K      +V+  TP G+ ++Q++AN      +LI++CGH++G D RI  + +  EISIGDY+LTGGE+AA  + D+++R+IP VIS   S  S+SF +NLL  P YT+P  + G+KVPE+LLSG+  +I +   +  + +T+  R DL 
  S:     1 MRIDIITVLPEMIEGFFNCSIMKRAQDKGLAEIHIHNLRDYTEDKYRRVDDYPFGGFAGMVMKIEPIERCINTLKAERDYDEVIFTTPDGEQFDQKMANSLSLSGNLIILCGHFKGIDYRIREHLITKEISIGDYVLTGGELAAAVMADAIVRIIPGVISDEQSALSDSFQDNLLAAPVYTRPAEYKGWKVPEILLSGHEAKIKEWELQQSLERTRRLRPDLL 223
>gi|163839831|ref|YP_001624236.1| tRNA (guanine-N1)-methyltransferase [Renibacterium salmoninarum ATCC 33209] >gi|189036094|sp|A9WP47|TRMD_RENSM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|162953307|gb|ABY22822.1| tRNA (guanine-N1)-methyltransferase [Renibacterium salmoninarum ATCC 33209] (263 aa)
Score = 466, Expect = 4.8e-45, Identities = 93/221 (42%), Positives = 145/221 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPS--GKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-----ISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M++ V+S+F ++    +  S+I KA  + L+++ + + R F+ D H  VDDTPYGGGAGMV+  +P   A+  V    + SK VL+ PS  G+ +NQ+IA +     HL+  CG YEG DER++++         +S+GDY+L GGE+A MA++++  RL+P V+ + +SL  ES  + LL+YP YTKP  + G  +P VLLSGNH +I + R++ Q+ +T   R DL  +
  S:     1 MRLDVISIFPDYLAPLE-LSLIGKARQDGLLELNVHDLRAFTTDRHRTVDDTPYGGGAGMVMKPEPWALALASVVEPAAKSKPVLIVPSPAGEVFNQRIAEELAAESHLVFACGRYEGIDERVVDWARESFTVRPMSLGDYVLNGGEVAVMAMVEATARLLPGVVGNPDSLLEESHQDGLLEYPVYTKPSAWRGVDIPAVLLSGNHAKIARFRRDEQLRRTAQRRPDLLTQ 230
>gi|119478676|ref|ZP_01618566.1| tRNA (guanine-N(1)-)-methyltransferase [marine gamma proteobacterium HTCC2143] >gi|119448402|gb|EAW29654.1| tRNA (guanine-N(1)-)-methyltransferase [marine gamma proteobacterium HTCC2143] (247 aa)
Score = 466, Expect = 4.8e-45, Identities = 90/218 (41%), Positives = 143/218 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+I V++LF +      +  I  +A+  +LV I+ +N R+F++D H  VDD PYGGG GMV+ ++P+  AI+  +     ++KV+ L+P G+  +Q    +  + E +ILI G YEG DER+I+  VD E SIGDY+L+GGE+AAM ++D+V+R +P  +    S   +SF   LLD P++T+P  + G  VP+VLLSG+H+ I + R +  + +T + R+DL
  S:     1 MQIDVITLFPDMLAAVTDHGITGRAVRQDLVTIDCLNPRDFTEDKHRTVDDRPYGGGPGMVMKIEPLRKAIDAARAKSGGSAKVIYLSPQGRQLDQAGVEELSSRERIILIAGRYEGIDERLIDSEVDEEWSIGDYVLSGGELAAMVMIDAVVRQLPGALGHEQSAREDSFAEGLLDCPHFTRPEIYQGRPVPDVLLSGDHENIRRWRLKQALGRTWLRRRDL 223
>gi|15834916|ref|NP_296675.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydia muridarum Nigg] >gi|26400845|sp|Q9PL12|TRMD_CHLMU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|7190337|gb|AAF39162.1| tRNA (guanine-N1)-methyltransferase [Chlamydia muridarum Nigg] (352 aa)
Score = 466, Expect = 5.3e-45, Identities = 93/223 (41%), Positives = 139/223 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDER-IINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           M+I +LSLF ++F      +I+ +AI    + I   + R F      +VDD PY G  GM+L  +P+V AI  VK   SKVV L+P G+  + + + +     HLIL+CGHYEG DER + + VD EISIGDY+LT G  AA+ ++D++ R IP V+ +  S E +S +N LL+ P+YT+P  F G +VPE+L  G+H+ I   RK+  + +T+  R DL+++Y 
  S:     1 MEIDILSLFPDYFTSPLQATILGRAIKQGALSIRSRDIREFGLGKWKQVDDAPYSG-EGMLLMAEPVVQAIRSVKREKSKVVYLSPQGQLLSAKKSRELSLCPHLILLCGHYEGIDERALASEVDEEISIGDYVLTNGCAAALVLVDALARFIPGVLGNQESAECDSLENGLLEGPHYTRPRVFEGVQVPEILFCGDHQRIANWRKKVSLERTRERRPDLYLQYF 224
>gi|119946970|ref|YP_944650.1| tRNA (guanine-N1)-methyltransferase [Psychromonas ingrahamii 37] >gi|166200440|sp|A1SZY6|TRMD_PSYIN tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119865574|gb|ABM05051.1| tRNA (Guanine37-N(1)-) methyltransferase [Psychromonas ingrahamii 37] (248 aa)
Score = 466, Expect = 5.8e-45, Identities = 95/219 (43%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS------NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF + F    +  +  +A+ N L+ I+  N R+F+ D H  VDD PYGGG GM++ ++P+ DAI   K +       +KV+ L+P GK  +   A      + LIL+ G YEG DER+I + VD E S+GDY+L+GGE+ AM ++D+V+R +P V+  V S E +SF + LLD P+YT+P   +G +VP VLLSG+H++I   R +  + +TK  R DL 
  S:     1 MWIGVVSLFPDMFRAISDNGVTGRAVKNKLLSIQCWNPRDFTLDKHRTVDDRPYGGGPGMLMMVKPLRDAILAAKKAAREAGHEAKVIYLSPQGKRLDHCGAQLLSGSDALILVAGRYEGVDERLIESLVDEEWSVGDYVLSGGELPAMILIDAVVRFVPGVLGHVLSAEQDSFADGLLDCPHYTRPEVLDGKQVPSVLLSGDHEKIRLWRSKQALQRTKQRRPDLL 227
>gi|28572463|ref|NP_789243.1| tRNA (guanine-N1)-methyltransferase [Tropheryma whipplei TW08/27] >gi|46577426|sp|Q820Z0|TRMD_TROW8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|28410595|emb|CAD66981.1| tRNA (guanine-N1)-methyltransferase [Tropheryma whipplei TW08/27] (234 aa)
Score = 466, Expect = 6.0e-45, Identities = 95/225 (42%), Positives = 140/225 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-----ISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M+   +S+F  +F+   + S+I KA  N L+D+ + N R +S+    +VD +PYGGG GMV++ +P   AI H+ T  S VV  +PSG+ Y+  +A    +  H++  CG YEG D RI  +         ISIGDY+L GGEIAA+ IL+  +R IP V+ +  SL  ES+  NLL+YP YTKP  + G +VP++LLSGNH  I + R + Q+  T+  R DL+  ++ E
  S:     4 MRCDFVSIFPEYFDVL-DISLIGKARRNGLLDLRVHNLREYSEAG--RVDSSPYGGGPGMVMSAEPWARAIEHIATGESLVVFPSPSGQPYSHDLAQSLSSEMHIVFCCGRYEGIDNRIYEWTATRLRSSGISIGDYVLNGGEIAALVILEGFVRFIPGVLGNPESLVEESYQYNLLEYPVYTKPAVWRGLEVPDILLSGNHDLIREWRYKKQLEITQKTRPDLYSTHIYE 231
>gi|78185075|ref|YP_377510.1| tRNA (guanine-N1-)-methyltransferase [Synechococcus sp. CC9902] >gi|78169369|gb|ABB26466.1| tRNA (Guanine37-N(1)-) methyltransferase [Synechococcus sp. CC9902] (401 aa)
Score = 465, Expect = 6.4e-45, Identities = 89/224 (39%), Positives = 141/224 (62%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           ++ V++L    F       +I +A +  + ++ + N R F+ D H KVDD PYGGGAGMVL  +P+  A+  V +   S+V+L++P G+   Q    ++ + F+ L+ +CGHYEGFDERI    D E+SIGD++LTGGE+ AM +++ V+RL+P  +   +SL  ES    LL++P+YT+P +F G  VP VL SG+H  I   R++ +  +T+  R DL+ ++  E
  S:     5 RLDVVTLAPQAFAPLLELGVIGRAFSAGIAEMHLHNPREFATDRHRKVDDVPYGGGAGMVLKPEPVFAAMESVPRCPRSRVLLMSPQGRPLQQSDLQRWSREFDQLVFLCGHYEGFDERIRGLADEEVSIGDFVLTGGELPAMTVINGVVRLLPGTVGAPDSLVEESHSTVLLEHPHYTRPADFRGMTVPAVLRSGDHGAIANWRQQQRELRTQERRPDLWTRWQTE 231
>gi|33861836|ref|NP_893397.1| putative bifuntional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33640204|emb|CAE19739.1| putative bifuntional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (407 aa)
Score = 465, Expect = 6.7e-45, Identities = 91/214 (42%), Positives = 143/214 (66%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           V++LF   F    N  +I +A+  NL+++ + + R + + ++ +VDD PYGGG+GMVL  +PI  A + + K  NSK +L+TP GK   QQ   ++ + + LI+ICG YEGFDER+    D E+SIGDY+L+GGEI +++I++ + RL+P  +    SL  ES +++LL+YP+YT+P  F   +VP++L+SGNH+EI   RK+  + +T   R DL
  S:     8 VITLFPKAFELINNLGVITRALEKNLINVNLHDLREYGEGNYRQVDDKPYGGGSGMVLKPEPIYKAHDSIDKLPNSKTLLMTPQGKVLKQQDLLRWSSLDQLIIICGQYEGFDERVRCLADEEVSIGDYVLSGGEIPSISIINGLTRLLPGTLGDPGSLIDESHNSSLLEYPHYTRPLIFREMRVPDILVSGNHEEIKLWRKQKMLERTLDRRNDL 223
>gi|33519646|ref|NP_878478.1| tRNA(guanine-N1)methyltransferase [Candidatus Blochmannia floridanus] >gi|46577377|sp|Q7U345|TRMD_BLOFL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|33517309|emb|CAD83694.1| tRNA(guanine-N1)methyltransferase [Candidatus Blochmannia floridanus] (248 aa)
Score = 465, Expect = 6.9e-45, Identities = 94/221 (42%), Positives = 148/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQ-IANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M + +++LF + FN      ++ +++    + I+I N R+F+ D ++KVDD PYGGG GM++ +QP+  AIN  K     ++KV+ L+P GK   Q+ + +     + LIL+CG Y+G DER+I   +D E SIGDY+L+GGE+A+M ++D++ R++P  + + NS +S+SF  N LD P YT+P  + G +VP VLLSGNH++INK R ++ +  T I R DL  K
  S:     1 MLLGIITLFPDMFNAITRYGVVGRSVRKGGLVIKIWNPRDFTYDQYHKVDDRPYGGGVGMIMMIQPLKRAINQAKNDLGCDAKVIYLSPQGKRLCQKYVYDLAYNNQALILVCGRYQGIDERLIKMEIDEEWSIGDYVLSGGELASMVLIDAMARVLPGTLKNRNSQKSDSFFENKLDCPYYTRPKIYEGMQVPSVLLSGNHRDINKWRLKYALGNTWIKRPDLLKK 227
>gi|113971171|ref|YP_734964.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella sp. MR-4] >gi|114048409|ref|YP_738959.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella sp. MR-7] >gi|117921454|ref|YP_870646.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella sp. ANA-3] >gi|123130193|sp|Q0HGB0|TRMD_SHESM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|123131182|sp|Q0HSK3|TRMD_SHESR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166200449|sp|A0KZM1|TRMD_SHESA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|113885855|gb|ABI39907.1| tRNA (guanine-N1)-methyltransferase [Shewanella sp. MR-4] >gi|113889851|gb|ABI43902.1| tRNA (guanine-N1)-methyltransferase [Shewanella sp. MR-7] >gi|117613786|gb|ABK49240.1| tRNA (guanine-N1)-methyltransferase [Shewanella sp. ANA-3] (248 aa)
Score = 465, Expect = 6.9e-45, Identities = 93/219 (42%), Positives = 139/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L+++   N R+F+ D H+ VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +QQ   +      LIL+CG YEG DERII   VD E S+GDY+L+GGE+ AM ++D+V RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH++I   R +  + +T + R +LF
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHSTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEEAKVIYLSPQGRKLDQQGVTELAESSRLILVCGRYEGIDERIIQTEVDEEWSVGDYVLSGGELPAMTLIDAVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGLDVPAVLLSGNHEQIRLWRLQQSLGRTFLRRPELF 224
>gi|120599791|ref|YP_964365.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella sp. W3-18-1] >gi|146292273|ref|YP_001182697.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella putrefaciens CN-32] >gi|166200448|sp|A4Y4L5|TRMD_SHEPC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166200450|sp|A1RMB6|TRMD_SHESW tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|120559884|gb|ABM25811.1| tRNA (guanine-N1)-methyltransferase [Shewanella sp. W3-18-1] >gi|145563963|gb|ABP74898.1| tRNA (guanine-N1)-methyltransferase [Shewanella putrefaciens CN-32] (248 aa)
Score = 465, Expect = 7.0e-45, Identities = 93/219 (42%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L+++   N R+F+ D HN VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +QQ   +      LIL+CG YEG DERII   VD E S+GDY+L+GGE+ AM ++D+V RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH++I   R +  + +T + R +L 
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHNTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEEAKVIYLSPQGRKLDQQGVTELAKSSRLILVCGRYEGIDERIIQTEVDEEWSVGDYVLSGGELPAMTMIDAVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGLDVPAVLLSGNHEQIRLWRLQQSLGRTLLRRPELL 224
>gi|78484994|ref|YP_390919.1| tRNA (guanine-N1)-methyltransferase [Thiomicrospira crunogena XCL-2] >gi|119371011|sp|Q31HX8|TRMD_THICR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|78363280|gb|ABB41245.1| tRNA (Guanine37-N(1)-) methyltransferase [Thiomicrospira crunogena XCL-2] (237 aa)
Score = 465, Expect = 7.1e-45, Identities = 91/226 (40%), Positives = 138/226 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPI---VDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+  V++LF   F+    + + ++A  + L   +  N R ++ D H  VDD PYGGG GM++   P+   VDAI         VV L+P G+   QQ  ++ ++  ++ L+CG YEG DER I   VD EI +GD+I++GGE+ AM ++D +IRLIP  +  N S E +SF + LLD P+YT+P   +G  VPEVL  G+H +I + R E ++ +TK  R DL+  YL ++
  S:     1 MRFDVITLFPEMFSALTESGVSRRAYQDQLYQFKTWNPRTYTTDRHKTVDDRPYGGGPGMLMMYPPLKKTVDAITDEVGEKPYVVYLSPQGRPLTQQKLSELQSHSNVTLVCGRYEGIDERFIETVVDEEICVGDFIVSGGELPAMMLMDGMIRLIPGALGHNQSAEQDSFSDGLLDCPHYTRPVEVDGMGVPEVLQEGHHAKIEQWRHEQKLLRTKQKRPDLYTAYLAKH 231
>gi|15676495|ref|NP_273634.1| tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis MC58] >gi|26400844|sp|Q9K0K4|TRMD_NEIMB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|7225820|gb|AAF41018.1| tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis MC58] (249 aa)
Score = 465, Expect = 7.1e-45, Identities = 94/221 (42%), Positives = 135/221 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +++F   F+      +  +A    +   E VN R F+ +    +DD P+GGG GM++   P+  AI H KT +S   KV+ L+P GK    Q A +     HLIL+CG YEG DER++ + VD EISIGD++++GGE+ AM ++D+V+RL+P V+  + S E +SF + +LD P+YTKP  F G  VPEVL SGNH  I + R E  + +T   R DL  K
  S:     1 MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKTQSSQAAKVIYLSPQGKPLTHQKAVELAELPHLILLCGRYEGIDERLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGVLGDMQSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPDLLEK 226
>gi|88658005|ref|YP_506838.1| tRNA (guanine-N1)-methyltransferase [Ehrlichia chaffeensis str. Arkansas] >gi|119382740|sp|Q2GI95|TRMD_EHRCR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|88599462|gb|ABD44931.1| tRNA (guanine-N1)-methyltransferase [Ehrlichia chaffeensis str. Arkansas] (235 aa)
Score = 465, Expect = 7.6e-45, Identities = 94/216 (43%), Positives = 144/216 (66%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNL-LDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           + VL++F   F    + SII +A+   L ++ +++ R+F+KD H  VDD PYGGG GM++    I  AI+ V  K  N+K++ ++PSG   NQ I+ Q   F ++ ++CG +EG D+RI+++ D+ EISIGDYIL+GGE+A M ++++ +RLIP V+S   S+  ESF  +  L+YP YT+P  + G +VP+VLLSGNHK+IN  +       TK  R +L
  S:     5 VNVLTIFPEMFPGTLSHSIIGRALNKGLWNLNVIDIRSFAKDKHKTVDDRPYGGGPGMIMKADVIGSAIDEVLSKNKNTKLIYMSPSGIKLNQDISGQLTHFSNITILCGRFEGIDKRILDFYDFHEISIGDYILSGGEVACMVLIETCVRLIPGVVSNTQSIRDESFTLDYKLEYPQYTRPAKWRGLEVPDVLLSGNHKKINLWKANQSYCITKQRRPEL 225
>gi|116072351|ref|ZP_01469618.1| tRNA (guanine-N1-)-methyltransferase [Synechococcus sp. BL107] >gi|116064873|gb|EAU70632.1| tRNA (guanine-N1-)-methyltransferase [Synechococcus sp. BL107] (402 aa)
Score = 465, Expect = 7.6e-45, Identities = 89/224 (39%), Positives = 141/224 (62%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV-KTSNSKVVLLTPSGKTYNQ-QIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           ++ V++L    F    +  +I +A +  + ++ + N R F+ D H KVDD PYGGGAGMVL  +P+  A+  V +   S+V+L++P G+   Q  +    + F+ L+ +CGHYEGFDERI    D E+SIGD++LTGGE+ AM +++ V+RL+P  +   +SL  ES    LL++P+YT+P +F G  VP VL SG+H  I   R++ +  +T+  R DL+ ++  E
  S:     6 RLDVVTLAPQAFAPLLDLGVIGRAFSAGIAEMHLHNPREFATDRHRKVDDEPYGGGAGMVLKPEPVFAAMESVPRCPRSRVLLMSPQGRPLQQCDLQRWSREFDQLVFLCGHYEGFDERIRGLADEEVSIGDFVLTGGELPAMTVINGVVRLLPGTVGAPDSLVEESHSTVLLEHPHYTRPADFKGMTVPAVLRSGDHGAIANWRQQQRELRTQERRPDLWTRWQTE 232
>gi|76788739|ref|YP_327825.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydia trachomatis A/HAR-13] >gi|119382729|sp|Q3KMZ5|TRMD_CHLTA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|76167269|gb|AAX50277.1| tRNA (guanine-N(1)-)-methyltransferase [Chlamydia trachomatis A/HAR-13] (352 aa)
Score = 465, Expect = 7.7e-45, Identities = 91/226 (40%), Positives = 141/226 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+I +LSLF ++F      +I+ +AI    + +   + R F      +VDD+PY G  GM+L  +P+V AI  ++   SKV+ L+P G+  + + + +  +  HL+L+CGHYEG DER +   VD EISIGDY+LT G  AA+ ++D++ R IP V+ +  S E +S +N LL+ P YT+P  F G  VPEVLL G+H++I   RK+  + +T+  R DL+++Y   N
  S:     1 MEIDILSLFPDYFASPLQATILGRAIKQGALSVRSRDIREFGLGKWKQVDDSPYNG-EGMLLMAEPVVQAIRSIRRKKSKVIYLSPQGQLLSAKKSRELASCSHLVLLCGHYEGIDERALTAEVDEEISIGDYVLTNGCAAALVLVDALARFIPGVLGNQESAEYDSLENGLLEGPQYTRPRVFEGESVPEVLLCGDHQKIADWRKQVSLERTRERRPDLYLQYFYGN 227
>gi|15604745|ref|NP_219529.1| fused tRNA (guanine-N(1)-)-methyltransferase/uncharacterized domain-containing protein [Chlamydia trachomatis D/UW-3/CX] >gi|26400738|sp|O84030|TRMD_CHLTR tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|3328417|gb|AAC67617.1| tRNA (guanine N-1) Methyltransferase [Chlamydia trachomatis D/UW-3/CX] (352 aa)
Score = 465, Expect = 7.7e-45, Identities = 91/226 (40%), Positives = 141/226 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+I +LSLF ++F      +I+ +AI    + +   + R F      +VDD+PY G  GM+L  +P+V AI  ++   SKV+ L+P G+  + + + +  +  HL+L+CGHYEG DER +   VD EISIGDY+LT G  AA+ ++D++ R IP V+ +  S E +S +N LL+ P YT+P  F G  VPEVLL G+H++I   RK+  + +T+  R DL+++Y   N
  S:     1 MEIDILSLFPDYFASPLQATILGRAIKQGALSVRSRDIREFGLGKWKQVDDSPYNG-EGMLLMAEPVVQAIRSIRRKKSKVIYLSPQGQLLSAKKSRELASCSHLVLLCGHYEGIDERALTAEVDEEISIGDYVLTNGCAAALVLVDALARFIPGVLGNQESAEYDSLENGLLEGPQYTRPRVFEGESVPEVLLCGDHQKIADWRKQVSLERTRERRPDLYLQYFYGN 227
>gi|62422968|ref|ZP_00378143.1| COG0336: tRNA-(guanine-N1)-methyltransferase [Brevibacterium linens BL2] (264 aa)
Score = 464, Expect = 9.3e-45, Identities = 95/219 (43%), Positives = 146/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--------KTSNSKVVLLTPS--GKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-----ISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI V+S+F  +    +  S+I KA+   L+D+ + + R+F+ D HN VDD+PYGGGAGMV+  +P   A+ ++          +  K +L+ PS  G  +NQ+IA +    EHL+  CG YEG D+R+I++         +SIGDY+L GGE+A+M ++++V RL+P VI +  SL  ES ++ LL+YP YTKP ++ G  VP++LLSGNH  I + R++ ++  T   R DL 
  S:     5 MKIDVVSIFPEYLAGLQ-LSLIGKAVDQGLLDLTVHDLRDFTFDRHNTVDDSPYGGGAGMVMKAEPWALALENILDEPKAAGAGTPQKPILIVPSPAGPVFNQRIAEELSEAEHLVFACGRYEGIDQRVIDWSAEHFDLRPMSIGDYVLNGGEVASMVMIEAVSRLVPGVIGNPESLTEESHEDGLLEYPIYTKPASWRGRDVPDILLSGNHGAIARWRRDRRLELTAEVRPDLL 238
>gi|154493682|ref|ZP_02033002.1| hypothetical protein PARMER_03023 [Parabacteroides merdae ATCC 43184] >gi|154086892|gb|EDN85937.1| hypothetical protein PARMER_03023 [Parabacteroides merdae ATCC 43184] (225 aa)
Score = 464, Expect = 9.6e-45, Identities = 90/212 (42%), Positives = 142/212 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTK 212
           M+I +L++         N SI+K+A    L +I + N R+++ +   +VDD P+GG AGMV+ ++PI  AI+ +K+     +V+  +P G+T+NQ +AN      +LI++CGHY+G D RI  + +  EIS+GDY+LTGGE+AA  I D+V+RLIP  I    S  S+SF +NLL  P YT+P ++NG+KVP+VLLSG+ ++I    +EW++ + +
  S:     2 MRIDILTVLPEMIEGMVNCSIVKRAQDKGLAEIHLHNLRDYTTNKWRRVDDYPFGGEAGMVMQIEPIDRAISALKSERDYDEVIYTSPDGETFNQPMANSMSMLNNLIILCGHYKGIDYRIREHLITKEISVGDYVLTGGELAAAIITDAVVRLIPGAIGDEQSALSDSFQDNLLAPPVYTRPADYNGWKVPDVLLSGHQRKI----EEWRLGQAQ 213
>gi|123966674|ref|YP_001011755.1| putative bifunctional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. MIT 9515] >gi|123201040|gb|ABM72648.1| putative bifunctional enzyme: tRNA methyltransferase; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Prochlorococcus marinus str. MIT 9515] (407 aa)
Score = 464, Expect = 9.9e-45, Identities = 93/218 (42%), Positives = 138/218 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           +   V++LF   F    N  +I +A+   L+ + + + R + + S+ +VDD PYGGG+GMVL   PI  A + +K   N K +L++P GK   QQ   ++ T + LI+ICG YEGFDER+    D E+SIGDY+L+GGEI AM I++ + RL+P  +    SL  ES +++LL+YP+YT+P  F   KVP++L+SGNH+EI   RK+    +T   R DL
  S:     4 LNFEVITLFPKAFELINNLGVITRALEKKLIKVNLHDLREYGEGSYRQVDDKPYGGGSGMVLKPGPIFKAHDSIKKLPNIKTLLMSPQGKVLKQQDLLRWSTLDQLIIICGQYEGFDERVRCLADEEVSIGDYVLSGGEIPAMTIINGLTRLLPGTLGDPRSLIDESHNSSLLEYPHYTRPLIFREMKVPDILVSGNHEEIELWRKQKMFERTLERRNDL 223
>gi|94270958|ref|ZP_01291859.1| tRNA (guanine-N(1)-)-methyltransferase [delta proteobacterium MLMS-1] >gi|93450602|gb|EAT01723.1| tRNA (guanine-N(1)-)-methyltransferase [delta proteobacterium MLMS-1] (429 aa)
Score = 464, Expect = 1.0e-44, Identities = 95/219 (43%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-----------TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNL---LDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  +L++F +FF       +I++AI      +   N R+F+ D H   DD P+GGG GMV+  +P+  A+ H +            S  +VVLLTP GK  +QQ+A +    + LIL+CG YEG DER    YVD EISIGDY+L+GGE AA+ +LD +IRL+P V+   +S  +++F       L YP YT+P  F G +VPEVLL G+H  I   R++    +T+  R DL 
  S:     1 MRFDILTIFPDFFTSPLAEGMIRRAIEGGAATVWAHNIRDFATDKHAMTDDRPFGGGEGMVMKPEPLAAAVRHARRLGMDDPVNQEVSGGQVVLLTPQGKKLDQQLAGELLAQQQLILVCGRYEGVDERFCQQYVDREISIGDYVLSGGEPAALVLLDCLIRLLPGVLGCGDSALNDTFSAGSRGGLKYPQYTRPRVFEGCEVPEVLLGGDHAAIQHWRQQAAEERTRARRPDLL 235
>gi|94266069|ref|ZP_01289787.1| tRNA (guanine-N(1)-)-methyltransferase [delta proteobacterium MLMS-1] >gi|93453352|gb|EAT03783.1| tRNA (guanine-N(1)-)-methyltransferase [delta proteobacterium MLMS-1] (436 aa)
Score = 464, Expect = 1.0e-44, Identities = 95/219 (43%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-----------TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNL---LDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  +L++F +FF       +I++AI      +   N R+F+ D H   DD P+GGG GMV+  +P+  A+ H +            S  +VVLLTP GK  +QQ+A +    + LIL+CG YEG DER    YVD EISIGDY+L+GGE AA+ +LD +IRL+P V+   +S  +++F       L YP YT+P  F G +VPEVLL G+H  I   R++    +T+  R DL 
  S:     1 MRFDILTIFPDFFTSPLAEGMIRRAIEGGAATVWAHNIRDFATDKHAMTDDRPFGGGEGMVMKPEPLAAAVRHARRLGMDDPVNQEVSGGQVVLLTPQGKKLDQQLAGELLAQQQLILVCGRYEGVDERFCQQYVDREISIGDYVLSGGEPAALVLLDCLIRLLPGVLGCGDSALNDTFSAGSRGGLKYPQYTRPRVFEGCEVPEVLLGGDHAAIQHWRQQAAEERTRARRPDLL 235
>gi|104783231|ref|YP_609729.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas entomophila L48] >gi|122402144|sp|Q1I5Z0|TRMD_PSEE4 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|95112218|emb|CAK16945.1| tRNA (guanine-1-)-methyltransferase. [Pseudomonas entomophila L48] (250 aa)
Score = 463, Expect = 1.1e-44, Identities = 90/219 (41%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +++ V++LF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+   QQ        E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRVEVVTLFPEMFSAITEYGITSRAVKQGLLQVTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALASARQATGAAAKVIYLSPQGRKLTQQAVKGLAEQESLILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRMKQSLGRTFERRADLL 227
>gi|87301106|ref|ZP_01083947.1| putative bifuntional enzyme: tRNA methyltransferase;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Synechococcus sp. WH 5701] >gi|87284074|gb|EAQ76027.1| putative bifuntional enzyme: tRNA methyltransferase;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Synechococcus sp. WH 5701] (398 aa)
Score = 463, Expect = 1.1e-44, Identities = 92/225 (40%), Positives = 140/225 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQFKT-FEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           M++ V+SL    F    +  +I +A    + ++   N R+ + D + KVDD PYGGGAGMVL  +P+  A   +      +V+LL+P G+   Q    ++ T  + L+L+CGHYEGFDERI    D E+S+GD++LTGGE+AAM +++ V+RL+P  + S  SL  ES    LL++P+YT+P  F G  VP+VL SG+H  I + R E Q  +TK  R DL+ ++ ++
  S:     1 MRLDVVSLAPESFAPLTSLGVIGRAFNAGIAELHTHNPRDHASDRYRKVDDQPYGGGAGMVLKPEPLFAAFESIPVLERRRVLLLSPQGQPLRQADLQRWATDHDQLVLLCGHYEGFDERIRTLADEEVSLGDFVLTGGELAAMVLINGVVRLLPGTVGSAESLLEESHSALLLEHPHYTRPAEFRGLAVPQVLRSGDHGAIARWRAEQQQERTKRRRPDLYRRWQEQ 228
>gi|166154248|ref|YP_001654366.1| tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein [Chlamydia trachomatis 434/Bu] >gi|166155123|ref|YP_001653378.1| tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930236|emb|CAP03721.1| tRNA (guanine-N(1)-)-methyltransferase [Chlamydia trachomatis 434/Bu] >gi|165931111|emb|CAP06675.1| tRNA (guanine-N(1)-)-methyltransferase [Chlamydia trachomatis L2b/UCH-1/proctitis] (352 aa)
Score = 463, Expect = 1.1e-44, Identities = 90/226 (39%), Positives = 141/226 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+I +LSLF ++F      +I+ +AI    + +   + R F      +VDD+PY G  GM+L  +P+V AI  ++   SKV+ L+P G+  + + + +  +  HL+L+CGHYEG DER +   VD EISIGDY+LT G  AA+ ++D++ R IP ++ +  S E +S +N LL+ P YT+P  F G  VPEVLL G+H++I   RK+  + +T+  R DL+++Y   N
  S:     1 MEIDILSLFPDYFASPLQATILGRAIKQGALSVRSRDIREFGLGKWKQVDDSPYNG-EGMLLMAEPVVQAIRSIRRKKSKVIYLSPQGQLLSAKKSRELASCSHLVLLCGHYEGIDERALTAEVDEEISIGDYVLTNGCAAALVLVDALARFIPGILGNQESAEYDSLENGLLEGPQYTRPRVFEGESVPEVLLCGDHQKIADWRKQVSLERTRERRPDLYLQYFYGN 227
>gi|170723316|ref|YP_001751004.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas putida W619] >gi|169761319|gb|ACA74635.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas putida W619] (250 aa)
Score = 463, Expect = 1.1e-44, Identities = 90/219 (41%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAI---NHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +++ V++LF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+        +++KV+ L+P G+   QQ        E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRVDVITLFPEMFSAITEYGITSRAVKQGLLQVTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVSARQATGASAKVIYLSPQGRKLTQQAVKGLAEQESLILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRMKQSLGRTFERRADLL 227
>gi|146308418|ref|YP_001188883.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas mendocina ymp] >gi|145576619|gb|ABP86151.1| tRNA (Guanine37-N(1)-) methyltransferase [Pseudomonas mendocina ymp] (247 aa)
Score = 463, Expect = 1.1e-44, Identities = 90/219 (41%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M++ V++LF   F       I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+  NQ    +    + LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +   +S E +SF + LLD P+YT+P  +   +VPEVLLSGNH+ I + R +  + +T   R DL 
  S:     1 MRVEVITLFPEMFAAIGEYGITSRAVKQELLKLNCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALASARQAAGETAKVIYLSPQGRRLNQAAVRELAQEDALILIAGRYEGIDERFIETHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHADSAEEDSFTDGLLDCPHYTRPEVYADKRVPEVLLSGNHEHIRRWRLQQSLGRTWERRADLL 224
>gi|160943018|ref|ZP_02090256.1| hypothetical protein FAEPRAM212_00495 [Faecalibacterium prausnitzii M21/2] >gi|158445712|gb|EDP22715.1| hypothetical protein FAEPRAM212_00495 [Faecalibacterium prausnitzii M21/2] (415 aa)
Score = 463, Expect = 1.2e-44, Identities = 89/222 (40%), Positives = 141/222 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK-------VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNS-LESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKY 222
           M++ +++LF     +  + SII +A     ++      R+++ +   + DD PYGGG GMVL  QPI D +  V+   ++       +V LT  G+ Y ++ A +   +++L L+CGHYEG DER+I  + D EISIGDYILTGGE+A++ + DSV+RL P V++     E ES+ + LL+YP YT+P  + G  VPEVLL G+H +I+  R E    +T++ R +L+ ++
  S:     3 MRVDIVTLFPEMCQQVLDASIIGRAAKRGYIETHCHQIRDYTLNKQKQTDDYPYGGGCGMVLYAQPIADCLRAVQHEVAEQGRPAPHIVFLTAGGQRYTEEHAKRLAEYDNLTLVCGHYEGIDERVIEAFADEEISIGDYILTGGELASLVVADSVLRLKPGVLAEQKGYEEESYWDGLLEYPQYTRPEVWEGRAVPEVLLGGDHAKIDAWRGEQSRTRTRLRRPELYEQW 233
>gi|149377070|ref|ZP_01894820.1| tRNA (guanine-N(1)-)-methyltransferase [Marinobacter algicola DG893] >gi|149358606|gb|EDM47078.1| tRNA (guanine-N(1)-)-methyltransferase [Marinobacter algicola DG893] (252 aa)
Score = 463, Expect = 1.2e-44, Identities = 93/221 (42%), Positives = 138/221 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +SLF   +    +  I  +A+ + L+     N R F+ D H  VDD PYGGG GM++ +QP+ DAI+  + S    + VV L+P G+  NQ +       + LIL+ G YEG DER+I+  VD E+S+GD++L+GGE+AAMA++D+V RLIP  +    S E +SF + LLD P+YT+P  + G  VP+VLL G+H +I + R +  + +T+  R DL  K
  S:     1 MWIGAVSLFPEMYAAVTDYGITGRAVRDGLLTFTAWNPREFTHDRHRTVDDRPYGGGPGMLMKIQPLRDAIHAARESAPGRACVVYLSPQGEPMNQGVVESLAAEDSLILVAGRYEGVDERLISAEVDREVSLGDFVLSGGELAAMAVIDAVTRLIPRALGHAQSAEQDSFADGLLDCPHYTRPEVYEGQAVPDVLLGGHHDQIRRWRLKQSLRRTRERRPDLLEK 226
>gi|58337563|ref|YP_194148.1| tRNA methyltransferase [Lactobacillus acidophilus NCFM] >gi|84029217|sp|Q5FJK7|TRMD_LACAC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|58254880|gb|AAV43117.1| tRNA methyltransferase [Lactobacillus acidophilus NCFM] (242 aa)
Score = 462, Expect = 1.4e-44, Identities = 84/186 (45%), Positives = 132/186 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYK 186
           MKI +L+LF + F   +  S++ + + +   D+ +VNFR+F+ D H+ VDDTPYGGGAGMVL + PI  A++ +  S  K+++  P GKT+N+++A ++   + L  ICGHYEGFD+R+ +  D  +SIGDY+LTGGE+  M+++D+ +RL+P ++  S +S+E ESF + LL+YP YT+P +F G K
  S:     1 MKINILTLFPDMFTPLQ-VSMLGRGLEDGKWDLNLVNFRDFTTDLHHHVDDTPYGGGAGMVLQIMPIKKALDSLP-STGKIIITAPQGKTFNEKMAQEWAKEDELTFICGHYEGFDQRVYDLADETVSIGDYVLTGGELPTMSMVDATVRLLPGILGNSASSVE-ESFSHGLLEYPQYTRPADFEGKK 185
>gi|26988197|ref|NP_743622.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas putida KT2440] >gi|38258496|sp|Q88MV4|TRMD_PSEPK tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|24982934|gb|AAN67086.1|AE016337_9 tRNA (guanine-N1)-methyltransferase [Pseudomonas putida KT2440] (250 aa)
Score = 462, Expect = 1.4e-44, Identities = 90/219 (41%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +++ V++LF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+   QQ        E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRVDVITLFPEMFSAITEYGITSRAVKQGLLQVTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVSARQATGAAAKVIYLSPQGRKLTQQAVKGLAEQESLILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRMKQSLGRTFERRADLL 227
>gi|59800628|ref|YP_207340.1| putative tRNA (guanine-N1)-methyltransferase [Neisseria gonorrhoeae FA 1090] >gi|194097806|ref|YP_002000849.1| putative tRNA (guanine-N1)-methyltransferase [Neisseria gonorrhoeae NCCP11945] >gi|66774171|sp|Q5FA59|TRMD_NEIG1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|59717523|gb|AAW88928.1| putative tRNA (guanine-N1)-methyltransferase [Neisseria gonorrhoeae FA 1090] >gi|193933096|gb|ACF28920.1| putative tRNA (guanine-N1)-methyltransferase [Neisseria gonorrhoeae NCCP11945] (249 aa)
Score = 462, Expect = 1.4e-44, Identities = 92/221 (41%), Positives = 134/221 (60%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +++F   F+      +  +A    +   E VN R F+ +    +DD P+GGG GM++   P+  AI H K  +S   KV+ L+P GK    Q A +     HLIL+CG YEG DER++ + VD EISIGD++++GGE+ AM ++D+V+RL+P ++  + S E +SF + +LD P+YTKP  F G  VPEVL SGNH  I + R E  + +T   R DL  K
  S:     1 MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQTAKVIYLSPQGKPLTHQKAAELAELTHLILLCGRYEGIDERLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGILGDIQSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPDLLEK 226
>gi|94676487|ref|YP_588653.1| tRNA (guanine-N1)-methyltransferase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|118575133|sp|Q1LTR1|TRMD_BAUCH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|94219637|gb|ABF13796.1| tRNA (guanine-N1)-methyltransferase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (252 aa)
Score = 462, Expect = 1.7e-44, Identities = 97/219 (44%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAI----NHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++S+F + F    +  +  +A+   L+ +   N R FS + H  VDD PYGGG GM+L +QP+ DAI    NH +T   KV+ L+P G+  +QQ   +    + LILICG Y+G DER+I   +D E SIGDY+L+GGE+AAM ++DS+ RLIP  +S  S   E SF   LLD P+YT+P    G KVP VLLSG+H  I + R +  + +T + R +L 
  S:     1 MWIGLISIFPDMFRAVMDYGVTGRAVKKGLLQVHCWNPRAFSHNRHQTVDDRPYGGGPGMLLMMQPLRDAIHEAKNHTETG-VKVIYLSPQGRKLDQQGVYELAANKKLILICGRYKGIDERLITTEIDEEWSIGDYVLSGGELAAMILIDSMTRLIPGALSHESSAVEDSFAQGLLDCPHYTRPEVLYGIKVPPVLLSGHHANIRRWRLKQSLGRTWLRRPELL 224
>gi|73667544|ref|YP_303560.1| tRNA (Guanine37-N1) methyltransferase [Ehrlichia canis str. Jake] >gi|119382739|sp|Q3YQP3|TRMD_EHRCJ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|72394685|gb|AAZ68962.1| tRNA (Guanine37-N1) methyltransferase [Ehrlichia canis str. Jake] (235 aa)
Score = 461, Expect = 1.9e-44, Identities = 92/218 (42%), Positives = 146/218 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHV--KTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFD-NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           + + VL++F   F    + S+I +A+   + ++ +++ R+F+KD H  VDD PYGGG GM++    I  AI+ V  K  N+K++ ++PSG   NQ I+ Q   F ++ ++CG +EG D+RI+++ D+ EISIGDYIL+GGE+A M ++++ +RLIP V+ +  S+  ESF  NN L+YP YT+P  + G +VP++LLSGNHK+IN  +       TK  R +L
  S:     3 LNVNVLTIFPEMFPGPLSYSVIGRALNKGIWNLNVIDIRSFAKDKHKTVDDKPYGGGPGMIMKADVIGSAIDEVLSKNKNTKLIYMSPSGVKLNQDISGQLTHFSNITVLCGRFEGIDKRILDFYDFHEISIGDYILSGGEVACMVLIEACVRLIPGVVNNTQSICDESFTLNNQLEYPQYTRPAKWRGLEVPDILLSGNHKKINLWKANQSYCITKQRRPEL 225
>gi|161869522|ref|YP_001598689.1| tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis 053442] >gi|189036090|sp|A9M2D1|TRMD_NEIM0 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|161595075|gb|ABX72735.1| tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis 053442] (249 aa)
Score = 461, Expect = 2.1e-44, Identities = 93/221 (42%), Positives = 133/221 (60%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +++F   F+      +  +A    +   E VN R F+ +    +DD P+GGG GM++   P+  AI H K  +S   KV+ L+P GK    Q A +     HLIL+CG YEG DER++   VD EISIGD++++GGE+ AM ++D+V+RL+P V+  + S E +SF + +LD P+YTKP  F G  VPEVL SGNH  I + R E  + +T   R DL  K
  S:     1 MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQTAKVIYLSPQGKPLTHQKAAELAELPHLILLCGRYEGIDERLLQTSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGVLGDMQSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPDLLEK 226
>gi|88606964|ref|YP_505786.1| tRNA (guanine-N1)-methyltransferase [Anaplasma phagocytophilum HZ] >gi|119382718|sp|Q2GIL5|TRMD_ANAPZ tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|88598027|gb|ABD43497.1| tRNA (guanine-N1)-methyltransferase [Anaplasma phagocytophilum HZ] (232 aa)
Score = 461, Expect = 2.2e-44, Identities = 92/226 (40%), Positives = 142/226 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M   VL++F   F      S +  A+   L  + + + R F+ + HN VDDTPYGGG GM+L    +   I+ V +   N+K++  +P G ++ Q IA Q   F+++ L+CG +EG DER++++    E+SIGDY+L+GGE+AAM I+D+ +R++P VI +  SL+ ES + + L+YP YT+P ++ G +VPEVLL+GNH EI K R+   ++ T   R DL      EN
  S:     1 MIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFANNKHNTVDDTPYGGGPGMLLRADVLGRCIDEVLSLHPNTKLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFYKLQEVSIGDYVLSGGELAAMVIIDTCVRMVPGVIGNAESLKQESMEGS-LEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASLSITAARRPDLLKDRYGEN 229
>gi|91794103|ref|YP_563754.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella denitrificans OS217] >gi|123165877|sp|Q12KJ5|TRMD_SHEDO tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|91716105|gb|ABE56031.1| tRNA (guanine-N1)-methyltransferase [Shewanella denitrificans OS217] (248 aa)
Score = 461, Expect = 2.2e-44, Identities = 94/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A+ N L+++   N R+F+ D H+ VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q    +    + LIL+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF   LLD P+YT+P   +G  VP VLLSG+H++I   R +  I +T + R +LF
  S:     1 MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHSTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGDGAKVIYLSPQGRKLDQHGVTELAKSDSLILVCGRYEGVDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVARLVPGVLGKQASAEQDSFSEGLLDCPHYTRPEQLDGMDVPAVLLSGDHEKIRLWRLQQSIGRTFLRRPELF 224
>gi|88860523|ref|ZP_01135161.1| tRNA (guanine-7-)-methyltransferase [Pseudoalteromonas tunicata D2] >gi|88817721|gb|EAR27538.1| tRNA (guanine-7-)-methyltransferase [Pseudoalteromonas tunicata D2] (255 aa)
Score = 461, Expect = 2.2e-44, Identities = 93/217 (42%), Positives = 141/217 (64%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT---SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           + V+SLF   F+      +  +A+ + L+D    N R+++ D H  VDD PYGGG GM++ ++P+  AI   K     ++ V+ ++P G+  +QQ A +  T + LI++ G YEG DERII + +D E SIGD+I++GGE+ AM ++D+V RLIP V+  N S E +SF + LLD P+YT+P   +G +VP VLLSGNH+EI K R +  + +T + R DL 
  S:     9 VGVISLFPEMFDAITKQGVTGRAMKHGLIDFNCWNPRDYALDKHRTVDDRPYGGGPGMLMMVEPLQKAIAQAKAAAGDDATVIYMSPQGRKLDQQGAAELATHKKLIIVAGRYEGIDERIIESCIDQEWSIGDFIMSGGELPAMTLIDTVARLIPGVLGHNQSAEQDSFSDGLLDCPHYTRPEILDGKQVPAVLLSGNHQEIAKWRLKQSLGRTWLRRPDLL 230
>gi|54296433|ref|YP_122802.1| hypothetical protein lpp0464 [Legionella pneumophila str. Paris] >gi|84029218|sp|Q5X7Z1|TRMD_LEGPA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|53750218|emb|CAH11612.1| hypothetical protein [Legionella pneumophila str. Paris] (250 aa)
Score = 460, Expect = 2.4e-44, Identities = 95/201 (47%), Positives = 134/201 (66%)
  Q:    21 IIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQ----QIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +  +AI   LV I+  N R++S   + +VDD PYGGG GMV+  +P+  AI H ++    N K + L+P GK   Q    QIA Q ++   L+ + G YEG DERIIN+ +D E S+GD++L+GGE+AAM  +D++IRLIP  +  + S E +SF N LLD P+YT+P   NG  VP+VLL GNHKEI + R++  + KT + R DL  K
  S:    22 VTGRAIEQGLVKIDCWNPRDWSSRPYKQVDDKPYGGGPGMVMMYEPLHAAIKHARSEMKENCKTIYLSPQGKVVRQNDLKQIAIQKQS---LLFVAGRYEGIDERIINHHIDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLGHLGSAEQDSFMNGLLDCPHYTRPATINGLDVPDVLLGGNHKEIERWRRKQSLGKTWLKRPDLLEK 228
>gi|121634385|ref|YP_974630.1| tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis FAM18] >gi|166200436|sp|A1KSJ9|TRMD_NEIMF tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|120866091|emb|CAM09829.1| putative tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis FAM18] (249 aa)
Score = 460, Expect = 2.7e-44, Identities = 93/221 (42%), Positives = 134/221 (60%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +++F   F+      +  +A    +   E VN R F+ +    +DD P+GGG GM++   P+  AI H K  +S   KV+ L+P GK    Q A +     HLIL+CG YEG DER++ + VD EISIGD++++GGE+ AM ++D+V+RL+P V+  + S E +SF + +LD P+YTKP  F G  VPEVL SGNH  I + R E  + +T   R DL  K
  S:     1 MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQAAKVIYLSPQGKPLTHQKAVELAELPHLILLCGRYEGIDERLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGVLGDMQSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPDLLEK 226
>gi|148549463|ref|YP_001269565.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas putida F1] >gi|166200438|sp|A5W8C1|TRMD_PSEP1 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|148513521|gb|ABQ80381.1| tRNA (Guanine37-N(1)-) methyltransferase [Pseudomonas putida F1] (250 aa)
Score = 460, Expect = 2.8e-44, Identities = 90/219 (41%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +++ V++LF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+   QQ        E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     4 LRVDVITLFPEMFSAITEYGITSRAVKQGLLQVICWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVSARQATGAAAKVIYLSPQGRKLTQQAVKGLAEQESLILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRMKQSLGRTFERRADLL 227
>gi|148360986|ref|YP_001252193.1| tRNA (guanine N1) methyltransferase [Legionella pneumophila str. Corby] >gi|148282759|gb|ABQ56847.1| tRNA (guanine N1) methyltransferase [Legionella pneumophila str. Corby] (250 aa)
Score = 460, Expect = 2.8e-44, Identities = 95/201 (47%), Positives = 133/201 (66%)
  Q:    21 IIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQ----QIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +  +AI   LV I+  N R++S   + +VDD PYGGG GMV+  +P+  AI H  +    N K + L+P GK   Q    QIA Q ++   L+ + G YEG DERIIN+ +D E S+GD++L+GGE+AAM  +D++IRLIP  +  + S E +SF N LLD P+YT+P   NG  VP+VLL GNHKEI + R++  + KT + R DL  K
  S:    22 VTGRAIEQGLVKIDCWNPRDWSSRPYKQVDDKPYGGGPGMVMMYEPLHAAIKHAHSEMKENCKTIYLSPQGKVVRQNDLKQIATQKQS---LLFVAGRYEGIDERIINHHIDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLGHLGSAEQDSFMNGLLDCPHYTRPATINGLGVPDVLLGGNHKEIERWRRKQSLGKTWLKRPDLLEK 228
>gi|108763843|ref|YP_631741.1| tRNA (guanine-N1)-methyltransferase [Myxococcus xanthus DK 1622] >gi|118575147|sp|Q1D6I2|TRMD_MYXXD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|108467723|gb|ABF92908.1| tRNA (guanine-N1)-methyltransferase [Myxococcus xanthus DK 1622] (247 aa)
Score = 460, Expect = 2.9e-44, Identities = 90/219 (41%), Positives = 140/219 (63%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEH-LILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           + +L+LF      +   SI+ KA    L+   I + R +++  H   DD PYGGGAGMV+  +P+V AI   K  +  ++V+L++P G T+ Q  A +    E  LIL+CG YEG DER++ ++D E+S+GD++LTGGE+AAM ++D+V RL+P V+ +V+S  +ESF+  LL++P YT+P  F G +VP  L SG+H  I + R+   +  T   R DL+ +
  S:     7 VEILTLFPGMVTGYLGASILGKAQEKGLLATTITDIREYAEGKHRVTDDAPYGGGAGMVMKPEPLVAAIEAAKARHPGARVLLMSPRGPTFTQATARELVRHEAGLILVCGRYEGVDERVMAHLDGELSLGDFVLTGGELAAMTVVDAVARLVPGVLGNVDSSVTESFEEGLLEHPQYTRPPVFRGVEVPAALQSGDHARIARWRRWKSLVLTHERRPDLYAR 229
>gi|167623033|ref|YP_001673327.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella halifaxensis HAW-EB4] >gi|189036099|sp|B0TJ77|TRMD_SHEHH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|167353055|gb|ABZ75668.1| tRNA (guanine-N1)-methyltransferase [Shewanella halifaxensis HAW-EB4] (248 aa)
Score = 460, Expect = 3.0e-44, Identities = 92/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A++  L++++  N R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+   QQ   +      L+L+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH+ I + R +  + +T + R +L 
  S:     1 MWLGVVTLFPEMFRAVTDFGVTGRAVSKGLLELQTWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGKEAKVIYLSPQGRKLTQQGVEELAKSSSLVLVCGRYEGVDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGLDVPAVLLSGNHEHIRRWRLQQSLGRTLLRRPELL 224
>gi|157960879|ref|YP_001500913.1| tRNA (guanine-N(1)-)-methyltransferase [Shewanella pealeana ATCC 700345] >gi|189036100|sp|A8H1E1|TRMD_SHEPA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|157845879|gb|ABV86378.1| tRNA (guanine-N1)-methyltransferase [Shewanella pealeana ATCC 700345] (248 aa)
Score = 460, Expect = 3.0e-44, Identities = 92/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M + V++LF   F    +  +  +A++  L++++  N R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+   QQ   +      L+L+CG YEG DERII   VD E SIGDY+L+GGE+ AM ++DSV RL+P V+    S E +SF + LLD P+YT+P + +G  VP VLLSGNH+ I + R +  + +T + R +L 
  S:     1 MWLGVVTLFPEMFRAVTDFGVTGRAVSKGLLELQTWNPRDFTHDKHKTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGKEAKVIYLSPQGRKLTQQGVEELAKSSSLVLVCGRYEGVDERIIQTEVDEEWSIGDYVLSGGELPAMTLIDSVSRLVPGVLGKQASAEQDSFSDGLLDCPHYTRPESLDGLDVPAVLLSGNHEHIRRWRLQQSLGRTLLRRPELL 224
>gi|149278164|ref|ZP_01884302.1| tRNA (guanine-N(1)-)-methyltransferase [Pedobacter sp. BAL39] >gi|149230930|gb|EDM36311.1| tRNA (guanine-N(1)-)-methyltransferase [Pedobacter sp. BAL39] (225 aa)
Score = 459, Expect = 3.1e-44, Identities = 88/219 (40%), Positives = 143/219 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  ++S+  +        SI+++A    + +I + N R+++ +    VDD PYGGG+GMV+++ P    I  +K      +V+ ++P G+T+NQ IAN+     +L+++CGHY+G D+RI + +V  EISIGDY+L+GGE+ A  ++D++ RLIP V++   S  S+SF   LLD P YT+P ++NG+KVP VLLSG+  +IN+ R E  + +T+  R DL 
  S:     1 MRFDIISVLPDLLESPFAHSILQRAQKKGIAEIVVHNLRDYATNKQKSVDDYPYGGGSGMVMSIAPFAACIEALKAEREYDEVIFMSPDGETFNQTIANELSGKGNLMILCGHYKGIDQRIRDLFVTREISIGDYVLSGGELPAAVLVDAITRLIPGVLNDETSALSDSFQGELLDAPVYTRPADWNGHKVPVVLLSGHEAKINEWRHEQALIRTQQRRPDLL 223
>gi|145633789|ref|ZP_01789513.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 3655] >gi|144985360|gb|EDJ92190.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae 3655] (246 aa)
Score = 459, Expect = 3.1e-44, Identities = 94/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F       +  +A+ +NL+ +E  N R+F+ D H  VDD PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q    +    + LIL+CG YEG DER+I   +D E SIGDY+LTGGE+ AM ++D+V R IP V+    S E +SF + LLD P+YT+P    G  VP VL+SG+H+ I K R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEGIRKWRLKQSLQRTWLRRPELL 224
>gi|120555192|ref|YP_959543.1| tRNA (guanine-N1)-methyltransferase [Marinobacter aquaeolei VT8] >gi|120325041|gb|ABM19356.1| tRNA (Guanine37-N1) methyltransferase [Marinobacter aquaeolei VT8] (252 aa)
Score = 459, Expect = 3.5e-44, Identities = 92/221 (41%), Positives = 138/221 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +SLF + F+   +  I  +A+   L+  +  N R+++ D    VDD PYGGG GM++ +QP+ DAI   + S    + VV L+P G+  +Q +       + LIL+ G YEG DER+I   VD E+S+GD++L+GGE+AAMA++D+V RLIP  +    S E +SF + LLD P+YT+P  + G  VPEVLL G+H++I + R +  + +T   R DL  K
  S:     1 MWIGAVSLFPDMFSAVTDYGITGRAVREGLLTFQSWNPRDYTHDRRRTVDDRPYGGGPGMLMKIQPLRDAIQAARASAPGKACVVYLSPQGERLDQSVVESLAAEQQLILVAGRYEGVDERLIAAEVDREVSLGDFVLSGGELAAMAVIDAVTRLIPGALGHAQSAEQDSFADGLLDCPHYTRPEVYEGQAVPEVLLGGHHEQIRRWRLKESLRRTSERRPDLLEK 226
>gi|53802418|ref|YP_112925.1| tRNA (guanine-N1)-methyltransferase [Methylococcus capsulatus str. Bath] >gi|84029226|sp|Q60BS1|TRMD_METCA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|53756179|gb|AAU90470.1| tRNA (guanine-N1)-methyltransferase [Methylococcus capsulatus str. Bath] (251 aa)
Score = 459, Expect = 3.7e-44, Identities = 91/219 (41%), Positives = 134/219 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK---TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  +++LF     +     +  +A+A   V +E+ N R+F++D H  VDD PYGGG GMV+ ++P+ DAI   K   T  ++VVL++P G   +Q    +F     LIL+ G YEG DER+I   +D E SIGDY+L+GGE+ A+ + D+V+RL+P V+    S E +S    LLD+P+YT+P    G  VP VL SGNH  I + R +  + KT + R DL 
  S:     1 MRFDIVTLFPEMVRDAARYGVTGRALAAGKVSLEVWNPRDFTRDRHRTVDDRPYGGGPGMVMKVEPLRDAIRAAKGQATPGARVVLMSPQGTRLDQAAVRRFAAAPGLILVAGRYEGVDERLIETEIDEEWSIGDYVLSGGELPALVVFDAVVRLLPGVLGDAESAEQDSHAEGLLDHPHYTRPERVAGRDVPAVLQSGNHAAIGRWRLKQALGKTWLKRPDLL 224
>gi|82701705|ref|YP_411271.1| tRNA (guanine-N1)-methyltransferase [Nitrosospira multiformis ATCC 25196] >gi|119370979|sp|Q2YBJ2|TRMD_NITMU tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|82409770|gb|ABB73879.1| tRNA (Guanine37-N1) methyltransferase [Nitrosospira multiformis ATCC 25196] (256 aa)
Score = 458, Expect = 4.2e-44, Identities = 90/215 (41%), Positives = 134/215 (62%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVK-------TSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           V++LF   FN      +  +A  N +  +   N R F++D++ +VDD PYGGG GMV+  +P+  AI   +         ++KVV L+P G+  NQ +  +      L+L+ G YEG DER+I   VDYEISIGDY+++GGE+A+M ++D V+R +P V+    S   +SF   LLD+P+YT+P  + G  VPEVLLSGNH  I + R +  + +T + R DL 
  S:     7 VITLFPEMFNAVTRYGVTGRANENAIYRLYTWNPREFTEDNYRRVDDRPYGGGPGMVMLAEPLEKAITAARERQRACGIGSTKVVYLSPQGRPLNQNVVMELSELSALVLLAGRYEGVDERLIERQVDYEISIGDYVVSGGELASMVLMDCVVRQLPGVLGDPESANQDSFTAGLLDFPHYTRPEVYRGSVVPEVLLSGNHARIERWRLQQSLGRTWLRRPDLL 230
>gi|50122279|ref|YP_051446.1| tRNA (guanine-N(1)-)-methyltransferase [Pectobacterium atrosepticum SCRI1043] >gi|84029213|sp|Q6D1U0|TRMD_ERWCT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|49612805|emb|CAG76255.1| tRNA(guanine-N1)methyltransferase [Erwinia carotovora subsp. atroseptica SCRI1043] (251 aa)
Score = 458, Expect = 4.2e-44, Identities = 92/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F    +  +  +A+ N L++++  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        ++V+ L+P G+  +QQ   Q  T + +IL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+    S E +SF + LLD P++T+P       VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITDFGVTGRAVKNGLLNVQYWSPRDFTYDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGARVIYLSPQGRKLDQQGVRQLATNQKMILVCGRYEGIDERVIKTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHQASAEEDSFADGLLDCPHFTRPEILESMDVPAVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|118594351|ref|ZP_01551698.1| tRNA (guanine-N1)-methyltransferase [Methylophilales bacterium HTCC2181] >gi|118440129|gb|EAV46756.1| tRNA (guanine-N1)-methyltransferase [Methylophilales bacterium HTCC2181] (260 aa)
Score = 458, Expect = 4.4e-44, Identities = 89/223 (39%), Positives = 147/223 (65%)
  Q:     1 MKIT-------VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN-------SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           MKIT       +++L    F    +  +  +A  + ++++ + N R F+KD+HN +DD  YGGG GM++ ++P+V AI  +K          +KVV +TP GK+ + Q+  +    + LI+I   YEG DERI ++VD EIS+GDY+++GGE+ AM ++D +IR +P V++ + S   +SF + LLD+P++T+P  + G KVPEVL+SG+H++I   R +  + +T   R DL  + L
  S:     1 MKITKSLFRFDLVTLMPEMFQALTDFGVTGRAFKSGVIEMHVCNPREFAKDAHNTIDDKSYGGGPGMLMMVEPLVKAIEFIKEKQHKKGLKGAKVVHMTPRGKSLDHQLVRELLKEDSLIIIASRYEGVDERINDWVDEEISVGDYVMSGGELPAMTLMDCMIRQLPGVLNDDESANQDSFVDGLLDHPHFTRPELYRGLKVPEVLMSGDHEKIRIWRLKESLRETWTKRPDLLAERL 238
>gi|52840641|ref|YP_094440.1| tRNA (guanine N1) methyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52627752|gb|AAU26493.1| tRNA (guanine N1) methyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (256 aa)
Score = 458, Expect = 4.5e-44, Identities = 95/201 (47%), Positives = 134/201 (66%)
  Q:    21 IIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQ----QIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +  +AI   LV I+  N R++S   + +VDD PYGGG GMV+  +P+  AI H ++    N K + L+P GK   Q    QIA Q ++   L+ + G YEG DERII++ VD E S+GD++L+GGE+AAM  +D++IRLIP  +  + S E +SF N LLD P+YT+P   NG  VP+VLL GNHKEI + R++  + KT + R DL  K
  S:    28 VTGRAIEQGLVKIDCWNPRDWSSRPYKQVDDKPYGGGPGMVMMYEPLHAAIKHARSEMKENCKTIYLSPQGKVVRQNDLKQIAAQKQS---LLFVAGRYEGIDERIISHHVDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLGHLGSAEQDSFMNGLLDCPHYTRPATINGLDVPDVLLGGNHKEIERWRRKQSLGKTWLKRPDLLEK 234
>gi|84029219|sp|Q5ZYH6|TRMD_LEGPH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) (250 aa)
Score = 458, Expect = 4.5e-44, Identities = 95/201 (47%), Positives = 134/201 (66%)
  Q:    21 IIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQ----QIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +  +AI   LV I+  N R++S   + +VDD PYGGG GMV+  +P+  AI H ++    N K + L+P GK   Q    QIA Q ++   L+ + G YEG DERII++ VD E S+GD++L+GGE+AAM  +D++IRLIP  +  + S E +SF N LLD P+YT+P   NG  VP+VLL GNHKEI + R++  + KT + R DL  K
  S:    22 VTGRAIEQGLVKIDCWNPRDWSSRPYKQVDDKPYGGGPGMVMMYEPLHAAIKHARSEMKENCKTIYLSPQGKVVRQNDLKQIAAQKQS---LLFVAGRYEGIDERIISHHVDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLGHLGSAEQDSFMNGLLDCPHYTRPATINGLDVPDVLLGGNHKEIERWRRKQSLGKTWLKRPDLLEK 228
>gi|157148120|ref|YP_001455439.1| tRNA (guanine-N(1)-)-methyltransferase [Citrobacter koseri ATCC BAA-895] >gi|157085325|gb|ABV15003.1| hypothetical protein CKO_03930 [Citrobacter koseri ATCC BAA-895] (244 aa)
Score = 458, Expect = 4.6e-44, Identities = 90/207 (43%), Positives = 137/207 (66%)
  Q:    13 FNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ DAI+  K++    +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+    +++E +SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     2 FRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKSAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASAIE-DSFADGLLDCPHYTRPEVLEGMEVPAVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 213
>gi|167032082|ref|YP_001667313.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas putida GB-1] >gi|189036093|sp|B0KRI3|TRMD_PSEPG tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166858570|gb|ABY96977.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas putida GB-1] (250 aa)
Score = 458, Expect = 4.6e-44, Identities = 90/217 (41%), Positives = 135/217 (62%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN---SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           + V++LF   F+      I  +A+   L+ +   N R+++ D H+ VDD P+GGG GMV+ ++P+ DA+   + +    +KV+ L+P G+   QQ        E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +  V+S E +SF + LLD P+YT+P  +   +VP+VLLSGNH  I + R +  + +T   R DL 
  S:     6 VDVITLFPEMFSAITEYGITSRAVKQGLLQVTCWNPRDYTTDRHHTVDDRPFGGGPGMVMKIKPLEDALVSARQATGAAAKVIYLSPQGRKLTQQAVKGLAEQESLILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHVDSAEEDSFTDGLLDCPHYTRPEVYADQRVPDVLLSGNHAHIRRWRMKQSLGRTFERRADLL 227
>gi|77165721|ref|YP_344246.1| tRNA (guanine-N(1)-)-methyltransferase [Nitrosococcus oceani ATCC 19707] >gi|118575148|sp|Q3J8Y0|TRMD_NITOC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|76884035|gb|ABA58716.1| tRNA (Guanine37-N1) methyltransferase [Nitrosococcus oceani ATCC 19707] (252 aa)
Score = 458, Expect = 4.9e-44, Identities = 92/219 (42%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN----SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+  V++LF   F+   ++ ++ +A+    + +   N R+F+ D H  VD  PYGGG GMV+ +QP+ DAI HV  +      +V+ L+P G+  +Q       + E L+ + G YEG DER+I   VD E SIGDY+L+GGE+AAM I+D + RL+P V+ +  S + +SF N LLD P+YT+P    GY+VP VLLSG+HK I + R +  + +T + R DL 
  S:     1 MRFGVITLFPGMFDALWDSGVVGRALKQGKISLNFWNPRDFAHDRHRTVDARPYGGGPGMVMGIQPLRDAI-HVGRAELGKGCRVLYLSPQGRRLDQAGLEALASNESLLFVAGRYEGVDERLIEMEVDEEWSIGDYVLSGGELAAMVIIDGLARLLPGVLGAAESAQQDSFVNGLLDCPHYTRPEVIEGYRVPPVLLSGDHKAIRRWRLKQALGRTWLKRPDLL 224
>gi|119717480|ref|YP_924445.1| tRNA (Guanine37-N1) methyltransferase [Nocardioides sp. JS614] >gi|119538141|gb|ABL82758.1| tRNA (Guanine37-N1) methyltransferase [Nocardioides sp. JS614] (385 aa)
Score = 458, Expect = 4.9e-44, Identities = 92/219 (42%), Positives = 139/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQP---IVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-----YEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++S+F  +    +  S+  KA    L+D+ + + R ++ D H  VDDTPYGGGAGMV+  +P    +DA+  +    + VV+ TPSG+ + Q++A +  T E L+  CG YEG D+R++  V       EIS+GDY+L GGE+AA+AI ++V+RL+P  + +  SL  ES +  LL+YP YTKP ++ G  VP VLLSG+H  I   R +  + +T   R DL 
  S:     1 MRIDIVSIFPEYLAPLE-LSLAGKAREKGLIDVRVHDLRAWTHDRHRTVDDTPYGGGAGMVMKPEPWGEALDALGVLDGDGATVVVTTPSGQPFTQEVARELATRERLVFACGRYEGIDQRVLEEVAERAELREISLGDYVLNGGEVAALAITEAVVRLVPGFMGNAESLLEESHEGGLLEYPVYTKPGSWRGRAVPPVLLSGDHAAIAAWRHDQAVRRTAERRPDLL 227
>gi|163784276|ref|ZP_02179192.1| tRNA guanine-N1 methyltransferase [Hydrogenivirga sp. 128-5-R1-1] >gi|159880452|gb|EDP74040.1| tRNA guanine-N1 methyltransferase [Hydrogenivirga sp. 128-5-R1-1] (215 aa)
Score = 458, Expect = 4.9e-44, Identities = 93/186 (50%), Positives = 126/186 (67%)
  Q:    36 VNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +N R+F+ D H  VDDT YGGG GM+L  +PI  A   +     K  V++  P G+ ++Q+ A +    + +++ICG YEG DER+ + VD E+SIGD+IL+GGE AA+ I+D+V RL+P V+   NSL  +SF +NL+ YPNYT+P +F G KVPEVLLSGNHK I K RK  QI +T   R DL  K
  S:     2 INPRDFTSDKHKTVDDTVYGGGPGMLLKPEPIFKAYESILEKGHKPYVLITEPWGRKFDQEFAKELSEKDEILIICGRYEGVDERVKSIVDEEVSIGDFILSGGEPAAVVIIDAVARLVPGVVGDKNSLNIDSFSDNLIGYPNYTRPADFRGMKVPEVLLSGNHKLIEKWRKWQQIERTYKKRPDLLKK 190
>gi|110597447|ref|ZP_01385734.1| tRNA (guanine-N1)-methyltransferase [Chlorobium ferrooxidans DSM 13031] >gi|110340991|gb|EAT59462.1| tRNA (guanine-N1)-methyltransferase [Chlorobium ferrooxidans DSM 13031] (235 aa)
Score = 458, Expect = 5.0e-44, Identities = 88/219 (40%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERI-INYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I V+S+   FF+   +  ++  A      DI I N  ++    + +VDD+P+GGGAGMVL  +P+   I  ++   +  +V+ LTP GK + Q +AN+    ++LI++CGHY+  DERI    +  EISIGD +L+GGEI A+ ++D+V+R+IP V+    S  ++SF N LLD   YT+P  F G KVP++L+SG+H +I + R E  + +T+  R DL 
  S:    10 MRIDVISVIPGFFDSVLDNGLLSIARKKQYADIHIHNLHDYGLGRYRQVDDSPFGGGAGMVLRPEPVFSCIEALQAERAYDEVIFLTPDGKLFEQSLANRLSGMQNLIILCGHYKAVDERIRQKLITMEISIGDVVLSGGEIPALLLMDAVLRVIPGVLGDSESALTDSFQNGLLDCVYYTRPAEFRGMKVPDILMSGHHSKIEQWRGENALERTRTRRPDLL 232
>gi|146312729|ref|YP_001177803.1| tRNA (guanine-N(1)-)-methyltransferase [Enterobacter sp. 638] >gi|166988162|sp|A4WDH2|TRMD_ENT38 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|145319605|gb|ABP61752.1| tRNA (Guanine37-N1) methyltransferase [Enterobacter sp. 638] (255 aa)
Score = 458, Expect = 5.1e-44, Identities = 92/219 (42%), Positives = 139/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN---HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+   L++I+  + R+F+ D H  VD+ PYGGG GM++ +QP+ DAI+         +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKKGLLNIQSWSPRDFAHDRHRTVDERPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASATEDSFADGLLDCPHYTRPEVLEGMEVPAVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|156932851|ref|YP_001436767.1| tRNA (guanine-N(1)-)-methyltransferase [Enterobacter sakazakii ATCC BAA-894] >gi|166200420|sp|A7MEG4|TRMD_ENTS8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|156531105|gb|ABU75931.1| hypothetical protein ESA_00648 [Enterobacter sakazakii ATCC BAA-894] (257 aa)
Score = 457, Expect = 5.6e-44, Identities = 94/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T E LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIDSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNEKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASATEDSFADGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|15617000|ref|NP_240213.1| tRNA (guanine-N1)-methyltransferase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387175|sp|P57476|TRMD_BUCAI tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|25285978|pir||C84976 tRNA (guanine-N1-)-methyltransferase (EC 2.1.1.31) [imported] - Buchnera sp. (strain APS) >gi|10039065|dbj|BAB13099.1| tRNA (guanine-n1)-methyltransferase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (237 aa)
Score = 457, Expect = 5.7e-44, Identities = 102/217 (47%), Positives = 137/217 (63%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPSGKTYNQ-QIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           ++++F   F    N  II +AI   +++I   N RNFSK+ +  VDD PYGGG GM+++ +P+  AI   K++  N  V+ L+P GK   Q  I       + ++ ICG YEG D+RII N VD E SIG YILTGGE+AAM ++D++ RLIP VI    S+E +SF N+LLDYPNYT+P       VP+VLLSGNH EI   R +  +  T I R DL  K
  S:    14 IITIFPEMFYAITNYGIIGQAIKKKIININFFNPRNFSKNKYKSVDDRPYGGGPGMLMSFEPLYLAIQQAKSTSKNVTVIYLSPQGKELKQNHIEELLVKKKKIVFICGRYEGIDQRIIDNQVDEEWSIGSYILTGGELAAMVMIDAISRLIPGVIKTKKSIEEDSFTNDLLDYPNYTRPKIIKNMSVPQVLLSGNHNEIRLWRLKQSLGTTWIKRPDLIKK 235
>gi|171910506|ref|ZP_02925976.1| tRNA (guanine-N(1)-)-methyltransferase [Verrucomicrobium spinosum DSM 4136] (228 aa)
Score = 457, Expect = 6.0e-44, Identities = 94/219 (42%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESF-DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M++ V++LF          SI+ +A    ++D+ + + R      + +VDD P+GGG GMV+  +PI   ++ V+T  SKV+ +TP GK ++Q  A +  T  HLI +CGHYEG D+RI++  VD EIS+GDY+LT G IAA  ++D+++RL+P V+  + S   ESF +++LLD+P+YT+P  + G KVP++LLSG+H +I K RKE    +T+ NR DL 
  S:     1 MQVDVITLFPEVVTVPLGASIMGRAREKGVLDLRVHDLRKHGMGKYRQVDDAPFGGGPGMVMRPEPIAAMLDEVRTPQSKVIFMTPQGKPFDQATARRLSTEPHLIFLCGHYEGVDQRIVDTCVDEEISLGDYVLTNGAIAAAVVVDAIVRLVPGVLGDDESAIQESFTESDLLDHPHYTRPAEWQGQKVPDILLSGDHGKIAKWRKEQAKERTRKNRPDLL 222
>gi|88711914|ref|ZP_01106001.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacteriales bacterium HTCC2170] >gi|88709320|gb|EAR01553.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacteriales bacterium HTCC2170] (230 aa)
Score = 457, Expect = 6.4e-44, Identities = 93/219 (42%), Positives = 148/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++ + N R+++  S+N+VDD  +GGGAGMVL ++PI   I+ +K+     +V+ +TP G+T NQ+IAN      ++I++CGHY+G D+R+ + ++  EIS+GDY+L+GGE+AA  + DS+IRLIP V+ +  S  +++F +NLL  P YT+P  + G KVPEVLLSGN  +I + R+    ++TK  R DL 
  S:     1 MRIDIITVLPELLKSPFEASILKRAIEKGLVEVHMHNLRDYTVLSYNQVDDYQFGGGAGMVLMIEPIDKCISALKSERDYDEVIYMTPDGETLNQKIANTISLKGNIIILCGHYKGVDQRVRDAFITKEISVGDYVLSGGELAAAILCDSIIRLIPGVLNNETSALTDTFQDNLLAPPVYTRPSEYKGMKVPEVLLSGNFPKIEEWRENEAYSRTKTLRPDLL 223
>gi|71281063|ref|YP_270722.1| tRNA (guanine-N1)-methyltransferase [Colwellia psychrerythraea 34H] >gi|119382731|sp|Q47WV0|TRMD_COLP3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|71146803|gb|AAZ27276.1| tRNA (guanine-N1)-methyltransferase [Colwellia psychrerythraea 34H] (253 aa)
Score = 456, Expect = 6.9e-44, Identities = 95/219 (43%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD------AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNF-----NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   FN      +  +AI N L+D  + N R+F+ D H  VDD PYGGG GM++ +QP+ D          V    +KV+ L+P G+  +QQ  ++    + L+ I G YEG DER+I + +D E S+GDYIL+GGE+ AM ++D+V RL+P V+    S E +SF N LLD P+YT+P        +   VP+VLLSGNH+ I   R+E  + +T   R +L 
  S:     1 MWIGVISLFPEMFNAITEYGVTGRAIRNGLIDFHLWNPRDFTHDKHRTVDDRPYGGGPGMLMMVQPLRDAIAAARKAAEVNGGKAKVIYLSPQGRKLDQQGVSELAQHDRLVFIAGRYEGIDERLIASDIDEEWSVGDYILSGGELPAMNVIDAVARLVPGVLGHKESAEQDSFSNGLLDCPHYTRPEVLTTPQGDEMSVPKVLLSGNHEHIRLWRQEQSLLRTWTRRPELL 232
>gi|83592523|ref|YP_426275.1| tRNA (Guanine37-N(1)-) methyltransferase [Rhodospirillum rubrum ATCC 11170] >gi|119370993|sp|Q2RV57|TRMD_RHORT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|83575437|gb|ABC21988.1| tRNA (Guanine37-N(1)-) methyltransferase [Rhodospirillum rubrum ATCC 11170] (239 aa)
Score = 456, Expect = 7.5e-44, Identities = 92/223 (41%), Positives = 137/223 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDY-EISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYL 223
           ++  VL+LF   F      SI  KA+      IE V+ R+F+ D H+ VDD+P+GGGAGMV+    +  AI      +  +V LTP G+  +Q +  +      L L+CG YEG D+R+++     EISIGDY+L+GGE AA  +LD+V+RL+P V+    SLE ESF+  LL+YP+YT+P  + G  VPEVL SG+H++++  R+      T+  R DL+ +Y+
  S:     3 LRAVVLTLFPEMFPGPLGHSIAGKALETGAWSIEAVDIRSFATDRHHTVDDSPFGGGAGMVMRPDVVDAAIAASWPGDGPLVYLTPRGRVLDQALVRELAQAPSLTLLCGRYEGVDQRVLDERGMLEISIGDYVLSGGEAAAQVLLDAVVRLLPGVVGKTESLEDESFERGLLEYPHYTRPAEWRGRTVPEVLTSGHHQKVSDWRQARSEEITQTRRPDLWARYV 227
>gi|51246655|ref|YP_066539.1| tRNA (guanine-N1)-methyltransferase [Desulfotalea psychrophila LSv54] >gi|84029210|sp|Q6AJE8|TRMD_DESPS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|50877692|emb|CAG37532.1| probable tRNA (guanine-N1)-methyltransferase [Desulfotalea psychrophila LSv54] (251 aa)
Score = 456, Expect = 7.5e-44, Identities = 87/221 (39%), Positives = 139/221 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   +L++F N  +      I+K+A  +  +D+ IV+ R ++ D H+  D  PYGGG GMV+  +P+  A+  +K  ++ +V+ LTP G+ Y Q++A +      + L+CG YEG DER    Y+D EIS+GD+ILTGGE+AA+ ++DSV R++P V+  + S+ +++F  +LL +P YT+P  F G +VP+VLLSG+H+ I   R    + +T   R  L  K
  S:     1 MLFNILTIFPNLLSSPLEEGILKRAQNSGSIDVNIVDIRQYASDKHSTTDARPYGGGEGMVMKAEPLSLAVQDIKKKDAGRVIFLTPQGRKYTQRVAEELAQESSITLVCGRYEGVDERFCEKYIDDEISLGDFILTGGELAALMVVDSVSRILPGVLGCDASVTNDTFSRHLLKHPQYTRPRIFEGLEVPDVLLSGDHQAIEDYRFIASVERTFHKRPGLLKK 224
>gi|119960837|ref|YP_948175.1| tRNA (guanine-N1)-methyltransferase [Arthrobacter aurescens TC1] >gi|166231335|sp|A1R7G3|TRMD_ARTAT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119947696|gb|ABM06607.1| tRNA (guanine-N1)-methyltransferase [Arthrobacter aurescens TC1] (266 aa)
Score = 456, Expect = 8.4e-44, Identities = 93/218 (42%), Positives = 141/218 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS--NSKVVLLTPS--GKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-----YEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+I V+S+F  +    +  S+I KA  + L+++ + + R F+ D H  VDDTPYGGGAGMV+  +P   A+  V  +  NSK VL+ PS  G+ +NQ +A +    E L+  CG YEG DER+I++         +S+GDY+L GGE+A +A+++++ RL+P V+ +  SL  ES  + LL+YP YTKP  +  + VP +LLSGNH +I + R+  Q  +T   R DL
  S:     1 MRIDVVSIFPEYLAPLE-LSLIGKARQDGLLELNVHDLRTFTTDKHRTVDDTPYGGGAGMVMKPEPWAQALESVAAARENSKPVLIVPSPAGEKFNQALAYELAEEEQLVFACGRYEGIDERVIDWAQDHFRVRPVSLGDYVLNGGEVAVLAMVEAIGRLLPGVVGNPESLVEESHSDGLLEYPVYTKPSAWRDHDVPPILLSGNHGKIAQWRRHEQFRRTAERRPDL 227
>gi|117923820|ref|YP_864437.1| tRNA (Guanine37-N1) methyltransferase [Magnetococcus sp. MC-1] >gi|166200432|sp|A0L4Y8|TRMD_MAGSM tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|117607576|gb|ABK43031.1| tRNA (Guanine37-N1) methyltransferase [Magnetococcus sp. MC-1] (252 aa)
Score = 456, Expect = 8.6e-44, Identities = 89/221 (40%), Positives = 144/221 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINH-VKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNF----NGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+ ++L+LF   F   +  SI+ +   +  +D+ +V  R+F+ D H  VDDTP+GGG GMVL    +  A+   ++   + VV ++P G  ++Q  A +   + H++L+CG YEG DER I+ +VD E+S+GD++LTGGE+ AM ++D+V R++P V+  + S +++SF   LLD+P+YT+P ++    + Y  PEVLLSGNH  I + R+   + +T I R DL  K
  S:     1 MRFSILTLFPEMFAPLQ-ASILGRGQKSGRLDLNLVQIRDFATDRHQNVDDTPFGGGPGMVLKPDILSHALRATLQGETAHVVYMSPQGSRFDQATAQRLAGYGHVVLLCGRYEGVDERFIDAHVDEELSVGDFVLTGGELPAMMVVDAVSRMVPGVLGDLESAQADSFQTGLLDHPHYTRPAHWVVDGDHYGAPEVLLSGNHGAIAEWRRRQALLRTLIRRPDLLGK 227
>gi|57239612|ref|YP_180748.1| putative tRNA (guanine-N(1)-)-methyltransferase [Ehrlichia ruminantium str. Welgevonden] >gi|84029212|sp|Q5H9Z7|TRMD_EHRRW tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|57161691|emb|CAH58621.1| tRNA (Guanine-N(1)-)-methyltransferase [Ehrlichia ruminantium str. Welgevonden] (235 aa)
Score = 456, Expect = 8.8e-44, Identities = 90/216 (41%), Positives = 146/216 (67%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNL-LDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           + +L++F   F      S+I KA+   + ++ +++ R+F+ D H  VDD PYGGG GM++    I  AI++V ++N  +K++ ++PSG   NQ I+ Q   F ++ ++CG +EG D R++++ D YEISIGDYIL+GGE+A+M ++++ +RLIP V+S V+S+  ESF  +  L+Y  YT+P N+ G +VP VL+SGNHK+IN  + +     TK  R +L
  S:     5 VNILTIFPEMFPGTLGYSVIGKALNKGIWNLNVIDIRSFATDKHKTVDDKPYGGGPGMIMKADVIGSAIDNVLSTNKETKLIYMSPSGVKLNQDISGQLAHFSNITILCGRFEGIDRRVLDFYDFYEISIGDYILSGGEVASMVLIETCVRLIPGVVSNVDSIRDESFTASYGLEYSQYTRPANWRGLEVPSVLVSGNHKKINLWKTQQSYRITKQRRPEL 225
>gi|163755445|ref|ZP_02162565.1| tRNA (guanine-N(1)-)-methyltransferase [Kordia algicida OT-1] >gi|161324865|gb|EDP96194.1| tRNA (guanine-N(1)-)-methyltransferase [Kordia algicida OT-1] (225 aa)
Score = 455, Expect = 9.9e-44, Identities = 90/219 (41%), Positives = 146/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++S+  +        SI+K++I   +V++ + N R+++ D++  +DD  +GGGAGMV+ + PI   +  +K+  +  +V+ +TP GKT NQ IAN+     ++I++CGHY+G D+R+ + ++  EISIGDY+L+GGE+ A  + D+VIRLIP V+ +  S  ++SF +NLL  P YT+P  +N ++VPEVLLSGN  +I   R+E    +TK  R DL 
  S:     1 MRIDIISVVPDLLKSPFEASILKRSIDKGIVEVHLHNLRDYATDNYKSIDDYQFGGGAGMVMMVGPIDRCLTDLKSQRNYDEVIYMTPDGKTLNQGIANELSLKGNIIILCGHYKGVDQRVRDHFITREISIGDYVLSGGELGAAVLCDAVIRLIPGVLGNETSALTDSFQDNLLAPPVYTRPAKYNDWEVPEVLLSGNFPKIEAWREEQAYERTKKLRPDLL 223
>gi|146281577|ref|YP_001171730.1| tRNA (guanine-N(1)-)-methyltransferase [Pseudomonas stutzeri A1501] >gi|166200439|sp|A4VIT7|TRMD_PSEU5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|145569782|gb|ABP78888.1| tRNA (guanine-N1)-methyltransferase [Pseudomonas stutzeri A1501] (250 aa)
Score = 455, Expect = 1.0e-43, Identities = 91/219 (41%), Positives = 135/219 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           +++ V+SLF + F       I  +A+   L+ +   N R++++D H  VDD P+GGG GMV+ ++P+  A+   K +    +KV+ L+P G+   Q    +    E LILI G YEG DER I  +VD E SIGDY+L+GGE+ AM ++D+V RL+P  +    S E +SF + LLD P+YT+P  + G  VPEVLLSGNH+ I + R +  + +T   R DL 
  S:     4 LRVEVISLFPDMFAAISEYGITSRAVKQGLLQLNCWNPRSYTEDRHQTVDDRPFGGGPGMVMKIKPLELALADAKRAAGGKAKVIYLSPQGRQLKQADVRELANEEALILIAGRYEGIDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHAGSAEEDSFTDGLLDCPHYTRPEVYEGKCVPEVLLSGNHEHIRRWRLQQSLGRTWERRADLL 227
>gi|163788618|ref|ZP_02183063.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacteriales bacterium ALC-1] >gi|159875855|gb|EDP69914.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacteriales bacterium ALC-1] (225 aa)
Score = 455, Expect = 1.0e-43, Identities = 90/219 (41%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++++           SI+K+AI   LV++   N R+++  ++  +DDT +GGGAGMV+ ++PI   I+ ++   +  +++ +TP G   NQ IAN     E++I++CGHY+G D+R+ + ++  EISIGDY+L+GGE+ A  + D+VIRLIP V+ +  S  ++SF +NLL  P YT+P  + G KVPEVL SGN  EI K R+E    +T+  R DL 
  S:     1 MRIDIITVLPELLKSPFEASILKRAIEAGLVEVHFHNLRDYTTGNYKAIDDTQFGGGAGMVMLIEPIDKCISKLQAERNYDEIIYMTPDGVQLNQGIANTISLKENIIILCGHYKGVDQRVRDKFISKEISIGDYVLSGGELGAAVLCDAVIRLIPGVLGNETSALTDSFQDNLLAPPIYTRPREYKGMKVPEVLFSGNFGEIEKWREEQAYKRTQERRPDLL 223
>gi|126732675|ref|ZP_01748471.1| tRNA (guanine-N1-)-methyltransferase [Sagittula stellata E-37] >gi|126706805|gb|EBA05875.1| tRNA (guanine-N1-)-methyltransferase [Sagittula stellata E-37] (266 aa)
Score = 455, Expect = 1.1e-43, Identities = 91/215 (42%), Positives = 137/215 (63%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           V++LF   F      S+  KA+   L  ++ V  R F +  H  VDDTP GGGAGMVL    +  AI H ++  +    ++ L+P GK ++Q++A    T   + LICG +EG D+R+I+ Y   E+SIGDY+LTGGE+AA  +LD+ +RL+P V+ + +S E ESF + LL++P YT+P  + G  +P+VLLSG+H EI K R++   + T+  R DL+
  S:    37 VITLFPEAFPGILGLSLTGKALQQELWQLQTVPLRPFGEGKHRNVDDTPAGGGAGMVLRPDVMGAAIEHARSQQAPGAPLIYLSPRGKPFSQEMARDLATRPGVTLICGRFEGLDQRVIDHYRIAEVSIGDYVLTGGELAAQVMLDAAVRLLPGVLGNADSTEEESFSDGLLEHPQYTRPAEWQGRTIPDVLLSGHHGEIAKWRRQQSEDLTRTRRPDLW 256
>gi|150007875|ref|YP_001302618.1| tRNA (guanine-N(1)-)-methyltransferase [Parabacteroides distasonis ATCC 8503] >gi|149936299|gb|ABR42996.1| tRNA Guanine-N(1)-methyltransferase [Parabacteroides distasonis ATCC 8503] (243 aa)
Score = 454, Expect = 1.3e-43, Identities = 91/219 (41%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I +L++         N SI+K+A    L +I + N R+++ +   +VDD P+GG AGMV+ ++PI  AI+ +K+     +V+  +P G+T NQ +AN      ++I++CGHY+G D RI  + +  EIS+GDY+LTGGE+AA  I D+V+RLIP  I    S  S+SF ++LL  P YT+P ++ G+KVPEVLLSG+ ++I + R +    +T   R DL 
  S:    20 MRIDILTVLPEMIEGMINCSIVKRAQDKGLAEIHLHNLRDYTTNKWRRVDDYPFGGEAGMVMQIEPIDRAISALKSEREYDEVIYTSPDGETLNQPMANSMSLLNNMIILCGHYKGIDYRIREHLITKEISVGDYVLTGGELAAAIITDAVVRLIPGAIGDEQSALSDSFQDDLLAPPVYTRPADYKGWKVPEVLLSGHQRKIEEWRLQQAQERTARLRPDLL 242
>gi|15793767|ref|NP_283589.1| tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis Z2491] >gi|26400843|sp|Q9JVL0|TRMD_NEIMA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|121051735|emb|CAM08039.1| putative tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis Z2491] (249 aa)
Score = 454, Expect = 1.5e-43, Identities = 92/221 (41%), Positives = 132/221 (59%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M I  +++F   F+      +  +A    +   E VN R F+ +    +DD P+GGG GM++   P+  AI H K  +S   KV+ L+P GK      A +     HLIL+CG YEG DER++   VD EISIGD++++GGE+ AM ++D+V+RL+P V+  + S E +SF + +LD P+YTKP  F G  VPEVL SGNH  I + R E  + +T   R DL  K
  S:     1 MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQAAKVIYLSPQGKPLTHPKAAELAELPHLILLCGRYEGIDERLLQTSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGVLGDMQSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPDLLEK 226
>gi|168701264|ref|ZP_02733541.1| tRNA (Guanine-N(1))-methyltransferase [Gemmata obscuriglobus UQM 2246] (238 aa)
Score = 453, Expect = 1.5e-43, Identities = 86/205 (41%), Positives = 137/205 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS---KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVI---SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKE 205
           ++  VL+LF   F+ +   S+++ AI   +V +   N R+++++ H +VDD P+GGG GMVL++QP+VD +  V+       KVV+LTP+G+   Q++  +      L+L+CG YEGFD+RI   ++  EIS+GD++  GGE+ AM ++D+VIRL+P V+      + ES S D   L+YP YT+P  + G  VP++LLSGNH+ + K R+E
  S:     5 IRFDVLTLFPGIFDGYVRQSLLEDAIQAGIVQVHAWNIRDWTQNKHQRVDDRPFGGGPGMVLSVQPVVDCVAAVRAKAEPPGKVVMLTPAGERLTQRVVERLAGEPRLLLLCGRYEGFDDRIRQLLNPTEISVGDFVCNGGEVPAMVLIDTVIRLMPGVLGDEQSAADESHSEDGR-LEYPQYTRPRVYEGLAVPDILLSGNHQAVAKWRRE 215
>gi|77972184|ref|ZP_00827758.1| COG0336: tRNA-(guanine-N1)-methyltransferase [Yersinia frederiksenii ATCC 33641] (246 aa)
Score = 453, Expect = 1.6e-43, Identities = 93/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F    +  +  +A+ N L+ ++  + R+F+ D H  VDD PYGGG GM++ +QP+ +   A        +KV+ L+P G+  +QQ   +  T + +IL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+    S E +SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITDYGVTGRAVKNGLLSVQCWSPRDFTYDRHRTVDDRPYGGGPGMLMMVQPLREAIHAAKAAAGEGAKVIYLSPQGRKLDQQGVCELATHQKMILVCGRYEGVDERVIKAEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHQASAEEDSFVDGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|77976456|ref|ZP_00831944.1| COG0336: tRNA-(guanine-N1)-methyltransferase [Yersinia intermedia ATCC 29909] (246 aa)
Score = 453, Expect = 1.6e-43, Identities = 93/219 (42%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F    +  +  +A+ N L+ ++  + R+F+ D H  VDD PYGGG GM++ +QP+ +   A        +KV+ L+P G+  +QQ   +  T + +IL+CG YEG DER++   +D E SIGDY+L+GGE+ AMA++DSV R IP V+    S E +SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITDYGVTGRAVKNGLLSVQCWSPRDFTYDRHRTVDDRPYGGGPGMLMMVQPLREAIHAAKAAAGEGAKVIYLSPQGRKLDQQGVCELATNQKMILVCGRYEGVDERVLKTEIDEEWSIGDYVLSGGELPAMALIDSVSRFIPGVLGHQASAEEDSFVDGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|153888762|ref|ZP_02009901.1| tRNA (guanine-N1)-methyltransferase [Ralstonia pickettii 12D] >gi|151574774|gb|EDN39191.1| tRNA (guanine-N1)-methyltransferase [Ralstonia pickettii 12D] (262 aa)
Score = 453, Expect = 1.7e-43, Identities = 90/218 (41%), Positives = 136/218 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN----SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           M+  V+SLF + F    +  I  +A    +  +   N R+F+ D++  VDD PYGGG GMV+  +P+  A++ ++ +     S VVLL+P GK    +   +      L L+CG YE  D+R+++  VD EIS+GD++L+GGEIAAMAI+D+V+R +P V+    S   +SF N LLD P+YT+P  + G +VP+VLL G+H EI K R++  +  T   R DL
  S:     1 MQFDVVSLFPDMFRALTDWGITSRAAKQQVYTLRTWNPRDFTTDNYRTVDDRPYGGGPGMVMLAKPLEAALDAIRQAQAPAASHVVLLSPQGKPLTHKRVMELAQLPALTLLCGRYEAIDQRLVDRRVDEEISLGDFVLSGGEIAAMAIIDAVVRQLPGVLGDAQSAVQDSFVNGLLDCPHYTRPEEYEGVRVPDVLLGGHHAEIEKWRRQQALMNTMRKRPDL 224
>gi|170766103|ref|ZP_02900914.1| tRNA (guanine-N1)-methyltransferase [Escherichia albertii TW07627] >gi|170125249|gb|EDS94180.1| tRNA (guanine-N1)-methyltransferase [Escherichia albertii TW07627] (255 aa)
Score = 453, Expect = 1.9e-43, Identities = 93/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF   LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPSVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|90407077|ref|ZP_01215266.1| tRNA (guanine-N1)-methyltransferase [Psychromonas sp. CNPT3] >gi|90311799|gb|EAS39895.1| tRNA (guanine-N1)-methyltransferase [Psychromonas sp. CNPT3] (249 aa)
Score = 453, Expect = 1.9e-43, Identities = 94/219 (42%), Positives = 139/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS------NSKVVLLTPSGKTYNQQIANQFKTFE-HLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF + F       +  +A+ NNL+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ DAIN  K +       +KV+ L+P G+  +   A    +    LIL+ G YEG DERII + +D E S+GDY+L+GGE+ AM ++D++ R +P V+  V S E +SF + LLD P+YT+P   +G  VP VLLSG+H++I   R +  + +T   R DL 
  S:     1 MWIGVISLFPDMFRAISENGVTGRAVKNNLLQIQCWDPRDFTMDKHRTVDDRPYGGGPGMLMMVQPLRDAINAAKQAAKEAGHEAKVIYLSPQGRRLDHCGAQSLASNNTALILVAGRYEGIDERIIESLIDEEWSVGDYVLSGGELPAMILIDALARFVPGVLGHVLSAEQDSFADGLLDCPHYTRPEVLDGKTVPSVLLSGDHEKIRLWRLKQSLQRTLQRRPDLL 228
>gi|58579601|ref|YP_197813.1| putative tRNA (guanine-N(1)-)-methyltransferase [Ehrlichia ruminantium str. Welgevonden] >gi|58418227|emb|CAI27431.1| Putative tRNA (Guanine-N(1)-)-methyltransferase [Ehrlichia ruminantium str. Welgevonden] (235 aa)
Score = 452, Expect = 2.0e-43, Identities = 90/216 (41%), Positives = 146/216 (67%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNL-LDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           + +L++F   F      S+I KA+   + ++ +++ R+F+ D H  VDD PYGGG GM++    I  AI++V ++N  +K++ ++PSG   NQ I+ Q   F ++ ++CG +EG D R++++ D YEISIGDYIL+GGE+A+M ++++ +RLIP V+S V+S+  ESF  +  L+Y  YT+P N+ G +VP VL+SGNHK+IN  + +     TK  R +L
  S:     5 VNILTIFPEMFPGTLGYSVIGKALNKGIWNLNVIDIRSFATDKHITVDDKPYGGGPGMIMKADVIGSAIDNVLSTNKETKLIYMSPSGVKLNQDISGQLAHFSNITILCGRFEGIDRRVLDFYDFYEISIGDYILSGGEVASMVLIETCVRLIPGVVSNVDSIRDESFTASYGLEYSQYTRPANWRGLEVPSVLVSGNHKKINLWKTQQSYRITKQRRPEL 225
>gi|152991243|ref|YP_001356965.1| tRNA (guanine-N(1)-)-methyltransferase [Nitratiruptor sp. SB155-2] >gi|166200437|sp|A6Q549|TRMD_NITSB tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|151423104|dbj|BAF70608.1| tRNA (guanine-N1-)-methyltransferase [Nitratiruptor sp. SB155-2] (226 aa)
Score = 452, Expect = 2.1e-43, Identities = 94/217 (43%), Positives = 138/217 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKD 217
           MKIT L+LF N    +   SI+K+A+   L +IE +++R FS + H KVD    GGGAGM+L  +PI DA+  +K   S VV  TP  K + Q+ A +    +H++ + G YEGFDER+I  Y D   SIGD+ILTGGE+A++ + D+++R IP V+  + SLE ESF+ +LL+ P++TKP  F G  V +  L GNH +I+ ++ +    +TK  R D
  S:     1 MKITYLTLFPNLMRCYFEDSILKRALEKKLFEIEFIDYRAFSHNKHKKVDRYKIGGGAGMLLEPRPIADALEFIKKKESWVVFTTPVAKRFTQKDAKRLAHKKHIVFVNGRYEGFDERLIEIYADEVFSIGDFILTGGELASLVMSDAIVRNIPGVLGNSASLEEESFEGDLLEAPSFTKPDVFKGKAVIKEFLKGNHSKISALKYQLARLRTKYYRPD 219
>gi|193216159|ref|YP_001997358.1| tRNA (guanine-N1)-methyltransferase [Chloroherpeton thalassium ATCC 35110] >gi|193089636|gb|ACF14911.1| tRNA (guanine-N1)-methyltransferase [Chloroherpeton thalassium ATCC 35110] (228 aa)
Score = 452, Expect = 2.1e-43, Identities = 89/219 (40%), Positives = 138/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M++ ++S+  +FF+      +++ A     + + + + R +    + +VDDTP+GGGAGMVL ++P+   I  +K      +V+  TP GK +NQ  AN+     +LIL+CGHY+  DERI    +  EIS+GD++L+GGE+ A+  LDSV RL+P V+    S+ ++SF +  LD  +YT+P  F G KVP+VLLSGNHK+I + R E  I +T+  R DL 
  S:     1 MRVDIISVLPDFFDSPLANGLLRIAREKQRLQLHVHSLREYGLGKYKQVDDTPFGGGAGMVLRVEPVFACIEKLKADRDYDEVIFFTPDGKQFNQSEANRHALDRNLILLCGHYKAIDERIRETLITKEISLGDFVLSGGELPALIFLDSVARLLPGVLHDEESMLTDSFQDGKLDCAHYTRPSEFRGMKVPDVLLSGNHKKIEEWRLENAIERTRQRRPDLL 223
>gi|194435110|ref|ZP_03067346.1| tRNA (guanine-N1)-methyltransferase [Shigella dysenteriae 1012] >gi|194416641|gb|EDX32774.1| tRNA (guanine-N1)-methyltransferase [Shigella dysenteriae 1012] (255 aa)
Score = 452, Expect = 2.2e-43, Identities = 93/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF   LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIYAAKAAAGEGAKVIYLSPQGRKLDQAGVSELSTNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|58617655|ref|YP_196854.1| putative tRNA (guanine-N(1)-)-methyltransferase [Ehrlichia ruminantium str. Gardel] >gi|84029211|sp|Q5FGP5|TRMD_EHRRG tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|58417267|emb|CAI28380.1| Putative tRNA (Guanine-N(1)-)-methyltransferase [Ehrlichia ruminantium str. Gardel] (235 aa)
Score = 452, Expect = 2.2e-43, Identities = 89/216 (41%), Positives = 146/216 (67%)
  Q:     3 ITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVD-YEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNL-LDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDL 218
           + +L++F   F      S+I KA+   + ++ +++ R+F+ D H  VDD PYGGG GM++    I  AI++V ++N  +K++ ++PSG   NQ I+ Q   F ++ ++CG +EG D R++++ D YEISIGDYIL+GGE+A+M ++++ +RLIP V+S V+S+  ESF  +  L+Y  YT+P ++ G +VP VL+SGNHK+IN  + +     TK  R +L
  S:     5 VNILTIFPEMFPGTLGYSVIGKALNKGIWNLNVIDIRSFATDKHKTVDDKPYGGGPGMIMKADVIGSAIDNVLSTNKETKLIYMSPSGVKLNQDISGQLAHFSNITILCGRFEGIDRRVLDFYDFYEISIGDYILSGGEVASMVLIETCVRLIPGVVSNVDSIRDESFTASYGLEYSQYTRPASWRGLEVPSVLVSGNHKKINLWKTQQSYRITKQRRPEL 225
>gi|83857663|ref|ZP_00951191.1| tRNA (guanine-N(1)-)-methyltransferase [Croceibacter atlanticus HTCC2559] >gi|83849030|gb|EAP86899.1| tRNA (guanine-N(1)-)-methyltransferase [Croceibacter atlanticus HTCC2559] (225 aa)
Score = 452, Expect = 2.2e-43, Identities = 86/219 (39%), Positives = 147/219 (67%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++S+  +        SI+K+AI    V+I   + R++  D++ ++DD  +GGGAGMV+ ++PI   I H+K+     +V+ +TP G+T  Q +ANQ    +++I++CGHY+G D+R+ + ++  EISIGDY+L+GGE+ A+ + D+VIRL+P V+ +  S  ++SF + LL  P YT+P ++ G+KVPE+L SGN  +I + R++  + +T+  R DL 
  S:     1 MRIDIISVVPDVLKSPFEASILKRAIEKGHVEIHFHDLRDYVTDNYRQIDDYQFGGGAGMVMMIEPIDKCITHLKSERDYDEVIYMTPDGETLKQGMANQISLQKNIIILCGHYKGVDQRVRDHFITREISIGDYVLSGGELGALILCDAVIRLLPGVLGNETSALTDSFQDGLLAPPIYTRPADYKGWKVPELLTSGNTPKIEEWREDQAVKRTQELRPDLL 223
>gi|91214548|ref|ZP_01251521.1| tRNA (guanine-N(1)-)-methyltransferase [Psychroflexus torquis ATCC 700755] >gi|91186975|gb|EAS73345.1| tRNA (guanine-N(1)-)-methyltransferase [Psychroflexus torquis ATCC 700755] (226 aa)
Score = 452, Expect = 2.4e-43, Identities = 91/226 (40%), Positives = 150/226 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKEN 226
           M+I ++++  +        SI+K++I   LV+I I N R+++  S+ ++DD  YGGGAGMV+ ++PI   I+ +K      +V+ LTP G+  NQ +AN      +LI++CGHY+G D+R+   ++  EISIGDY+L+GGE+AA  + DS+IRLIP V+ +  S  +++F ++LL  P YT+P  + G +VP++LLSG+ +++++ R E  + +TK  R DL    LKE+
  S:     1 MRIDIITVVPDLLKSPFEASILKRSIEKKLVEIHIHNLRDYTTLSYKQIDDYQYGGGAGMVMMVEPIDKCISKLKGERDYDEVIYLTPDGEVLNQAMANTLSLKGNLIMLCGHYKGVDQRVRELFITREISIGDYVLSGGELAAAVLCDSIIRLIPGVLGNETSALTDAFQDDLLSPPIYTRPSTYKGLEVPKILLSGHQRKVDEWRDEKALERTKELRPDL----LKED 226
>gi|123441196|ref|YP_001005183.1| tRNA (guanine-N(1)-)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166200463|sp|A1JK25|TRMD_YERE8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|122088157|emb|CAL10945.1| tRNA (guanine-N1)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] (246 aa)
Score = 452, Expect = 2.5e-43, Identities = 93/219 (42%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I V+SLF   F    +  +  +A+ N L+ ++  + R+F+ D H  VDD PYGGG GM++ +QP+ +   A        +KV+ L+P G+  +QQ   +  T + +IL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+    S E +SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGVISLFPEMFRAITDYGVTGRAVKNGLLSVQCWSPRDFTYDRHRTVDDRPYGGGPGMLMMVQPLREAIHAAKAAAGEGAKVIYLSPQGRKLDQQGVCELATNQKMILVCGRYEGVDERVIKTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHQASAEEDSFVDGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|49258440|pdb|1P9P|A Chain A, The Crystal Structure Of A M1g37 Trna Methyltransferase, Trmd (261 aa)
Score = 452, Expect = 2.6e-43, Identities = 93/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF   LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     7 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 230
>gi|15803129|ref|NP_289160.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli O157:H7 EDL933] >gi|15832724|ref|NP_311497.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli O157:H7 str. Sakai] >gi|16130528|ref|NP_417098.1| tRNA (guanine-1-)-methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|24113945|ref|NP_708455.1| tRNA (guanine-N(1)-)-methyltransferase [Shigella flexneri 2a str. 301] >gi|26248970|ref|NP_755010.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli CFT073] >gi|30064006|ref|NP_838177.1| tRNA (guanine-N(1)-)-methyltransferase [Shigella flexneri 2a str. 2457T] >gi|74313197|ref|YP_311616.1| tRNA (guanine-N(1)-)-methyltransferase [Shigella sonnei Ss046] >gi|82545151|ref|YP_409098.1| tRNA (guanine-N(1)-)-methyltransferase [Shigella boydii Sb227] >gi|82777966|ref|YP_404315.1| tRNA (guanine-N(1)-)-methyltransferase [Shigella dysenteriae Sd197] >gi|89109408|ref|AP_003188.1| tRNA (guanine-1-)-methyltransferase [Escherichia coli W3110] >gi|91211941|ref|YP_541927.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli UTI89] >gi|110642768|ref|YP_670498.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli 536] >gi|157156563|ref|YP_001463926.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli E24377A] >gi|157162083|ref|YP_001459401.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli HS] >gi|168708112|ref|ZP_02740389.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4045] >gi|168734072|ref|ZP_02766349.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4115] >gi|168758676|ref|ZP_02783683.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4401] >gi|168762399|ref|ZP_02787406.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4501] >gi|168773466|ref|ZP_02798473.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4196] >gi|168778585|ref|ZP_02803592.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4076] >gi|168789509|ref|ZP_02814516.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC869] >gi|168793765|ref|ZP_02818772.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4042] >gi|168801724|ref|ZP_02826731.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC508] >gi|170019116|ref|YP_001724070.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli ATCC 8739] >gi|170082211|ref|YP_001731531.1| tRNA (guanine-1-)-methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|170680491|ref|YP_001744790.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli SMS-3-5] >gi|187730506|ref|YP_001881397.1| tRNA (guanine-N1)-methyltransferase [Shigella boydii CDC 3083-94] >gi|188496419|ref|ZP_03003689.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli 53638] >gi|191169054|ref|ZP_03030817.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli B7A] >gi|191174571|ref|ZP_03036066.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli F11] >gi|193064063|ref|ZP_03045148.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli E22] >gi|193071698|ref|ZP_03052599.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli E110019] >gi|194430161|ref|ZP_03062662.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli B171] >gi|194439340|ref|ZP_03071418.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli 101-1] >gi|195940201|ref|ZP_03085583.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli O157:H7 str. EC4024] >gi|67473571|sp|P0A873|TRMD_ECOLI tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166988160|sp|A7ZQ47|TRMD_ECO24 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|166988161|sp|A8A3B4|TRMD_ECOHS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|189036081|sp|B1IVM6|TRMD_ECOLC tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|67473574|sp|P0A874|TRMD_ECOL6 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|67473575|sp|P0A875|TRMD_ECO57 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|67473576|sp|P0A876|TRMD_SHIFL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|118575141|sp|Q0TEN2|TRMD_ECOL5 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119370996|sp|Q31XD8|TRMD_SHIBS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119370997|sp|Q32CY1|TRMD_SHIDS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119370998|sp|Q3YYN1|TRMD_SHISS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|119382738|sp|Q1R8B8|TRMD_ECOUT tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|12517029|gb|AAG57718.1|AE005490_13 tRNA methyltransferase; tRNA (guanine-7-)-methyltransferase [Escherichia coli O157:H7 EDL933] >gi|26109376|gb|AAN81578.1|AE016764_260 tRNA (Guanine-N(1)-)-methyltransferase [Escherichia coli CFT073] >gi|43144|emb|CAA25959.1| unnamed protein product [Escherichia coli] >gi|1788959|gb|AAC75656.1| tRNA (guanine-1-)-methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|1800012|dbj|BAA16492.1| tRNA (guanine-1-)-methyltransferase [Escherichia coli W3110] >gi|13362941|dbj|BAB36893.1| tRNA (guanine-7-)-methyltransferase [Escherichia coli O157:H7 str. Sakai] >gi|24053052|gb|AAN44162.1| tRNA methyltransferase; tRNA (guanine-7-)-methyltransferase [Shigella flexneri 2a str. 301] >gi|30042262|gb|AAP17987.1| tRNA methyltransferase; tRNA (guanine-7-)-methyltransferase [Shigella flexneri 2a str. 2457T] >gi|73856674|gb|AAZ89381.1| tRNA methyltransferase; tRNA (guanine-7-)-methyltransferase [Shigella sonnei Ss046] >gi|81242114|gb|ABB62824.1| tRNA methyltransferase [Shigella dysenteriae Sd197] >gi|81246562|gb|ABB67270.1| tRNA methyltransferase [Shigella boydii Sb227] >gi|91073515|gb|ABE08396.1| tRNA methyltransferase; tRNA (guanine-7-)-methyltransferase [Escherichia coli UTI89] >gi|110344360|gb|ABG70597.1| tRNA (guanine-N(1)-)-methyltransferase [Escherichia coli 536] >gi|157067763|gb|ABV07018.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli HS] >gi|157078593|gb|ABV18301.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli E24377A] >gi|169754044|gb|ACA76743.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli ATCC 8739] >gi|169890046|gb|ACB03753.1| tRNA (guanine-1-)-methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|170518209|gb|ACB16387.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli SMS-3-5] >gi|187427498|gb|ACD06772.1| tRNA (guanine-N1)-methyltransferase [Shigella boydii CDC 3083-94] >gi|187770683|gb|EDU34527.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4196] >gi|188491618|gb|EDU66721.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli 53638] >gi|189003462|gb|EDU72448.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4076] >gi|189354545|gb|EDU72964.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4401] >gi|189367228|gb|EDU85644.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC4501] >gi|189370899|gb|EDU89315.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC869] >gi|189376163|gb|EDU94579.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli O157:H7 str. EC508] >gi|190900895|gb|EDV60681.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli B7A] >gi|190905144|gb|EDV64788.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli F11] >gi|192929298|gb|EDV82907.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli E22] >gi|192954993|gb|EDV85495.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli E110019] >gi|194411786|gb|EDX28107.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli B171] >gi|194421702|gb|EDX37711.1| tRNA (guanine-N1)-methyltransferase [Escherichia coli 101-1] (255 aa)
Score = 452, Expect = 2.6e-43, Identities = 93/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF   LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|124004985|ref|ZP_01689828.1| tRNA (guanine-N1)-methyltransferase [Microscilla marina ATCC 23134] >gi|123989663|gb|EAY29209.1| tRNA (guanine-N1)-methyltransferase [Microscilla marina ATCC 23134] (240 aa)
Score = 452, Expect = 2.6e-43, Identities = 82/219 (37%), Positives = 145/219 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS--KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I +++      +   + SI+K+A    L  IE+ + R++S  +  + DD  +GGGAGMV+ ++PI   I+H+++  +  +++ +TP G+ +NQ++ANQ    ++ I++CGHY+G DER+  Y +  EIS+GDY+++GGE+AA  + D+++RL+P V++   S  ++SF +NLL  P YT+P  + G KVPE+L++G+H  I + R +  I +T+  R D+ 
  S:     1 MHIDIITCLPRLLDSPFSHSIMKRAQEKGLATIEVHDLRDYSTLNQRQTDDYAFGGGAGMVMMIEPIDQCISHLQSKRTYDEIIYMTPDGEPFNQKMANQLSLSQNFIILCGHYKGIDERVREYFITKEISLGDYVISGGELAAAVVTDALVRLVPGVLNDETSALTDSFQDNLLAPPVYTRPEEYKGMKVPEILMTGHHANIEEWRLQKAIERTQQRRPDIL 223
>gi|153813992|ref|ZP_01966660.1| hypothetical protein RUMTOR_00199 [Ruminococcus torques ATCC 27756] >gi|145848388|gb|EDK25306.1| hypothetical protein RUMTOR_00199 [Ruminococcus torques ATCC 27756] (301 aa)
Score = 451, Expect = 2.6e-43, Identities = 106/221 (47%), Positives = 151/221 (68%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDA-----------INHVKTSNS----------------------------KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV--DYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   +L+LF         TSII +A+A  L+ IE VN R+F+ + H  VDD PYGGGAGM++  +P+  A           I + K  N+                            +VV L+P GKT++Q++A +    E L+L+CGHYEG DER++  +  DY +SIGDY+LTGGE+ AM ++D++ RL+P V+  + S E ESF +NLL+YP Y++P  ++G KVP VLLSG+H  I K R+E  I +T   R DL  K
  S:     8 MNFHILTLFPEMVENGLKTSIIGRAVAGGLLSIEAVNIRDFAFNKHQSVDDYPYGGGAGMLMQAEPVYLAYKDIEERIQKRIQNAKMQNAETEEQDAEVKVQNAGIQDAETVSPDKKLRVVYLSPQGKTFDQKMAEELAEEEDLVLLCGHYEGIDERVLEEIVTDY-VSIGDYVLTGGELPAMVMVDTISRLVPGVLHNDVSAEFESFQDNLLEYPQYSRPEEWHGKKVPPVLLSGHHANIEKWRREQSILRTYERRPDLLEK 269
>gi|148272550|ref|YP_001222111.1| putative tRNA (guanine-N1)-methyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|166231356|sp|A5CQR1|TRMD_CLAM3 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|147830480|emb|CAN01415.1| putative tRNA (guanine-N1)-methyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (228 aa)
Score = 451, Expect = 2.7e-43, Identities = 87/219 (39%), Positives = 141/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-----ISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++S+F  FF    + S++ +A  + L+D+ + + R F+ D H  VDDTPYGGGAGMV+  +P  +A++ V   ++   V+  +P+G+ + Q +A +     HL   CG YEG D+R++++         +S+GDY+L GGE+A MA+++++ RL+P V+ +  SL  ES    LL++P+YTKP  + G  VP+VL SGNH  I   R+E Q+ +T+  R DL 
  S:     1 MRIDIVSIFPEFFGVL-DISLLGRARQSGLIDLRVHDLRAFTHDRHRTVDDTPYGGGAGMVMRPEPWGEAMDEVLADDTDPVVIFPSPAGEVFTQAMAQELSAEPHLAFGCGRYEGIDQRVVDHTATRARVRLVSLGDYVLNGGEVAVMAMIEAIGRLVPGVVGNPASLVEESHSEGLLEHPSYTKPPEWRGLAVPDVLRSGNHAAIAAWRREQQLERTRRVRPDLL 226
>gi|148244420|ref|YP_001219114.1| tRNA (guanine-N1-)-methyltransferase [Candidatus Vesicomyosocius okutanii HA] >gi|146326247|dbj|BAF61390.1| tRNA (guanine-N1-)-methyltransferase [Candidatus Vesicomyosocius okutanii HA] (224 aa)
Score = 451, Expect = 2.8e-43, Identities = 99/208 (47%), Positives = 146/208 (70%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQI 208
           M+  +++LF N FN  K+  ++ +AI  + + + I   R+FS + +  +DD PYGGG GMV+ ++PI D IN +K S+  +K++ L+P G+    ++  +   F+ + L+CG YEG DERIIN+ +D EISIGDYI++GGE+AAM ++D+V R IPNV+ ++NSL ++SF NNLLDYPNYT+P   +  KVPEVLLSG+   IN  R E  I
  S:     1 MRFDIITLFPNMFNIIKDEGVVARAIKKSHLSVHIWQLRDFSNNKYKNIDDKPYGGGGGMVMQVKPIRDCINKIKQSSPKTKIIYLSPQGQPLKHKLTKELSMFDAITLLCGRYEGVDERIINHDIDMEISIGDYIISGGELAAMVLIDTVSRQIPNVLGNINSL-NDSFTNNLLDYPNYTRPKIIDNQKVPEVLLSGHQANINIWRIEQSI 211
>gi|50086296|ref|YP_047806.1| tRNA (guanine-1-)-methyltransferase. [Acinetobacter sp. ADP1] >gi|51704319|sp|Q43963|TRMD_ACIAD tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|49532272|emb|CAG69984.1| tRNA (guanine-1-)-methyltransferase. [Acinetobacter sp. ADP1] (249 aa)
Score = 451, Expect = 2.8e-43, Identities = 94/221 (42%), Positives = 137/221 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-------SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERII-NYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M   V++LF   F       I  +A    +  +  +N R+F++ ++ +VD+ P+GGG GMV+  +P+  AI H K         ++ VV ++P GKT N+    QF  ++ LI++CG YEG DER+I +YVD E SIGDY+L+GGE+ AM +LDS+IR +P+ +S   S   +SF + LLD P YTKP +F G  VPEVL SG+H  I K R   +  +T   R +L  K
  S:     1 MFFAVITLFPEMFEAITAYGISGRATKRQIATVSCINPRDFAEGNYKRVDERPFGGGPGMVMMAEPLAKAIIHAKQLAEQAGCVHAPVVYMSPQGKTLNEHAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPDAMSDEQSHIQDSFVDGLLDCPQYTKPDHFEGLDVPEVLKSGHHANIEKWRFLQRYQRTLDRRPELVEK 230
>gi|170781189|ref|YP_001709521.1| tRNA (guanine-N1)-methyltransferase [Clavibacter michiganensis subsp. sepedonicus] >gi|189036074|sp|B0REN1|TRMD_CLAMS tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|169155757|emb|CAQ00878.1| tRNA (guanine-N1)-methyltransferase [Clavibacter michiganensis subsp. sepedonicus] (228 aa)
Score = 451, Expect = 2.9e-43, Identities = 87/219 (39%), Positives = 142/219 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK--VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-----ISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+I ++S+F  FF    + S++ +A  + L+D+ + + R F+ D H  VDDTPYGGGAGMV+  +P  +A++ V   ++   V+  +P+G+ + Q +A +     HL   CG YEG D+R++++         +S+GDY+L GGE+A MA+++++ RL+P V+ +  SL  ES  + LL++P+YTKP  + G  VP+VL SGNH  I   R+E Q+ +T+  R DL 
  S:     1 MRIDIVSIFPEFFGVL-DISLLGRARQSGLIDLRLHDLRAFTHDRHRTVDDTPYGGGAGMVMRPEPWGEAMDEVLADDTDPVVIFPSPAGEVFTQAMAQELSAEPHLAFGCGRYEGIDQRVVDHTATRARVRLVSLGDYVLNGGEVAVMAMIEAIGRLVPGVVGNPASLVEESHSDGLLEHPSYTKPPEWRGLAVPDVLRSGNHGAIAAWRREQQLERTRRVRPDLL 226
>gi|62181245|ref|YP_217662.1| tRNA (guanine-N(1)-)-methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167553525|ref|ZP_02347274.1| tRNA (guanine-N(1)-)-methyltransferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168262154|ref|ZP_02684127.1| tRNA (guanine-N(1)-)-methyltransferase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|75505618|sp|Q57L31|TRMD_SALCH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|62128878|gb|AAX66581.1| tRNA (guanine-7-)-methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (255 aa)
Score = 451, Expect = 3.0e-43, Identities = 93/219 (42%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L++I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+    +++E +SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MFIGIVSLFPEMFRAITDYGVTGRAVKNGLLNIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGVDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASAIE-DSFADGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|94969902|ref|YP_591950.1| tRNA (Guanine37-N1) methyltransferase [Acidobacteria bacterium Ellin345] >gi|119382716|sp|Q1IMM4|TRMD_ACIBL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|94551952|gb|ABF41876.1| tRNA (Guanine37-N1) methyltransferase [Acidobacteria bacterium Ellin345] (264 aa)
Score = 451, Expect = 3.1e-43, Identities = 93/219 (42%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT------SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYV-DYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESF----------------DNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           MKI ++++F  FF    +  I+ +A    LV+I I + R F+ D H  VDD P+GGG GMVL  +PI + +  ++        N +V++L+P G+ ++Q +A +    + L+LI G YEG DER+   + D EIS+GD++L+GGE+ +  I+D+V RL+P  + + +S   ESF                   LLDYP+YT+P  F GY VP+VL  GNH EI + R+   + KT  NR DL 
  S:     1 MKIDLITIFPEFFRGPLDHGIVSRAQKAGLVEITIRDLREFTHDRHRTVDDRPFGGGEGMVLKPEPIFECLEAMEIPPRGNRENVQVLVLSPQGRLFDQTMALELSKLDRLVLINGRYEGVDERVSEVLADGEISVGDFVLSGGELGSAIIVDAVTRLLPGALGNADSARQESFTAVAKEISEGPDSTCASGGLLDYPHYTRPAEFRGYVVPQVLQDGNHAEIQRWRRRRALEKTFKNRPDLL 243
>gi|169184174|ref|ZP_02844556.1| tRNA (guanine-N1)-methyltransferase [Thauera sp. MZ1T] >gi|169008800|gb|EDS55594.1| tRNA (guanine-N1)-methyltransferase [Thauera sp. MZ1T] (282 aa)
Score = 451, Expect = 3.3e-43, Identities = 85/215 (39%), Positives = 137/215 (63%)
  Q:     5 VLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS-------NSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           V++LF   F     + I ++AI   L  +   N R+F+ D H  VDD PYGGG GMV+  +P++ AI   +T+       + +V+ L+P G+   Q++  +      L+L+CG YEG D+R+I+  VD E+S+GD++L+GGE+ AM +LD+++R +P  + +  S + +SF + LLD P+YT+P  +   +VPEVLLSGNH  I + R +  + +T + R DL 
  S:    27 VITLFPEMFAALTGSGITRRAIDRGLYALGFHNPRDFTSDPHRTVDDRPYGGGPGMVMLAEPLMQAIRAARTAQERALGRSGRVIYLSPQGRRLEQEVVLELAAEPALVLLCGRYEGVDQRLIDREVDEELSLGDFVLSGGELPAMVLLDAIVRQLPGALNTAGSAQEDSFADGLLDCPHYTRPERYEDERVPEVLLSGNHAAIRRWRLKQSLGRTWLRRPDLL 250
>gi|116073384|ref|ZP_01470646.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. RS9916] >gi|116068689|gb|EAU74441.1| tRNA (guanine-N1)-methyltransferase [Synechococcus sp. RS9916] (235 aa)
Score = 450, Expect = 3.6e-43, Identities = 89/224 (39%), Positives = 139/224 (62%)
  Q:     2 KITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT-SNSKVVLLTPSGKTYNQQIANQF-KTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIKYLKE 225
           ++ VLSL    F       +I +A A  + ++ + N R+F+ D + KVDD PYGGGAGMVL  +P+  A   V      +V+L++P G+   Q    ++  + + L+++CGHYEGFDERI    D E+S+GD++LTGGE+ AM I++ V+RL+P  + +  SL  ES  + LL++P+YT+P  F G  VPEVL SG+H  I   R+  +  +T+  R DL  ++ ++
  S:     5 RLDVLSLAPQAFAPLLELGVIGRAFAAGIAELHVHNPRDFATDKYRKVDDIPYGGGAGMVLKPEPVYAAFEAVPVLPRRRVLLMSPQGQPLKQADLQRWADSCDQLVMLCGHYEGFDERIRPLADEEVSLGDFVLTGGELPAMTIINGVVRLLPGTVGTAASLVEESHSDLLLEHPHYTRPAEFRGMTVPEVLRSGDHAAIEAWRQAQREERTQARRPDLHQRWQEQ 231
>gi|152980226|ref|YP_001352283.1| tRNA (guanine-N(1)-)-methyltransferase [Janthinobacterium sp. Marseille] >gi|166200430|sp|A6SVI6|TRMD_JANMA tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|151280303|gb|ABR88713.1| tRNA (guanine-N1)-methyltransferase [Janthinobacterium sp. Marseille] (249 aa)
Score = 450, Expect = 3.9e-43, Identities = 91/221 (41%), Positives = 134/221 (60%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNS-------KVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  V++LF   F     + I ++A       + + N R+F+ D H  VDD PYGGG GMV+ ++P+  A+   K   +       +VV L+P GK    +   Q  T   L+L+CG YE  D+R ++  VD EIS+GD++L+GGEI AMA++D+VIR +P V+  + S   +SF N LLD P+YT+P  + G  VP VL+ G+H EI K R+E  +  T   R DL +K
  S:     1 MQFDVVTLFPEMFTAITQSGITRRAFEQKKCALSLWNPRDFTSDKHRTVDDRPYGGGPGMVMMVKPLEAAVQAAKARQTEQGLAAPRVVYLSPQGKALTHERVMQLTTEPGLVLLCGRYEAVDQRFLDSCVDEEISLGDFVLSGGEIPAMALMDAVIRQLPGVLHDDASAVEDSFVNGLLDCPHYTRPEVYEGAAVPAVLMGGHHVEIEKWRRERALEATARKRPDLIVK 230
>gi|54293391|ref|YP_125806.1| hypothetical protein lpl0440 [Legionella pneumophila str. Lens] >gi|84029220|sp|Q5WZE2|TRMD_LEGPL tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|53753223|emb|CAH14670.1| hypothetical protein [Legionella pneumophila str. Lens] (250 aa)
Score = 450, Expect = 4.4e-43, Identities = 94/201 (46%), Positives = 133/201 (66%)
  Q:    21 IIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTS---NSKVVLLTPSGKTYNQ----QIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVIS-VNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +  +AI   LV I+  N R++S   + +VDD PYGGG GMV+  +P+  AI H ++    N K + L+P GK   Q    QIA Q ++   L+ + G YEG DERII++ VD E S+GD++L+GGE+AAM  +D++IRLIP  +  + S   +SF N LLD P+YT+P   NG  VP+VLL GNHKEI + R++  + KT + R DL  K
  S:    22 VTGRAIEQGLVKIDCWNPRDWSSRPYKQVDDKPYGGGPGMVIMYEPLHAAIKHARSEMKENCKTIYLSPQGKVVRQNDLKQIAAQKQS---LLFVAGRYEGIDERIISHHVDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLGHLGSAVQDSFMNGLLDCPHYTRPATINGLDVPDVLLGGNHKEIERWRRKQSLGKTWLKRPDLLEK 228
>gi|46579249|ref|YP_010057.1| tRNA (guanine-N1)-methyltransferase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603188|ref|YP_967588.1| tRNA (guanine-N1)-methyltransferase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|85543858|sp|Q72DU3|TRMD_DESVH tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|46448663|gb|AAS95316.1| tRNA (guanine-N1)-methyltransferase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563417|gb|ABM29161.1| tRNA (guanine-N1)-methyltransferase [Desulfovibrio vulgaris subsp. vulgaris DP4] (425 aa)
Score = 449, Expect = 4.5e-43, Identities = 86/219 (39%), Positives = 137/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYE-ISIGDYILTGGEIAAMAILDSVIRLIPNVISV-NSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M+ T+L+LF  FF+   +  ++ KA  + L+D+ +VN R ++ D H+ VDD PYGGG GMV+ ++P   A+  ++    +++++ P G+ + Q +A +    E L ++CG YEGFD R+      E +S+GD++L GGE AA+A+L++V RL+P  +    S   ESF   LL+YP+YT+P ++ G+ VPEVL SG+H  I   RKE  +  T   R D+ 
  S:     1 MRCTILTLFPEFFDSPLDAGLMGKARESGLIDVALVNPRAYTTDRHSTVDDRPYGGGPGMVMRVEPWEKALQGIEEP-GRILMMAPKGRPFTQAMARELAQEESLTILCGRYEGFDARLEEIYPIEAVSMGDFVLNGGETAALAVLEAVSRLVPGFMGKEESGTEESFSAGLLEYPHYTRPEDYAGHVVPEVLRSGDHGRIAAWRKECSLRLTLSQRPDIL 220
>gi|110806725|ref|YP_690245.1| tRNA (guanine-N(1)-)-methyltransferase [Shigella flexneri 5 str. 8401] >gi|123146752|sp|Q0T175|TRMD_SHIF8 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|110616273|gb|ABF04940.1| tRNA methyltransferase [Shigella flexneri 5 str. 8401] (255 aa)
Score = 449, Expect = 4.8e-43, Identities = 93/219 (42%), Positives = 135/219 (61%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF   LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R  L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPKLL 224
>gi|157164613|ref|YP_001466985.1| tRNA (guanine-N(1)-)-methyltransferase [Campylobacter concisus 13826] >gi|112800967|gb|EAT98311.1| tRNA (guanine-N1)-methyltransferase [Campylobacter concisus 13826] (230 aa)
Score = 449, Expect = 5.0e-43, Identities = 93/221 (42%), Positives = 142/221 (64%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKT--SNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVN-SLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           MK T ++LFEN    +   SI+K+AI+N  ++I  +N RNF+ D HNKVDD   GGGAG+++  QP+ ++I  +K    N+ V+ LTP+GK ++Q  A +    +H+  +C  YEG DER++  + D    IGD+ILTGGE+ A+ + D++ R +P V+  + SLE ESF+ NLL+ P++TKP NF    V    L GNH +I+ ++ +    KT+  R DL+ K
  S:     1 MKFTFITLFENLVKPYFCDSILKRAISNKFIEIVFINPRNFTNDKHNKVDDYMIGGGAGLLMFPQPLDESIKFLKEKDKNTHVIFLTPAGKKFSQNDAKRLSKKDHICFVCSRYEGLDERVVELWADEVFCIGDFILTGGELPALCMSDAISRNVPGVLGNDMSLEVESFEGNLLEAPSFTKPDNFKSLFVVSEFLKGNHAKIHNLKNKMAHCKTRYFRPDLYQK 225
>gi|168464153|ref|ZP_02698070.1| tRNA (guanine-N1)-methyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195633675|gb|EDX52089.1| tRNA (guanine-N1)-methyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (255 aa)
Score = 448, Expect = 5.9e-43, Identities = 92/219 (42%), Positives = 140/219 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI--SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L++I+  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + +IL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+    +++E +SF + LLD P+YT+P    G +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MFIGIVSLFPEMFRAITDYGVTGRAVKNGLLNIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKIILVCGRYEGVDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASAIE-DSFADGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|118047171|ref|ZP_01515812.1| tRNA (guanine-N1)-methyltransferase [Chloroflexus aggregans DSM 9485] >gi|117996339|gb|EAV10539.1| tRNA (guanine-N1)-methyltransferase [Chloroflexus aggregans DSM 9485] (255 aa)
Score = 448, Expect = 5.9e-43, Identities = 102/221 (46%), Positives = 144/221 (65%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSNSK---VVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+  +L+LF   F      SI+K+A     + I + + R+++ D H  VDD PYGGGAGMV+  +P+  AI  V+ ++     VVLLTP G+ +NQ IA +  T   LIL+CGHYEG DER+    VD EISIGDY+LTGGE+AAM ++D+V RL+P VI   S+  ES  + LL+YP+YT+P  + G  VP +LLSG+H EI + R+  ++ +T   R DL  +
  S:     1 MRFDILTLFPAMFQGPLTESILKRAQQAGKITIHLHDIRDWATDRHRTVDDAPYGGGAGMVMKAEPLAAAIRAVQAADEPGGPVVLLTPDGELFNQSIARELATLPRLILVCGHYEGIDERVRERLVDREISIGDYVLTGGELAAMVVVDAVARLVPGVIDSESIVEESHSDFLLEYPHYTRPAVWEGLAVPSILLSGHHGEIARWRRSERLRRTLARRPDLLAR 225
>gi|152971457|ref|YP_001336566.1| tRNA (guanine-N(1)-)-methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166200431|sp|A6TCL5|TRMD_KLEP7 tRNA (guanine-N(1)-)-methyltransferase (M1G-methyltransferase) (tRNA [GM37] methyltransferase) >gi|150956306|gb|ABR78336.1| tRNA (guanine-N(1)-)-methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (255 aa)
Score = 448, Expect = 6.2e-43, Identities = 93/219 (42%), Positives = 136/219 (62%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVD---AINHVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINY-VDYEISIGDYILTGGEIAAMAILDSVIRLIPNVISVNSLESE-SFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLF 219
           M I ++SLF   F    +  +  +A+ N L+ IE  + R+F+ D H  VDD PYGGG GM++ +QP+ D   A        +KV+ L+P G+  +Q   ++  T + LIL+CG YEG DER+I   +D E SIGDY+L+GGE+ AM ++DSV R IP V+   +  +E SF + LLD P+YT+P      +VP VLLSGNH EI + R +  + +T + R +L 
  S:     1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIESWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFADGLLDCPHYTRPEVLEEMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL 224
>gi|86142834|ref|ZP_01061273.1| tRNA (guanine-N(1)-)-methyltransferase [Flavobacterium sp. MED217] >gi|85830866|gb|EAQ49324.1| tRNA (guanine-N(1)-)-methyltransferase [Leeuwenhoekiella blandensis MED217] (225 aa)
Score = 448, Expect = 6.3e-43, Identities = 88/221 (39%), Positives = 148/221 (66%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAINHVKTSN--SKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIIN-YVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFDNNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           M+I ++++           SI++++IA  LV++   N R+++ +++ +VDD  YGGGAGMV+ ++PI   I+ +K      +V+ +TP G+T NQ IAN     +++I++CGHY+G D+R+ + ++  EISIGDY+L+GGE+ A+ + D+VIRLIP V+ +  S  ++SF +++L  P YT+P  + G+KVPE+L SGN  +I   R+E Q  K  +NR+   +K
  S:     1 MRIDIITVVPELLKSPFEASIMQRSIAKGLVEVHFHNLRDYTTNAYKQVDDYQYGGGAGMVMMIEPIDKCISGLKAERDYDEVIYMTPDGETLNQGIANTISLQKNIIILCGHYKGVDQRVRDQFITREISIGDYVLSGGELGALILCDAVIRLIPGVLGNETSALTDSFQDDMLAPPVYTRPAEYKGWKVPEILTSGNTPKIEAWREE-QAYKHTLNRRPDLLK 224
>gi|163768715|ref|ZP_02175698.1| tRNA (guanine-N1)-methyltransferase [Anaeromyxobacter sp. K] >gi|196172221|gb|ACG73194.1| tRNA (guanine-N1)-methyltransferase [Anaeromyxobacter sp. K] (247 aa)
Score = 448, Expect = 6.7e-43, Identities = 92/221 (41%), Positives = 140/221 (63%)
  Q:     1 MKITVLSLFENFFNEFKNTSIIKKAIANNLVDIEIVNFRNFSKDSHNKVDDTPYGGGAGMVLTLQPIVDAIN--HVKTSNSKVVLLTPSGKTYNQQIANQFKTFEHLILICGHYEGFDERIINYVDYEISIGDYILTGGEIAAMAILDSVIRLIPNVI-SVNSLESESFD--NNLLDYPNYTKPYNFNGYKVPEVLLSGNHKEINKVRKEWQINKTKINRKDLFIK 221
           +++ +L+LF      +   SI+ KA    L+   I + R+ +   H   DD PYGGGAGMV+  +P+V+AI     +   + VVL +P G   +Q +A +F     LIL+CG YEG DER++  VD ++SIGD++LTGGE+AA+ ++D+  RL+P V+ +  S ++ESF     LL++P YT+P  F G KVPEVLLSG+H+ I + R+   +  T+  R DLF +
  S:     4 LEVDILTLFPRMCAGYLGESILGKAQEAGLLAATITDIRDHATGKHRVCDDAPYGGGAGMVMKPEPLVEAIEAARARLPGAWVVLTSPRGARLDQALARRFAEHGRLILVCGRYEGVDERVMTAVDMQVSIGDFVLTGGELAALCVVDAAARLVPGVLGNAASADAESFAGVEGLLEHPQYTRPPEFRGMKVPEVLLSGDHRRIERWRRREALRATRERRPDLFAR 229