>gi|26553557|ref|NP_757491.1| hypothetical protein MYPE1035 [Mycoplasma penetrans HF-2] >gi|26453563|dbj|BAC43895.1| predicted coding region [Mycoplasma penetrans HF-2] (56 aa)
Score = 260, Expect = 1.6e-21, Identities = 56/56 (100%), Positives = 56/56 (100%)
  Q:     1 MLTTRFNCFDNSWMALLLYSTSFDQTGLHHFPINRVEIVSLPVTRPIYIVAYKVVM 56
           MLTTRFNCFDNSWMALLLYSTSFDQTGLHHFPINRVEIVSLPVTRPIYIVAYKVVM
  S:     1 MLTTRFNCFDNSWMALLLYSTSFDQTGLHHFPINRVEIVSLPVTRPIYIVAYKVVM 56