>gi|26553558|ref|NP_757492.1| purine nucleoside phosphorylase [Mycoplasma penetrans HF-2] >gi|26453564|dbj|BAC43896.1| purine nucleoside phosphorylase [Mycoplasma penetrans HF-2] (246 aa)
Score = 1188, Expect = 1.3e-128, Identities = 246/246 (100%), Positives = 246/246 (100%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN 246
           MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN
  S:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN 246
>gi|13357841|ref|NP_078115.1| purine-nucleoside phosphorylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762063|ref|YP_001752365.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920394|ref|ZP_02931719.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508751|ref|ZP_02958225.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701948|ref|ZP_02971587.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11280173|pir||G82909 purine-nucleoside phosphorylase UU281 [imported] - Ureaplasma urealyticum >gi|6899254|gb|AAF30690.1|AE002125_1 purine-nucleoside phosphorylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827640|gb|ACA32902.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902832|gb|EDT49121.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675684|gb|EDT87589.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700701|gb|EDU18983.1| purine nucleoside phosphorylase [Ureaplasma parvum serovar 6 str. ATCC 27818] (239 aa)
Score = 662, Expect = 1.4e-67, Identities = 136/236 (57%), Positives = 179/236 (75%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGAN-RSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           MT HN+AK GEIAKVVLMPGDP+RAKWIAE FLEN  L+N+VRGML YTG Y  K++++MGHGMG+ SIGIYSYEL+ FY+V+ IIRVGS GSY KD+NV D+VL +K+YS+ST+A  IG +   D  L  S E+N++I+ TA E N++L+    H+SD+FY  + +++++I   TKS  V+MESF LFANA  LNK AATLLT SDSL+T +++S  +R   F  M+ LAL+   K+
  S:     1 MTAHNQAKLGEIAKVVLMPGDPMRAKWIAETFLENAILVNEVRGMLCYTGTYKGKKISIMGHGMGIPSIGIYSYELYKFYEVETIIRVGSTGSYKKDLNVNDVVLVEKSYSDSTFASLIGAQVGDDKVLLPSREVNNLIKNTAKELNLELSLATCHASDVFYNNDFQTLDEIIHRTKSDCVDMESFGLFANAQILNKNAATLLTVSDSLITGDALSPAERANTFKKMVTLALESAIKL 238
>gi|31544790|ref|NP_853368.1| purine nucleoside phosphorylase [Mycoplasma gallisepticum R] >gi|31541636|gb|AAP56936.1| DeoD [Mycoplasma gallisepticum R] (237 aa)
Score = 630, Expect = 6.4e-64, Identities = 137/236 (58%), Positives = 165/236 (69%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           MTPH +AKK EIAK V+MPGDPLRAKWIAE FLE+ KL+N+VR M  YTG Y NK VTVMGHGMG  SIGIY++EL+ FYDV+ IIRVGS G+  KD+N+GD++L  KAYSES YA  IG++  D T   S +L ++ RKTA E  IK  + +V   D FY    + +Q      +  VEME F+L ANA K  K A T+LT SDSLVTHESMS E RQT F NM+ LAL V  K+
  S:     2 MTPHIKAKKEEIAKTVIMPGDPLRAKWIAETFLEDYKLVNEVRNMFAYTGKYKNKLVTVMGHGMGNPSIGIYTHELYNFYDVENIIRVGSCGALVKDVNLGDVILESKAYSESPYAMLIGVDVVDKTNYPSAKLLELSRKTADELKIKYHEGLVICEDAFYQTLYTPKQANEKWNAIAVEMEGFALNANAQKAKKHAMTILTVSDSLVTHESMSPEKRQTTFKNMMELALNVANKL 237
>gi|13507801|ref|NP_109750.1| purine nucleoside phosphorylase [Mycoplasma pneumoniae M129] >gi|2494057|sp|P75053|DEOD_MYCPN Purine nucleoside phosphorylase deoD-type (PNP) >gi|1673747|gb|AAB95740.1| purine-nucleoside phosphorylase [Mycoplasma pneumoniae M129] (238 aa)
Score = 622, Expect = 6.0e-63, Identities = 120/236 (50%), Positives = 167/236 (70%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEA-KDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           MTPH  AKK +IAKVVLMPGDPLRAKWIAE F+E P+L+N+VRGML +TG Y  K +T+MGHGMG+ SIGIYSYEL  FY+V+ IIR+GS G+    +N+ DL++  KA+SES YA  +G+E   D  L  S +L ++ +KTA +  +   + +V   D F+   + V ++A +  +  VEME+ +L+ANA+ LNK+A T+LT SDSLVTH ++ AE RQ  F NM  L+L++  ++
  S:     1 MTPHINAKKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGMLAFTGQYKGKTITIMGHGMGIPSIGIYSYELMKFYEVNTIIRIGSCGALQGSLNLQDLIIAAKAWSESIYANDMGVEVPADKILMASPQLVELAKKTANQLQLAFHEGLVFCEDAFHQIRKDVLKLAQEKHALAVEMEAHALYANAMLLNKQALTMLTVSDSLVTHAALPAEQRQATFKNMAILSLEMASQL 237
>gi|108885079|ref|NP_072709.2| purine nucleoside phosphorylase [Mycoplasma genitalium G37] >gi|2506346|sp|P47295|DEOD_MYCGE Purine nucleoside phosphorylase deoD-type (PNP) >gi|84626160|gb|AAC71265.2| purine nucleoside phosphorylase [Mycoplasma genitalium G37] >gi|166078972|gb|ABY79590.1| purine nucleoside phosphorylase [synthetic Mycoplasma genitalium JCVI-1.0] (238 aa)
Score = 587, Expect = 5.9e-59, Identities = 128/236 (54%), Positives = 168/236 (71%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           MTPH  AKK +I+KVVLMPGDPLRAKWIAE FL+  KL+N+VRGM  YTG Y +K VTVMGHGMG+ SIGIYSYEL  FY+V+ IIR+GS G+    + + DLV+  KA+SES YAK +G+E  +D  L  +  L ++ ++TAI+N +   + +V   D FY   + V  +A +  S  VEME+ +L+ANAI L KKA TLLT SDSLVTHE++S+E RQ  F  M  LAL++ +K+
  S:     1 MTPHISAKKDDISKVVLMPGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSKTVTVMGHGMGIPSIGIYSYELMNFYEVETIIRIGSCGALAPQLKLKDLVIASKAWSESIYAKDMGVEIPEDKILFATSSLVELAKETAIKNKLDFHEGLVFCEDAFYQTRKDVISLAKEKNSLAVEMEAHALYANAILLKKKALTLLTVSDSLVTHEALSSELRQKSFKQMALLALEMTQKL 237
>gi|47459370|ref|YP_016232.1| purine-nucleoside phosphorylase [Mycoplasma mobile 163K] >gi|47458700|gb|AAT28021.1| purine-nucleoside phosphorylase [Mycoplasma mobile 163K] (233 aa)
Score = 582, Expect = 2.5e-58, Identities = 127/232 (54%), Positives = 162/232 (69%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENP-KLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           MTPH +AK GEIAK VLMPGDPLRAK+IAENFL+   K++NDVR ML +TG Y  + +T+   GMG  SIGIYSYELF FY V+ IIR+GSAGSY KD+ + D++L   +YS+S     + +      +EGS  LND IR  A    + L +  VHSSD+FY + RS+E    +TKS+ VEMESF+LF NA KLNK AA +LT SD+L+T E  SAE+RQ  F  M+ LAL++
  S:     1 MTPHIKAKVGEIAKTVLMPGDPLRAKYIAENFLDKGFKVVNDVRNMLFFTGTYKGRAITIAASGMGCPSIGIYSYELFKFYGVENIIRIGSAGSYEKDLKLYDILLATSSYSDSNSFAKLVLNESTHEIEGSKILNDRIRTIAKSKKMNLHEGRVHSSDVFY-STRSLENTIKETKSRAVEMESFALFVNAKKLNKNAACILTISDNLITKEETSAEERQNNFTKMMELALEL 232
>gi|153810926|ref|ZP_01963594.1| hypothetical protein RUMOBE_01316 [Ruminococcus obeum ATCC 29174] >gi|149832814|gb|EDM87897.1| hypothetical protein RUMOBE_01316 [Ruminococcus obeum ATCC 29174] (237 aa)
Score = 570, Expect = 5.0e-57, Identities = 124/230 (53%), Positives = 156/230 (67%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR--SVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  AKKGEIAK VLMPGDPLRAK++AE+FLE+ +L+N VR +  YTG Y  KE+TVM  GMGM SIGIYSYEL+ FYDVD IIR+GSAG+YT  + V D+VL   A+S+S++AK +     D  L  S+ LN  I   A    I L    +HSSD+FY  +     ++I    + + VEMESF+LF NA  L K AA LLT SDS VTHE +S+  RQ  F NM+ +AL+
  S:     5 TPHIEAKKGEIAKNVLMPGDPLRAKYVAEHFLEDARLVNQVRNVYAYTGTYKGKELTVMASGMGMPSIGIYSYELYKFYDVDNIIRIGSAGAYTDRLAVYDVVLADSAWSQSSFAK-VQNGCMDDVLYPSEALNTRILDAAHCLQIPLKTARIHSSDVFYTEDNVDGYKEIIKKHQCECVEMESFALFHNAKLLGKNAACLLTISDSFVTHEELSSLARQESFENMMKIALE 235
>gi|15829116|ref|NP_326476.1| purine nucleoside phosphorylase (inosine phosphorylase) (PNP) [Mycoplasma pulmonis UAB CTIP] >gi|14090060|emb|CAC13818.1| PURINE NUCLEOSIDE PHOSPHORYLASE (INOSINE PHOSPHORYLASE) (PNP) [Mycoplasma pulmonis] (232 aa)
Score = 559, Expect = 1.1e-55, Identities = 121/232 (52%), Positives = 163/232 (70%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           MTPH  AKKGEIAKVVLMPGDPLRAK +AE +L+N KL++ VR    YTG Y  K++++   GMG ASIGIYS+ELF  Y+V+ IIRVG++GSY KD+N+GD+VL K AY+++     +     ++    S ELN+ I K A +  I + ++ VHSSD+FY A R +E+    T+SQ VEME+ +LFA A K NK+AATLLT SD+L+THE  S++ RQ  F  M  +AL++
  S:     1 MTPHINAKKGEIAKVVLMPGDPLRAKTMAEKYLKNYKLVSSVRNAFIYTGEYKGKQISIAASGMGCASIGIYSHELFDKYEVEKIIRVGTSGSYVKDLNIGDVVLAKSAYTDNQNFSLVLSGKAENVFYPSKELNEQISKIAKDLLIPIKEIQVHSSDVFY-ATRPLEETIKITQSQAVEMEASALFAVANKFNKQAATLLTISDNLITHEEASSQTRQNNFTKMFEIALEI 231
>gi|71894460|ref|YP_278568.1| purine-nucleoside phosphorylase [Mycoplasma synoviae 53] >gi|71851248|gb|AAZ43857.1| purine-nucleoside phosphorylase [Mycoplasma synoviae 53] (232 aa)
Score = 549, Expect = 1.6e-54, Identities = 127/232 (54%), Positives = 162/232 (69%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           MTPH  A+K EIAK+VLMPGDPLRAK+IAE +L++ KL+N VR M  YTG Y  K++++ G GMG  SIGIYS+ELF FYDV+ IIR+GS GSY KD+   DLVL K AYS+S+  KY  +  K      S ELN+ I+K A    IKL    VHSSDIFY +   +E+  S +K+  VEMES++LF NA  LNK+AA LLT SD+L+THE  SA +RQ  F  M+ +AL++
  S:     1 MTPHITAQKDEIAKIVLMPGDPLRAKFIAETYLQDYKLVNTVRNMFIYTGTYKGKKISIAGSGMGCPSIGIYSFELFKFYDVEKIIRIGSTGSYKKDLKNYDLVLAKSAYSDSSAYKYNMLRKKSRLAFPSKELNEQIKKIAKSKKIKLNLGRVHSSDIFY-SQIPLEERISTSKAISVEMESYALFVNAEFLNKQAACLLTVSDNLITHEVTSALERQNSFTKMMEIALEI 231
>gi|148377773|ref|YP_001256649.1| purine nucleoside phosphorylase (inosinephosphorylase) [Mycoplasma agalactiae PG2] >gi|148291819|emb|CAL59209.1| Purine nucleoside phosphorylase (Inosinephosphorylase) [Mycoplasma agalactiae PG2] (233 aa)
Score = 546, Expect = 3.4e-54, Identities = 120/232 (51%), Positives = 159/232 (68%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFL-ENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           MTPH  A KG IAK+VLMPGDPLRAK+IAE FL E  +L+N VR +  YTG Y  K+V++   GMG  SIGIYSYELF FYDVD IIRVGS G+Y +D+ + D VL   AY++S   + + +         S  LN+ I+K+A   NI+L  V  HSSD+FY +    ++IA ++ +  VEMES++LF NA KL K+AA LLT SD+L+THE  + E+RQT F NM+ +AL++
  S:     1 MTPHINAPKGSIAKLVLMPGDPLRAKYIAETFLDEGYELVNTVRNVFMYTGTYKGKKVSIAASGMGCPSIGIYSYELFKFYDVDKIIRVGSTGAYVEDLKLYDTVLVDSAYADSNAFRKLVLNDHSYVAYPSASLNEEIKKSAQNLNIELKTVRTHSSDVFYSSVPLSQRIA-ESNAACVEMESYALFTNAEKLGKQAACLLTVSDNLITHEETTPEERQTSFKNMMKIALEL 232
>gi|110005263|emb|CAK99588.1| probable purine nucleoside phosphorylase transmembrane protein [Spiroplasma citri] (236 aa)
Score = 541, Expect = 1.3e-53, Identities = 124/230 (53%), Positives = 154/230 (66%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MTPH  AKK EIAKVVLMPGDPLRAK +AE +L N KL+N+VR ML YTG Y N EVT+ G GMG  SIGIYSYELF FYDVD IIR+GSAGSY  +I V D+   ++A+ ES YAK I      + +  S++L + I   A    IK    + H++D+FY  + S++ I +     VVEMES++LF NAI   K AATLLT SD LVT E  +A +RQ  F+ M+ LAL
  S:     1 MTPHINAKKEEIAKVVLMPGDPLRAKTVAEKYLTNLKLVNEVRNMLMYTGKYKNIEVTIAGSGMGCPSIGIYSYELFKFYDVDYIIRIGSAGSYNPNIKVYDIFNVREAFGESNYAK-IAANIDSNLIAASEKLFNEIEAVAQAKGIKTHTGIAHAADVFYRYDDSLDFIHTHNLD-VVEMESYALFTNAIVTQKHAATLLTVSDHLVTKEVTTALERQNNFMTMVELAL 228
>gi|50365480|ref|YP_053905.1| purine-nucleoside phosphorylase [Mesoplasma florum L1] >gi|50364036|gb|AAT76021.1| purine-nucleoside phosphorylase [Mesoplasma florum L1] (235 aa)
Score = 535, Expect = 7.0e-53, Identities = 122/237 (51%), Positives = 157/237 (66%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN 246
           MTPH  AKK +IAK VLMPGDPLRAK IAE +LEN KL+N+VR M  YTG Y   +VT+ G GMG  SIGIYSYELF FY+V+ IIR+GSAGSY ++I V D+   K+AY +S YAK +     D  ++  D+L  +I K A +  IK      HS+D+FY  +  + +   +    VVEMES +LFANAIK  K+AA LLT SD+LVT E  +AE+RQ  F+ M+ +AL    + N
  S:     1 MTPHISAKKEDIAKTVLMPGDPLRAKKIAETYLENVKLVNEVRNMFMYTGTYKGIQVTIAGSGMGCPSIGIYSYELFNFYNVENIIRIGSAGSYKEEIKVYDVYNVKEAYGDSNYAK-LAANIDDKVIKAGDKLYSLIEKIAKDKKIKTLTGRAHSADVFY-RHDDITEFVKENNLDVVEMESVALFANAIKAKKQAACLLTISDNLVTKEVTTAEERQNNFMQMVEIALDAAVESN 235
>gi|150017963|ref|YP_001310217.1| purine nucleoside phosphorylase [Clostridium beijerinckii NCIMB 8052] >gi|149904428|gb|ABR35261.1| purine nucleoside phosphorylase [Clostridium beijerinckii NCIMB 8052] (237 aa)
Score = 519, Expect = 4.4e-51, Identities = 114/233 (48%), Positives = 153/233 (65%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           TPHN AK GEIAK VLMPGDPLRAK+IAENFLE+    N VR MLGYTG Y  K V+VMG GMGM SIGIYSYELF FY VD IIR+G+AGS ++ +++ D+V+   A + S YA    +    + +   D ++  + + A ENNI +    + SSD FY A+++  +         +EME+ +L+ NA +  K A  LLT SDS++T ES+SAEDRQ  F  M+ +AL++ +
  S:     6 TPHNGAKLGEIAKTVLMPGDPLRAKFIAENFLEDVTQFNTVRNMLGYTGTYKGKRVSVMGGGMGMPSIGIYSYELFNFYGVDNIIRIGTAGSISEKLHLRDVVIGLGASTNSNYAHQYNLPGTFAPIASFDLVSSAV-EAAKENNINVVVGNILSSDTFYSADKTATEKWKSMGVLAIEMEAAALYMNAAEAGKNALCLLTISDSVLTGESLSAEDRQLSFTEMMKIALEIAK 237
>gi|160878910|ref|YP_001557878.1| purine nucleoside phosphorylase [Clostridium phytofermentans ISDg] >gi|160427576|gb|ABX41139.1| purine nucleoside phosphorylase [Clostridium phytofermentans ISDg] (238 aa)
Score = 513, Expect = 2.1e-50, Identities = 113/231 (48%), Positives = 148/231 (64%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH---SSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           TPHN AK GEIAK VLMPGDPLRAK+IAE +LENP   N VR M GYTG Y  K+++VMG GMGM SIGIYSYEL+ FYDVD IIR+GSAG  + +++V D+V+   A + S +A    +    + +   + L   +     +N    T+VVV    SSDIFY  N++   +        VEME+ +L+ NA +  K A  +LT SD L T ES+SAEDRQ  F  M+ +AL++
  S:     8 TPHNGAKSGEIAKTVLMPGDPLRAKFIAETYLENPVCFNTVRNMFGYTGTYKGKQISVMGGGMGMPSIGIYSYELYHFYDVDNIIRIGSAGGISDNVHVRDVVIGMGASTNSNFASQYELPGTFAPIASYELLEKAVNAARSQN----TNVVVGNILSSDIFYDDNKNSSNLWKKMGVLCVEMEAAALYMNAARAGKNALCILTISDHLYTGESLSAEDRQVSFREMMEIALEL 237
>gi|89256750|ref|YP_514112.1| purine nucleoside phosphorylase [Francisella tularensis subsp. holarctica] >gi|115315150|ref|YP_763873.1| purine nucleoside phosphorylase [Francisella tularensis subsp. holarctica OSU18] >gi|134302350|ref|YP_001122319.1| purine nucleoside phosphorylase [Francisella tularensis subsp. tularensis WY96-3418] >gi|167009807|ref|ZP_02274738.1| purine nucleoside phosphorylase [Francisella tularensis subsp. holarctica FSC200] >gi|89144581|emb|CAJ79900.1| purine nucleoside phosphorylase [Francisella tularensis subsp. holarctica LVS] >gi|115130049|gb|ABI83236.1| purine-nucleoside phosphorylase [Francisella tularensis subsp. holarctica OSU18] >gi|134050127|gb|ABO47198.1| purine nucleoside phosphorylase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134253858|gb|EBA52952.1| purine nucleoside phosphorylase [Francisella tularensis subsp. holarctica 257] >gi|151571819|gb|EDN37473.1| purine nucleoside phosphorylase [Francisella tularensis subsp. novicida GA99-3548] >gi|157122609|gb|EDO66738.1| purine nucleoside phosphorylase [Francisella tularensis subsp. holarctica FSC022] (240 aa)
Score = 506, Expect = 1.4e-49, Identities = 111/234 (47%), Positives = 157/234 (67%)
  Q:    11 TPH-NRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR-SVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           TPH    +K E AK V+MPGDPLRAK+IA+N+LEN   +N VR M GYTG Y  K+V+VMG GMGM S+GIY+YELF +YDVD IIRVGSAGSY  +  V D+VL +++Y ES + + +   +K S +  S+ELN  +  +A   +I+L     H +D+FY  N    ++I       +VEME+ +LFA A +L KKA+ ++T SDS +T ES +A+ R+  F NM+ +AL  +++
  S:     5 TPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKKVSVMGSGMGMPSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIV-TGSKTSDVRSSEELNKELIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDSFITGESTTAQQREQSFTNMMEVALGTIKE 239
>gi|118497265|ref|YP_898315.1| purine nucleoside phosphorylase [Francisella tularensis subsp. novicida U112] >gi|194323568|ref|ZP_03057345.1| purine nucleoside phosphorylase [Francisella tularensis subsp. novicida FTE] >gi|118423171|gb|ABK89561.1| purine nucleoside phosphorylase [Francisella tularensis subsp. novicida U112] >gi|151570365|gb|EDN36019.1| purine-nucleoside phosphorylase [Francisella tularensis subsp. novicida GA99-3549] >gi|194322423|gb|EDX19904.1| purine nucleoside phosphorylase [Francisella tularensis subsp. novicida FTE] (240 aa)
Score = 505, Expect = 2.0e-49, Identities = 110/234 (47%), Positives = 157/234 (67%)
  Q:    11 TPH-NRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR-SVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           TPH    +K E AK V+MPGDPLRAK+IA+N+LEN   +N VR M GYTG Y  ++V+VMG GMGM S+GIY+YELF +YDVD IIRVGSAGSY  +  V D+VL +++Y ES + + +   +K S +  S+ELN  +  +A   +I+L     H +D+FY  N    ++I       +VEME+ +LFA A +L KKA+ ++T SDS +T ES +A+ R+  F NM+ +AL  +++
  S:     5 TPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGRKVSVMGSGMGMPSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIV-TGSKTSDVRSSEELNKELIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDSFITGESTTAQQREQSFTNMMEVALGTIKE 239
>gi|62258552|gb|AAX77804.1| unknown protein [synthetic construct] (275 aa)
Score = 501, Expect = 5.0e-49, Identities = 110/234 (47%), Positives = 156/234 (66%)
  Q:    11 TPH-NRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR-SVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           TPH    +K E AK V+MPGDPLRAK+IA+N+LEN   +N VR M GYTG Y  K+V+VMG GMGM S+GIY+YELF +YDVD IIRVGSAGSY  +  V D+VL +++Y ES + + +   +K   +  S+ELN  +  +A   +I+L     H +D+FY  N    ++I       +VEME+ +LFA A +L KKA+ ++T SDS +T ES +A+ R+  F NM+ +AL  +++
  S:    31 TPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKKVSVMGSGMGMPSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIV-TGSKTIDVRSSEELNKELIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDSFITGESTTAQQREQSFTNMMEVALGTIKE 265
>gi|56707880|ref|YP_169776.1| purine nucleoside phosphorylase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670351|ref|YP_666908.1| purine nucleoside phosphorylase [Francisella tularensis subsp. tularensis FSC198] >gi|56604372|emb|CAG45399.1| purine nucleoside phosphorylase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320684|emb|CAL08782.1| purine nucleoside phosphorylase [Francisella tularensis subsp. tularensis FSC 198] >gi|151568615|gb|EDN34269.1| hypothetical protein FTBG_00133 [Francisella tularensis subsp. tularensis FSC033] (240 aa)
Score = 501, Expect = 6.1e-49, Identities = 110/234 (47%), Positives = 156/234 (66%)
  Q:    11 TPH-NRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR-SVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           TPH    +K E AK V+MPGDPLRAK+IA+N+LEN   +N VR M GYTG Y  K+V+VMG GMGM S+GIY+YELF +YDVD IIRVGSAGSY  +  V D+VL +++Y ES + + +   +K   +  S+ELN  +  +A   +I+L     H +D+FY  N    ++I       +VEME+ +LFA A +L KKA+ ++T SDS +T ES +A+ R+  F NM+ +AL  +++
  S:     5 TPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKKVSVMGSGMGMPSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIV-TGSKTIDVRSSEELNKELIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDSFITGESTTAQQREQSFTNMMEVALGTIKE 239
>gi|54020132|ref|YP_115810.1| purine-nucleoside phosphorylase [Mycoplasma hyopneumoniae 232] >gi|71893439|ref|YP_278885.1| purine-nucleoside phosphorylase [Mycoplasma hyopneumoniae J] >gi|72080426|ref|YP_287484.1| purine-nucleoside phosphorylase [Mycoplasma hyopneumoniae 7448] >gi|53987305|gb|AAV27506.1| purine nucleoside phosphorylase [Mycoplasma hyopneumoniae 232] >gi|71851566|gb|AAZ44174.1| purine-nucleoside phosphorylase [Mycoplasma hyopneumoniae J] >gi|71913550|gb|AAZ53461.1| purine-nucleoside phosphorylase [Mycoplasma hyopneumoniae 7448] (232 aa)
Score = 478, Expect = 2.3e-46, Identities = 108/233 (46%), Positives = 153/233 (65%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MT H  AKK EIA +VLMPGDPLRA++IA+NFL++ KL++ VR  L +TG Y  K+VT+   GMG  SIGIY+YELF FYDV+ IIR+GSAGSY KD+ V  LV+   A+S+S     +    K      +  L   +  +A +  +      +HS+D+FY ++R++E+    +K++ VEMESF+LF  A  L KKAA++LT SD+L+T   + +  RQ KFV MI +AL+ +
  S:     1 MTAHIEAKKNEIAPIVLMPGDPLRAEFIAKNFLKDAKLVSKVRNNLIFTGEYKGKKVTIAASGMGSGSIGIYAYELFKFYDVEKIIRIGSAGSYDKDLEVYSLVIANSAWSDSCSFPALISGKKVHLAHPNPGLVANLFHSATKLGLNPLYTRIHSTDVFY-SSRNLEKTIELSKAKAVEMESFALFTIANYLGKKAASILTISDNLITKSELDSVTRQEKFVEMIEIALEAI 232
>gi|27468655|ref|NP_765292.1| purine nucleoside phosphorylase [Staphylococcus epidermidis ATCC 12228] >gi|27316202|gb|AAO05336.1|AE016749_282 purine nucleoside phosphorylase [Staphylococcus epidermidis ATCC 12228] (236 aa)
Score = 474, Expect = 7.7e-46, Identities = 107/233 (45%), Positives = 142/233 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           TPH      +IAK VLMPGDPLRA++IAENFLEN +  N VR M GYTG Y  KEV+VMG GMG+ SIGIYSYEL+ F+DVD IIRVGS G+  +D+N+ D+++ + A + S Y     I    + +    + N V +     + I     V  V SSD FY A+ +            +EMES  L+ NAI  NKKA  + T SD ++  E+ SAE+RQT F  M+ +AL++ E
  S:     5 TPHINPNGVKIAKTVLMPGDPLRAQYIAENFLENVEQFNTVRNMFGYTGTYKGKEVSVMGSGMGIPSIGIYSYELYHFFDVDTIIRVGSCGALQEDVNLYDVIIAQAASTNSNYVDQFNIPGHFAPIA---DFNLVAKAKKAADEIGAISHVGNVLSSDTFYNADSTFNDSWKKMGILGIEMESAGLYLNAIHANKKALGIFTVSDHILRDEATSAEERQTSFTQMMEIALEIAE 236
>gi|148377684|ref|YP_001256560.1| purine nucleoside phosphorylase (inosinephosphorylase) (PNP) [Mycoplasma agalactiae PG2] >gi|148291730|emb|CAL59116.1| Purine nucleoside phosphorylase (Inosinephosphorylase) (PNP) [Mycoplasma agalactiae PG2] (242 aa)
Score = 473, Expect = 1.0e-45, Identities = 103/235 (43%), Positives = 151/235 (64%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH    KGEIAK+VLMPGDPLRA+++A+ FL NPKL++ VR +  YTG Y  K VT+   GMG+AS+GIY+YELF  YDVDVIIR+GS GSY   ++    VL K+AY++      +    K        ++  +++K+A +  I + DV  H++D+FY   R +E+    TK Q V+ E F LF  A + NKK+A LL+ S+++VT +SM++++R  +F  M  +AL  ++ I
  S:     3 TPHLSCNKGEIAKIVLMPGDPLRAEYMAKKFLTNPKLVSSVRNIYFYTGEYKGKLVTIGASGMGVASMGIYAYELFTEYDVDVIIRLGSTGSYVDWLDTKQPVLVKRAYADGLGFVSLMTGEKTHNAYPDKDIVKLLKKSAKKKKINVLDVACHTTDVFYSL-RPLEETIRKTKCQTVDNECFGLFTTAKRCNKKSAALLSVSENIVTGKSMTSDERLLEFSQMFEVALNALDDI 236
>gi|57867639|ref|YP_189311.1| purine nucleoside phosphorylase [Staphylococcus epidermidis RP62A] >gi|57638297|gb|AAW55085.1| purine nucleoside phosphorylase [Staphylococcus epidermidis RP62A] (236 aa)
Score = 471, Expect = 1.7e-45, Identities = 107/233 (45%), Positives = 142/233 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           TPH      +IAK VLMPGDPLRA++IAENFLEN +  N VR M GYTG Y  KEV+VMG GMG+ SIGIYSYEL+ F+DVD IIRVGS G+  +D+N+ D+++ + A + S Y     I    + +    + N V +     + I     V  V SSD FY A+ +            +EMES  L+ NAI  NKKA  + T SD ++  E+ SAE+RQT F  M+ +AL++ E
  S:     5 TPHINPNGVKIAKTVLMPGDPLRAQYIAENFLENVEQFNTVRNMFGYTGTYKGKEVSVMGSGMGIPSIGIYSYELYHFFDVDTIIRVGSCGALQEDVNLYDVIIAQAASTNSNYVDQFNIPGHFAPIA---DYNLVAKAKKAADEIGAISHVGNVLSSDTFYNADSTFNDSWKKMGILGIEMESAGLYLNAIHANKKALGIFTVSDHILRDEATSAEERQTSFTQMMEIALEIAE 236
>gi|73662055|ref|YP_300836.1| purine nucleoside phosphorylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494570|dbj|BAE17891.1| purine nucleoside phosphorylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (236 aa)
Score = 467, Expect = 4.4e-45, Identities = 101/233 (43%), Positives = 149/233 (63%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           TPH +    +IAK VLMPGDPLRAK+IA+N+LEN +  N+VR M GYTG YN KEV+VMG GMG+ SIGIYSYEL+ F+DVD IIR+GS G+  +++N+ D+++ + A + S+Y +   I    + L    +   +++     ++I  T  V  + SSD FY A+ +  +         +EMES +L+ NA   NKKA  + T SD ++  E+ +AE+RQ  F  M+ +AL++ E
  S:     5 TPHIQPNGKKIAKTVLMPGDPLRAKYIADNYLENVEQFNEVRNMFGYTGTYNGKEVSVMGSGMGVPSIGIYSYELYNFFDVDTIIRIGSCGALQENVNLYDVIIAQGASTNSSYVEQYNIPGHFAPLA---DFELILKAKQKADDIGATTHVGNILSSDTFYNADPTFNEQWQRMGVLGIEMESAALYLNATYANKKALGIFTVSDHILRDEATTAEERQNSFTQMMEIALEIAE 236
>gi|15925128|ref|NP_372662.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927712|ref|NP_375245.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus N315] >gi|21283791|ref|NP_646879.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MW2] >gi|49484362|ref|YP_041586.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486931|ref|YP_044152.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652160|ref|YP_186945.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus COL] >gi|82751739|ref|YP_417480.1| purine nucleoside phosphorylase [Staphylococcus aureus RF122] >gi|87160143|ref|YP_494737.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300] >gi|88196043|ref|YP_500857.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268589|ref|YP_001247532.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH9] >gi|150394653|ref|YP_001317328.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH1] >gi|151222254|ref|YP_001333076.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980453|ref|YP_001442712.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu3] >gi|161510344|ref|YP_001576003.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728403|ref|ZP_02760680.1| purine-nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13701932|dbj|BAB43224.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus N315] >gi|14247911|dbj|BAB58300.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu50] >gi|21205233|dbj|BAB95927.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MW2] >gi|49242491|emb|CAG41207.1| putative purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245374|emb|CAG43849.1| putative purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286346|gb|AAW38440.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus COL] >gi|82657270|emb|CAI81711.1| purine nucleoside phosphorylase [Staphylococcus aureus RF122] >gi|87126117|gb|ABD20631.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203601|gb|ABD31411.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741658|gb|ABQ49956.1| purine-nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH9] >gi|149947105|gb|ABR53041.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH1] >gi|150375054|dbj|BAF68314.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722588|dbj|BAF79005.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu3] >gi|160369153|gb|ABX30124.1| purine-nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (236 aa)
Score = 463, Expect = 1.5e-44, Identities = 102/233 (43%), Positives = 142/233 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           TPH +    +IAK VLMPGDPLRAK+IA+NFLEN +  NDVR M GYTG Y  KEV+VMG GMG+ SIGIYSYEL+ F+DVD IIR+GS G+  +++N+ D+++ + A + S Y     I    + +    +   V +   + + I  T  V  V SSD FY A+ +            +EMES  L+ NAI   KKA  + T SD ++  E+ + E+RQ  F  M+ +AL++ E
  S:     5 TPHIQPNGVKIAKTVLMPGDPLRAKYIADNFLENVEQFNDVRNMFGYTGTYKGKEVSVMGSGMGIPSIGIYSYELYNFFDVDTIIRIGSCGALQENVNLYDVIIAQAASTNSNYVDQYNIPGHFAPIA---DFELVTKAKNVADQIGATTHVGNVLSSDTFYNADPTFNDAWKKMGILGIEMESAGLYLNAIHAGKKALGIFTVSDHILRDEATTPEERQNSFTQMMEIALEIAE 236
>gi|6010055|emb|CAB57234.1| putative purine-nucleoside phosphorylase [Entodinium caudatum] (241 aa)
Score = 461, Expect = 2.3e-44, Identities = 97/230 (42%), Positives = 149/230 (64%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDEL---NDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A KG  AK VLMPGDP RAK++AE+FL+N  L+NDVRG+ GYTG Y  K+++VMG GMG+ SIGIYSYEL+  YDVD IIR+G++G+  KDI++ D+++   A ++S Y     +    S +   + L   ++ +++  +E+ +K    +  S+D+FYG      +         VEME+++L+ NA +  K+A  +   SD+LV+ E +S+E+R+    +MI LAL+
  S:     6 TPHISAPKGAFAKTVLMPGDPKRAKYVAEHFLQNAVLVNDVRGIQGYTGEYKGKKISVMGSGMGIPSIGIYSYELYHAYDVDNIIRIGTSGALMKDIHIKDIIVGTGASTDSNYGASFKLNGTISAIPDFNLLKKCDEKVKELKLEDKVKFGQFL--STDVFYGEGPETLEWPK-MGVIAVEMEAYALYLNAARAGKRALCICAVSDNLVSKEVLSSEEREKSVNDMIQLALE 235
>gi|125974084|ref|YP_001037994.1| purine nucleoside phosphorylase [Clostridium thermocellum ATCC 27405] >gi|196251514|ref|ZP_03150183.1| purine nucleoside phosphorylase [Clostridium thermocellum DSM 4150] >gi|125714309|gb|ABN52801.1| purine-nucleoside phosphorylase [Clostridium thermocellum ATCC 27405] >gi|196199126|gb|EDX93954.1| purine nucleoside phosphorylase [Clostridium thermocellum DSM 4150] (236 aa)
Score = 458, Expect = 6.0e-44, Identities = 104/232 (44%), Positives = 144/232 (62%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           T HN A +G+IAK VLMPGDPLRAK+IAE +LEN    N VR MLG+TG Y  K V+VMGHGMG+ SIGIYSYELF FYDVD IIR+GSAG+ + D+++ DLV+   A ++S YA    +    + +     +   I + A +  I +    V S+D+FY AN+             +EME+ +L+ NA +  K A  +L+ SD +     +SA++RQ  F NMI +AL ++
  S:     6 TAHNAAVEGQIAKTVLMPGDPLRAKFIAETYLENVTCFNTVRNMLGFTGTYQGKPVSVMGHGMGIPSIGIYSYELFNFYDVDNIIRIGSAGALSDDLDLKDLVIAMGACTDSNYANQYQLPGTFAPIASYTLMQKAIEE-AQKKGISVAIGNVLSTDVFYNANKGANDAWKSMGVLCIEMEAAALYMNAAQAGKNALCILSISDHIYKGTELSAQERQLGFKNMIEVALGII 236
>gi|70725897|ref|YP_252811.1| purine nucleoside phosphorylase [Staphylococcus haemolyticus JCSC1435] >gi|68446621|dbj|BAE04205.1| purine nucleoside phosphorylase [Staphylococcus haemolyticus JCSC1435] (236 aa)
Score = 457, Expect = 7.6e-44, Identities = 101/233 (43%), Positives = 143/233 (61%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           TPH +    +IAK VLMPGDPLRAK+IA+NFLEN +  N+VR M GYTG Y  KEV+VMG GMG+ SIGIYSYEL+ F+DVD IIRVGS G+  +++N+ D+++ + A + S Y     I    + +    +   + +   + + I     V  V SSD FY A+++            +EMES  L+ NAI   KKA  + T SD ++  E+ +AE+RQ  F  M+ +AL++ E
  S:     5 TPHIQPNGTKIAKTVLMPGDPLRAKYIADNFLENVEQFNEVRNMFGYTGTYKGKEVSVMGSGMGIPSIGIYSYELYNFFDVDTIIRVGSCGALQENVNLYDVIIAQAASTNSNYVDQFNIPGHFAPIA---DYELITKAKNVADEIGAVSHVGNVLSSDTFYNADKTFNDNWQKMGILGIEMESAGLYLNAINAGKKALGIFTVSDHILRDEATTAEERQDSFTQMMEIALEIAE 236
>gi|118726293|ref|ZP_01574921.1| purine nucleoside phosphorylase [Clostridium cellulolyticum H10] >gi|118664292|gb|EAV70926.1| purine nucleoside phosphorylase [Clostridium cellulolyticum H10] (235 aa)
Score = 455, Expect = 1.1e-43, Identities = 102/231 (44%), Positives = 146/231 (63%)
  Q:    11 TPH-NRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYI---GIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           TPH N +K+G IA+ VLMPGDPLRAK+IAE +LENP   N VR M GYTG Y  K+++VMG GMGM S+GIYSYEL  FY V  IIR+GS G+  +D+ + D+++   A + S YA      G  A  ++     +  DV     I  +++  +++  S+DIFY     V +  +      +EME+ +L+ NA +    A  +LT SDSLV+ E+ +AE+RQT F NM+ +AL++
  S:     4 TPHINVSKQGIIAETVLMPGDPLRAKFIAETYLENPVQFNSVRNMFGYTGTYKGKKISVMGSGMGMPSMGIYSYELLNFYGVKNIIRIGSCGAIQEDVKIRDIIIGMSASTTSNYASQFNLPGTYAPTASWPLMKKALDVAENKGI--SVRAGNIL--SADIFYDDEPEVWKRWARMGVLAIEMEAAALYMNAARAGANAVCILTVSDSLVSREATTAEERQTSFTNMMEIALEL 234
>gi|123456598|ref|XP_001316033.1| purine nucleoside phosphorylase, putative [Trichomonas vaginalis G3] >gi|121898728|gb|EAY03810.1| purine nucleoside phosphorylase, putative [Trichomonas vaginalis G3] (236 aa)
Score = 443, Expect = 2.8e-42, Identities = 97/235 (41%), Positives = 141/235 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPHN AK G+ A+ VLM GDPLRAK IA+N+LEN K +N VRGMLG+TG Y  K ++VMGHGMG+ SI IY+ EL+  Y V  IIRVG+ G+   +++V D+ +   + ++S   + + +   D     + E+   + ++A   NI       +S+DIFY   + + +  +      VEMES  LF  A     +A  + T SD ++THES + E+RQT F NMI +AL+   K+
  S:     3 TPHNSAKVGDFAETVLMCGDPLRAKLIADNYLENAKQVNSVRGMLGFTGTYKGKPLSVMGHGMGIPSISIYAEELYNVYKVKTIIRVGTCGTVDPNVHVRDVCIVTASGTDSNVNR-MRLLGHDFPATANFEVVSALVESAKALNIPTQVGKAYSTDIFYSKEQGLNEALAQYHFIAVEMESAGLFPIADYYGARAGCICTVSDHIITHESATPEERQTSFQNMIKIALEATLKL 236
>gi|149242208|pdb|2ISC|A Chain A, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Dadme-Imm-A >gi|149242209|pdb|2ISC|B Chain B, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Dadme-Imm-A >gi|149242210|pdb|2ISC|C Chain C, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Dadme-Imm-A >gi|149242211|pdb|2ISC|D Chain D, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Dadme-Imm-A >gi|149242212|pdb|2ISC|E Chain E, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Dadme-Imm-A >gi|149242213|pdb|2ISC|F Chain F, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Dadme-Imm-A (239 aa)
Score = 441, Expect = 5.1e-42, Identities = 99/236 (41%), Positives = 138/236 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN 246
           TPHN A+ G+ A+ VLM GDPLRAK IAE +LENPKL+N+VRG+ GYTG Y  K ++VMGHGMG+ SI IY+ EL++ Y V  IIRVG+ G+   DI+  D+V+   A + S   + I     D     S ++   +   A E NI        S+D+FY     + Q+ +      VEMES  LF  A     +A  + T SD ++ HE  +AE+RQ  F NM+ +AL+   K++
  S:     2 TPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINR-IRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEETTAEERQNSFQNMMKIALEAAIKLH 236
>gi|149242117|pdb|2I4T|A Chain A, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Imm-A >gi|149242118|pdb|2I4T|B Chain B, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Imm-A >gi|149242119|pdb|2I4T|C Chain C, Crystal Stucture Of Purine Nucleoside Phosphorylase From Trichomonas Vaginalis With Imm-A (236 aa)
Score = 440, Expect = 7.1e-42, Identities = 99/236 (41%), Positives = 138/236 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN 246
           TPHN A+ G+ A+ VLM GDPLRAK IAE +LENPKL+N+VRG+ GYTG Y  K ++VMGHGMG+ SI IY+ EL++ Y V  IIRVG+ G+   DI+  D+V+   A + S   + I     D     S ++   +   A E NI        S+D+FY     + Q+ +      VEMES  LF  A     +A  + T SD ++ HE  +AE+RQ  F NM+ +AL+   K++
  S:     2 TPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINR-IRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEETTAEERQNSFQNMMKIALEAAIKLH 236
>gi|148324182|gb|EDK89432.1| purine-nucleoside phosphorylase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (235 aa)
Score = 439, Expect = 8.9e-42, Identities = 108/236 (45%), Positives = 141/236 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M+ H  AK G+IA+ VL+PGDP RAKWIAEN+LENP    D+RGMLG+TG Y  K+V+V G GMG+ SI IY  EL   Y V  +IRVGSAGSY KD+NV D+V+     ++S           + +   + EL  +  K A E NIK+    V +SD FY  N    +  +D     VEME+  L+  A K   KA ++LT SDSLV+ E  SAE+R+  F  MI LAL+   +I
  S:     1 MSIHIGAKVGDIAETVLLPGDPKRAKWIAENYLENPFCYTDIRGMLGFTGTYKGKKVSVQGTGMGIPSISIYITELMKDYGVKNLIRVGSAGSYQKDVNVRDVVIAMSTSTDSNINNR-RFNGANFSPTANFELFSMALKVAEEKNIKIKAGNVLTSDEFYNDNSDYYKKWADFGVLAVEMETAGLYTLAAKYKAKALSILTISDSLVSPEITSAEEREKTFSEMIELALETAIRI 235
>gi|62738888|pdb|1Z33|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase >gi|62738889|pdb|1Z34|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase Complexed With 2-Fluoro-2'- Deoxyadenosine >gi|62738890|pdb|1Z35|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase Complexed With 2-Fluoroadenosine >gi|62738891|pdb|1Z36|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase Complexed With Formycin A >gi|62738892|pdb|1Z37|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase Complexed With Adenosine >gi|62738893|pdb|1Z38|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase Complexed With Inosine >gi|62738894|pdb|1Z39|A Chain A, Crystal Structure Of Trichomonas Vaginalis Purine Nucleoside Phosphorylase Complexed With 2'-Deoxyinosine (235 aa)
Score = 439, Expect = 9.5e-42, Identities = 99/235 (42%), Positives = 137/235 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPHN A+ G+ A+ VLM GDPLRAK IAE +LENPKL+N+VRG+ GYTG Y  K ++VMGHGMG+ SI IY+ EL++ Y V  IIRVG+ G+   DI+  D+V+   A + S   + I     D     S ++   +   A E NI        S+D+FY     + Q+ +      VEMES  LF  A     +A  + T SD ++ HE  +AE+RQ  F NM+ +AL+   K+
  S:     2 TPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINR-IRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEETTAEERQNSFQNMMKIALEAAIKL 235
>gi|123480887|ref|XP_001323435.1| purine nucleoside phosphorylase, putative [Trichomonas vaginalis G3] >gi|121906300|gb|EAY11212.1| purine nucleoside phosphorylase, putative [Trichomonas vaginalis G3] (236 aa)
Score = 439, Expect = 1.0e-41, Identities = 99/235 (42%), Positives = 137/235 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPHN A+ G+ A+ VLM GDPLRAK IAE +LENPKL+N+VRG+ GYTG Y  K ++VMGHGMG+ SI IY+ EL++ Y V  IIRVG+ G+   DI+  D+V+   A + S   + I     D     S ++   +   A E NI        S+D+FY     + Q+ +      VEMES  LF  A     +A  + T SD ++ HE  +AE+RQ  F NM+ +AL+   K+
  S:     3 TPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINR-IRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEETTAEERQNSFQNMMKIALEAAIKL 236
>gi|23099800|ref|NP_693266.1| purine nucleoside phosphorylase [Oceanobacillus iheyensis HTE831] >gi|81745874|sp|Q8ENY0|DEOD_OCEIH Purine nucleoside phosphorylase deoD-type (PNP) >gi|22778031|dbj|BAC14301.1| purine nucleoside phosphorylase [Oceanobacillus iheyensis HTE831] (235 aa)
Score = 430, Expect = 8.6e-41, Identities = 100/235 (42%), Positives = 143/235 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGAN-RSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK+GEIA  +L+PGDPLRAK+IAE FLE PKL N+VRGM GYTG Y  + V+V G GMG+ SI IY  EL   YDV  +IRVG+ G+  KD+NV D++L + A ++S   + I     D       EL        ++  + L    V +SD FY  N + V ++ +  +   +EMES +L+  A K  ++A ++LT SD ++T E  +AE+RQT F +M+ +AL  + K
  S:     1 MSVHIGAKQGEIADKILLPGDPLRAKYIAETFLEEPKLYNEVRGMYGYTGTYKGERVSVQGTGMGVPSISIYVNELIQSYDVKKLIRVGTCGAIQKDVNVRDVILAQGATTDSQMNRLI-FNGIDYAPIADFELLKNAYDAGVDKGLHLRVGNVFTSDTFYRDNAQQVNELLAKYQVLAIEMESTALYTLAAKYGRQALSVLTVSDHIITGEETTAEERQTTFNDMMEIALDTIIK 235
>gi|126725044|ref|ZP_01740887.1| purine nucleoside phosphorylase [Rhodobacterales bacterium HTCC2150] >gi|126706208|gb|EBA05298.1| purine nucleoside phosphorylase [Rhodobacterales bacterium HTCC2150] (234 aa)
Score = 430, Expect = 1.1e-40, Identities = 96/235 (40%), Positives = 141/235 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDV-VVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           MT H  AK+G+IA+ VLMPGDP RAKW AE FL++ KL+N+VRGMLG+TG +N   VT+ G GMGM S+ IY+ EL   Y+   +IR+GS GS  +++ V D+VL + A +  + ++ I  +   S +   D L+      A E     T V  ++SSD FY     + +         VEME+  L+  A +  ++A  +LT SD L+THE++ AEDR+  F +M+ +AL+   K
  S:     1 MTIHIGAKEGDIAETVLMPGDPYRAKWAAETFLKDAKLVNEVRGMLGFTGTWNGHRVTIQGSGMGMPSLSIYANELIRDYNAQTLIRIGSTGSMQENVKVRDVVLAQAAATAGSPSRTIFKDFNYSPVADFDLLHKAFH--AAEAKGTPTHVGSIYSSDTFYDERSDLTEQMMRHGVLAVEMEAAELYTLAARYGRRALAILTVSDHLITHEALPAEDRERTFGDMVEIALEAAFK 234
>gi|37524530|ref|NP_927874.1| purine nucleoside phosphorylase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81572733|sp|Q7N930|DEOD_PHOLL Purine nucleoside phosphorylase deoD-type (PNP) >gi|36783954|emb|CAE12817.1| purine-nucleoside phosphorylase (inosine phosphorylase) (PNP) [Photorhabdus luminescens subsp. laumondii TTO1] (238 aa)
Score = 426, Expect = 3.0e-40, Identities = 98/232 (42%), Positives = 137/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRK---TAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLEN + +NDVRGMLG+TG Y  + ++VMGHGMG+ S  IY+ EL   +   V+IRVGS GS   D+ + D+V+   A ++S   +   I  KD       +  D++R     A   NI +    + S ++FY  +  +  I        VEME+   +  A +   KA T+ T SD + THE ++AE+RQT F  MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLENVRQVNDVRGMLGFTGTYKGRPISVMGHGMGIPSCSIYAKELITDFGAKVLIRVGSCGSVRHDVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DLVRNAVDAAKAKNINVRVGNIFSVELFYTPDPQLFDIMEKYGILGVEMEAAGFYGVAAEYGAKALTICTVSDHIRTHEKLTAEERQTTFNEMIEIALESV 233
>gi|88713715|ref|ZP_01107796.1| Purine nucleoside phosphorylase [Flavobacteriales bacterium HTCC2170] >gi|88707842|gb|EAR00081.1| Purine nucleoside phosphorylase [Flavobacteriales bacterium HTCC2170] (232 aa)
Score = 425, Expect = 3.9e-40, Identities = 105/232 (45%), Positives = 139/232 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           M+ H  AKKGEIA+ VLMPGDPLRAKWIAE FL++P   N VRGMLGYTG Y  K+++V G GMG+ S  IY +EL   Y V  +IRVGSAGS+ K+I V D+VL   A + S       I +  S     D L +     A +N IK+    V S+D FY  +    ++ +      VEME+  L+  A K N +A  +LT SDSLVT E  S+++R+T F  M+ +AL +
  S:     1 MSVHIEAKKGEIAETVLMPGDPLRAKWIAETFLKDPFCYNKVRGMLGYTGTYKGKKISVQGSGMGIPSAMIYYHELINNYGVKNLIRVGSAGSFQKNIKVRDIVLAMAASTTSGINNSRFINSDYSPTANFDLLLNA-SLYAKKNGIKIKAGNVLSADEFYEDDPDAYKLWAKYGVLCVEMEASGLYTIAAKFNVRALAILTISDSLVTGEKTSSKERETSFNEMVEIALNI 231
>gi|89890999|ref|ZP_01202507.1| purine-nucleoside phosphorylase [Flavobacteria bacterium BBFL7] >gi|89516643|gb|EAS19302.1| purine-nucleoside phosphorylase [Flavobacteria bacterium BBFL7] (233 aa)
Score = 424, Expect = 4.3e-40, Identities = 104/234 (44%), Positives = 141/234 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKT--AIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           M+ H  AKKGEIA  VL+PGDP+RAKWIAE FL+N    NDVRGMLGYTG Y  K V+V G GMG+ S  IY +EL   Y V  +IRVGSAGSY KD+ + D+V+   A + ST +       K++    +   +  ++    A + NI +    + S+D FY  +    +  +D     VEME+  L+  A K N KA ++LT SDSLVT E  ++E+R+T F  MI +AL  +E
  S:     1 MSTHIEAKKGEIADTVLLPGDPMRAKWIAETFLDNAICYNDVRGMLGYTGSYKGKPVSVQGTGMGIPSALIYCHELINDYGVKNLIRVGSAGSYQKDVAIRDIVI---AMAASTTSGINNSRFKNADYSPTANFDLFLKACLYAKDKNIPIKAGNILSADEFYEDDFENYKQWADYGVLCVEMETAGLYTIAAKHNVKALSILTISDSLVTGEHTTSEERETTFQKMIEIALATLE 233
>gi|83645832|ref|YP_434267.1| purine nucleoside phosphorylase [Hahella chejuensis KCTC 2396] >gi|123533050|sp|Q2SHN2|DEOD_HAHCH Purine nucleoside phosphorylase deoD-type (PNP) >gi|83633875|gb|ABC29842.1| purine nucleoside phosphorylase [Hahella chejuensis KCTC 2396] (236 aa)
Score = 420, Expect = 1.3e-39, Identities = 91/230 (39%), Positives = 137/230 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A  G+ A  VLMPGDPLRAK IAE +L NP L+NDVRGMLGYTG Y  + ++VMG GMG+ SI IY++ELF  ++V  I+R+GS GS   ++ V D+V+   A ++S   + + +   D       +L + +   A     +     + ++D+FY A+  + +  S    + VEME+  L+  A +   KA  L T SD L++ E +S E+R+T F +M+ +AL+
  S:     3 TPHIAANPGDFADTVLMPGDPLRAKHIAETYLANPVLVNDVRGMLGYTGEYRGRMLSVMGSGMGVPSISIYAHELFTQFNVKNIVRIGSCGSIRDEVKVRDIVIGMGAGTDSLVNR-VRLNHYDFAAIADYDLLEPVVNAARRREARFHVGALFTTDLFYAADPGLTERLSAHGVKAVEMEAAGLYGVAAECGGKALALCTVSDHLLSGERLSPEERRTSFNDMVEIALE 231
>gi|167037160|ref|YP_001664738.1| purine nucleoside phosphorylase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039961|ref|YP_001662946.1| purine nucleoside phosphorylase [Thermoanaerobacter sp. X514] >gi|166854201|gb|ABY92610.1| purine nucleoside phosphorylase [Thermoanaerobacter sp. X514] >gi|166855994|gb|ABY94402.1| purine nucleoside phosphorylase [Thermoanaerobacter pseudethanolicus ATCC 33223] (233 aa)
Score = 420, Expect = 1.4e-39, Identities = 99/234 (42%), Positives = 141/234 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           M+ H  AK+ EIA+ VL+PGDPLRAK+IAENFLE+ K  N+VRGM G+TGYY  K V+V G GMG+ S+ IY  EL   Y+V  +IR+G+ GS   DI + D+V+   + ++S   K I     D     S +L       A+E  I+     + ++D FY  +    ++ +      VEME+  L+  A K N  A T+LT SDSLVT E+ +AE+RQ  F+NM+ +AL++ E
  S:     1 MSIHIGAKENEIAQTVLLPGDPLRAKYIAENFLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGVPSLSIYVNELINSYNVKNLIRIGTCGSLQPDIKLRDIVIAMSSSTDSAINK-IRFNGMDYAPTASFKLLKKAYDKAMELGIQPKVGNILTTDTFYNDDPDSWKLWAKFGVLAVEMETAGLYTLAAKYNVDALTILTVSDSLVTGEATTAEERQKTFMNMVKIALEIAE 233
>gi|110801027|ref|YP_696093.1| purine nucleoside phosphorylase [Clostridium perfringens ATCC 13124] >gi|168215258|ref|ZP_02640883.1| purine nucleoside phosphorylase [Clostridium perfringens CPE str. F4969] >gi|123344738|sp|Q0TQJ7|DEOD_CLOP1 Purine nucleoside phosphorylase deoD-type (PNP) >gi|110675674|gb|ABG84661.1| purine nucleoside phosphorylase [Clostridium perfringens ATCC 13124] >gi|170713345|gb|EDT25527.1| purine nucleoside phosphorylase [Clostridium perfringens CPE str. F4969] (235 aa)
Score = 420, Expect = 1.5e-39, Identities = 99/230 (43%), Positives = 136/230 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+G+IA+ +L+PGDPLRAK+IAE FLENP   N+VRGMLGYTG Y  K+++V G GMG+ SI IY  EL   Y V  +IRVG+AG   +DI V DLVL   ++++S   K +     D     S +L      TA+E         V ++D FY  N    +  +   +  VEME+ +L+  A K    A T+LT SD L+T E  ++E+RQT F  M+ +AL
  S:     1 MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKKISVQGTGMGVPSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINK-VRFNGLDFAPTASFKLLKAAYDTAVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAEETTSEERQTTFTKMMEVAL 229
>gi|18310380|ref|NP_562314.1| purine nucleoside phosphorylase [Clostridium perfringens str. 13] >gi|110803378|ref|YP_698710.1| purine nucleoside phosphorylase [Clostridium perfringens SM101] >gi|168206305|ref|ZP_02632310.1| purine nucleoside phosphorylase [Clostridium perfringens E str. JGS1987] >gi|168216787|ref|ZP_02642412.1| purine nucleoside phosphorylase [Clostridium perfringens NCTC 8239] >gi|169347265|ref|ZP_02866204.1| purine nucleoside phosphorylase [Clostridium perfringens C str. JGS1495] >gi|182626457|ref|ZP_02954209.1| putative membrane protein [Clostridium perfringens D str. JGS1721] >gi|123146114|sp|Q0ST47|DEOD_CLOPS Purine nucleoside phosphorylase deoD-type (PNP) >gi|18145060|dbj|BAB81104.1| probable purine nucleoside phosphorylase [Clostridium perfringens str. 13] >gi|110683879|gb|ABG87249.1| purine nucleoside phosphorylase [Clostridium perfringens SM101] >gi|169296661|gb|EDS78792.1| purine nucleoside phosphorylase [Clostridium perfringens C str. JGS1495] >gi|170662200|gb|EDT14883.1| purine nucleoside phosphorylase [Clostridium perfringens E str. JGS1987] >gi|177908254|gb|EDT70812.1| putative membrane protein [Clostridium perfringens D str. JGS1721] >gi|182381112|gb|EDT78591.1| purine nucleoside phosphorylase [Clostridium perfringens NCTC 8239] (235 aa)
Score = 419, Expect = 1.8e-39, Identities = 99/230 (43%), Positives = 135/230 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+G+IA+ +L+PGDPLRAK+IAE FLENP   N+VRGMLGYTG Y  K ++V G GMG+ SI IY  EL   Y V  +IRVG+AG   +DI V DLVL   ++++S   K +     D     S +L      TA+E         V ++D FY  N    +  +   +  VEME+ +L+  A K    A T+LT SD L+T E  ++E+RQT F  M+ +AL
  S:     1 MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINK-VRFNGLDFAPTASFKLLKAAYDTAVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAEETTSEERQTTFTKMMEVAL 229
>gi|15807160|ref|NP_295889.1| purine nucleoside phosphorylase [Deinococcus radiodurans R1] >gi|6459967|gb|AAF11716.1|AE002050_2 purine nucleoside phosphorylase [Deinococcus radiodurans R1] (305 aa)
Score = 419, Expect = 1.8e-39, Identities = 100/230 (43%), Positives = 135/230 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  A+KG+IA+ VL+PGDPLRA+ IAE FLENP   N VRGMLG+TG Y  + V+V G GMG+ S  IY  EL   Y    +IRVG+AGSY + ++V DLVL + A ++S   +   +   + T     +   ++R   I      +  V  + SSD FY  N +  Q  ++     VEME+  L+  A K   +A T+LT SD LVTHE  SAE+RQ  F  MI +AL
  S:    67 MSIHLNAEKGQIAETVLLPGDPLRARHIAETFLENPVQHNTVRGMLGFTGTYKGERVSVQGTGMGIPSCMIYVNELIQDYGCKNLIRVGTAGSYQEGVHVRDLVLAQAACTDSNINR---VRFGERTFAPIADFELLLRAYQIAQERGFSAHVGNIMSSDTFYNDNPTEFQRWAEFGVLAVEMEAAGLYTLAAKYGVRALTILTISDHLVTHEVTSAEERQLTFNGMIEVAL 295
>gi|52080655|ref|YP_079446.1| purine nucleoside phosphorylase [Bacillus licheniformis ATCC 14580] >gi|52786029|ref|YP_091858.1| hypothetical protein BLi02285 [Bacillus licheniformis ATCC 14580] >gi|81609115|sp|Q65IE9|DEOD_BACLD Purine nucleoside phosphorylase deoD-type (PNP) >gi|52003866|gb|AAU23808.1| purine nucleoside phosphorylase [Bacillus licheniformis ATCC 14580] >gi|52348531|gb|AAU41165.1| DeoD [Bacillus licheniformis DSM 13] (232 aa)
Score = 419, Expect = 1.9e-39, Identities = 99/230 (43%), Positives = 141/230 (61%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  A+KG+IA+ VL+PGDPLRAK+IA+ +LEN +  N+VRGM G+TG Y  K V+V G GMG+ SI IY  EL   YDV  +IRVGS G+  KD+NV D++L   + ++S   + +   + D        L       A E NI +T   V ++D FY  +  +E++A       VEME+ +L+  A K  +KA ++LT SD ++T E  +AE+RQT F +MI LAL
  S:     1 MSVHIGAEKGQIAETVLLPGDPLRAKYIADTYLENVECYNEVRGMYGFTGTYKGKRVSVQGTGMGVPSISIYVNELIRSYDVKNLIRVGSCGAIRKDVNVRDVILAMTSSTDSQINR-VAFGSIDFAPCADFGLLKAAYDAASERNIPVTAGNVFTADQFYNDDSQIEKLAKH-GVLAVEMETTALYTLAAKFGRKALSILTVSDHVITGEETTAEERQTTFNDMILLAL 228
>gi|34764022|ref|ZP_00144909.1| Purine nucleoside phosphorylase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886207|gb|EAA23496.1| Purine nucleoside phosphorylase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (241 aa)
Score = 419, Expect = 2.0e-39, Identities = 103/236 (43%), Positives = 139/236 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M+ H  AK+G+I + VL+PGDP RAKWIAEN+LEN     D+RGMLG+TG Y  K ++V G GMG+ SI IY  EL   Y V  +IRVGSAGSY +DI V D+V+     ++S           + +   + EL  +  K A E NIK+    V +SD FY  +    +  +D     VEME+  L+  A K   KA ++LT SDSLV+ E  SAE+R+  F  MI LAL++  +I
  S:     7 MSIHIGAKEGDIVETVLLPGDPKRAKWIAENYLENAFCYTDIRGMLGFTGTYKGKRISVQGTGMGIPSISIYITELMKDYGVKNLIRVGSAGSYQEDIKVRDVVIAMSTSTDSNINNR-RFNGGNFSPTANFELFSLALKVAEEKNIKIKAGNVLTSDEFYNDDSDYYKKWADFGILAVEMETAGLYTLAAKYKAKALSILTISDSLVSPEITSAEEREKTFSEMIELALEIAVRI 241
>gi|91214890|ref|ZP_01251863.1| Purine-nucleoside phosphorylase [Psychroflexus torquis ATCC 700755] >gi|91187317|gb|EAS73687.1| Purine-nucleoside phosphorylase [Psychroflexus torquis ATCC 700755] (232 aa)
Score = 418, Expect = 2.5e-39, Identities = 100/232 (43%), Positives = 142/232 (61%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           M+ H  AKKGEIA+ +L+PGDPLRAKWIAE +LEN    N+VRGMLGYTG Y  ++++V G GMG+ SI IY++EL + + V  +IRVGSAG+  +D+ +GD+++   A S S+  +       D     S  L D   KTA +  I      V SSD FY  +    +  +      VEME+  L++ A K N  A  +LT SDSL+T E  +A++R++ F NMI +AL++
  S:     1 MSVHINAKKGEIAETILLPGDPLRAKWIAETYLENISCYNEVRGMLGYTGTYKGRKISVQGTGMGIPSISIYAHELISEFGVKNLIRVGSAGAIKQDVKMGDVIIAMAASSSSSLNRN-RFNGGDFAPTASFNLFDKAIKTARDQKISFKAGNVLSSDFFYTDDPLDYEKWAAYNVLCVEMEAAGLYSIAAKHNVDALAILTISDSLITGEQSTAQERESTFNNMIKIALEL 231
>gi|126734845|ref|ZP_01750591.1| purine nucleoside phosphorylase [Roseobacter sp. CCS2] >gi|126715400|gb|EBA12265.1| purine nucleoside phosphorylase [Roseobacter sp. CCS2] (234 aa)
Score = 417, Expect = 3.3e-39, Identities = 94/230 (40%), Positives = 132/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  A+K +IA  VLMPGDP RAKW AE FL + + IN+VRGMLG+TG +N   VT+ G GMGM S+ IY+ EL   YDV  +IR+GS G   K++ + D++L   A + ST ++ I  E   +         D +   A     K   V  H     SSD+FY     + +         VEME+  L+  A +  ++A  +LT SD L+THE++ AEDR+  F +M+ +AL
  S:     1 MTIHIGAEKSDIAPTVLMPGDPYRAKWAAETFLTDARCINEVRGMLGFTGTWNGHPVTIQGSGMGMPSLSIYANELIKDYDVQTLIRIGSCGGMQKNVGIRDVILAMTASTLSTPSRGIFKELNFAPCA------DYVLLAAAHQAAKSKGVPTHVGGIYSSDVFYDERPDLNEQMVRHGILGVEMEAAELYNLAARYGRRALAVLTVSDHLITHEALPAEDRERSFGDMVEIAL 229
>gi|20808171|ref|NP_623342.1| purine-nucleoside phosphorylase [Thermoanaerobacter tengcongensis MB4] >gi|81590626|sp|Q8R973|DEOD_THETN Purine nucleoside phosphorylase deoD-type (PNP) >gi|20516762|gb|AAM24946.1| Purine-nucleoside phosphorylase [Thermoanaerobacter tengcongensis MB4] (232 aa)
Score = 414, Expect = 7.8e-39, Identities = 98/232 (42%), Positives = 138/232 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           M+ H  AK+G+IA+ VL+PGDPLRAK+IAEN LE+ K  N+VRGM G+TGYY  K V+V G GMG+ SI IY  EL   Y V  +IR+G+ GS   DI + D+V+   A ++S   K I     D     S +L       A+E  I+     + ++D FY  +    ++ +      VEME+  L+  A K    A T+LT SDSLVT E+ SAE+RQ  F++M+ +AL++
  S:     1 MSIHIGAKEGDIAETVLLPGDPLRAKYIAENLLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGVPSISIYVNELITSYGVKNLIRIGTCGSLQPDIKIRDIVIAMSASTDSAINK-IRFNGMDYAPTASFKLLKKAYDKAVEMGIEPKVGNILTTDTFYHDDPESWRLWAKFGVLAVEMETAGLYTLAAKYGVDALTILTVSDSLVTGEATSAEERQKTFMDMVKIALEI 231
>gi|19703773|ref|NP_603335.1| purine nucleoside phosphorylase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713913|gb|AAL94634.1| Purine nucleoside phosphorylase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (241 aa)
Score = 410, Expect = 2.2e-38, Identities = 103/236 (43%), Positives = 137/236 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M+ H  AK  +IA+ VL+PGDP RAKWIAEN+LEN     D+RGMLG+TG Y  K +++ G GMG+ SI IY  EL   Y V  +IRVGSAGSY +DI V D+V+     ++S           + +   + EL  +  K A E NIK+    V +SD FY  N    +  +D     VEME+  L+  A K   KA ++LT SDSLV+ E  SAE+R+  F  MI LAL+   +I
  S:     7 MSIHIGAKLEDIAETVLLPGDPKRAKWIAENYLENAFCYTDIRGMLGFTGTYKGKMISIQGTGMGIPSISIYITELMKDYGVKNLIRVGSAGSYQEDIKVRDVVIAMSTSTDSNINNR-KFNGANFSPTANFELFSMALKVAEEKNIKIKAGNVLTSDEFYSDNSDYYKKWADFGVLAVEMETAGLYTLAAKYKAKALSILTISDSLVSPEITSAEEREKTFSEMIELALETAIRI 241
>gi|150018954|ref|YP_001311208.1| purine nucleoside phosphorylase [Clostridium beijerinckii NCIMB 8052] >gi|189083109|sp|A6M0X2|DEOD_CLOB8 Purine nucleoside phosphorylase deoD-type (PNP) >gi|149905419|gb|ABR36252.1| purine nucleoside phosphorylase [Clostridium beijerinckii NCIMB 8052] (237 aa)
Score = 408, Expect = 3.8e-38, Identities = 96/236 (40%), Positives = 135/236 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M+ H  A +G IA+ VL+PGDPLRAK+IAENFLE+    N+VRGM G+TG Y  K+++V G GMG+ SI IY+ EL   Y V  +IRVG+ G Y++ + V DL++   A ++S     +  + +      S EL       A+E         ++SSD+FYG +    +  +      VEME+ +L+  A K    A  LLT SD  VT E  SAE+RQ  F NM+ +AL  + KI
  S:     1 MSVHINAPEGAIAESVLLPGDPLRAKFIAENFLEDVVCYNEVRGMYGFTGTYKGKKISVQGTGMGIPSISIYANELIQSYGVKNLIRVGTCGGYSEKVKVRDLIIAMSASTDSNL-NLVRFQGRTFAPTASFELLKPAYDIAVEKGFDPKVGSIYSSDVFYGDDDEDWKKWAKFGCLGVEMEAAALYTIAAKFGVNALALLTVSDHFVTGEVTSAEERQLTFTNMMEVALDTIAKI 235
>gi|16767811|ref|NP_463426.1| purine nucleoside phosphorylase [Salmonella typhimurium LT2] >gi|167546570|ref|ZP_02342134.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167989812|ref|ZP_02570912.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168244531|ref|ZP_02669463.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194451868|ref|YP_002048590.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|81594768|sp|Q8ZJV7|DEOD_SALTY Purine nucleoside phosphorylase deoD-type (PNP) >gi|16423136|gb|AAL23385.1| purine-nucleoside phosphorylase [Salmonella typhimurium LT2] >gi|194410172|gb|ACF70391.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (239 aa)
Score = 406, Expect = 6.3e-38, Identities = 95/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK IAE FLEN + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 233
>gi|110004267|emb|CAK98605.1| putative purine nucleoside phosphorylase II c-terminal truncated protein [Spiroplasma citri] (178 aa)
Score = 404, Expect = 9.6e-38, Identities = 91/164 (55%), Positives = 109/164 (66%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYI-GIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGAN 173
           MTPH  AK+ EIA+ VLMPGDPLRAK+IAE FLE  KL+N++R M  YTG Y NK +TV G  MG  SIGIYSYELF FY+VD IIR+GSAGSY   + + D+V    AY E+ YA+ + GIE  D  L  S  L   I + A    IK    +VHSSD+FY  N
  S:     1 MTPHINAKQEEIAETVLMPGDPLRAKFIAETFLEKIKLVNEIRNMYIYTGTYKNKTITVAGSEMGCPSIGIYSYELFKFYNVDNIIRIGSAGSYDDALKIYDIVNATAAYGENNYARIVAGIE--DEVLNSSQHLFATIEEVAKAKQIKTFPEIVHSSDVFYRKN 163
>gi|77960324|ref|ZP_00824201.1| COG0813: Purine-nucleoside phosphorylase [Yersinia mollaretii ATCC 43969] (239 aa)
Score = 404, Expect = 1.0e-37, Identities = 95/232 (40%), Positives = 137/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ KL+NDVRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   +  KD       +  ++ R        K  DV V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVKLVNDVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNR---LRFKDHDYAAIADF-EMTRNAVDAAKAKGIDVRVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESV 233
>gi|170717874|ref|YP_001783514.1| purine nucleoside phosphorylase [Haemophilus somnus 2336] >gi|189083111|sp|B0UVM2|DEOD_HAES2 Purine nucleoside phosphorylase deoD-type (PNP) >gi|168826003|gb|ACA31374.1| purine nucleoside phosphorylase [Haemophilus somnus 2336] (238 aa)
Score = 404, Expect = 1.1e-37, Identities = 97/233 (41%), Positives = 133/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A  G  A VVLMPGDPLRAK+IAE FLEN + + +VR MLGYTG Y  ++++VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ + D+++   A ++S   +   I  KD+      +   + R        K  DV V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  SAE+RQ  F  MI +AL+ V
  S:     1 MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNVRNMLGYTGTYKGRKISVMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFG-MARAAVQAAKNKGIDVKVGNLFSADLFYTPDLEMFDVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHEQTSAEERQLTFNEMIEIALESV 232
>gi|117626742|ref|YP_860065.1| purine nucleoside phosphorylase [Escherichia coli APEC O1] >gi|91075674|gb|ABE10555.1| purine nucleoside phosphorylase [Escherichia coli UTI89] >gi|115515866|gb|ABJ03941.1| purine nucleoside phosphorylase [Escherichia coli APEC O1] (258 aa)
Score = 404, Expect = 1.1e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:    22 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 252
>gi|26111707|gb|AAN83888.1|AE016772_66 Purine nucleoside phosphorylase [Escherichia coli CFT073] (258 aa)
Score = 404, Expect = 1.1e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:    22 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 252
>gi|27367887|ref|NP_763414.1| purine nucleoside phosphorylase [Vibrio vulnificus CMCP6] >gi|161486686|ref|NP_936410.2| purine nucleoside phosphorylase [Vibrio vulnificus YJ016] >gi|81446828|sp|Q8D3Z2|DEOD2_VIBVU Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|85540976|sp|Q7MFG6|DEOD2_VIBVY Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|27359460|gb|AAO08404.1|AE016813_156 Purine-nucleoside phosphorylase [Vibrio vulnificus CMCP6] (236 aa)
Score = 404, Expect = 1.1e-37, Identities = 93/230 (40%), Positives = 136/230 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+N+ D+V+   A ++S   +    +   + L     L + + K A   N+ +    V S+D+FY     + +         V+ME+  ++  A  L  KA T+LT SD ++  E +S+EDRQ  F +M+ +AL+
  S:     3 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEEAV-KQARAQNVPVKVGNVFSADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGEKLSSEDRQKSFNDMMKVALE 231
>gi|67480401|ref|XP_655550.1| purine nucleoside phosphorylase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56472702|gb|EAL50167.1| purine nucleoside phosphorylase, putative [Entamoeba histolytica HM-1:IMSS] (235 aa)
Score = 403, Expect = 1.3e-37, Identities = 91/231 (39%), Positives = 137/231 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-------YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           TPHN A   + A  VL+ GDPLR K++A+ +L +   +N VRG LGYTGYY  K+V++  HGMG+ SIGIY+YELF FY V  IIR+GSAG+ +  +++GD+V+   A   S + +       +  I   +   +  + +  +  K A+ N        V SSD FY  + S+++         VEME+  L+A A +  K+A T+ + SD      ++SAE+RQTKF  M+ +AL +
  S:     6 TPHNNANIADFADTVLVAGDPLRCKFVADTYLTDVVQVNGVRGALGYTGYYKGKKVSIQAHGMGIPSIGIYAYELFNFYGVKRIIRIGSAGAISSKLDIGDIVIATGACHNSNFMQQYKLPGTFCPIADYELVHKAVEAVEKIGAKYAVGN--------VFSSDCFYDDSSSLKE-WDKMGVLAVEMEAAGLYAIAARAGKQALTICSISDCPFKETALSAEERQTKFTQMMEVALSI 234
>gi|113460434|ref|YP_718496.1| purine nucleoside phosphorylase [Haemophilus somnus 129PT] >gi|123131932|sp|Q0I1K5|DEOD_HAES1 Purine nucleoside phosphorylase deoD-type (PNP) >gi|112822477|gb|ABI24566.1| purine-nucleoside phosphorylase [Haemophilus somnus 129PT] (238 aa)
Score = 403, Expect = 1.5e-37, Identities = 96/233 (41%), Positives = 132/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A  G  A VVLMPGDPLRAK+IAE FLEN + + ++R MLGYTG Y  ++++VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ + D+++   A ++S   +   I  KD+      +            N K  DV V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  SAE+RQ  F  MI +AL+ V
  S:     1 MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNIRNMLGYTGTYKGRKISVMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFGMAQAAVQAAKN-KGIDVKVGNLFSADLFYTPDPEMFDVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHEQTSAEERQLTFNEMIEIALESV 232
>gi|108761834|ref|YP_630526.1| purine nucleoside phosphorylase [Myxococcus xanthus DK 1622] >gi|122981183|sp|Q1D9Z7|DEOD_MYXXD Purine nucleoside phosphorylase deoD-type (PNP) >gi|108465714|gb|ABF90899.1| purine nucleoside phosphorylase [Myxococcus xanthus DK 1622] (239 aa)
Score = 402, Expect = 1.5e-37, Identities = 90/231 (38%), Positives = 130/231 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST----------YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           TPH  A  G+ A VVLMPGDPLRA++I++ FLE  + +  VR MLG+TG +  + V+VMGHGMG+ SI IY+ EL   Y V VIIRVGS G+ + D+ V ++++   A ++S           +A           +E ++  N  +R              V +SD+FY     +    +      VEME   L+  A +   +A  LLT SD ++T ES++ ++RQT F  MI LAL V
  S:     3 TPHISAAPGDFADVVLMPGDPLRARYISDRFLEGAREVTSVRNMLGFTGTFRGRRVSVMGHGMGVPSISIYATELIKTYGVRVIIRVGSCGALSTDVKVREVIVATGAGTDSNVNRMRLMGHDFAAVADFTLARRAMEAAERRNKPVRAGP-----------VFTSDLFYHPQEQLNATLARMGVLAVEMEVAGLYGVAAESGARALGLLTVSDHIITGESLTPQERQTTFDEMIELALDV 232
>gi|34499153|ref|NP_903368.1| purine nucleoside phosphorylase [Chromobacterium violaceum ATCC 12472] >gi|81654560|sp|Q7NRT2|DEOD_CHRVO Purine nucleoside phosphorylase deoD-type (PNP) >gi|34105004|gb|AAQ61360.1| purine nucleoside phosphorylase [Chromobacterium violaceum ATCC 12472] (236 aa)
Score = 402, Expect = 1.6e-37, Identities = 94/235 (40%), Positives = 135/235 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  AK G  A+ VLMPGDPLRA+ IAE FLE  +L+ +VR + GYTG Y  K ++VM HGMG+ S  IY+ EL   Y V  IIR+GS G+ T DI + +L +   A ++S   + +     D        L   +  TA E   K+T   V S+D+FYG   ++  + S  +  V+EME   +++ A +   +A  +LT SD + T E+ SAE+RQT F +M+ +AL    K+
  S:     3 TPHINAKDGAFAETVLMPGDPLRAQLIAETFLEGAELVTNVRNVFGYTGTYKGKRLSVMAHGMGIPSASIYTTELIKDYGVKNIIRIGSCGAVTPDIKLRELFVAMGASTDSKVNR-MRFNDHDYAAIADYTLLRTVVDTAAEQGKKVTVGNVFSADLFYGVQPNMLDVLSKLQVNVIEMELAGIYSVAAQYGARAVGILTVSDIIPTGEATSAEERQTSFRDMMEVALDAAIKL 236
>gi|16079021|ref|NP_389844.1| purine nucleoside phosphorylase [Bacillus subtilis subsp. subtilis str. 168] >gi|6647707|sp|O34925|DEOD_BACSU Purine nucleoside phosphorylase deoD-type (PNP) (Purine nucleoside phosphorylase II) (PU-NPase II) >gi|2415397|gb|AAB72065.1| purine nucleoside phosphorylase [Bacillus subtilis] >gi|2529472|gb|AAB81164.1| YokY [Bacillus subtilis] >gi|2634355|emb|CAB13854.1| purine nucleoside phosphorylase [Bacillus subtilis subsp. subtilis str. 168] (233 aa)
Score = 402, Expect = 1.6e-37, Identities = 98/235 (41%), Positives = 144/235 (61%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  A+KG+IA  VL+PGDPLRAK+IAE +LEN +  N+VRGM G+TG Y  K+++V G GMG+ SI IY  EL   YDV  +IRVGS G+  KD+ V D++L   + ++S   + +   + D       EL       A +  + +T   V ++D FY  +  +E++A   K  V  VEME+ +L+  A K  +KA ++LT SD ++T E  +AE+RQT F +MI +AL  V +
  S:     1 MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLA---KYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ 233
>gi|89053290|ref|YP_508741.1| purine-nucleoside phosphorylase [Jannaschia sp. CCS1] >gi|88862839|gb|ABD53716.1| purine-nucleoside phosphorylase [Jannaschia sp. CCS1] (234 aa)
Score = 402, Expect = 1.7e-37, Identities = 90/231 (38%), Positives = 130/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A  G+IA+ VLMPGDPLRAKW AE FLENP  +N+VRGMLG+TG +    VT+ G GMGM S+ IY+ EL   Y    +IR+GS G+   D+ + D++L   A + ST +  I  E   +       L     K A      +    ++SSD+FY     + +         VEME+  L+  A +   +A  +LT SD L+T E++ +E+RQ+ F +M+ +AL+
  S:     1 MTVHIGAAPGDIAETVLMPGDPLRAKWAAERFLENPVCVNEVRGMLGFTGMWRGNRVTIHGSGMGMPSLSIYANELLRDYGAKTLIRIGSCGAMQADVKLRDVILAMTASTLSTPSSGIFRELNYAPCADYGLLQ-AAYKAAEGKGSPIHVGGIYSSDVFYDERPDLNEQMVRHGVLAVEMEAAELYTLAARHKARALAVLTVSDHLLTEEALPSEERQSSFSDMVEIALE 230
>gi|62182988|ref|YP_219405.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161617883|ref|YP_001591849.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167559186|ref|ZP_02352193.1| hypothetical protein Sententeri_20359 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|189083113|sp|A9N7E3|DEOD_SALPB Purine nucleoside phosphorylase deoD-type (PNP) >gi|75478553|sp|Q57G38|DEOD_SALCH Purine nucleoside phosphorylase deoD-type (PNP) >gi|62130621|gb|AAX68324.1| purine-nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161367247|gb|ABX71015.1| hypothetical protein SPAB_05750 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (239 aa)
Score = 402, Expect = 1.9e-37, Identities = 94/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 233
>gi|116511748|ref|YP_808964.1| purine-nucleoside phosphorylase [Lactococcus lactis subsp. cremoris SK11] >gi|125624400|ref|YP_001032883.1| DeoD protein [Lactococcus lactis subsp. cremoris MG1363] >gi|123025471|sp|Q02ZT0|DEOD_LACLS Purine nucleoside phosphorylase deoD-type (PNP) >gi|3121986|sp|O32810|DEOD_LACLM Purine nucleoside phosphorylase deoD-type (PNP) >gi|2281310|gb|AAC45498.1| purine nucleoside phosphorylase [Lactococcus lactis subsp. cremoris] >gi|116107402|gb|ABJ72542.1| purine-nucleoside phosphorylase [Lactococcus lactis subsp. cremoris SK11] >gi|124493208|emb|CAL98173.1| DeoD protein [Lactococcus lactis subsp. cremoris MG1363] (234 aa)
Score = 401, Expect = 2.0e-37, Identities = 92/232 (39%), Positives = 140/232 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+KGEIA  +L+PGDPLRAK+IAENFLE+    N VRGMLG+TG Y    V+VMG GMG+ SI IY+ EL   Y V  +IRVG+AGS  +D+++ DLV+ + A + S   ++   +  D       + + + +   I  ++ +T  V  + SSD+FYG   +V+        + VEME+  L+    K   +   ++T SD ++T ES ++E+RQ  F +M+ + L+ +
  S:     3 TPHIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRH---DFPDFDFPQIADFDLLDKAYHIAKDLGITTHVGNILSSDLFYGGPDAVK--VGKLGVKAVEMEAAGLYYLGAKYKVQTLGIMTISDHILTGESTTSEERQLTFTDMMKVGLETL 231
>gi|16763365|ref|NP_458982.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144843|ref|NP_808185.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56416344|ref|YP_153419.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167552204|ref|ZP_02345957.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168219873|ref|ZP_02645105.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227698|ref|ZP_02652929.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168230216|ref|ZP_02655274.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168234706|ref|ZP_02659764.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168262376|ref|ZP_02684349.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464510|ref|ZP_02698413.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168473819|ref|ZP_02702842.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168822113|ref|ZP_02834113.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442299|ref|YP_002043811.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194469651|ref|ZP_03075635.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194737296|ref|YP_002117485.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|81593046|sp|Q8Z0U2|DEOD_SALTI Purine nucleoside phosphorylase deoD-type (PNP) >gi|81599672|sp|Q5PK20|DEOD_SALPA Purine nucleoside phosphorylase deoD-type (PNP) >gi|25326513|pir||AF1073 purine nucleoside phosphorylase (EC 2.4.2.1) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505674|emb|CAD03405.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140482|gb|AAO72045.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56130601|gb|AAV80107.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|194400962|gb|ACF61184.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194456015|gb|EDX44854.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194712798|gb|ACF92019.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632980|gb|EDX51434.1| purine nucleoside phosphorylase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (239 aa)
Score = 401, Expect = 2.1e-37, Identities = 94/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 233
>gi|17942804|pdb|1K9S|A Chain A, Purine Nucleoside Phosphorylase From E. Coli In Complex With Formycin A Derivative And Phosphate >gi|17942805|pdb|1K9S|B Chain B, Purine Nucleoside Phosphorylase From E. Coli In Complex With Formycin A Derivative And Phosphate >gi|17942806|pdb|1K9S|C Chain C, Purine Nucleoside Phosphorylase From E. Coli In Complex With Formycin A Derivative And Phosphate >gi|17942807|pdb|1K9S|D Chain D, Purine Nucleoside Phosphorylase From E. Coli In Complex With Formycin A Derivative And Phosphate >gi|17942808|pdb|1K9S|E Chain E, Purine Nucleoside Phosphorylase From E. Coli In Complex With Formycin A Derivative And Phosphate >gi|17942809|pdb|1K9S|F Chain F, Purine Nucleoside Phosphorylase From E. Coli In Complex With Formycin A Derivative And Phosphate >gi|39654483|pdb|1PK7|A Chain A, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With Adenosine And SulfatePHOSPHATE >gi|39654484|pdb|1PK7|B Chain B, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With Adenosine And SulfatePHOSPHATE >gi|39654485|pdb|1PK7|C Chain C, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With Adenosine And SulfatePHOSPHATE >gi|39654486|pdb|1PK9|A Chain A, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 2-Fluoroadenosine And SulfatePHOSPHATE >gi|39654487|pdb|1PK9|B Chain B, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 2-Fluoroadenosine And SulfatePHOSPHATE >gi|39654488|pdb|1PK9|C Chain C, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 2-Fluoroadenosine And SulfatePHOSPHATE >gi|39654489|pdb|1PKE|A Chain A, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 2-Fluoro-2'-Deoxyadenosine And SulfatePHOSPHATE >gi|39654490|pdb|1PKE|B Chain B, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 2-Fluoro-2'-Deoxyadenosine And SulfatePHOSPHATE >gi|39654491|pdb|1PKE|C Chain C, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 2-Fluoro-2'-Deoxyadenosine And SulfatePHOSPHATE (237 aa)
Score = 401, Expect = 2.4e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     2 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 232
>gi|16803896|ref|NP_465381.1| purine nucleoside phosphorylase [Listeria monocytogenes EGD-e] >gi|46908088|ref|YP_014477.1| purine nucleoside phosphorylase [Listeria monocytogenes str. 4b F2365] >gi|47093239|ref|ZP_00231011.1| purine nucleoside phosphorylase [Listeria monocytogenes str. 4b H7858] >gi|47096899|ref|ZP_00234477.1| purine nucleoside phosphorylase [Listeria monocytogenes str. 1/2a F6854] >gi|153167699|ref|ZP_01927803.1| purine nucleoside phosphorylase [Listeria monocytogenes FSL N1-017] >gi|153183344|ref|ZP_01934204.1| purine nucleoside phosphorylase [Listeria monocytogenes J0161] >gi|153191359|ref|ZP_01938579.1| purine nucleoside phosphorylase [Listeria monocytogenes J2818] >gi|167015024|ref|ZP_02277557.1| purine nucleoside phosphorylase [Listeria monocytogenes FSL J1-194] >gi|167214714|ref|ZP_02285021.1| purine nucleoside phosphorylase [Listeria monocytogenes FSL R2-503] >gi|168266261|ref|ZP_02688226.1| purine nucleoside phosphorylase [Listeria monocytogenes FSL J2-071] >gi|81565532|sp|Q71YG0|DEOD_LISMF Purine nucleoside phosphorylase deoD-type (PNP) >gi|81592748|sp|Q8Y644|DEOD_LISMO Purine nucleoside phosphorylase deoD-type (PNP) >gi|16411310|emb|CAC99934.1| purine nucleoside phosphorylase [Listeria monocytogenes] >gi|46881358|gb|AAT04654.1| purine nucleoside phosphorylase [Listeria monocytogenes str. 4b F2365] >gi|47014712|gb|EAL05667.1| purine nucleoside phosphorylase [Listeria monocytogenes str. 1/2a F6854] >gi|47018371|gb|EAL09132.1| purine nucleoside phosphorylase [Listeria monocytogenes str. 4b H7858] >gi|126943635|gb|EBA21352.1| purine nucleoside phosphorylase [Listeria monocytogenes J0161] >gi|127765138|gb|EBA25488.1| purine nucleoside phosphorylase [Listeria monocytogenes J2818] >gi|133726798|gb|EBA28496.1| purine nucleoside phosphorylase [Listeria monocytogenes FSL N1-017] (233 aa)
Score = 401, Expect = 2.5e-37, Identities = 101/235 (42%), Positives = 139/235 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD-------ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+  L N VRGMLG+TG Y  ++V+VMG GMG+ SI IY  EL   YDV  +IRVG+ G    D+ V D+V+ + A ++S        +   +T  G D        L        IE  + L    V S+D FY      +Q+A D     +EME+ +L+  A K  ++A  +LT SD + T E  SAE+RQT F +MI +AL+   K
  S:     1 MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDS--------QINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLDKQQLA-DYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK 233
>gi|82779635|ref|YP_405984.1| purine nucleoside phosphorylase [Shigella dysenteriae Sd197] >gi|85541682|sp|Q327L2|DEOD_SHIDS Purine nucleoside phosphorylase deoD-type (PNP) >gi|81243783|gb|ABB64493.1| purine-nucleoside phosphorylase [Shigella dysenteriae Sd197] (239 aa)
Score = 400, Expect = 2.7e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 233
>gi|1633413|pdb|1ECP|A Chain A, Purine Nucleoside Phosphorylase >gi|1633414|pdb|1ECP|B Chain B, Purine Nucleoside Phosphorylase >gi|1633415|pdb|1ECP|C Chain C, Purine Nucleoside Phosphorylase >gi|1633416|pdb|1ECP|D Chain D, Purine Nucleoside Phosphorylase >gi|1633417|pdb|1ECP|E Chain E, Purine Nucleoside Phosphorylase >gi|1633418|pdb|1ECP|F Chain F, Purine Nucleoside Phosphorylase >gi|3892013|pdb|1A69|A Chain A, Purine Nucleoside Phosphorylase In Complex With Formycin B And Sulphate (Phosphate) >gi|3892014|pdb|1A69|B Chain B, Purine Nucleoside Phosphorylase In Complex With Formycin B And Sulphate (Phosphate) >gi|3892015|pdb|1A69|C Chain C, Purine Nucleoside Phosphorylase In Complex With Formycin B And Sulphate (Phosphate) >gi|46015038|pdb|1OTY|A Chain A, Native Pnp +allo >gi|46015039|pdb|1OTY|B Chain B, Native Pnp +allo >gi|46015040|pdb|1OTY|C Chain C, Native Pnp +allo >gi|46015041|pdb|1OU4|A Chain A, Native Pnp +talo >gi|46015042|pdb|1OU4|B Chain B, Native Pnp +talo >gi|46015043|pdb|1OU4|C Chain C, Native Pnp +talo (238 aa)
Score = 400, Expect = 2.8e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     2 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 232
>gi|30065622|ref|NP_839793.1| purine nucleoside phosphorylase [Shigella flexneri 2a str. 2457T] >gi|56480611|ref|NP_710124.2| purine nucleoside phosphorylase [Shigella flexneri 2a str. 301] >gi|110644821|ref|YP_672551.1| purine nucleoside phosphorylase [Escherichia coli 536] >gi|110808173|ref|YP_691693.1| purine nucleoside phosphorylase [Shigella flexneri 5 str. 8401] >gi|161486005|ref|NP_757314.2| purine nucleoside phosphorylase [Escherichia coli CFT073] >gi|162138297|ref|YP_544086.2| purine nucleoside phosphorylase [Escherichia coli UTI89] >gi|170021656|ref|YP_001726610.1| purine nucleoside phosphorylase [Escherichia coli ATCC 8739] >gi|188494998|ref|ZP_03002268.1| purine nucleoside phosphorylase [Escherichia coli 53638] >gi|191167403|ref|ZP_03029218.1| purine nucleoside phosphorylase [Escherichia coli B7A] >gi|191173136|ref|ZP_03034668.1| purine nucleoside phosphorylase [Escherichia coli F11] >gi|85541013|sp|Q8FA51|DEOD_ECOL6 Purine nucleoside phosphorylase deoD-type (PNP) >gi|123047646|sp|Q0SX27|DEOD_SHIF8 Purine nucleoside phosphorylase deoD-type (PNP) >gi|123048516|sp|Q0T8S9|DEOD_ECOL5 Purine nucleoside phosphorylase deoD-type (PNP) >gi|189083110|sp|B1IS35|DEOD_ECOLC Purine nucleoside phosphorylase deoD-type (PNP) >gi|81723869|sp|Q83P00|DEOD_SHIFL Purine nucleoside phosphorylase deoD-type (PNP) >gi|30043886|gb|AAP19605.1| purine-nucleoside phosphorylase [Shigella flexneri 2a str. 2457T] >gi|56384162|gb|AAN45831.2| purine-nucleoside phosphorylase [Shigella flexneri 2a str. 301] >gi|110346413|gb|ABG72650.1| purine nucleoside phosphorylase [Escherichia coli 536] >gi|110617721|gb|ABF06388.1| purine-nucleoside phosphorylase [Shigella flexneri 5 str. 8401] >gi|169756584|gb|ACA79283.1| purine nucleoside phosphorylase [Escherichia coli ATCC 8739] >gi|188490197|gb|EDU65300.1| purine nucleoside phosphorylase [Escherichia coli 53638] >gi|190902543|gb|EDV62277.1| purine nucleoside phosphorylase [Escherichia coli B7A] >gi|190906521|gb|EDV66128.1| purine nucleoside phosphorylase [Escherichia coli F11] (239 aa)
Score = 400, Expect = 2.8e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 233
>gi|84515890|ref|ZP_01003251.1| purine nucleoside phosphorylase [Loktanella vestfoldensis SKA53] >gi|84510332|gb|EAQ06788.1| purine nucleoside phosphorylase [Loktanella vestfoldensis SKA53] (234 aa)
Score = 400, Expect = 2.9e-37, Identities = 89/231 (38%), Positives = 128/231 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A K +IA  VLMPGDP RAKW AE FL++ + IN VRGMLG+TG ++   VT+ G GMGM S+ IY+ EL   YD   +IR+GS G     + + D++L   A + ST ++ I    KD       +   +            T  V  ++SSD+FY     +           VEME+  L+  A +  ++A  +LT SD L+THE++ AEDR+  F +M+ +AL+
  S:     1 MTIHIGAAKDDIAPTVLMPGDPYRAKWAAETFLDDARCINQVRGMLGFTGTWHGHPVTIQGSGMGMPSLSIYANELIRDYDAQTLIRIGSCGGMQDHVGIRDVILAMTATTLSTPSRGI---FKDLNFAPCADFGLLAAAHHAALAKGTTTHVGGIYSSDVFYDERADLNDQMMRHGILAVEMEAAELYILAARYKRRALAVLTVSDHLITHEALPAEDRERSFGDMVEIALQ 230
>gi|126650222|ref|ZP_01722450.1| purine nucleoside phosphorylase [Bacillus sp. B14905] >gi|126592872|gb|EAZ86854.1| purine nucleoside phosphorylase [Bacillus sp. B14905] (235 aa)
Score = 400, Expect = 3.0e-37, Identities = 94/231 (40%), Positives = 137/231 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AKKGEIA  +L+PGDPLRAK+IAE FLE+    N+VR M GYTG Y  K ++V G GMG+ SI IY+ EL   YDV  +IRVG+ G+  KD+ V D++L + A S++   + I   A D       +L         +  + L    + ++D+FY      E++A       VEMES +L+  A K  +KA ++LT SD ++T E  ++E+RQT F +M+ +AL+
  S:     1 MSVHINAKKGEIADTILLPGDPLRAKYIAETFLEDVTCYNEVRNMFGYTGTYKGKRISVQGTGMGVPSISIYATELMQEYDVQKLIRVGTCGAIQKDVKVRDVILAQAATSDTRMNQIIWGGAIDFAPIADFDLLLKAYNAGKDAGLNLQVGNIFTADLFYSDEHQNEKLAQ-YGVLAVEMESAALYTLAAKFGRKALSVLTVSDHILTGEVTTSEERQTTFNDMMVVALE 230
>gi|15804956|ref|NP_290998.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 EDL933] >gi|15834597|ref|NP_313370.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. Sakai] >gi|16132201|ref|NP_418801.1| purine-nucleoside phosphorylase [Escherichia coli str. K-12 substr. MG1655] >gi|74314819|ref|YP_313238.1| purine nucleoside phosphorylase [Shigella sonnei Ss046] >gi|82546734|ref|YP_410681.1| purine nucleoside phosphorylase [Shigella boydii Sb227] >gi|89111092|ref|AP_004872.1| purine-nucleoside phosphorylase [Escherichia coli W3110] >gi|157155627|ref|YP_001465906.1| purine nucleoside phosphorylase [Escherichia coli E24377A] >gi|157163832|ref|YP_001461150.1| purine nucleoside phosphorylase [Escherichia coli HS] >gi|168707699|ref|ZP_02739976.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4045] >gi|168718437|ref|ZP_02750714.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4206] >gi|168736699|ref|ZP_02768976.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4115] >gi|168750977|ref|ZP_02775999.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4113] >gi|168756804|ref|ZP_02781811.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4401] >gi|168762738|ref|ZP_02787745.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4501] >gi|168766667|ref|ZP_02791674.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4486] >gi|168776636|ref|ZP_02801643.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4196] >gi|168781675|ref|ZP_02806682.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4076] >gi|168785029|ref|ZP_02810036.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC869] >gi|168792350|ref|ZP_02817357.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4042] >gi|168797958|ref|ZP_02822965.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC508] >gi|170083770|ref|YP_001733090.1| purine-nucleoside phosphorylase [Escherichia coli str. K12 substr. DH10B] >gi|170680308|ref|YP_001746840.1| purine nucleoside phosphorylase [Escherichia coli SMS-3-5] >gi|187732962|ref|YP_001883048.1| purine nucleoside phosphorylase [Shigella boydii CDC 3083-94] >gi|193065647|ref|ZP_03046713.1| purine nucleoside phosphorylase [Escherichia coli E22] >gi|193070617|ref|ZP_03051555.1| purine nucleoside phosphorylase [Escherichia coli E110019] >gi|194429186|ref|ZP_03061715.1| purine nucleoside phosphorylase [Escherichia coli B171] >gi|194439314|ref|ZP_03071393.1| purine nucleoside phosphorylase [Escherichia coli 101-1] >gi|195937655|ref|ZP_03083037.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4024] >gi|81175264|sp|P0ABP8|DEOD_ECOLI Purine nucleoside phosphorylase deoD-type (PNP) (Inosine phosphorylase) >gi|167012089|sp|A7ZVS7|DEOD_ECO24 Purine nucleoside phosphorylase deoD-type (PNP) >gi|167012090|sp|A8A8B3|DEOD_ECOHS Purine nucleoside phosphorylase deoD-type (PNP) >gi|81175263|sp|P0ABP9|DEOD_ECO57 Purine nucleoside phosphorylase deoD-type (PNP) >gi|85541681|sp|Q31SV5|DEOD_SHIBS Purine nucleoside phosphorylase deoD-type (PNP) >gi|85541683|sp|Q3YU09|DEOD_SHISS Purine nucleoside phosphorylase deoD-type (PNP) >gi|39654532|pdb|1PR0|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With Inosine And PhosphateSULFATE >gi|39654533|pdb|1PR0|B Chain B, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With Inosine And PhosphateSULFATE >gi|39654534|pdb|1PR0|C Chain C, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With Inosine And PhosphateSULFATE >gi|39654535|pdb|1PR1|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With Formycin B And PhosphateSULFATE >gi|39654536|pdb|1PR1|B Chain B, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With Formycin B And PhosphateSULFATE >gi|39654537|pdb|1PR1|C Chain C, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With Formycin B And PhosphateSULFATE >gi|39654538|pdb|1PR2|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-[2-Deoxyribofuranosyl]-6-Methylpurine And PhosphateSULFATE >gi|39654539|pdb|1PR2|B Chain B, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-[2-Deoxyribofuranosyl]-6-Methylpurine And PhosphateSULFATE >gi|39654540|pdb|1PR2|C Chain C, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-[2-Deoxyribofuranosyl]-6-Methylpurine And PhosphateSULFATE >gi|39654541|pdb|1PR4|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-Ribofuranosyl-6-Methylthiopurine And PhosphateSULFATE >gi|39654542|pdb|1PR4|B Chain B, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-Ribofuranosyl-6-Methylthiopurine And PhosphateSULFATE >gi|39654543|pdb|1PR4|C Chain C, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-Ribofuranosyl-6-Methylthiopurine And PhosphateSULFATE >gi|39654544|pdb|1PR5|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 7-Deazaadenosine And PhosphateSULFATE >gi|39654545|pdb|1PR5|B Chain B, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 7-Deazaadenosine And PhosphateSULFATE >gi|39654546|pdb|1PR5|C Chain C, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 7-Deazaadenosine And PhosphateSULFATE >gi|39654547|pdb|1PR6|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-Xylofuranosyladenine And PhosphateSULFATE >gi|39654548|pdb|1PR6|B Chain B, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-Xylofuranosyladenine And PhosphateSULFATE >gi|39654549|pdb|1PR6|C Chain C, Escherichia Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D-Xylofuranosyladenine And PhosphateSULFATE >gi|39654559|pdb|1PW7|A Chain A, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D- Arabinofuranosyladenine And SulfatePHOSPHATE >gi|39654560|pdb|1PW7|B Chain B, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D- Arabinofuranosyladenine And SulfatePHOSPHATE >gi|39654561|pdb|1PW7|C Chain C, Crystal Structure Of E. Coli Purine Nucleoside Phosphorylase Complexed With 9-Beta-D- Arabinofuranosyladenine And SulfatePHOSPHATE >gi|12519411|gb|AAG59565.1|AE005669_9 purine-nucleoside phosphorylase [Escherichia coli O157:H7 EDL933] >gi|147309|gb|AAA24401.1| purine nucleoside phosphorylase >gi|537224|gb|AAA97280.1| purine-nucleoside phosphorylase [Escherichia coli] >gi|1790844|gb|AAC77337.1| purine-nucleoside phosphorylase [Escherichia coli str. K-12 substr. MG1655] >gi|13364821|dbj|BAB38766.1| purine-nucleoside phosphorylase [Escherichia coli O157:H7 str. Sakai] >gi|73858296|gb|AAZ91003.1| purine-nucleoside phosphorylase [Shigella sonnei Ss046] >gi|81248145|gb|ABB68853.1| purine-nucleoside phosphorylase [Shigella boydii Sb227] >gi|85677123|dbj|BAE78373.1| purine-nucleoside phosphorylase [Escherichia coli W3110] >gi|157069512|gb|ABV08767.1| purine nucleoside phosphorylase [Escherichia coli HS] >gi|157077657|gb|ABV17365.1| purine nucleoside phosphorylase [Escherichia coli E24377A] >gi|169891605|gb|ACB05312.1| purine-nucleoside phosphorylase [Escherichia coli str. K12 substr. DH10B] >gi|170518026|gb|ACB16204.1| purine nucleoside phosphorylase [Escherichia coli SMS-3-5] >gi|187429954|gb|ACD09228.1| purine nucleoside phosphorylase [Shigella boydii CDC 3083-94] >gi|187768014|gb|EDU31858.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4196] >gi|188014904|gb|EDU53026.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4113] >gi|189000743|gb|EDU69729.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4076] >gi|189356061|gb|EDU74480.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4401] >gi|189364163|gb|EDU82582.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4486] >gi|189366978|gb|EDU85394.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC4501] >gi|189375140|gb|EDU93556.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC869] >gi|189379510|gb|EDU97926.1| purine nucleoside phosphorylase [Escherichia coli O157:H7 str. EC508] >gi|192926720|gb|EDV81348.1| purine nucleoside phosphorylase [Escherichia coli E22] >gi|192956100|gb|EDV86565.1| purine nucleoside phosphorylase [Escherichia coli E110019] >gi|194412801|gb|EDX29094.1| purine nucleoside phosphorylase [Escherichia coli B171] >gi|194421796|gb|EDX37804.1| purine nucleoside phosphorylase [Escherichia coli 101-1] (239 aa)
Score = 400, Expect = 3.1e-37, Identities = 93/232 (40%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 233
>gi|59713585|ref|YP_206360.1| purine nucleoside phosphorylase [Vibrio fischeri ES114] >gi|163729931|ref|ZP_02137408.1| purine nucleoside phosphorylase [Vibrio fischeri MJ11] >gi|75352916|sp|Q5E0H4|DEOD2_VIBF1 Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|59481833|gb|AAW87472.1| purine nucleoside phosphorylase deoD-type 2 [Vibrio fischeri ES114] >gi|161396685|gb|EDQ20977.1| purine nucleoside phosphorylase [Vibrio fischeri MJ11] (236 aa)
Score = 400, Expect = 3.3e-37, Identities = 96/235 (40%), Positives = 134/235 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAENFLE+ K + DVR M GYTG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+ + D+V+   A ++S   + I     D        L +     A E N+ +    V S+D+FY     +           V+ME+  ++  A  L  KA T+LT SD +   E +S+EDRQ  F +M+ +AL+   K+
  S:     3 TPHINAQAGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRNMFGYTGTYKGKKVSVMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVHDDVKLMDVVIGMGASTDSKVNR-IRFNNHDFAAIADFGLLETAVGQARELNVPVKVGNVFSADLFYSPEADLFDKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIKRGEKLSSEDRQKSFNDMMTVALETAIKL 236
>gi|16801036|ref|NP_471304.1| purine nucleoside phosphorylase [Listeria innocua Clip11262] >gi|116873291|ref|YP_850072.1| purine nucleoside phosphorylase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466461|sp|A0AJW1|DEOD_LISW6 Purine nucleoside phosphorylase deoD-type (PNP) >gi|81595267|sp|Q92AF2|DEOD_LISIN Purine nucleoside phosphorylase deoD-type (PNP) >gi|16414471|emb|CAC97200.1| purine nucleoside phosphorylase [Listeria innocua] >gi|116742169|emb|CAK21293.1| deoD [Listeria welshimeri serovar 6b str. SLCC5334] (233 aa)
Score = 399, Expect = 3.7e-37, Identities = 100/235 (42%), Positives = 139/235 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD-------ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+  L N VRGMLG+TG Y  ++V+VMG GMG+ SI IY  EL   YDV  +IRVG+ G    D+ V D+V+ + A ++S        +   +T  G D        L        +E  + L    V S+D FY      +Q+A D     +EME+ +L+  A K  ++A  +LT SD + T E  SAE+RQT F +MI +AL+   K
  S:     1 MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDS--------QINRNTFAGVDFAPVADFSLLKKAYDAGVEKGLSLKVGNVFSADRFYNDQLDKQQLA-DYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK 233
>gi|37200554|dbj|BAC96380.1| purine-nucleoside phosphorylase [Vibrio vulnificus YJ016] (274 aa)
Score = 399, Expect = 4.2e-37, Identities = 93/230 (40%), Positives = 136/230 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+N+ D+V+   A ++S   +    +   + L     L + + K A   N+ +    V S+D+FY     + +         V+ME+  ++  A  L  KA T+LT SD ++  E +S+EDRQ  F +M+ +AL+
  S:    41 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEEAV-KQARAQNVPVKVGNVFSADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGEKLSSEDRQKSFNDMMKVALE 269
>gi|54301742|ref|YP_131735.1| purine nucleoside phosphorylase [Photobacterium profundum SS9] >gi|81614776|sp|Q6LLA7|DEOD2_PHOPR Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|46915162|emb|CAG21935.1| putative purine nucleoside phosphorylase [Photobacterium profundum SS9] (236 aa)
Score = 398, Expect = 5.2e-37, Identities = 90/235 (38%), Positives = 139/235 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIEN-NIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAENFLE+ K + DVR MLG+TG Y  K V+VMGHGMG+ S  IY +EL   + V  IIRVGS G+   D+ + D+++   A ++S   +    +   + +     L   +++  ++N N+++ ++   S+D+FY     +           ++ME+  ++  A +L  KA T+LT SD +   E +S+EDRQ  F  M+N+AL+    I
  S:     3 TPHINAELGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRSMLGFTGTYKGKRVSVMGHGMGIPSCSIYVHELIKDFGVKNIIRVGSCGAVHDDVKLMDIIIGMGASTDSKVNRIRFNDHDFAAIADFHLLETSVQQARLQNVNVRVGNIF--SADLFYSPEEGLFDKMEKLGMLGIDMEAAGIYGVAAELGAKALTILTVSDHIKRGEKLSSEDRQKSFGEMMNVALETAVNI 236
>gi|153196363|ref|ZP_01940733.1| purine nucleoside phosphorylase [Listeria monocytogenes 10403S] >gi|127633824|gb|EBA23216.1| purine nucleoside phosphorylase [Listeria monocytogenes 10403S] (233 aa)
Score = 398, Expect = 5.5e-37, Identities = 100/235 (42%), Positives = 139/235 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD-------ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+  L N VRGMLG+TG Y  ++V+VMG GMG+ SI IY  EL   YDV  +IRVG+ G    D+ V D+V+ + A ++S        +   +T  G D        L        IE  + L    V S+D FY      +Q+A D     ++ME+ +L+  A K  ++A  +LT SD + T E  SAE+RQT F +MI +AL+   K
  S:     1 MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDS--------QINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLDKQQLA-DYGVLGIDMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK 233
>gi|77959706|ref|ZP_00823723.1| COG0813: Purine-nucleoside phosphorylase [Yersinia bercovieri ATCC 43970] (239 aa)
Score = 398, Expect = 5.5e-37, Identities = 94/232 (40%), Positives = 136/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ K +NDVRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   +  KD       +  ++ R        K  DV V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVKQVNDVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNR---LRFKDHDYAAIADF-EMTRNAVDAAKAKGIDVRVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESV 233
>gi|150391918|ref|YP_001321967.1| purine nucleoside phosphorylase [Alkaliphilus metalliredigens QYMF] >gi|167012083|sp|A6TVU0|DEOD_ALKMQ Purine nucleoside phosphorylase deoD-type (PNP) >gi|149951780|gb|ABR50308.1| purine nucleoside phosphorylase [Alkaliphilus metalliredigens QYMF] (233 aa)
Score = 397, Expect = 6.2e-37, Identities = 96/234 (41%), Positives = 137/234 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           M+ H  AKKGEIA+ +L+PGDPLRAK+IAENFLEN +  N+VRGM G+TG Y  K ++V G GMGM SI IY  EL + Y V  +IRVG+ G+  ++I + D++L   A ++S   K +     D     S  L       A E  I      V + D FY  + +  +  ++  +  VEME+ +L+  A K    A TLLT SDSL+T    ++E+RQ  F+ M+ +AL++ E
  S:     1 MSIHIGAKKGEIAETILLPGDPLRAKFIAENFLENIECYNEVRGMYGFTGSYKGKRISVQGTGMGMPSISIYVNELISDYGVKNLIRVGTCGAMQEEIQLRDVILAMSASTDSNMNK-LRFGGMDYAPTASFRLLKKAYDVAQEKGILTRVGNVLTVDTFYNEDVNSWKKWAEFGTLAVEMETAALYTLAAKFGVDALTLLTVSDSLITGGQTTSEERQNTFMGMVKIALELAE 233
>gi|126730317|ref|ZP_01746128.1| purine nucleoside phosphorylase [Sagittula stellata E-37] >gi|126709050|gb|EBA08105.1| purine nucleoside phosphorylase [Sagittula stellata E-37] (234 aa)
Score = 397, Expect = 6.8e-37, Identities = 88/231 (38%), Positives = 131/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A  GEIA+ VLMPGDPLRA+W A+ FLEN K +N VRGMLGYTG +  + VT+ G GMGM S+ IY+ EL   Y    +IR+GS G+    + + D+++   A + ST ++ I  E   +       L   +   A   +  +    ++SSD+FY     + +         VEME+  L+  A +   +A  +LT SD L+THE++ +EDR+  F +M+ +AL+
  S:     1 MTIHIGAAPGEIAETVLMPGDPLRAEWAAQTFLENAKCVNRVRGMLGYTGTWKGQRVTIQGSGMGMPSLSIYANELIRDYGAKTLIRIGSCGAMQNSVKIRDVIVAMTASTLSTPSRGIFRELNFAPCADFGLLEKAV-TAARGKDCGVHVGGIYSSDVFYDERPDLNEQMVRHGILGVEMEAAELYTLAARHGVRALAVLTVSDHLLTHEALPSEDRERSFGDMVEIALE 230
>gi|153202851|ref|ZP_01944289.1| purine nucleoside phosphorylase [Listeria monocytogenes HPB2262] >gi|133734921|gb|EBA36619.1| purine nucleoside phosphorylase [Listeria monocytogenes HPB2262] (233 aa)
Score = 397, Expect = 7.0e-37, Identities = 100/235 (42%), Positives = 139/235 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD-------ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+  L N VRGMLG+TG Y  ++V+VMG G+G+ SI IY  EL   YDV  +IRVG+ G    D+ V D+V+ + A ++S        +   +T  G D        L        IE  + L    V S+D FY      +Q+A D     +EME+ +L+  A K  ++A  +LT SD + T E  SAE+RQT F +MI +AL+   K
  S:     1 MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGIGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDS--------QINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLDKQQLA-DYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK 233
>gi|90409827|ref|ZP_01217844.1| purine nucleoside phosphorylase [Photobacterium profundum 3TCK] >gi|90329180|gb|EAS45437.1| purine nucleoside phosphorylase [Photobacterium profundum 3TCK] (236 aa)
Score = 397, Expect = 7.1e-37, Identities = 90/235 (38%), Positives = 139/235 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIEN-NIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAENFLE+ K + DVR MLG+TG Y  K V+VMGHGMG+ S  IY +EL   + V  IIRVGS G+   D+ + D+++   A ++S   +    +   + +     L   +++  ++N N+++ ++   S+D+FY     +           ++ME+  ++  A +L  KA T+LT SD +   E +S+EDRQ  F  M+N+AL+    I
  S:     3 TPHINAELGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRSMLGFTGTYKGKRVSVMGHGMGIPSCSIYVHELIKDFGVKNIIRVGSCGAVHDDVKLMDVIIGMGASTDSKVNRIRFNDHDFAAIADFHLLETSVQQARLQNVNVRVGNIF--SADLFYSPEEGLFDKMEKLGMLGIDMEAAGIYGVAAELGAKALTILTVSDHIKRGEKLSSEDRQKSFGEMMNVALETAVNI 236
>gi|15672913|ref|NP_267087.1| purine nucleoside phosphorylase [Lactococcus lactis subsp. lactis Il1403] >gi|22653705|sp|Q9CH10|DEOD_LACLA Purine nucleoside phosphorylase deoD-type (PNP) >gi|12723866|gb|AAK05029.1|AE006327_9 purine nucleoside phosphorylase (EC 2.4.2.1) [Lactococcus lactis subsp. lactis Il1403] (234 aa)
Score = 396, Expect = 7.5e-37, Identities = 93/232 (40%), Positives = 140/232 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+KGEIA  +L+PGDPLRAK+IAENFLE+    N VRGMLG+TG Y    V+VMG GMG+ SI IY+ EL   Y V  +IRVG+AGS  +D+++ DLV+ + A   +T +  I  +  D       + + + +   I  ++ +T  V  + SSD+FYG   +V+        + VEME+  L+    K   +   ++T SD ++T ES ++E+RQ  F +M+ + L+ +
  S:     3 TPHIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAA---ATTSAIIRNDFPDFDFPQIADFDLLDKAYHIAKDLGITTHVGNILSSDLFYGGPDAVK--VGKLGVKAVEMEAAGLYYLGAKYKVQTLGIMTISDHILTGESTTSEERQLTFTDMMKVGLETL 231
>gi|33152033|ref|NP_873386.1| purine nucleoside phosphorylase [Haemophilus ducreyi 35000HP] >gi|81578196|sp|Q7VMS8|DEOD_HAEDU Purine nucleoside phosphorylase deoD-type (PNP) >gi|33148255|gb|AAP95775.1| purine nucleoside phosphorylase [Haemophilus ducreyi 35000HP] (238 aa)
Score = 396, Expect = 8.4e-37, Identities = 91/233 (39%), Positives = 131/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A  G  A VVLMPGDPLRAK+IAE FLEN + + +VR M GYTG Y  + +++MGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ + D+V+   A ++S   + I     D       E+     + A + NI +    + S+D+FY  + ++  +        VEME+  ++  A +   K+  + T SD + + E +SAEDRQ  F  MI +AL+ V
  S:     1 MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTGTYKGRRISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRADVKLRDIVIGSGACTDSKVNR-IRFRDNDFAAIADFEMTLAAYQVAKQKNISVQVGNLFSADLFYTPDVAMFDVMEKYGILGVEMEAAGIYVVAAEYGVKSLAICTVSDHIRSGEKLSAEDRQLTFNEMIEIALESV 232
>gi|121585921|ref|ZP_01675714.1| purine nucleoside phosphorylase [Vibrio cholerae 2740-80] >gi|153212817|ref|ZP_01948453.1| purine nucleoside phosphorylase [Vibrio cholerae 1587] >gi|153224772|ref|ZP_01954583.1| purine nucleoside phosphorylase [Vibrio cholerae MAK 757] >gi|153803124|ref|ZP_01957710.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-3] >gi|153820062|ref|ZP_01972729.1| purine nucleoside phosphorylase [Vibrio cholerae NCTC 8457] >gi|153824091|ref|ZP_01976758.1| purine nucleoside phosphorylase [Vibrio cholerae B33] >gi|153827503|ref|ZP_01980170.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-2] >gi|194533759|ref|YP_002069174.1| purine nucleoside phosphorylase [Vibrio cholerae MO10] >gi|194536369|ref|YP_002071529.1| purine nucleoside phosphorylase [Vibrio cholerae RC385] >gi|194538049|ref|YP_002073186.1| purine nucleoside phosphorylase [Vibrio cholerae V51] >gi|9657436|gb|AAF95967.1| purine nucleoside phosphorylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121549857|gb|EAX59877.1| purine nucleoside phosphorylase [Vibrio cholerae 2740-80] >gi|124116330|gb|EAY35150.1| purine nucleoside phosphorylase [Vibrio cholerae 1587] >gi|124117482|gb|EAY36225.1| purine nucleoside phosphorylase [Vibrio cholerae MAK 757] >gi|124121343|gb|EAY40086.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-3] >gi|125619811|gb|EAZ48337.1| purine nucleoside phosphorylase [Vibrio cholerae MO10] >gi|125622662|gb|EAZ50980.1| purine nucleoside phosphorylase [Vibrio cholerae V51] >gi|126509397|gb|EAZ71991.1| purine nucleoside phosphorylase [Vibrio cholerae NCTC 8457] >gi|126518388|gb|EAZ75611.1| purine nucleoside phosphorylase [Vibrio cholerae B33] >gi|149738566|gb|EDM52921.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-2] >gi|150421163|gb|EDN13447.1| purine nucleoside phosphorylase [Vibrio cholerae RC385] >gi|150425565|gb|EDN17341.1| purine nucleoside phosphorylase [Vibrio cholerae AM-19226] (245 aa)
Score = 396, Expect = 9.3e-37, Identities = 91/235 (38%), Positives = 133/235 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  IIR+GS G+   D+ + D+V+   A ++S   + I     D       +L +     A    + +    V S+D+FY     + +         V+ME+  ++  A  L  +A T+LT SD ++  E +S+EDRQ  F +M+ +AL+    I
  S:    12 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGKKVSVMGHGMGIPSCSIYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNR-IRFSGHDFAAIADYDLLETAVNQARAQQVPVKVGNVFSADLFYTPEPEIFEKMKKLGILGVDMEAAGIYGVAADLGARALTILTVSDHILRGEKLSSEDRQKSFNDMMKVALETAINI 245
>gi|84500166|ref|ZP_00998432.1| purine nucleoside phosphorylase [Oceanicola batsensis HTCC2597] >gi|84392100|gb|EAQ04368.1| purine nucleoside phosphorylase [Oceanicola batsensis HTCC2597] (234 aa)
Score = 396, Expect = 9.3e-37, Identities = 87/231 (37%), Positives = 129/231 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+ G+IA+ VLMPGDP RAKW AE FLE  +L+N+VRGMLG+TG +    VT+ G GMGM S+ IY+ EL   Y    +IR+GS G+    + + D++L   A S ST +     E   +       L+    + A    +      ++S+D+FY     +++         VEME+  L+  A +   +A  +LT SD L THE++ AEDR+  F +M+ +AL+
  S:     1 MTIHIGAEPGQIAETVLMPGDPYRAKWAAETFLEGAELVNEVRGMLGFTGTWRGHRVTIQGSGMGMPSLSIYANELIRDYGARTLIRIGSCGAMQSHVKIRDVILAMSASSISTPSLGFFREVNFAPTADFGLLHGAF-QAAEARGVTTHTGGIYSADVFYAERPDLDEAMERHGILAVEMEAAELYTVAARHGCRALAVLTVSDHLKTHEALPAEDREKSFGDMVEIALE 230
>gi|46015035|pdb|1OTX|A Chain A, Purine Nucleoside Phosphorylase M64v Mutant >gi|46015036|pdb|1OTX|B Chain B, Purine Nucleoside Phosphorylase M64v Mutant >gi|46015037|pdb|1OTX|C Chain C, Purine Nucleoside Phosphorylase M64v Mutant >gi|46015044|pdb|1OUM|A Chain A, M64v Pnp +talo >gi|46015045|pdb|1OUM|B Chain B, M64v Pnp +talo >gi|46015046|pdb|1OUM|C Chain C, M64v Pnp +talo >gi|46015048|pdb|1OV6|A Chain A, M64v Pnp + Allo >gi|46015049|pdb|1OV6|B Chain B, M64v Pnp + Allo >gi|46015050|pdb|1OV6|C Chain C, M64v Pnp + Allo >gi|46015051|pdb|1OVG|A Chain A, M64v Pnp +mepdr >gi|46015052|pdb|1OVG|B Chain B, M64v Pnp +mepdr >gi|46015053|pdb|1OVG|C Chain C, M64v Pnp +mepdr (238 aa)
Score = 396, Expect = 9.6e-37, Identities = 92/232 (39%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHG+G+ S  IY+ EL   + V  IIRVGS G+    + + D+V+   A ++S   +   I  KD       +  D++R           D  V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +A +RQT F +MI +AL+ V
  S:     2 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGVGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR---IRFKDHDFAAIADF-DMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESV 232
>gi|28901330|ref|NP_800985.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|153836004|ref|ZP_01988671.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus AQ3810] >gi|81725314|sp|Q87G42|DEOD2_VIBPA Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|28809877|dbj|BAC62818.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|149750758|gb|EDM61503.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus AQ3810] (236 aa)
Score = 395, Expect = 1.0e-36, Identities = 93/235 (39%), Positives = 134/235 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+N+ D+V+   A ++S   + I     D        L +   K A    + +    V S+D+FY     + +         V+ME+  ++  A  L  KA T+LT SD ++  E +S+E+RQ  F +M+ +AL+    I
  S:     3 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNR-IRFNNHDFAAIADFSLLEEAVKQARAQEVPVKVGNVFSADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEERQKSFNDMMKVALETAINI 236
>gi|121729770|ref|ZP_01682208.1| purine nucleoside phosphorylase [Vibrio cholerae V52] >gi|147672088|ref|YP_001214924.1| purine nucleoside phosphorylase [Vibrio cholerae O395] >gi|121628492|gb|EAX60979.1| purine nucleoside phosphorylase [Vibrio cholerae V52] >gi|146314471|gb|ABQ19011.1| purine nucleoside phosphorylase [Vibrio cholerae O395] (245 aa)
Score = 395, Expect = 1.1e-36, Identities = 91/235 (38%), Positives = 133/235 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  IIR+GS G+   D+ + D+V+   A ++S   + I     D       +L +     A    + +    V S+D+FY     + +         V+ME+  ++  A  L  +A T+LT SD ++  E +S+EDRQ  F +M+ +AL+    I
  S:    12 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGKKVSVMGHGMGIPSCSIYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNR-IRFSGHDFAAIADYDLLETAINQARAQQVPVKVGNVFSADLFYTPEPEIFEKMKKLGILGVDMEAAGIYGVAADLGARALTILTVSDHILRGEKLSSEDRQKSFNDMMKVALETAINI 245
>gi|153829278|ref|ZP_01981945.1| purine nucleoside phosphorylase [Vibrio cholerae 623-39] >gi|161582046|ref|NP_232454.2| purine nucleoside phosphorylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|85681036|sp|Q9KNB2|DEOD2_VIBCH Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|148875243|gb|EDL73378.1| purine nucleoside phosphorylase [Vibrio cholerae 623-39] (236 aa)
Score = 395, Expect = 1.1e-36, Identities = 91/235 (38%), Positives = 133/235 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  IIR+GS G+   D+ + D+V+   A ++S   + I     D       +L +     A    + +    V S+D+FY     + +         V+ME+  ++  A  L  +A T+LT SD ++  E +S+EDRQ  F +M+ +AL+    I
  S:     3 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGKKVSVMGHGMGIPSCSIYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNR-IRFSGHDFAAIADYDLLETAVNQARAQQVPVKVGNVFSADLFYTPEPEIFEKMKKLGILGVDMEAAGIYGVAADLGARALTILTVSDHILRGEKLSSEDRQKSFNDMMKVALETAINI 236
>gi|123440941|ref|YP_001004931.1| purine nucleoside phosphorylase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|167016845|sp|A1JJA0|DEOD_YERE8 Purine nucleoside phosphorylase deoD-type (PNP) >gi|122087902|emb|CAL10690.1| purine nucleoside phosphorylase [Yersinia enterocolitica subsp. enterocolitica 8081] (241 aa)
Score = 395, Expect = 1.1e-36, Identities = 94/232 (40%), Positives = 137/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK IAE FL++ K +NDVRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+  +D+ + D+V+   A ++S   +   +  KD       +  D+ R        K  +V V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD +V+ E  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKHIAETFLKDVKQVNDVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNR---LRFKDHDYAAIADF-DMTRNAVDAAKAKGLNVRVGNLFSADLFYTPDPQMFDVMKKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIVSGEQTTAAERQTTFNDMIEIALESV 233
>gi|71282054|ref|YP_268708.1| purine nucleoside phosphorylase [Colwellia psychrerythraea 34H] >gi|85541012|sp|Q483Q8|DEOD_COLP3 Purine nucleoside phosphorylase deoD-type (PNP) >gi|71147794|gb|AAZ28267.1| purine nucleoside phosphorylase [Colwellia psychrerythraea 34H] (234 aa)
Score = 395, Expect = 1.2e-36, Identities = 96/232 (41%), Positives = 143/232 (61%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV----VHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ GE A+ VLMPGDPLRAK+IA+NFL++ K I  VR MLGYTG Y  K V+VMG GMG+ SI IY+ EL+  Y V+ IIR+GS G+   DI + D+V+   A ++S   +      +   ++ +   +  + K+ ++   KL   V    + ++D+FY      E+ A+  K  +  VEME+  L+  A +  KKA T+LT SD + T E  ++E+R+T F +M+ L L+ V
  S:     3 TPHIEAQDGEFAETVLMPGDPLRAKFIADNFLDDAKCITQVRNMLGYTGTYKGKRVSVMGSGMGVPSISIYATELYKDYGVEKIIRIGSCGAVRDDIKIRDIVIGMAASTDSNVNR-----QRFHNVDFAACADFSLLKSVVDTAEKLGKPVHVGNIFTADLFYTPQP--EKFATMEKYGILAVEMEAAGLYGVAAEYGKKALTVLTVSDHIKTGEKTTSEERETTFKDMMELTLESV 233
>gi|157368908|ref|YP_001476897.1| purine nucleoside phosphorylase [Serratia proteamaculans 568] >gi|157320672|gb|ABV39769.1| purine nucleoside phosphorylase [Serratia proteamaculans 568] (243 aa)
Score = 395, Expect = 1.2e-36, Identities = 92/232 (39%), Positives = 139/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNK----KAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE    +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL A + V  IIRVGS G+   D+ + D+V+   A ++S   +    +   + +   D + + +   A +  I      + S+D+FY  +  + Q+        VEME+  ++  A +L +    KA T+ T SD ++ HE+ +A +RQT F  MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEGAVEVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYARELIAEFGVKKIIRVGSCGAVRDDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFDMVRNAVDAAAAQ-GIPARVGNIFSADLFYTPDPDMFQVMKKYGILGVEMEAAGIYGVAAELYEEFGCKALTICTVSDHILRHEATTAAERQTTFNEMIVIALESV 237
>gi|119715749|ref|YP_922714.1| purine-nucleoside phosphorylase [Nocardioides sp. JS614] >gi|119536410|gb|ABL81027.1| purine-nucleoside phosphorylase [Nocardioides sp. JS614] (243 aa)
Score = 394, Expect = 1.3e-36, Identities = 90/230 (39%), Positives = 134/230 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDEL----NDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  A+ G+IA +VLMPGDPLRA+WIA+ FL++ +   +VRGM GYTG +  + V+V G GMG  S+ IY+ ELF  YDV  IIRVGS G+ ++ + V D+V+   A ++S+  + I  E  D        L    +D      +   + +   ++ SSD FY A   +     D     VEME+ +L+  A K  ++A T+ T SD +VT E  SA++R+  F  M+ +AL
  S:     1 MSTHIGARPGDIAPLVLMPGDPLRARWIADTFLDDARCYTEVRGMYGYTGSWQGQRVSVQGSGMGQPSLAIYANELFREYDVQSIIRVGSCGALSERLAVRDIVIASGACTDSSMNR-IRFEGLDYAPVADFGLLRAAHDAATAKQLAEGVHVG--LIFSSDSFYPARPELAARMVDFGVLAVEMEASALYTLAAKHGRRALTICTVSDHVVTGEETSAQEREQTFGTMVEIAL 231
>gi|28211066|ref|NP_782010.1| purine nucleoside phosphorylase [Clostridium tetani E88] >gi|75542431|sp|Q894Z3|DEOD_CLOTE Purine nucleoside phosphorylase deoD-type (PNP) >gi|28203505|gb|AAO35947.1| purine nucleoside phosphorylase [Clostridium tetani E88] (235 aa)
Score = 394, Expect = 1.5e-36, Identities = 93/233 (39%), Positives = 133/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A +G IA+ +L+PGDPLRAK+IA+ FLE+    N+VRGM G+TG Y  K V+V G GMG+ S+ IY+ EL   Y V  +IRVG+ GSY + + V DL++   A + S     +  + +      S +L       A+E   +     ++SSDIFY  ++   +  +      VEME+ +L+  A K    A TLLT SD  VTHE  SAE+RQT F  M+ +AL  +
  S:     1 MSIHINAPEGAIAESILLPGDPLRAKFIADTFLEDVVCYNEVRGMYGFTGTYKGKRVSVQGTGMGIPSMSIYATELIESYGVKNLIRVGTCGSYVEKVKVRDLIIAMSACTNSN-INLVPFKGRTFAPTASFDLLKPAYDIAVEKGFEPKVGSIYSSDIFYDDDKEDWKTWAKYGCLGVEMETAALYTIAAKYGVNALTLLTVSDHFVTHEVTSAEERQTTFKAMMEVALDTI 232
>gi|29374835|ref|NP_813988.1| purine nucleoside phosphorylase [Enterococcus faecalis V583] >gi|29342293|gb|AAO80059.1| purine nucleoside phosphorylase [Enterococcus faecalis V583] (235 aa)
Score = 394, Expect = 1.5e-36, Identities = 100/231 (43%), Positives = 139/231 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AK GEIA  +L+PGDPLRAK+IAE FLENP   N VRGMLGYTG Y  + V+V G GMGM S GIY++EL   YDV  +IRVG+ GS ++ +NV +LV+ + A + S+  +    +     +   D L   ++   I      T  V  V S D+FY    S++ +    +  V  +EME+  L+  A K + +A  ++T SDSLVT E  +AE+RQT F  MI + L+
  S:     1 MSVHIEAKPGEIADKILLPGDPLRAKYIAETFLENPVCYNQVRGMLGYTGTYKGQRVSVQGTGMGMPSAGIYAHELINSYDVKKLIRVGTCGSISEKVNVRELVIAQAAATPSSAIRNDFPKYDFPQIASFDLL---LKSYEIAKAKGFTTHVGNVLSDDVFY--KDSLDDVFRLGRYGVLAIEMEAAMLYYLAAKFDVEALAIMTVSDSLVTGEETTAEERQTTFNEMIEVGLE 230
>gi|75448687|sp|Q8KRT5|DEOD_XENNE Purine nucleoside phosphorylase deoD-type (PNP) >gi|22094599|gb|AAM91930.1|AF525420_1 purine nucleoside phosphorylase [Xenorhabdus nematophila] >gi|48237466|gb|AAT40584.1| putative purine-nucleoside phosphorylase [Xenorhabdus nematophila] (238 aa)
Score = 394, Expect = 1.5e-36, Identities = 89/232 (38%), Positives = 136/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIR---KTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRA++IAE FLE+ + +N+VRGMLG+TG Y  + ++VMGHGMG+ S  IY+ EL   + V  IIR+GS G+ ++D+ + D+V+   A ++S   +   +  KD       +  D++R     A   NI      + S D+FY  +  +  +        VEME+  ++  A +   KA  + T SD + T E  +AE+RQ  F +MI +AL+ +
  S:     3 TPHINAEMGDFADVVLMPGDPLRAQYIAETFLEDARQVNNVRGMLGFTGTYKGRRISVMGHGMGIPSCSIYAKELITEFGVKKIIRIGSCGAVSEDVKIRDVVIGMGACTDSKVNR---MRFKDHDFAAIADF-DLVRHAVDAAKAKNINTRVGNIFSVDLFYSPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGEQTTAEERQHTFNDMIEIALESI 233
>gi|94985597|ref|YP_604961.1| purine nucleoside phosphorylase [Deinococcus geothermalis DSM 11300] >gi|94555878|gb|ABF45792.1| purine nucleoside phosphorylase [Deinococcus geothermalis DSM 11300] (261 aa)
Score = 394, Expect = 1.5e-36, Identities = 98/227 (43%), Positives = 127/227 (55%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-------YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           H  A+ GEIA+ VL+PGDPLRA+ IAE F ENP   N VRGMLG+TG Y    V+V G GMG+AS  IY  EL   Y    +IRVG+AGSY  D++V DLVL + A ++S           +  I   +  L       D    T + N        + SSD FY  +    ++ +      VEME+  L+  A K   +A T+LT SD LVT E  +AE+RQT F  MI +AL
  S:    23 HLNARPGEIAETVLLPGDPLRAQHIAETFFENPVQHNSVRGMLGFTGTYRGVPVSVQGTGMGIASSMIYVNELIRDYGCQTLIRVGTAGSYQPDVHVRDLVLAQAACTDSNINNIRFGLRNFAPIADFELLLRAYQMARDRGFATHVGN--------ILSSDTFYQDDPESYKLWAQYGVLAVEMEAAGLYTLAAKYGVRALTILTISDHLVTREETTAEERQTTFNGMIEVAL 248
>gi|83943857|ref|ZP_00956314.1| purine nucleoside phosphorylase [Sulfitobacter sp. EE-36] >gi|83845104|gb|EAP82984.1| purine nucleoside phosphorylase [Sulfitobacter sp. EE-36] (236 aa)
Score = 394, Expect = 1.6e-36, Identities = 86/231 (37%), Positives = 133/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  AK G+IA+ VLMPGDP RAKW AE FL++ KL+N+VRGMLG+TG +N   VT+ G GMGM S+ IY+ EL + Y+   +IR+GS G     + + D+++   A + ++ +  I  E   +       L   +   A     K     ++SSD+FY     +++  +      VEME+  L+  A +  ++A  +LT SD L T E++ AE+R+  F +M+ +AL+
  S:     1 MTIHIGAKPGDIAETVLMPGDPYRAKWAAETFLKDAKLVNEVRGMLGFTGTWNGNRVTIQGSGMGMPSLSIYANELISEYNAQTLIRIGSCGGMQPQVGIRDVIIAMTATTITSPSSGIFREMNYAPCADWSLLRAAV-DAAEAKGTKTHVGGIYSSDVFYAERPDLDEQMTRHGILGVEMEAAELYTLAARHKRRALAVLTVSDHLQTGEALPAEEREKSFGDMVEIALQ 230
>gi|67480315|ref|XP_655507.1| purine nucleoside phosphorylase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56472653|gb|EAL50119.1| purine nucleoside phosphorylase, putative [Entamoeba histolytica HM-1:IMSS] (238 aa)
Score = 393, Expect = 1.7e-36, Identities = 96/233 (41%), Positives = 142/233 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTL-------EGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY------GANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLV-THESMSAEDRQTKFVNMINLALKVVE 243
           TPHN AK GEIA+ VLM GDPLR K +A+ +L +    N VRG +GYTGYY   +++V  HGMGM SIGIY+YELF FY V  IIR+GSAG++ + + +GD+V+   A  +S + +   I  K S +       E  D    +  +  + N        ++S++ FY      GA + +  +A       VEME+ +L+  A +  K+A  +LT SD    + E M+AE+R+TKF  M+ +AL + +
  S:     7 TPHNGAKYGEIAETVLMAGDPLRVKLLADTYLTDVVQYNSVRGAVGYTGYYKGVKLSVQAHGMGMPSIGIYAYELFNFYGVKRIIRIGSAGAFDESLKLGDIVIGMGACYDSNFERQYDIPGKYSCIADFQLCREAVDAAEKLGYRYKVGN--------IYSANYFYDDGDHSGAWKKMGVLA-------VEMEAAALYMIAARARKQALCMLTISDLCYGSGEKMTAEERRTKFTQMMEVALSLAK 238
>gi|114764856|ref|ZP_01444038.1| purine nucleoside phosphorylase [Roseovarius sp. HTCC2601] >gi|114542742|gb|EAU45765.1| purine nucleoside phosphorylase [Roseovarius sp. HTCC2601] (234 aa)
Score = 393, Expect = 1.7e-36, Identities = 88/231 (38%), Positives = 132/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+ G+IA+ VLMPGDPLRA+W A  FL++P  +N VRGMLG+TG +    VT+ G GMGM S+ IY+ EL   Y    +IR+GS G+  + + + D+++   A S ST ++ I  E   +       LN  +         K T    H     SSD+FY     + ++ +      VEME+  L+  A +   +A  +LT SD L+T E++ +EDRQ+ F +M+ +AL+
  S:     1 MTVHIGAEPGQIAETVLMPGDPLRAEWAANTFLDDPVCVNRVRGMLGFTGTWKGNRVTIHGSGMGMPSLSIYANELIRDYGAKTLIRIGSCGAMQEHVGIRDVIVAMTASSLSTPSRGIFRELNFAPCADYGLLNAAVEAA------KGTGATCHVGGIYSSDVFYDERPDLTEMMTRHGILGVEMEAAELYNLAARHGVRALAVLTVSDHLLTQEALPSEDRQSSFGDMVQIALE 230
>gi|83953498|ref|ZP_00962220.1| purine nucleoside phosphorylase [Sulfitobacter sp. NAS-14.1] >gi|83842466|gb|EAP81634.1| purine nucleoside phosphorylase [Sulfitobacter sp. NAS-14.1] (236 aa)
Score = 393, Expect = 1.8e-36, Identities = 86/231 (37%), Positives = 133/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  AK G+IA+ VLMPGDP RAKW AE FL++ KL+N+VRGMLG+TG +N   VT+ G GMGM S+ IY+ EL + Y+   +IR+GS G     + + D+++   A + ++ +  I  E   +       L   +   A     K     ++SSD+FY     +++  +      VEME+  L+  A +  ++A  +LT SD L T E++ AE+R+  F +M+ +AL+
  S:     1 MTIHIGAKPGDIAETVLMPGDPYRAKWAAETFLKDAKLVNEVRGMLGFTGTWNGNRVTIQGSGMGMPSLSIYANELMSEYNAQTLIRIGSCGGMQPQVGIRDVIIAMTATTITSPSSGIFREMNYAPCADWSLLRAAV-DAAEAKGTKTHVGGIYSSDVFYAERPDLDEQMTRHGILGVEMEAAELYTLAARHKRRALAVLTVSDHLQTGEALPAEEREKSFGDMVEIALQ 230
>gi|138895089|ref|YP_001125542.1| purine nucleoside phosphorylase [Geobacillus thermodenitrificans NG80-2] >gi|196248330|ref|ZP_03147031.1| purine nucleoside phosphorylase [Geobacillus sp. G11MC16] >gi|167012093|sp|A4IN93|DEOD_GEOTN Purine nucleoside phosphorylase deoD-type (PNP) >gi|134266602|gb|ABO66797.1| Purine nucleoside phosphorylase [Geobacillus thermodenitrificans NG80-2] >gi|196212055|gb|EDY06813.1| purine nucleoside phosphorylase [Geobacillus sp. G11MC16] (236 aa)
Score = 393, Expect = 1.8e-36, Identities = 92/235 (39%), Positives = 133/235 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK GEIA+ +L+PGDPLRAK+IAE FLE     N+VRGMLG+TG Y    ++V G GMG+ SI IY  EL   Y V  +IRVG+ G+   D+ V D++L   A ++S   + I    +D        L        +E  + L    V ++D+FY    + E  A       VEME+ +L+  A K + +A ++LT SD ++T E  +AE+RQT F +MI +AL+   +
  S:     1 MSVHIGAKPGEIAEHILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGHRISVQGTGMGVPSISIYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRLI-FRGRDYAPTADFHLLRTAYDVGMEKGLALKVGNVFTADMFYNDEPNWETWAR-YGVLAVEMETAALYTLAAKFDCRALSVLTVSDHIITGEETTAEERQTTFNDMIEVALEAASR 233
>gi|89068116|ref|ZP_01155533.1| purine nucleoside phosphorylase [Oceanicola granulosus HTCC2516] >gi|89046355|gb|EAR52412.1| purine nucleoside phosphorylase [Oceanicola granulosus HTCC2516] (234 aa)
Score = 392, Expect = 2.6e-36, Identities = 88/231 (38%), Positives = 135/231 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD-ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  AK G+IA+ VLMPGDP RA+W AE FL+ P+L+N+VRGMLGYTG +    VT+ G GMGM S+ IY+ EL   Y    +IR+GS G   + + V D+V+   A S ST +  +GI  + +    +D  L       A   ++ +    ++S+D+FY     + +  +      VEME+  L+  A +  ++A  +LT SD L+T E++ +E R+  F +M+ +AL+
  S:     1 MTIHIGAKPGQIAETVLMPGDPYRARWAAETFLDAPELVNEVRGMLGYTGTWRGNRVTIQGSGMGMPSLSIYANELIRDYGAQTLIRIGSCGGMQEKVKVRDIVIAMSASSISTPS--LGIFKEFNFAPCADWSLLSAAHAAAQTRDVGVHVGGIYSADVFYDERPDLNEQMTRHGILGVEMEAAELYNLAARHGRRALAILTVSDHLITGEALPSEQRERSFGDMVEIALE 230
>gi|6647714|sp|P77835|DEOD_BACST Purine nucleoside phosphorylase deoD-type (PNP) (Purine nucleoside phosphorylase II) (PU-NPase II) >gi|1638807|dbj|BAA13510.1| purine nucleoside phosphorylase [Geobacillus stearothermophilus] (234 aa)
Score = 392, Expect = 2.6e-36, Identities = 92/231 (39%), Positives = 135/231 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AK+ EIA  +L+PGDPLRAK+IAE FLE     N VRGMLG+TG Y    ++V G GMG+ SI IY  EL   Y+V  +IRVG+ G+  KD+ V D++L   + ++S   + +     D     + +L     +   E  ++L    V ++D+FY  N   E++A       VEME+ +L+  A K  +KA ++LT SD ++T E  +AE+RQT F  MI +AL+
  S:     1 MSVHIGAKEHEIADKILLPGDPLRAKYIAETFLEGATCYNQVRGMLGFTGTYKGHRISVQGTGMGVPSISIYITELMQSYNVQTLIRVGTCGAIQKDVKVRDVILAMTSSTDSQMNR-MTFGGIDYAPTANFDLLKTAYEIGKEKGLQLKVGSVFTADMFYNENAQFEKLAR-YGVLAVEMETTALYTLAAKFGRKALSVLTVSDHILTGEETTAEERQTTFNEMIEVALE 229
>gi|120435771|ref|YP_861457.1| purine nucleoside phosphorylase DeoD [Gramella forsetii KT0803] >gi|117577921|emb|CAL66390.1| purine nucleoside phosphorylase DeoD [Gramella forsetii KT0803] (232 aa)
Score = 391, Expect = 2.9e-36, Identities = 94/232 (40%), Positives = 134/232 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           M+ H  AKKGEIA+ VL+PGDPLRAKWIAE FL++    N++RGMLG+TG Y  ++V+V G GMG+ S  IY  EL   YDV  +IRVGSAG++ +D+N+ D+V+   A + S+           +     D L   +   A + +I      V SSDIFY  +    +  +       EME+  ++  A K   KA ++LT SDSLV  E +S+E R+ K   M+ +AL +
  S:     1 MSIHIEAKKGEIAETVLLPGDPLRAKWIAETFLKDSICYNNIRGMLGFTGNYQGRKVSVQGTGMGIPSTLIYCNELIKEYDVKNLIRVGSAGAFQRDLNLMDIVIAMSASTNSSMNSQTFNGGDYAPTANFDLLMQAV-NYAEKEHIHFKAGNVLSSDIFYDDDPDYYKKWASYGVLCAEMETAGIYTLAAKFGVKALSILTISDSLVNGEEVSSEVRENKLSQMVKIALNI 231
>gi|15923126|ref|NP_370660.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu50] >gi|15925840|ref|NP_373373.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus N315] >gi|57652484|ref|YP_185025.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus COL] >gi|82749849|ref|YP_415590.1| purine nucleoside phosphorylase [Staphylococcus aureus RF122] >gi|87159961|ref|YP_492855.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300] >gi|88193911|ref|YP_498698.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266562|ref|YP_001245505.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH9] >gi|150392601|ref|YP_001315276.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH1] >gi|151220292|ref|YP_001331115.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978466|ref|YP_001440725.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu3] >gi|161508405|ref|YP_001574064.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168726804|ref|ZP_02759081.1| purine-nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13700052|dbj|BAB41351.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus N315] >gi|14245903|dbj|BAB56298.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu50] >gi|57286670|gb|AAW38764.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus COL] >gi|82655380|emb|CAI79763.1| purine nucleoside phosphorylase [Staphylococcus aureus RF122] >gi|87125935|gb|ABD20449.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201469|gb|ABD29279.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147739631|gb|ABQ47929.1| purine-nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH9] >gi|149945053|gb|ABR50989.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus JH1] >gi|150373092|dbj|BAF66352.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720601|dbj|BAF77018.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus Mu3] >gi|160367214|gb|ABX28185.1| purine-nucleoside phosphorylase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (235 aa)
Score = 391, Expect = 3.3e-36, Identities = 91/232 (39%), Positives = 138/232 (59%)
  Q:    11 TPHNRAKKG-EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH +     EIA+ VL+PGDPLRAK+IAE +L++ +  N VR M G+TG Y  K+V+VMG GMGM SIGIYSYEL   +    +IRVGS G+  ++I++ D+++ + A ++S Y +   +    + +     L   + +TA +  ++     V SSDIFY A+ +  +         VEMES +L+ NAI    +A  + T SD L+   S + E+R+  F +MI +AL +V
  S:     4 TPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTVRNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLYDVIIAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAV-ETARDKGVRHHVGNVLSSDIFYNADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERERAFTDMIEIALSLV 235
>gi|118443089|ref|YP_878402.1| purine nucleoside phosphorylase [Clostridium novyi NT] >gi|167012087|sp|A0Q1A0|DEOD_CLONN Purine nucleoside phosphorylase deoD-type (PNP) >gi|118133545|gb|ABK60589.1| purine nucleoside phosphorylase [Clostridium novyi NT] (233 aa)
Score = 391, Expect = 3.6e-36, Identities = 96/234 (41%), Positives = 143/234 (61%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES--TYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           M+ H  AK+ EIA  VL+PGDPLRAK+IAENFLE+    NDVRGM GYTG Y  K V+V G GMG+ SI IY+ EL   Y V  +IRVG+ GS  KDI V D++L   A + S     ++ G++ A  ++ +   +  D+ +   ++  IK+ +++  SSD+FY  ++   ++ S      +EME+  L+    K       +LT SDS+VT E  +A++R+T F  M+ +AL++ E
  S:     1 MSTHIGAKQNEIASTVLLPGDPLRAKFIAENFLEDVICYNDVRGMYGYTGTYKGKRVSVQGTGMGIPSISIYANELIESYGVKNLIRVGTCGSINKDIKVRDIILAMGACTNSGTNRMRFNGMDFAPIASFDLLKKAYDIGKSKGLD--IKVGNIL--SSDLFYNDDKDAIKLWSKYGVLGIEMEASGLYTLGAKYGVNTLAILTVSDSIVTGEETTAKERETTFTKMMEIALELAE 233
>gi|145300520|ref|YP_001143361.1| purine-nucleoside phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853292|gb|ABO91613.1| purine-nucleoside phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] (238 aa)
Score = 391, Expect = 3.6e-36, Identities = 91/232 (39%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  AK G  A  VLMPGDPLRAK+IAE FLEN + + DVR MLG+TG Y  + ++VMGHGMG+ S  IY+ EL   Y V  +IRVGS G+  +D+ + D+V+   A ++S   +   +  KD       + + V        N  +   V  + S+D+FY  + S+  +        VEME+  ++  A +   KA T+ T SD + T E  ++E+RQ  F +MI +AL  V
  S:     3 TPHINAKDGAFADTVLMPGDPLRAKYIAETFLENVEQVCDVRSMLGFTGTYKGRRISVMGHGMGIPSCSIYAKELITDYGVKTLIRVGSCGAVREDVKLRDVVIGMGACTDSKVNR---LRFKDHDFAAIADFDLVANAVQAAKNKGVPVRVGNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTGEQTTSEERQLTFNDMIEIALDSV 233
>gi|56965779|ref|YP_177513.1| purine nucleoside phosphorylase [Bacillus clausii KSM-K16] >gi|56912025|dbj|BAD66552.1| purine-nucleoside phosphorylase [Bacillus clausii KSM-K16] (236 aa)
Score = 390, Expect = 4.0e-36, Identities = 99/235 (42%), Positives = 137/235 (58%)
  Q:     7 EFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           EF  TPH  AK GEIA+ VL+PGDPLRAK+IAE FL +    N VR M G+TG YN K ++VMG GMGM S+GIYSYEL   + V  +IRVGS G+   D+N+ D++L   A + S Y     +    + L  S  L +  +K A E  + +    + SSD FY A+        D     +EME+ +L+ NA +    A  +LT SD +   E  +AE+R+T F NM+ +AL++
  S:     3 EFKQTPHINAK-GEIAETVLLPGDPLRAKFIAERFLTDVVQFNSVRNMFGFTGTYNGKRISVMGTGMGMPSMGIYSYELIHVFGVKNLIRVGSCGALQDDLNLYDVILGMGASTNSNYVNQYHLPGTFAPL-ASYSLLEKAKKAADEKGVPVHVGNILSSDTFYNADEDAAGKWRDMGILGIEMEAAALYMNAAQAGVNALCILTVSDHIFKEEETTAEERETSFTNMMEIALEL 235
>gi|52425954|ref|YP_089091.1| purine nucleoside phosphorylase [Mannheimia succiniciproducens MBEL55E] >gi|81609417|sp|Q65RA4|DEOD_MANSM Purine nucleoside phosphorylase deoD-type (PNP) >gi|52308006|gb|AAU38506.1| DeoD protein [Mannheimia succiniciproducens MBEL55E] (238 aa)
Score = 390, Expect = 4.0e-36, Identities = 93/233 (39%), Positives = 131/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FLEN K + +VR MLGYTG Y  + V+VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ V D+++   A ++S   + I  +  D       ++     + A    I      + S+D+FY  +  +  +        VEME+  ++  A +   KA ++ T SD + T E  S+E+RQ  F +MI +AL+ V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLENAKEVTNVRNMLGYTGTYKGRPVSVMGHGMGIPSCSIYTKELITEYGVKKIIRVGSCGAVRNDVKVRDVIIGLGACTDSKVNR-IRFKDNDFAAIADFDMTQAAVQAAKAKGINYRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALSICTVSDHIRTGEQTSSEERQLTFNDMIEIALESV 232
>gi|49482379|ref|YP_039603.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49240508|emb|CAG39165.1| putative purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MRSA252] (235 aa)
Score = 390, Expect = 4.1e-36, Identities = 91/232 (39%), Positives = 138/232 (59%)
  Q:    11 TPHNRAKKG-EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH +     EIA+ VL+PGDPLRAK+IAE +L++ +  N VR M G+TG Y  K+V+VMG GMGM SIGIYSYEL   +    +IRVGS G+  ++I++ D+++ + A ++S Y +   +    + +     L   + +TA +  ++     V SSDIFY A+ +  +         VEMES +L+ NAI    +A  + T SD L+   S + E+R+  F +MI +AL +V
  S:     4 TPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTVRNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLYDVIVAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAV-ETARDKGVRHHVGNVLSSDIFYNADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERERAFTDMIEIALSLV 235
>gi|21281839|ref|NP_644925.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MW2] >gi|49485014|ref|YP_042235.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MSSA476] >gi|21203274|dbj|BAB93975.1| purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MW2] >gi|49243457|emb|CAG41878.1| putative purine nucleoside phosphorylase [Staphylococcus aureus subsp. aureus MSSA476] (235 aa)
Score = 389, Expect = 5.5e-36, Identities = 91/232 (39%), Positives = 137/232 (59%)
  Q:    11 TPHNRAKKG-EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH +     EIA+ VL+PGDPLRAK+IAE +L++ +  N VR M G+TG Y  K+V+VMG GMGM SIGIYSYEL   +    +IRVGS G+  ++I++ D+++ + A ++S Y +   +    + +     L   +  TA +  ++     V SSDIFY A+ +  +         VEMES +L+ NAI    +A  + T SD L+   S + E+R+  F +MI +AL +V
  S:     4 TPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTVRNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLYDVIIAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAV-GTARDKGVRHHVGNVLSSDIFYNADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERERAFTDMIEIALSLV 235
>gi|86138969|ref|ZP_01057540.1| purine nucleoside phosphorylase [Roseobacter sp. MED193] >gi|85824200|gb|EAQ44404.1| purine nucleoside phosphorylase [Roseobacter sp. MED193] (234 aa)
Score = 388, Expect = 6.4e-36, Identities = 86/231 (37%), Positives = 130/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A++G+IA+ VLMPGDP RAKW AENFL+N +L+N+VRGMLGYTG +N   VT+ G GMGM S+ IY+ EL   +    +IR+GS G     + + D++L   A + S+ +  I  E   +       L   + + A    I +    ++SSD FY     + +         VEME+  L+  A +   +A  +LT SD L T E++ ++ R+  F +M+ +AL+
  S:     1 MTIHIGAQQGDIAETVLMPGDPYRAKWAAENFLQNAQLVNEVRGMLGYTGSWNGHRVTIQGSGMGMPSLSIYANELIRDFGAKTLIRIGSCGGMQPQVKLRDVILAMTATTLSSPSHSIFKEVNFAPAADWSLLQAAV-QAAQSREIGIHVGCIYSSDTFYDERPDLNEQMVRHGILGVEMEAAELYTLAARYQCRALAVLTVSDHLGTGEALPSDQRERSFGDMVEIALE 230
>gi|77973607|ref|ZP_00829153.1| COG0813: Purine-nucleoside phosphorylase [Yersinia frederiksenii ATCC 33641] (239 aa)
Score = 388, Expect = 6.6e-36, Identities = 92/232 (39%), Positives = 135/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ + +N+VRGMLG+TG Y  + ++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   +  KD       +  ++ R        K  DV V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLKDVREVNNVRGMLGFTGTYKGRPISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNR---LRFKDHDYAAIADF-EMTRNAVDAAKAKGIDVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESV 233
>gi|146310208|ref|YP_001175282.1| purine nucleoside phosphorylase [Enterobacter sp. 638] >gi|167012091|sp|A4W6A1|DEOD_ENT38 Purine nucleoside phosphorylase deoD-type (PNP) >gi|145317084|gb|ABP59231.1| purine-nucleoside phosphorylase [Enterobacter sp. 638] (240 aa)
Score = 388, Expect = 8.1e-36, Identities = 95/232 (40%), Positives = 139/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDEL----NDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK IAE FLE+ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   +  KD       +     N V    A+  + ++ ++   S+D+FY  +   E      K  +  VEME+  ++  A +   KA T+ T SD + THE  SA +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNR---MRFKDHDFAAIADFGMVRNAVDAAKALGVDARVGNIF--SADLFYSPDGG-EMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTSAAERQTTFNDMIKIALESV 234
>gi|84385391|ref|ZP_00988423.1| purine nucleoside phosphorylase [Vibrio splendidus 12B01] >gi|86144592|ref|ZP_01062924.1| purine nucleoside phosphorylase [Vibrio sp. MED222] >gi|84379988|gb|EAP96839.1| purine nucleoside phosphorylase [Vibrio splendidus 12B01] >gi|85837491|gb|EAQ55603.1| purine nucleoside phosphorylase [Vibrio sp. MED222] (236 aa)
Score = 387, Expect = 8.7e-36, Identities = 92/235 (39%), Positives = 137/235 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKT-AIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FL++ K + DVR M GYTG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+ + D+V+   A ++S   +        + +     L + + +  A E  +K+ +V   S+D+FY     + +         V+ME+  ++  A  L  KA T+LT SD ++  E +S+EDRQ  F +M+ +AL+    I
  S:     3 TPHINAQAGDFAETVLMPGDPLRAKYIAETFLDDVKQVCDVRNMFGYTGTYKGKKVSVMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVKLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFGLLEEAVNQARAQEVPVKVGNVF--SADLFYTPEADLFEKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEDRQKSFNDMMKVALETAINI 236
>gi|15603156|ref|NP_246228.1| purine nucleoside phosphorylase [Pasteurella multocida subsp. multocida str. Pm70] >gi|81636735|sp|Q9CLE6|DEOD_PASMU Purine nucleoside phosphorylase deoD-type (PNP) >gi|12721652|gb|AAK03375.1| DeoD [Pasteurella multocida subsp. multocida str. Pm70] (238 aa)
Score = 387, Expect = 9.2e-36, Identities = 90/233 (38%), Positives = 132/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A  G  A VVLMPGDPLRAK+IAE FL++ K I +VR MLG+TG Y  ++++VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ + D+V+   A ++S   + I  +  D       ++     + A    + +    + S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  + E+RQ  F +MI +AL+ V
  S:     1 MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLQDVKEITNVRNMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITEYGVKKIIRVGSCGAVRMDVKLRDVVIGFGACTDSKVNR-IRFKNHDFAAIADFDMTMAAVQAAKAKGLNVHVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTPEERQLTFNDMIEIALESV 232
>gi|66880260|ref|ZP_00405243.1| COG0813: Purine-nucleoside phosphorylase [Mycoplasma genitalium G-37] (136 aa)
Score = 387, Expect = 1.0e-35, Identities = 71/110 (64%), Positives = 86/110 (78%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY 119
           MTPH  AKK +I+KVVLMPGDPLRAKWIAE FL+  KL+N+VRGM  YTG Y +K VTVMGHGMG+ SIGIYSYEL  FY+V+ IIR+GS G+    + + DLV+  KA+
  S:    27 MTPHISAKKDDISKVVLMPGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSKTVTVMGHGMGIPSIGIYSYELMNFYEVETIIRIGSCGALAPQLKLKDLVIASKAW 136
>gi|34849430|gb|AAP58929.1| purine-nucleoside phosphorylase [Spiroplasma kunkelii] (190 aa)
Score = 387, Expect = 1.0e-35, Identities = 85/164 (51%), Positives = 105/164 (64%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYI-GIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGAN 173
           MTPH  AK+ EIA+ VLMPGDP R  +IAENFLEN KL+N++R +  YT  Y NK +T+ G GMG  SIGIYSYELF FY+VD IIR+GSA SY   + + D+V    AY E+ YA+ + GIE  D  L     L   I + A E  IK    +V+S D FY  N
  S:     1 MTPHINAKQEEIAETVLMPGDPFRTNFIAENFLENIKLVNEIRNIFMYTETYKNKTITIAGSGMGCPSIGIYSYELFKFYNVDNIIRIGSACSYDAALKIYDIVNATAAYGENNYARIVAGIE--DDVLNSLQHLFATIEEVAKEKQIKTFPGIVYSFDFFYRKN 163
>gi|42525979|ref|NP_971077.1| purine nucleoside phosphorylase [Treponema denticola ATCC 35405] >gi|41816029|gb|AAS10958.1| purine nucleoside phosphorylase [Treponema denticola ATCC 35405] (233 aa)
Score = 386, Expect = 1.1e-35, Identities = 95/233 (40%), Positives = 137/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES--TYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRA+++A NFLENP+  N VRGMLG+TG Y    V+V G GMG  S  IY+ ELF  Y V   IR+G+AG+  KD+ + D+VL   A ++S     ++ G   A  +         D  +K  I+  +      + SSD+FY    + +  A+      VEME+  L+  A K  ++A  +LT SD++VT E  SAE+RQT F  M+ +AL+ +
  S:     1 MSVHIAAKQGEIADKILLPGDPLRAEFVANNFLENPQCYNKVRGMLGFTGTYKGVRVSVQGTGMGQPSFSIYANELFNEYGVQRAIRIGTAGALQKDMGLRDVVLAMAASTDSGINTHRFRGCHYAPTADWSLLKNAYDHAQKMGIKPLVG----SIASSDVFYDDLETWKMWAA-YGVLAVEMEAAELYTLAAKYKRQALAVLTISDNIVTQEQTSAEERQTTFKTMMEIALEAI 231
>gi|51594935|ref|YP_069126.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis IP 32953] >gi|153948351|ref|YP_001402450.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis IP 31758] >gi|170025839|ref|YP_001722344.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis YPIII] >gi|186893935|ref|YP_001871047.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis PB1/+] >gi|167016846|sp|A7FMH2|DEOD_YERP3 Purine nucleoside phosphorylase deoD-type (PNP) >gi|81640455|sp|Q66EV7|DEOD_YERPS Purine nucleoside phosphorylase deoD-type (PNP) >gi|51588217|emb|CAH19824.1| purine-nucleoside phosphorylase [Yersinia pseudotuberculosis IP 32953] >gi|152959846|gb|ABS47307.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis IP 31758] >gi|169752373|gb|ACA69891.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis YPIII] >gi|186696961|gb|ACC87590.1| purine nucleoside phosphorylase [Yersinia pseudotuberculosis PB1/+] (239 aa)
Score = 386, Expect = 1.3e-35, Identities = 91/232 (39%), Positives = 139/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDEL--NDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   + +  +  D       E+  N V    A   N+++ ++   S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNR-MRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLF--SADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESV 233
>gi|56420115|ref|YP_147433.1| purine-nucleoside phosphorylase [Geobacillus kaustophilus HTA426] >gi|81557949|sp|Q5KZM1|DEOD_GEOKA Purine nucleoside phosphorylase deoD-type (PNP) >gi|56379957|dbj|BAD75865.1| purine-nucleoside phosphorylase [Geobacillus kaustophilus HTA426] (236 aa)
Score = 386, Expect = 1.4e-35, Identities = 91/231 (39%), Positives = 131/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AK GEIA+ +L+PGDPLRAK+IAE FLE     N+VRGMLG+TG Y  + ++V G GMG+ SI IY  EL   Y V  +IRVG+ G+   D+ V D++L   A ++S   + I    +D        L     +  +E  + L    V ++D+FY    + E  A       VEME+ +L+  A K   +A ++LT SD ++T E  +AE+RQ  F  MI +AL+
  S:     1 MSVHIGAKTGEIAERILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGERISVQGTGMGVPSISIYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRLI-FRGRDYAPTADFHLLRTAYEVGVEKGLALKVGNVFTADMFYNDEPNWETWAR-YGVLAVEMETAALYTLAAKFGCRALSVLTVSDHILTGEETTAEERQMTFNEMIEVALE 229
>gi|38232892|ref|NP_938659.1| purine nucleoside phosphorylase [Corynebacterium diphtheriae NCTC 13129] >gi|38199150|emb|CAE48775.1| purine nucleoside phosphorylase II [Corynebacterium diphtheriae] (238 aa)
Score = 386, Expect = 1.4e-35, Identities = 91/229 (39%), Positives = 135/229 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEG-------SDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH   K  +IA+ VL+PGDPLRAK+IA+ +LE+    N VR MLG+TG Y    V+VMG GMGM SIGIYSYEL  F+D   +IRVGS G+  KDI++ ++++   A ++S + +   +    +            DE +   +K  + N        + SSD+FY A+ +V +  +      VEMES +L++ A      A  + T SD+L T    +AE+R++ F +M+ LAL
  S:     6 TPHINPKGVDIAETVLLPGDPLRAKFIADTYLEDVVQFNSVRNMLGFTGTYQGTPVSVMGSGMGMPSIGIYSYELINFFDARNVIRVGSIGAMQKDIDLYEIIVAASASTDSNFLEQYNLPGTYAPTASWTLLRAFMDEADRKGKKVHVGN--------ILSSDVFYNADNTVNERWARMGVLGVEMESAALYSIAAYAGANALGVFTVSDNLFTGARTTAEERESAFTDMMELAL 233
>gi|91223272|ref|ZP_01258538.1| purine nucleoside phosphorylase [Vibrio alginolyticus 12G01] >gi|153831788|ref|ZP_01984455.1| purine nucleoside phosphorylase [Vibrio harveyi HY01] >gi|91192085|gb|EAS78348.1| purine nucleoside phosphorylase [Vibrio alginolyticus 12G01] >gi|148872298|gb|EDL71115.1| purine nucleoside phosphorylase [Vibrio harveyi HY01] (236 aa)
Score = 385, Expect = 1.5e-35, Identities = 91/235 (38%), Positives = 137/235 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKT-AIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+ + D+V+   A ++S   +        + +     L + + +  A E  +K+ +V   S+D+FY     + +         V+ME+  ++  A  L  KA T+LT SD ++  E +S+E+RQ  F +M+ +AL+    I
  S:     3 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVKLMDVVIGMGASTDSKVNRIRFNNHDFAAIADYGLLEEAVNQARAQEVPVKVGNVF--SADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEERQKSFNDMMKVALETAINI 236
>gi|32033970|ref|ZP_00134226.1| COG0813: Purine-nucleoside phosphorylase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208488|ref|YP_001053713.1| purine nucleoside phosphorylase DeoD-like protein [Actinobacillus pleuropneumoniae L20] >gi|190150340|ref|YP_001968865.1| purine nucleoside phosphorylase DeoD-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|167012082|sp|A3N122|DEOD_ACTP2 Purine nucleoside phosphorylase deoD-type (PNP) >gi|3121993|sp|P94164|DEOD_ACTPL Purine nucleoside phosphorylase deoD-type (PNP) >gi|1732037|gb|AAB51435.1| purine nucleoside phosphorylase [Actinobacillus pleuropneumoniae] >gi|126097280|gb|ABN74108.1| purine nucleoside phosphorylase DeoD-like protein [Actinobacillus pleuropneumoniae L20] >gi|189915471|gb|ACE61723.1| purine nucleoside phosphorylase DeoD-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (240 aa)
Score = 385, Expect = 1.5e-35, Identities = 90/232 (38%), Positives = 132/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIR--KTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A +G  A VVLMPGDPLRAK+IAE FLE+   + DVR M GYTG Y  + ++VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+  +D+ V D+++   A ++S   +   I  +D+      + +  +   + A +  I      + S+D+FY  +  +  +        VEME+  ++A A +   KA  + T SD + T E  S+E+RQ  F +MI +AL+ V
  S:     3 TPHINAPEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNR---IRFRDNDFAAISDFDMTLAAVQAAKQKGIAARVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGEQTSSEERQLTFNDMITIALESV 233
>gi|77977211|ref|ZP_00832666.1| COG0813: Purine-nucleoside phosphorylase [Yersinia intermedia ATCC 29909] (239 aa)
Score = 385, Expect = 1.6e-35, Identities = 91/232 (39%), Positives = 136/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   +   +  KD       +  ++ R        K  DV V    S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  +A +RQ+ F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNR---MRFKDHDYAAIADF-EMTRNAVDAAKAKGIDVRVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQSTFNDMIEIALESV 233
>gi|117618320|ref|YP_858142.1| purine nucleoside phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559727|gb|ABK36675.1| purine nucleoside phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (238 aa)
Score = 385, Expect = 1.8e-35, Identities = 89/232 (38%), Positives = 130/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  AK G  A  VLMPGDPLRAK+IAE FLEN + + DVR M G+TG Y  + +++MGHGMG+ S  IY+ EL   Y V  +IRVGS G+  +D+ + D+V+   A ++S   +   +  KD       + + V        N  +   V  + S+D+FY  + S+  +        VEME+  ++  A +   KA T+ T SD + T E  ++E+RQ  F +MI +AL  V
  S:     3 TPHINAKDGAFADTVLMPGDPLRAKYIAETFLENVEQVCDVRNMFGFTGTYKGRRISIMGHGMGIPSCSIYAKELITDYGVKTLIRVGSCGAVREDVKLRDVVIGMGACTDSKVNR---LRFKDHDFAAIADFDLVANAVQAAKNKGVAVRVGNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTGEQTTSEERQLTFNDMIEIALDSV 233
>gi|24379651|ref|NP_721606.1| putative purine nucleoside phosphorylase [Streptococcus mutans UA159] >gi|24377605|gb|AAN58912.1|AE014959_6 putative purine nucleoside phosphorylase [Streptococcus mutans UA159] (234 aa)
Score = 384, Expect = 2.0e-35, Identities = 97/233 (41%), Positives = 136/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A+ G+IA  +L+PGDPLRAK+IAENFLE+    N+VRGMLG+TG Y    V+VMG GMGM SI IY  EL   Y V  +IRVG+AGS  KD++V DLVL + A + S+  K    E          + + + +   I  +++LT  V  V S D FY               + VEME+ +++  A K   +A  ++T SDSLV  E  +AE+RQT F +M+ + L+ +
  S:     1 MSIHIGAQVGQIADKILLPGDPLRAKFIAENFLEDAVCFNEVRGMLGFTGIYKGHRVSVMGTGMGMPSISIYVNELIRSYGVKKLIRVGTAGSLNKDVHVRDLVLAQAAGTTSSMIKN---EWPQYDFPQIADFSMLDKAYHIAEDMELTTHVGSVLSIDAFYSDFADNNIKLGQIGVKAVEMEAAAIYYLAAKHGVQALGIMTISDSLVADEDTTAEERQTTFTDMMKVGLETL 232
>gi|50119675|ref|YP_048842.1| purine nucleoside phosphorylase [Pectobacterium atrosepticum SCRI1043] >gi|81646162|sp|Q6D989|DEOD_ERWCT Purine nucleoside phosphorylase deoD-type (PNP) >gi|49610201|emb|CAG73644.1| purine nucleoside phosphorylase [Erwinia carotovora subsp. atroseptica SCRI1043] (239 aa)
Score = 384, Expect = 2.3e-35, Identities = 91/232 (39%), Positives = 137/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+  +D+ + D+V+   A ++S   +   +  KD       +  D++R     +  K  DV V      S+D+FY  +  +  +        VEME+  ++  A +   KA  + T SD + T    ++E+RQT F  MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLDDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITEFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNR---MRFKDHDYAAIADF-DMVRNAV--DAAKARDVSVRVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGAQTTSEERQTTFNEMIEIALESV 233
>gi|88800951|ref|ZP_01116503.1| purine nucleoside phosphorylase [Reinekea sp. MED297] >gi|88776326|gb|EAR07549.1| purine nucleoside phosphorylase [Reinekea sp. MED297] (236 aa)
Score = 383, Expect = 2.4e-35, Identities = 94/229 (41%), Positives = 131/229 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-------YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH +A+KG+ A+ VLMPGDPLRAK IA+ FL N KL+N+VR M GYTG Y  K V+VMG GMG+ SI IY+ EL   +DV  I+R+GS G+  KDI V D+++   A ++S   +       Y  I A  S LE S        K     N       V S+D+FY     +    +      VEME+  L+  A +    A  ++T SD ++T E++ A+ RQ  F +M+ + L
  S:     3 TPHIKAEKGDFAETVLMPGDPLRAKHIADTFLSNVKLVNEVRNMFGYTGEYKGKTVSVMGSGMGIPSISIYAKELITEFDVKNIVRIGSCGALKKDIQVRDVIIAMGASTDSAVNRSRLAGFDYAAI-ADYSLLEASVNAARSAGKQVRVGN-------VFSADLFYSPVDGIMDTLAKMNVLAVEMEAAGLYGVAAEYGANALAMMTVSDHIITGEALDADARQNTFNDMVEITL 230
>gi|149179706|ref|ZP_01858211.1| purine-nucleoside phosphorylase [Bacillus sp. SG-1] >gi|148851898|gb|EDL66043.1| purine-nucleoside phosphorylase [Bacillus sp. SG-1] (233 aa)
Score = 383, Expect = 2.5e-35, Identities = 94/235 (40%), Positives = 135/235 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK+ EIA+ VL+PGDPLRAK+IAE FLENP   N+VR M GYTG Y  K ++V G GMG+ SI IY  EL   Y+V  +IRVG+ G+  KD+ V D++L   + ++S   + +     D        L         E  + L    V ++D+FY  N   E+ A       +EME+ +L+  A K  +KA ++LT SD ++T E  ++E+RQT F +MI +AL+   K
  S:     1 MSIHIGAKENEIAETVLLPGDPLRAKYIAETFLENPVCYNEVRNMFGYTGTYKGKRISVQGTGMGVPSISIYINELMQSYNVQNLIRVGTCGAIQKDVKVRDVILAMSSSTDSQMNR-LTFNGIDYAPTADFSLLKRAYDAGEEKGLNLKVGNVFTADMFYNDNAEHEKWAQ-YGILALEMETSALYTLAAKYGRKALSVLTVSDHILTGEETTSEERQTTFNDMIEVALEAAIK 233
>gi|81177395|ref|ZP_00876220.1| Purine nucleoside phosphorylase [Streptococcus suis 89/1591] >gi|80975928|gb|EAP39612.1| Purine nucleoside phosphorylase [Streptococcus suis 89/1591] (237 aa)
Score = 383, Expect = 2.7e-35, Identities = 98/233 (42%), Positives = 143/233 (61%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA---NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK GEIA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMGM SI IY++EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T ++ I I+  +  L    + + + +   I   + +T  V  V SSD FY     +R++E      K+  VEME+ +L+    K   +   ++T SDSLV   E+ +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKPGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSRMINIDWPEYDLPQIADFDLLDKAYHIAKELNMTTHVGNVLSSDSFYSPKLFSRNLELGQLGVKA--VEMEAAALYYLGAKFGVQTLAIMTISDSLVNPEENTTAEERQNTFTDMMKVGLETL 234
>gi|152974987|ref|YP_001374504.1| purine nucleoside phosphorylase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189083108|sp|A7GN01|DEOD_BACCN Purine nucleoside phosphorylase deoD-type (PNP) >gi|152023739|gb|ABS21509.1| purine nucleoside phosphorylase [Bacillus cereus subsp. cytotoxis NVH 391-98] (235 aa)
Score = 383, Expect = 2.8e-35, Identities = 91/231 (39%), Positives = 133/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +   D     VEME+ +L+  A K    A ++LT SD + T E  +AE+RQT F  MI +AL+
  S:     1 MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNINR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHIRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTAEERQTTFNEMIEIALE 230
>gi|56695281|ref|YP_165629.1| purine nucleoside phosphorylase [Silicibacter pomeroyi DSS-3] >gi|56677018|gb|AAV93684.1| purine nucleoside phosphorylase [Silicibacter pomeroyi DSS-3] (236 aa)
Score = 383, Expect = 2.9e-35, Identities = 87/230 (37%), Positives = 130/230 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD-ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  A  GEIA+ VL+PGDP RAKW AE FL+NP L+N+VRGMLG+TG +    VT+ G GMGM S+ IY+ EL   Y    +IR+GS G     + V D++L   A +  T ++  GI  + S    +D  L     + A +  ++     ++SSD+FY     + +         VEME+  L+  A +   +A  +LT SD L+T  ++ + +R+T F +M+ +AL
  S:     1 MTIHIGANPGEIAETVLLPGDPYRAKWAAETFLDNPVLVNEVRGMLGFTGMWRGNRVTIHGSGMGMPSLSIYANELIRDYGAKTLIRIGSCGGMQDSVEVRDVILAMTASTLGTPSR--GIFRELSFAPCADWSLLHAAARAAEDKGVRTHVGGIYSSDVFYDERPDLNEQMVRHGVLGVEMEAAELYILAARHKCRALAVLTVSDHLLTGAALPSAERETSFGDMVEIAL 229
>gi|16120771|ref|NP_404084.1| purine nucleoside phosphorylase [Yersinia pestis CO92] >gi|108809835|ref|YP_653751.1| purine nucleoside phosphorylase [Yersinia pestis Antiqua] >gi|108810476|ref|YP_646243.1| purine nucleoside phosphorylase [Yersinia pestis Nepal516] >gi|145600449|ref|YP_001164525.1| purine nucleoside phosphorylase [Yersinia pestis Pestoides F] >gi|150260522|ref|ZP_01917250.1| purine nucleoside phosphorylase [Yersinia pestis CA88-4125] >gi|162421382|ref|YP_001605403.1| purine nucleoside phosphorylase [Yersinia pestis Angola] >gi|165927348|ref|ZP_02223180.1| purine nucleoside phosphorylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936537|ref|ZP_02225105.1| purine nucleoside phosphorylase [Yersinia pestis biovar Orientalis str. IP275] >gi|166008763|ref|ZP_02229661.1| purine nucleoside phosphorylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212178|ref|ZP_02238213.1| purine nucleoside phosphorylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400482|ref|ZP_02305991.1| purine nucleoside phosphorylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419069|ref|ZP_02310822.1| purine nucleoside phosphorylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426035|ref|ZP_02317788.1| purine nucleoside phosphorylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470356|ref|ZP_02335060.1| purine nucleoside phosphorylase [Yersinia pestis FV-1] >gi|122979295|sp|Q1C166|DEOD_YERPA Purine nucleoside phosphorylase deoD-type (PNP) >gi|123246774|sp|Q1CMY7|DEOD_YERPN Purine nucleoside phosphorylase deoD-type (PNP) >gi|167016847|sp|A4TQJ0|DEOD_YERPP Purine nucleoside phosphorylase deoD-type (PNP) >gi|81594666|sp|Q8ZIQ2|DEOD_YERPE Purine nucleoside phosphorylase deoD-type (PNP) >gi|108774124|gb|ABG16643.1| purine-nucleoside phosphorylase [Yersinia pestis Nepal516] >gi|108781748|gb|ABG15806.1| purine-nucleoside phosphorylase [Yersinia pestis Antiqua] >gi|115346250|emb|CAL19120.1| purine nucleoside phosphorylase [Yersinia pestis CO92] >gi|145212145|gb|ABP41552.1| purine-nucleoside phosphorylase [Yersinia pestis Pestoides F] >gi|149289930|gb|EDM40007.1| purine nucleoside phosphorylase [Yersinia pestis CA88-4125] >gi|162354197|gb|ABX88145.1| purine nucleoside phosphorylase [Yersinia pestis Angola] >gi|165915653|gb|EDR34262.1| purine nucleoside phosphorylase [Yersinia pestis biovar Orientalis str. IP275] >gi|165920810|gb|EDR38058.1| purine nucleoside phosphorylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992102|gb|EDR44403.1| purine nucleoside phosphorylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206924|gb|EDR51404.1| purine nucleoside phosphorylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963063|gb|EDR59084.1| purine nucleoside phosphorylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049850|gb|EDR61258.1| purine nucleoside phosphorylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054958|gb|EDR64758.1| purine nucleoside phosphorylase [Yersinia pestis biovar Mediaevalis str. K1973002] (239 aa)
Score = 383, Expect = 2.9e-35, Identities = 91/232 (39%), Positives = 138/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDEL--NDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   + +  +  D       E+  N V    A   N+++ ++   S+D+FY  +  +  +        VEME+  +   A +   KA T+ T SD + T E  +A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNR-MRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLF--SADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESV 233
>gi|24371692|ref|NP_715734.1| purine nucleoside phosphorylase [Shewanella oneidensis MR-1] >gi|81589458|sp|Q8EKK0|DEOD1_SHEON Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|24345465|gb|AAN53179.1|AE015460_12 purine nucleoside phosphorylase [Shewanella oneidensis MR-1] (236 aa)
Score = 383, Expect = 3.0e-35, Identities = 90/235 (38%), Positives = 143/235 (60%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELN---DVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A  G+ AK ++M GDPLRAK IAE +LE+ K + +VRG+LG+TG Y +K++++MGHGMG  S  IY +EL A Y V   IRVGS G+ + +I++ DL++   A ++S   +   ++   + +   D L    +V++ T +  N K+ +V   SSD+FY  N +   + +      VEME  +L+A A +   +A  L T +D +V HE ++A++R+T    M+ +AL+   KI
  S:     3 TPHINANPGDFAKTIIMSGDPLRAKLIAETYLEDVKEVTNVRGILGFTGKYKSKDISIMGHGMGAPSASIYFHELMATYGVKNFIRVGSCGAISDNIHLKDLIVAMGASTDSKINRIRFLDHDLAAIANYDLLQACIEVLKTTTV--NYKVGNVF--SSDLFYRPNENDYTLMAKYGVLGVEMEVNALYALAAEHQCRALALCTVTDHIVQHEHLTADERRTDLHEMVKVALETAIKI 236
>gi|22127612|ref|NP_671035.1| purine nucleoside phosphorylase [Yersinia pestis KIM] >gi|45443474|ref|NP_995013.1| purine nucleoside phosphorylase [Yersinia pestis biovar Microtus str. 91001] >gi|21960722|gb|AAM87286.1|AE013977_5 purine-nucleoside phosphorylase [Yersinia pestis KIM] >gi|45438343|gb|AAS63890.1| purine nucleoside phosphorylase [Yersinia pestis biovar Microtus str. 91001] (241 aa)
Score = 383, Expect = 3.0e-35, Identities = 91/232 (39%), Positives = 138/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDEL--NDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ + +N+VRGMLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   + +  +  D       E+  N V    A   N+++ ++   S+D+FY  +  +  +        VEME+  +   A +   KA T+ T SD + T E  +A +RQT F +MI +AL+ V
  S:     5 TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNR-MRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLF--SADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESV 235
>gi|148825206|ref|YP_001289959.1| purine nucleoside phosphorylase [Haemophilus influenzae PittEE] >gi|167012094|sp|A5U9X5|DEOD_HAEIE Purine nucleoside phosphorylase deoD-type (PNP) >gi|148715366|gb|ABQ97576.1| purine nucleoside phosphorylase [Haemophilus influenzae PittEE] (238 aa)
Score = 383, Expect = 3.0e-35, Identities = 90/233 (38%), Positives = 131/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FL++   + +VR MLG+TG Y  +++++MGHGMG+ S  IY+ EL   Y V  IIRVGS GS   D+ V D+++   A ++S   +   I  KD+      + +                 V  + S+D+FY  +  +  +        VEME+  ++  A + + KA T+ T SD + THE  +AE+RQ  F +MI +AL  V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGSVRMDVKVRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYSAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSV 232
>gi|157960464|ref|YP_001500498.1| purine nucleoside phosphorylase [Shewanella pealeana ATCC 700345] >gi|157845464|gb|ABV85963.1| purine nucleoside phosphorylase [Shewanella pealeana ATCC 700345] (236 aa)
Score = 383, Expect = 3.1e-35, Identities = 93/236 (39%), Positives = 134/236 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           MTPH  A+ G  AK VLMPGDPLRAK+IA+NFLEN  L+ DVR MLGYTG Y  K+++VMG GMG+ SI IY+ EL   Y V+ IIR+GS G+ +  I + D+V+   A ++S   +       ++      + N + R       +  +  V  ++SSD+FY A+ S   +        VEME+  L+  A +    A  ++T +D L     ++AE+RQ    +MI L L  VE +
  S:     1 MTPHINAENGAFAKTVLMPGDPLRAKYIADNFLENAVLVTDVRNMLGYTGEYKGKKISVMGSGMGIPSISIYAKELITEYGVENIIRIGSCGAVSDKIKLMDVVMAMGASTDSAVNR---TRFANTDFAMIADFNLLKRAADSAEKLGASYHVGNLYSSDLFYCADESRYDLMEKYGILGVEMEAAGLYGVATEFGANALAMMTVTDHLRQGLHLTAEERQQTLNDMIKLTLDAVEDL 235
>gi|53733053|ref|ZP_00155511.2| COG0813: Purine-nucleoside phosphorylase [Haemophilus influenzae R2846] (238 aa)
Score = 382, Expect = 3.3e-35, Identities = 90/233 (38%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FL++   + +VR MLG+TG Y  +++++MGHGMG+ S  IY+ EL   Y V  IIRVGS GS   D+ V D+++   A ++S   +   I  KD+      + +                 V  + S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +AE+RQ  F +MI +AL  V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGSVRMDVKVRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSV 232
>gi|149907498|ref|ZP_01896245.1| purine nucleoside phosphorylase [Moritella sp. PE36] >gi|149809168|gb|EDM69097.1| purine nucleoside phosphorylase [Moritella sp. PE36] (237 aa)
Score = 382, Expect = 3.9e-35, Identities = 91/232 (39%), Positives = 130/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+KG+ A+ VL PGDPLRAK+IAE FLE+ K +NDVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IR+GS G+ + D+ V D+V+   A ++S   +    +  D     S EL   + + A    I +    + S+D+FY     +           VEME+  L+  A +    A  + T SD + T E  +AE+RQ  F +MI +AL+ V
  S:     3 TPHINAEKGDFAETVLFPGDPLRAKYIAETFLEDVKQVNDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYAKELITEYGVKNLIRIGSCGAISTDVKVRDVVIGMGACTDSAVNR-ARFDGYDFAAIASWELLSKVTRAAKACKIDVKVGNIFSADLFYTPKPELFDSMEKLGILGVEMEAAGLYGVAAEFGANAICICTVSDHIRTGEVTTAEERQLTFNDMIIMALESV 233
>gi|124546667|ref|ZP_01705734.1| purine nucleoside phosphorylase [Shewanella putrefaciens 200] >gi|146293913|ref|YP_001184337.1| purine nucleoside phosphorylase [Shewanella putrefaciens CN-32] >gi|124509935|gb|EAY54009.1| purine nucleoside phosphorylase [Shewanella putrefaciens 200] >gi|145565603|gb|ABP76538.1| purine nucleoside phosphorylase [Shewanella putrefaciens CN-32] (236 aa)
Score = 381, Expect = 4.4e-35, Identities = 87/230 (37%), Positives = 134/230 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A +G  A+ VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D     + EL + + ++A     K+    + S+D+FY  +  +  +        VEME+  L+  A +   +A  ++T SD + T E  SAE+RQT F +MI + L+
  S:     3 TPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNR-LRFKGQDFAAIANYELMNAVIESAKVKGTKIRVGNIFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTSAEERQTTFNDMIIMTLE 231
>gi|159035904|ref|YP_001535157.1| purine nucleoside phosphorylase [Salinispora arenicola CNS-205] >gi|157914739|gb|ABV96166.1| purine nucleoside phosphorylase [Salinispora arenicola CNS-205] (235 aa)
Score = 381, Expect = 4.9e-35, Identities = 88/233 (37%), Positives = 135/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIE----NNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK GEIA+ VLMPGDPLRAKWIAE +LE  +  + VRGM G+TG +N  +V+V G GMGM S  IY++EL   Y V  +IRVG+ G+ T D+ + D+V    + ++S   +       D  ++ +   +  + ++++E      I +    V ++D FY A R +    +D     VEMES +L+  A +   +A T+LT SD L T    ++E+R+  F  M+ +AL  +
  S:     1 MSTHIGAKPGEIAERVLMPGDPLRAKWIAETYLEGAQCYSTVRGMFGFTGRWNGVDVSVQGSGMGMPSASIYAHELINDYGVRSLIRVGTCGALTDDLQLRDVVAASGSSTDSNMNRM----RFDGLIDYAPVADFGLLRSSVEVAERRGITMRVGPVLAADAFYTARRDLYDSLADYGVLAVEMESAALYTTAARHKARALTILTVSDHLRTGAKTTSEEREHTFSQMVEIALDTI 233
>gi|30019611|ref|NP_831242.1| purine nucleoside phosphorylase [Bacillus cereus ATCC 14579] >gi|81435362|sp|Q81FV5|DEOD_BACCR Purine nucleoside phosphorylase deoD-type (PNP) >gi|29895155|gb|AAP08443.1| Purine nucleoside phosphorylase [Bacillus cereus ATCC 14579] (235 aa)
Score = 381, Expect = 5.0e-35, Identities = 90/230 (39%), Positives = 132/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +   D     VEME+ +L+  A K    A ++LT SD + T E  ++E+RQT F  MI +AL
  S:     1 MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDIVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIAL 229
>gi|148974052|ref|ZP_01811585.1| purine nucleoside phosphorylase [Vibrionales bacterium SWAT-3] >gi|145965749|gb|EDK30997.1| purine nucleoside phosphorylase [Vibrionales bacterium SWAT-3] (236 aa)
Score = 380, Expect = 5.5e-35, Identities = 90/235 (38%), Positives = 138/235 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKT-AIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FL++ K + DVR M GYTG    K+V+VMGHGMG+ S  IY++EL A Y V  +IRVGS G+   D+ + D+V+   A ++S   +    +   + +     L + + +  A E  +K+ +V   S+D+FY     + +         V+ME+  ++  A  L  KA T+LT SD ++  E +S+E+RQ  F +M+ +AL+    I
  S:     3 TPHINAQAGDFAETVLMPGDPLRAKYIAETFLDDVKQVCDVRNMFGYTGTCKGKKVSVMGHGMGIPSACIYTHELIAEYGVKNVIRVGSCGAVRDDVKLMDVVIGMGASTDSKVNRIRFNDHDFAAIADFGLLEEAVNQARAQEVPVKVGNVF--SADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEERQKSFNDMMKVALETAINI 236
>gi|52143885|ref|YP_082943.1| purine nucleoside phosphorylase [Bacillus cereus E33L] >gi|81688748|sp|Q63DR9|DEOD_BACCZ Purine nucleoside phosphorylase deoD-type (PNP) >gi|51977354|gb|AAU18904.1| purine nucleoside phosphorylase [Bacillus cereus E33L] (235 aa)
Score = 380, Expect = 5.8e-35, Identities = 90/230 (39%), Positives = 133/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +  +D     VEME+ +L+  A K    A ++LT SD + T E  ++E+RQT F  MI +AL
  S:     1 MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLADYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIAL 229
>gi|53733305|ref|ZP_00349683.1| COG0813: Purine-nucleoside phosphorylase [Haemophilus influenzae R2866] >gi|145628899|ref|ZP_01784699.1| purine nucleoside phosphorylase [Haemophilus influenzae 22.1-21] >gi|145635401|ref|ZP_01791103.1| purine nucleoside phosphorylase [Haemophilus influenzae PittAA] >gi|145637443|ref|ZP_01793102.1| purine nucleoside phosphorylase [Haemophilus influenzae PittHH] >gi|145638567|ref|ZP_01794176.1| purine nucleoside phosphorylase [Haemophilus influenzae PittII] >gi|148827709|ref|YP_001292462.1| purine nucleoside phosphorylase [Haemophilus influenzae PittGG] >gi|167012095|sp|A5UH23|DEOD_HAEIG Purine nucleoside phosphorylase deoD-type (PNP) >gi|144979369|gb|EDJ89055.1| purine nucleoside phosphorylase [Haemophilus influenzae 22.1-21] >gi|145267407|gb|EDK07409.1| purine nucleoside phosphorylase [Haemophilus influenzae PittAA] >gi|145269389|gb|EDK09333.1| purine nucleoside phosphorylase [Haemophilus influenzae PittHH] >gi|145272162|gb|EDK12070.1| purine nucleoside phosphorylase [Haemophilus influenzae PittII] >gi|148718951|gb|ABR00079.1| purine nucleoside phosphorylase [Haemophilus influenzae PittGG] (238 aa)
Score = 380, Expect = 6.5e-35, Identities = 89/233 (38%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FL++   + +VR MLG+TG Y  +++++MGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ V D+++   A ++S   +   I  KD+      + +                 V  + S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +AE+RQ  F +MI +AL  V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSV 232
>gi|120598015|ref|YP_962589.1| purine nucleoside phosphorylase [Shewanella sp. W3-18-1] >gi|120558108|gb|ABM24035.1| purine nucleoside phosphorylase [Shewanella sp. W3-18-1] (236 aa)
Score = 379, Expect = 7.0e-35, Identities = 87/230 (37%), Positives = 133/230 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A +G  A+ VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D     + EL + + ++A     K+    + S+D+FY     +  +        VEME+  L+  A +   +A  ++T SD + T E  SAE+RQT F +MI + L+
  S:     3 TPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNR-LRFKGQDFAAIANYELMNAVIESAKVKGTKIRVGNIFSADLFYTPEPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTSAEERQTTFNDMIIMTLE 231
>gi|145633530|ref|ZP_01789259.1| purine nucleoside phosphorylase [Haemophilus influenzae 3655] >gi|145640494|ref|ZP_01796078.1| purine nucleoside phosphorylase [Haemophilus influenzae R3021] >gi|144985899|gb|EDJ92507.1| purine nucleoside phosphorylase [Haemophilus influenzae 3655] >gi|145275080|gb|EDK14942.1| purine nucleoside phosphorylase [Haemophilus influenzae 22.4-21] (238 aa)
Score = 379, Expect = 7.1e-35, Identities = 89/233 (38%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FL++   + +VR MLG+TG Y  +++++MGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ V D+++   A ++S   +   I  KD+      + +                 V  + S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +AE+RQ  F +MI +AL  V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRMDVKVRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSV 232
>gi|75761466|ref|ZP_00741432.1| Purine nucleoside phosphorylase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491048|gb|EAO54298.1| Purine nucleoside phosphorylase [Bacillus thuringiensis serovar israelensis ATCC 35646] (235 aa)
Score = 379, Expect = 7.1e-35, Identities = 90/230 (39%), Positives = 132/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +   D     VEME+ +L+  A K    A ++LT SD + T E  ++E+RQT F  MI +AL
  S:     1 MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVSCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIAL 229
>gi|2494056|sp|Q59482|DEOD_KLEPN Purine nucleoside phosphorylase deoD-type (PNP) >gi|1364141|pir||JC4326 purine-nucleoside phosphorylase (EC 2.4.2.1) - Klebsiella sp >gi|871394|emb|CAA61136.1| purine-nucleoside phosphorylase [Klebsiella sp.] (239 aa)
Score = 379, Expect = 7.8e-35, Identities = 90/232 (38%), Positives = 137/232 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNN-KEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENN---IKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRA  IAE FLE+ + +N+VRGMLG+TG Y   ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+  +D+ + ++V+   A ++S   +   +  KD       +   V  + A++     ++     + S+D+FY  + S+  +        VEME+  ++  A +   KA T+ T SD + THE   A +RQT F +MI +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRANSIAETFLEDAREVNNVRGMLGFTGTYKGRRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVREDVKLREVVIGHGACTDSKVNR---LRFKDHDFPAIADFGMV--RNAVDAKALGVEARRSNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTIAAERQTTFNDMIKIALESV 233
>gi|146148653|gb|ABQ02264.1| DeoD [Aggregatibacter actinomycetemcomitans] (239 aa)
Score = 379, Expect = 8.1e-35, Identities = 89/233 (38%), Positives = 133/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIEN----NIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A  G  A  VLMPGDPLRAK+IAE FL++ K + +VR MLG+TG Y  + ++VM HGMG+ S  IY+ EL   Y V  +IRVGS G+   D+ V D+V+   A ++S   +   I  KD+      +    + + A++      +K     + S+D+FY  + ++  +        VEME+  ++  A +   +A T+ T SD + THE  SAE+RQ  F  MI +AL+ +
  S:     1 MTPHINAPAGAFADAVLMPGDPLRAKYIAETFLDDVKEVTNVRNMLGFTGTYKGRRISVMAHGMGIPSCSIYAKELITEYGVKKLIRVGSCGAVRMDVKVRDVVIGVGACTDSKVNR---IRFKDNDFAAIADFG--LTQAAVQAVKTLGVKARVGNLFSADLFYTPDMAMFDVMEKYGILGVEMEAAGIYGVAAEYGARALTICTVSDHIRTHEQTSAEERQLTFNEMIKIALEAI 232
>gi|30261559|ref|NP_843936.1| purine nucleoside phosphorylase [Bacillus anthracis str. Ames] >gi|42780662|ref|NP_977909.1| purine nucleoside phosphorylase [Bacillus cereus ATCC 10987] >gi|47526757|ref|YP_018106.1| purine nucleoside phosphorylase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47569132|ref|ZP_00239820.1| purine nucleoside phosphorylase [Bacillus cereus G9241] >gi|49184389|ref|YP_027641.1| purine nucleoside phosphorylase [Bacillus anthracis str. Sterne] >gi|49481060|ref|YP_035679.1| purine nucleoside phosphorylase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65318829|ref|ZP_00391788.1| COG0813: Purine-nucleoside phosphorylase [Bacillus anthracis str. A2012] >gi|118477019|ref|YP_894170.1| purine nucleoside phosphorylase [Bacillus thuringiensis str. Al Hakam] >gi|163939377|ref|YP_001644261.1| purine nucleoside phosphorylase [Bacillus weihenstephanensis KBAB4] >gi|165872644|ref|ZP_02217274.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0488] >gi|166985027|ref|ZP_02256336.1| purine nucleoside phosphorylase [Bacillus cereus AH187] >gi|166992115|ref|ZP_02258575.1| purine nucleoside phosphorylase [Bacillus cereus AH820] >gi|167634309|ref|ZP_02392630.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0442] >gi|167641642|ref|ZP_02399888.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0193] >gi|167940261|ref|ZP_02527336.1| purine nucleoside phosphorylase [Bacillus cereus AH1134] >gi|168143311|ref|ZP_02586540.1| purine nucleoside phosphorylase [Bacillus cereus G9842] >gi|168164023|ref|ZP_02599256.1| purine nucleoside phosphorylase [Bacillus cereus H3081.97] >gi|170689251|ref|ZP_02880447.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0465] >gi|170706236|ref|ZP_02896697.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0389] >gi|177651583|ref|ZP_02934372.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0174] >gi|190568082|ref|ZP_03020992.1| purine nucleoside phosphorylase [Bacillus anthracis Tsiankovskii-I] >gi|196036841|ref|ZP_03104230.1| purine nucleoside phosphorylase [Bacillus cereus W] >gi|196038877|ref|ZP_03106184.1| purine nucleoside phosphorylase [Bacillus cereus NVH0597-99] >gi|196047632|ref|ZP_03114839.1| purine nucleoside phosphorylase [Bacillus cereus 03BB108] >gi|167012085|sp|A0RBS0|DEOD_BACAH Purine nucleoside phosphorylase deoD-type (PNP) >gi|81396696|sp|Q6HL92|DEOD_BACHK Purine nucleoside phosphorylase deoD-type (PNP) >gi|81569735|sp|Q73B32|DEOD_BACC1 Purine nucleoside phosphorylase deoD-type (PNP) >gi|81582900|sp|Q81T09|DEOD_BACAN Purine nucleoside phosphorylase deoD-type (PNP) >gi|112489887|pdb|2AC7|A Chain A, Crystal Structure Of Adenosine Phosphorylase From Bacillus Cereus With Adenosine Bound In The Active Site >gi|112489888|pdb|2AC7|B Chain B, Crystal Structure Of Adenosine Phosphorylase From Bacillus Cereus With Adenosine Bound In The Active Site >gi|30255413|gb|AAP25422.1| purine nucleoside phosphorylase [Bacillus anthracis str. Ames] >gi|42736582|gb|AAS40517.1| purine nucleoside phosphorylase [Bacillus cereus ATCC 10987] >gi|47501905|gb|AAT30581.1| purine nucleoside phosphorylase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47554203|gb|EAL12566.1| purine nucleoside phosphorylase [Bacillus cereus G9241] >gi|49178316|gb|AAT53692.1| purine nucleoside phosphorylase [Bacillus anthracis str. Sterne] >gi|49332616|gb|AAT63262.1| purine nucleoside phosphorylase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118416244|gb|ABK84663.1| purine-nucleoside phosphorylase [Bacillus thuringiensis str. Al Hakam] >gi|163861574|gb|ABY42633.1| purine nucleoside phosphorylase [Bacillus weihenstephanensis KBAB4] >gi|164711588|gb|EDR17135.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0488] >gi|167510435|gb|EDR85835.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0193] >gi|167530197|gb|EDR92923.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0442] >gi|170128770|gb|EDS97636.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0389] >gi|170666806|gb|EDT17573.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0465] >gi|172082861|gb|EDT67924.1| purine nucleoside phosphorylase [Bacillus anthracis str. A0174] >gi|190560816|gb|EDV14791.1| purine nucleoside phosphorylase [Bacillus anthracis Tsiankovskii-I] >gi|195990570|gb|EDX54549.1| purine nucleoside phosphorylase [Bacillus cereus W] >gi|196021546|gb|EDX60246.1| purine nucleoside phosphorylase [Bacillus cereus 03BB108] >gi|196030022|gb|EDX68622.1| purine nucleoside phosphorylase [Bacillus cereus NVH0597-99] (235 aa)
Score = 379, Expect = 8.2e-35, Identities = 90/230 (39%), Positives = 132/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +   D     VEME+ +L+  A K    A ++LT SD + T E  ++E+RQT F  MI +AL
  S:     1 MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIAL 229
>gi|146319099|ref|YP_001198811.1| purine-nucleoside phosphorylase [Streptococcus suis 05ZYH33] >gi|146321300|ref|YP_001201011.1| purine-nucleoside phosphorylase [Streptococcus suis 98HAH33] >gi|145689905|gb|ABP90411.1| Purine-nucleoside phosphorylase [Streptococcus suis 05ZYH33] >gi|145692106|gb|ABP92611.1| Purine-nucleoside phosphorylase [Streptococcus suis 98HAH33] (237 aa)
Score = 379, Expect = 9.0e-35, Identities = 97/233 (41%), Positives = 142/233 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA---NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK GEIA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMG+ SI IY++EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T ++ I I+  +  L    + + + +   I   + +T  V  V SSD FY     +R++E      K+  VEME+ +L+    K   +   ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKPGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGIPSISIYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSRMINIDWPEYDLPQIADFDLLDKAYHIAKELNMTTHVGNVLSSDSFYSPKLFSRNLELGQLGVKA--VEMEAAALYYLGAKFGVQTLAIMTISDSLVNPEEDTTAEERQNTFTDMMKVGLETL 234
>gi|149115684|ref|ZP_01842424.1| purine nucleoside phosphorylase [Shewanella baltica OS223] >gi|146864504|gb|EDK49914.1| purine nucleoside phosphorylase [Shewanella baltica OS223] (236 aa)
Score = 378, Expect = 9.1e-35, Identities = 86/230 (37%), Positives = 134/230 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A +G  A+ +L PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D     + EL + + ++A     K+    + S+D+FY  +  +  +        VEME+  L+  A +   +A  ++T SD + T E  SAE+RQT F +MI + L+
  S:     3 TPHINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNR-LRFKGQDFAAIANYELMNAVIESAKVRGTKIRVGNIFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTSAEERQTTFNDMIIMTLE 231
>gi|145630304|ref|ZP_01786085.1| purine nucleoside phosphorylase [Haemophilus influenzae 22.4-21] >gi|144984039|gb|EDJ91476.1| purine nucleoside phosphorylase [Haemophilus influenzae R3021] (238 aa)
Score = 378, Expect = 1.1e-34, Identities = 89/233 (38%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FL++   + +VR MLG+TG Y  +++++MGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ V D+++   A ++S   +   I  KD+      + +                 V  + S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +AE+RQ  F +MI +AL  V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRMDVKVRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGVKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSV 232
>gi|126175424|ref|YP_001051573.1| purine nucleoside phosphorylase [Shewanella baltica OS155] >gi|153001736|ref|YP_001367417.1| purine nucleoside phosphorylase [Shewanella baltica OS185] >gi|160876469|ref|YP_001555785.1| purine nucleoside phosphorylase [Shewanella baltica OS195] >gi|167012098|sp|A3D7J1|DEOD_SHEB5 Purine nucleoside phosphorylase deoD-type (PNP) >gi|167012099|sp|A6WRB5|DEOD_SHEB8 Purine nucleoside phosphorylase deoD-type (PNP) >gi|125998629|gb|ABN62704.1| purine nucleoside phosphorylase [Shewanella baltica OS155] >gi|151366354|gb|ABS09354.1| purine nucleoside phosphorylase [Shewanella baltica OS185] >gi|160861991|gb|ABX50525.1| purine nucleoside phosphorylase [Shewanella baltica OS195] (236 aa)
Score = 378, Expect = 1.1e-34, Identities = 86/230 (37%), Positives = 134/230 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A +G  A+ +L PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D     + EL + + ++A     K+    + S+D+FY  +  +  +        VEME+  L+  A +   +A  ++T SD + T E  SAE+RQT F +MI + L+
  S:     3 TPHINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNR-LRFKGQDFAAIANYELMNAVIESAKVRGTKVRVGNIFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTSAEERQTTFNDMIIMTLE 231
>gi|110678940|ref|YP_681947.1| purine nucleoside phosphorylase [Roseobacter denitrificans OCh 114] >gi|109455056|gb|ABG31261.1| purine nucleoside phosphorylase [Roseobacter denitrificans OCh 114] (234 aa)
Score = 378, Expect = 1.2e-34, Identities = 83/231 (35%), Positives = 131/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+  +IA+ VLMPGDP RA+W A+ FL+  +L+N+VRGMLG+TG Y    VT+ G GMGM S+ IY+ EL + Y+   +IR+GS G     + V D+++   A + ++ +  I  E   +     D L   +     +   +     ++SSD+FY     +++         VEME+  L+  A + N++A  +LT SD L T E++ AEDR+  F +M+ +AL+
  S:     1 MTIHIGARPDQIAETVLMPGDPYRARWAAQTFLDGAELVNEVRGMLGFTGTYKGNRVTIQGSGMGMPSLSIYANELISSYNAQTLIRIGSCGGMQPHVAVRDVIIAMSATTITSPSSGIFREVNFAPTAHYDLLAAAVTAAKAKGT-RTHVGGIYSSDVFYAERPDLDEQMVRHGILGVEMEAAELYTLAARHNRRALAILTVSDHLQTGEALPAEDREQTFGDMVEIALE 230
>gi|119946488|ref|YP_944168.1| purine nucleoside phosphorylase [Psychromonas ingrahamii 37] >gi|167012096|sp|A1SYK4|DEOD_PSYIN Purine nucleoside phosphorylase deoD-type (PNP) >gi|119865092|gb|ABM04569.1| purine-nucleoside phosphorylase [Psychromonas ingrahamii 37] (236 aa)
Score = 377, Expect = 1.2e-34, Identities = 94/232 (40%), Positives = 129/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A  G  A+ VLMPGDPLRAK+IAENFL++   + DVR MLG+TG Y  K V+VMG GMG+ S  IY+ ELF  Y V  IIRVGS G+ ++DI + D+++   A ++S  A  I  +  D     S EL +     A    IK     + S+D FY     V           VEME+  L+  A +  K A  +LT SD + T E  ++++RQ+ F  M+ +AL  +
  S:     3 TPHINAVDGAFAETVLMPGDPLRAKYIAENFLKDAVQVTDVRNMLGFTGTYKGKRVSVMGSGMGIPSCSIYATELFREYGVQNIIRVGSCGAVSRDIKLRDVIIGMGASTDSK-ANRIRFKGHDFAAIASYELLEKAVNAARALGIKARVGNIFSADTFYTPEPEVFDTLEKYNILGVEMEAAGLYGVAAEEGKNALCILTVSDHIRTGEKTTSDERQSSFNEMLIIALDSI 233
>gi|89097830|ref|ZP_01170717.1| purine-nucleoside phosphorylase [Bacillus sp. NRRL B-14911] >gi|89087332|gb|EAR66446.1| purine-nucleoside phosphorylase [Bacillus sp. NRRL B-14911] (233 aa)
Score = 377, Expect = 1.3e-34, Identities = 94/235 (40%), Positives = 148/235 (62%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK--YIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  A++ +IA+ VL+PGDPLRAK+IAE FLE+ +  N+VR M GYTG Y  K ++V G GMG+ SI IY  EL   Y+V  +IRVG+ G+  KD+ V D++L   A ++S   +  + G++ A  +  +      D   K  +  N+K+ +V   ++D+FY  N  +E+ A   K Q+  +EME+ +L+  A K ++KA ++LT SD ++T E  ++++RQT F  MI +AL+   K
  S:     1 MSVHIGAEENQIAETVLLPGDPLRAKYIAETFLEDAECYNEVRNMFGYTGTYKGKRISVQGTGMGVPSISIYINELMNSYNVQNLIRVGTCGAIQKDVKVRDVILAMSASTDSQMNRLTFGGVDYAPTADFDLLKRAYDAGEKKGL--NLKVGNVF--TADMFYNDNSELEKWA---KYQILAIEMETAALYTLAAKFDRKALSVLTVSDHILTGEETTSQERQTTFNEMIEVALEAAIK 233
>gi|75431932|sp|Q5EEL8|DEOD_BACCE Purine nucleoside phosphorylase deoD-type (PNP) >gi|58825800|gb|AAW82755.1| adenosine phosphorylase [Bacillus cereus] (235 aa)
Score = 377, Expect = 1.4e-34, Identities = 90/230 (39%), Positives = 132/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           M+ H  AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +   D     VEME+ +L+  A K    A ++LT SD + T E  ++E+RQT F  MI +AL
  S:     1 MSVHIEAKQGEIAESLLLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIAL 229
>gi|16272462|ref|NP_438676.1| purine nucleoside phosphorylase [Haemophilus influenzae Rd KW20] >gi|68249115|ref|YP_248227.1| purine nucleoside phosphorylase [Haemophilus influenzae 86-028NP] >gi|1169271|sp|P44417|DEOD_HAEIN Purine nucleoside phosphorylase deoD-type (PNP) >gi|81336479|sp|Q4QN30|DEOD_HAEI8 Purine nucleoside phosphorylase deoD-type (PNP) >gi|1573501|gb|AAC22176.1| purine-nucleoside phosphorylase (deoD) [Haemophilus influenzae Rd KW20] >gi|68057314|gb|AAX87567.1| Purine nucleoside phosphorylase [Haemophilus influenzae 86-028NP] (238 aa)
Score = 376, Expect = 1.6e-34, Identities = 91/233 (39%), Positives = 136/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV----VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  A +G  A VVLMPGDPLRAK+IAE FL++   + +VR MLG+TG Y  +++++MGHGMG+ S  IY+ EL   Y V  IIRVGS G+   D+ V D+++   A ++S   +   I  KD+      + +  + + A++       VV    + S+D+FY  +  +  +        VEME+  ++  A +   KA T+ T SD + THE  +AE+RQ  F +MI +AL  V
  S:     1 MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNR---IRFKDNDFAAIADFD--MAQAAVQAAKAKGKVVRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSV 232
>gi|15612169|ref|NP_223821.1| purine nucleoside phosphorylase [Helicobacter pylori J99] >gi|6647498|sp|Q9ZK38|DEOD_HELPJ Purine nucleoside phosphorylase deoD-type (PNP) >gi|4155701|gb|AAD06684.1| PURINE NUCLEOSIDE PHOSPHORYLASE [Helicobacter pylori J99] (233 aa)
Score = 376, Expect = 1.7e-34, Identities = 87/233 (37%), Positives = 133/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  AK G+     L+ GDPLR  +IA+NFL++ K I +VR MLG++G Y  K +++MGHGMG+AS  IY  EL   Y V  ++R+G+ G+ +  + + D+V+   A ++S   + +     D +     EL+    +TA    I L    V SSD FY        + +      +EME+  L+A A++LN KA  L + SD L+T E++S ++R   F NMI LAL+++
  S:     1 MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNR-VRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMM 232
>gi|24372802|ref|NP_716844.1| purine nucleoside phosphorylase [Shewanella oneidensis MR-1] >gi|81589347|sp|Q8EHK0|DEOD2_SHEON Purine nucleoside phosphorylase deoD-type 2 (PNP 2) >gi|24346893|gb|AAN54289.1|AE015566_4 purine nucleoside phosphorylase [Shewanella oneidensis MR-1] (236 aa)
Score = 376, Expect = 1.8e-34, Identities = 86/229 (37%), Positives = 133/229 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A +G  A+ VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D     + EL + + ++A     K+    V S+D+FY  +  +  +        VEME+  L+  A +   +A  ++T SD + T E  ++E+RQT F +MI + L
  S:     3 TPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNR-LRFKGQDFAAIANYELMNAVIESAKVKGTKIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSEERQTTFNDMIVMTL 230
>gi|146329483|ref|YP_001209609.1| purine nucleoside phosphorylase [Dichelobacter nodosus VCS1703A] >gi|167012088|sp|A5EV41|DEOD_DICNV Purine nucleoside phosphorylase deoD-type (PNP) >gi|146232953|gb|ABQ13931.1| purine nucleoside phosphorylase [Dichelobacter nodosus VCS1703A] (237 aa)
Score = 376, Expect = 1.9e-34, Identities = 85/236 (36%), Positives = 131/236 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           MTPH  A  G  A+ VL  GDPLRA++IA +FL+N + I +VR MLG+TG Y   +++VMGHGMG+ S  IY+ EL   Y V  +IRVGS G+   +I + D+++   A ++S   + +     D        +   +   A + NI      V S+D FY A+  +  +        VEME+  LF  A +   +A  +LT SD ++  E+ +A +RQT+F +MI +AL+   ++
  S:     1 MTPHINAPAGAFAETVLFCGDPLRAQFIAHHFLKNAQEITNVRAMLGFTGEYQQHKLSVMGHGMGIPSCSIYAKELITEYGVKNLIRVGSCGAVLDEIKLHDVIIALSAATDSNVNR-LRFRHYDFAATADYSIFSALIAAAAQQNITARVGTVFSTDSFYHADTELMDLLKRFHILGVEMEAAGLFGVAAEYGARAGCILTVSDHILRQETTTALERQTRFHDMITIALEAAVRL 235
>gi|149187442|ref|ZP_01865740.1| purine nucleoside phosphorylase [Vibrio shilonii AK1] >gi|148838978|gb|EDL55917.1| purine nucleoside phosphorylase [Vibrio shilonii AK1] (236 aa)
Score = 375, Expect = 2.1e-34, Identities = 88/235 (37%), Positives = 136/235 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAI-ENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A  G+ A+ VLMPGDPLRA++IAE FLE+   + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL   Y V  +IRVGS G+   D+N+ D+V+   A ++S   +    +   + +     L + +++  + E  +K+ ++   S+D+FY     +           V+ME+  ++  A  L  KA T+LT SD ++  E +S+EDRQ  F +M+ +AL+    I
  S:     3 TPHINANPGDFAETVLMPGDPLRAQYIAETFLEDVVKVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSCCIYVHELIKDYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAAIADYGLLEEAVKQARLQEVPVKVGNIF--SADLFYTPEADIFDKMKHLGILGVDMEAAGIYGVAADLGAKALTVLTVSDHIIRGEKLSSEDRQKSFNDMMVVALETAINI 236
>gi|145592769|ref|YP_001157066.1| purine nucleoside phosphorylase [Salinispora tropica CNB-440] >gi|145302106|gb|ABP52688.1| purine-nucleoside phosphorylase [Salinispora tropica CNB-440] (235 aa)
Score = 375, Expect = 2.2e-34, Identities = 86/233 (36%), Positives = 137/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIE----NNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK GEIA+ VLMPGDPLRAKWIAE +LE  +  + VRGMLG+TG +N  EV++ G GMGM S  IY++EL   Y V  +IRVGS G+ T+D+ + D+V    + ++S   +       D  ++ +   +  + +T++E      + +    V ++D FY     +    ++     VEMES +L+  A +   +A T+LT SD + T E +++++R+  F  M+ +AL  +
  S:     1 MSTHIGAKPGEIAERVLMPGDPLRAKWIAETYLEGAQCYSTVRGMLGFTGRWNGVEVSIQGSGMGMPSASIYAHELINEYGVRSLIRVGSCGALTEDLQLRDVVAAIGSSTDSNMNRV----RFDGLIDYAPVADFGLLRTSVEVAEQRGVTMRVGPVLAADAFYTDRPDLYDSLANYGVLAVEMESAALYTIAARFRARALTILTVSDHIRTGEKVTSQEREQTFSQMVEIALDTI 233
>gi|89072164|ref|ZP_01158760.1| purine nucleoside phosphorylase [Photobacterium sp. SKA34] >gi|89052265|gb|EAR57716.1| purine nucleoside phosphorylase [Photobacterium sp. SKA34] (236 aa)
Score = 374, Expect = 2.9e-34, Identities = 87/230 (37%), Positives = 129/230 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A+ G+ A+ VLMPGDPLRA++IAE +L+N K + DVR M GYTG Y  + ++VMGHGMG+ S  IY +EL   + V  IIR+GS G+   D+ + D+++   A ++S   + I     D       +L +     A    + +    V S+D+FY     +           V+ME+  ++  A +L  KA T+LT SD +   E +SAEDRQ  F  M+N+AL+
  S:     3 TPHINAELGDFAETVLMPGDPLRAQFIAETYLDNVKRVCDVRSMYGYTGTYKGQRISVMGHGMGIPSCSIYVHELIKDFGVKNIIRIGSCGAVHDDVKLMDVIIGMGASTDSKVNR-IRFSNHDFAAIADYQLLETAVNQARAQKVPVRVGNVFSADLFYSPESDLFDKMEKLGILGVDMEAAGIYGVAAELGAKALTILTVSDHIKRGEKLSAEDRQKSFNEMMNIALE 231
>gi|91792388|ref|YP_562039.1| purine nucleoside phosphorylase [Shewanella denitrificans OS217] >gi|122968910|sp|Q12QG0|DEOD_SHEDO Purine nucleoside phosphorylase deoD-type (PNP) >gi|91714390|gb|ABE54316.1| purine nucleoside phosphorylase [Shewanella denitrificans OS217] (236 aa)
Score = 374, Expect = 3.0e-34, Identities = 86/229 (37%), Positives = 131/229 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A  G  A+ +L PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+YEL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  +  D        L   +  +A E+  ++    V S+D+FY  +  +  +        VEME+  L+  A +L  KA  ++T SD + T E  ++++RQT F +MI + L
  S:     3 TPHINAVPGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSASIYAYELIKEYGVKNLIRVGTCGAISTDVKVRDVIIAMGACTDSKVNR-LRFKDHDFAAIADYSLLSAVVDSAKEHGTQIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHELGAKALCVVTVSDHIRTGEKTTSDERQTTFNDMIIMTL 230
>gi|59714151|ref|YP_206926.1| purine nucleoside phosphorylase deoD-type; PNP [Vibrio fischeri ES114] >gi|75431219|sp|Q5DYV8|DEOD3_VIBF1 Purine nucleoside phosphorylase deoD-type (PNP) >gi|59482399|gb|AAW88038.1| purine nucleoside phosphorylase deoD-type; PNP [Vibrio fischeri ES114] (239 aa)
Score = 374, Expect = 3.2e-34, Identities = 92/235 (39%), Positives = 134/235 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDV-----VVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           TPH  A     A  +LMPGDPLRAK IAE +LEN   + DVRGMLG+TG +  ++++VMGHGMG  S  IY +EL   Y V   IR+GS G+   D+ + DL++   A   ST +K   I  KD+    +   N +   +   N +K TD+      V SSD+FY  +     + +      VEME  +L++ A + +  A  L T +D +  HE ++A++R+T+   MIN+AL V  K+
  S:     3 TPHINAPLDAFADTILMPGDPLRAKLIAETYLENVVQVTDVRGMLGFTGEFKGRKISVMGHGMGAPSASIYFHELMTTYKVKNFIRIGSCGAIHDDVKLKDLIV---AIGASTDSKMNRIRFKDNDFAATANYNML---SECVNTLKTTDINYLVGNVFSSDLFYRPDEEQYDMMARYGILGVEMEVNALYSAAAENHCNAVALCTVTDHIKNHEHLTADERRTELHEMINVALDVALKL 236
>gi|77362004|ref|YP_341578.1| purine nucleoside phosphorylase (inosine phosphorylase) (PNP) [Pseudoalteromonas haloplanktis TAC125] >gi|85541680|sp|Q3ICU8|DEOD_PSEHT Purine nucleoside phosphorylase deoD-type (PNP) >gi|76876915|emb|CAI89132.1| Purine nucleoside phosphorylase (Inosine phosphorylase) (PNP) [Pseudoalteromonas haloplanktis TAC125] (233 aa)
Score = 373, Expect = 4.0e-34, Identities = 84/232 (36%), Positives = 132/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-------YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A  G+ A+ VLMPGDPLRAK+IAENFL++ K +  VR MLG+TG Y  K V++MG GMG+ S+ +Y+ EL   + V  +IR+G+ G    D+ + D++  + A ++S   +       +  I   D  L G +   D+  K  + N        V ++D FY A+ +  +         V+ME+  L+  A +   KA  L T SD ++T E+  A++RQ+ F  M+ +AL+ +
  S:     3 TPHINANVGDFAETVLMPGDPLRAKYIAENFLDDAKQVTSVRNMLGFTGTYKGKPVSIMGSGMGIPSMSLYARELIVTFGVKNLIRIGTCGGIGSDVKIRDVIFAQGACTDSNVNRARVRGTDFAAIADFDLLLNGVNAAKDLGIKAKVGN--------VFTTDTFYQADDTFYKDLDKLGVLAVDMETAGLYGVAAEYGAKAMALFTVSDHVITGEATPADERQSTFNEMVKIALESI 233
>gi|113969384|ref|YP_733177.1| purine nucleoside phosphorylase [Shewanella sp. MR-4] >gi|114046611|ref|YP_737161.1| purine nucleoside phosphorylase [Shewanella sp. MR-7] >gi|117919493|ref|YP_868685.1| purine nucleoside phosphorylase [Shewanella sp. ANA-3] >gi|123130659|sp|Q0HLE7|DEOD_SHESM Purine nucleoside phosphorylase deoD-type (PNP) >gi|123131650|sp|Q0HXQ1|DEOD_SHESR Purine nucleoside phosphorylase deoD-type (PNP) >gi|113884068|gb|ABI38120.1| purine nucleoside phosphorylase [Shewanella sp. MR-4] >gi|113888053|gb|ABI42104.1| purine nucleoside phosphorylase [Shewanella sp. MR-7] >gi|117611825|gb|ABK47279.1| purine and other phosphorylases, family 1 [Shewanella sp. ANA-3] (236 aa)
Score = 373, Expect = 4.2e-34, Identities = 85/229 (37%), Positives = 133/229 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A +G  A+ VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D     + EL + + ++A     K+    V S+D+FY  +  +  +        VEME+  L+  A +   +A  ++T SD + T E  ++++RQT F +MI + L
  S:     3 TPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNR-LRFKGQDFAAIANYELMNAVIESAKVKGTKIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSDERQTTFNDMIVMTL 230
>gi|172056628|ref|YP_001813088.1| purine nucleoside phosphorylase [Exiguobacterium sibiricum 255-15] >gi|171989149|gb|ACB60071.1| purine nucleoside phosphorylase [Exiguobacterium sibiricum 255-15] (235 aa)
Score = 372, Expect = 4.7e-34, Identities = 92/231 (39%), Positives = 132/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  A +G+IA+ VL+PGDPLRAK+IA+ FLE+  L N+VRGM G+TG Y  K+V+V G GMG+ S+ IY+ EL   Y    +IRVG+AG  T D+ V D+V+   A S       +     D     S +L      TA E+ I      + ++D FY  +    +  +D     +EME+  L+  A K    A T+LT SD L+T E  +AE+RQT F +M+ +AL+
  S:     1 MSVHINAAEGQIAETVLLPGDPLRAKYIADTFLEDVVLYNEVRGMYGFTGTYKGKKVSVQGTGMGVPSMSIYANELVQSYGAKNLIRVGTAGGITPDVKVRDVVIAMSA-SHDMAQNRVRFNGLDYAPTASFDLLHKAYMTAKEHGIDAKVGQIFTTDQFYQDDFHHFKKWADFGCLAIEMEAAGLYTLAAKHKVNALTILTISDHLLTGEETTAEERQTTFNDMMKVALE 230
>gi|114562183|ref|YP_749696.1| purine nucleoside phosphorylase [Shewanella frigidimarina NCIMB 400] >gi|122300506|sp|Q086F7|DEOD_SHEFN Purine nucleoside phosphorylase deoD-type (PNP) >gi|114333476|gb|ABI70858.1| purine nucleoside phosphorylase [Shewanella frigidimarina NCIMB 400] (236 aa)
Score = 372, Expect = 5.3e-34, Identities = 86/229 (37%), Positives = 131/229 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A +G  A+ VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY++EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  +  D        L   +  +A  +  K+    V S+D+FY  +  +  +        VEME+  L+  A +L  KA  ++T SD + T E  ++++RQT F +MI + L
  S:     3 TPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYAHELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSRVNR-LRFKDNDFAAIADYSLLSAVVDSAKAHGTKIRVGNVFSADLFYTPDPQMFDVMEKMGILGVEMEAAGLYGVAHELGAKALCVVTVSDHIRTGEKTTSDERQTTFSDMIIMTL 230
>gi|90408140|ref|ZP_01216309.1| purine nucleoside phosphorylase [Psychromonas sp. CNPT3] >gi|90310752|gb|EAS38868.1| purine nucleoside phosphorylase [Psychromonas sp. CNPT3] (235 aa)
Score = 372, Expect = 5.5e-34, Identities = 94/229 (41%), Positives = 129/229 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A  G  A+ VLMPGDPLRAK+IAENFL++   + +VR MLG+TG Y  K V+VMG GMG+ S  IY+ EL   Y V  IIRVGS G+ + D+ V D+++   A ++S  A  I     D     S EL +    +A   NIK+    + S+D FY    +V           VEME+  L+  A +    A  +LT SD + T E +S+++RQT F  M+ +AL
  S:     3 TPHINAVDGAFAETVLMPGDPLRAKYIAENFLDDAVEVTNVRNMLGFTGTYKGKRVSVMGSGMGIPSCSIYATELIREYGVKNIIRVGSCGAISLDVKVRDVIIGMGASTDSK-ANRIRFAGHDFAAIASYELLEKSVASAKALNIKVRVGNIFSADTFYTPEPAVFDTLEKYNILGVEMEAAGLYGVAAEEGANALCILTVSDHIRTGEKLSSDERQTSFNEMLIIAL 230
>gi|99078086|ref|YP_611344.1| purine-nucleoside phosphorylase [Silicibacter sp. TM1040] >gi|99035224|gb|ABF62082.1| purine-nucleoside phosphorylase [Silicibacter sp. TM1040] (234 aa)
Score = 372, Expect = 5.9e-34, Identities = 86/230 (37%), Positives = 131/230 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  ++K + A+ VL+PGDP RAKW AE FL + +L+N+VRGMLGYTG +N   V++ G GMGM S+ IY+ EL   +D   +IR+GS G     + V D+++   A S ST ++ I  +   +       L + +  TA E    L+  V  ++SSD FY     + +         VEME+  L+  A +  ++A  +LT SD L T E++ +E+R+  F  M+ +AL
  S:     1 MTVHIGSQKDDFAETVLLPGDPYRAKWAAETFLSDVRLVNEVRGMLGYTGMWNGHRVSIQGSGMGMPSLSIYANELIRDFDAQTLIRIGSCGGMQPHVKVRDVIIAMSATSVSTPSRTIFRDVNFAPTADWTLLRNAV--TAAEAQ-GLSPHVGGIYSSDTFYDERPDLNEQMVRHGVLGVEMEAAELYTLAARYGRRALAVLTVSDHLQTGEALPSEERERSFGEMVEIAL 229
>gi|170728211|ref|YP_001762237.1| purine nucleoside phosphorylase [Shewanella woodyi ATCC 51908] >gi|169813558|gb|ACA88142.1| purine nucleoside phosphorylase [Shewanella woodyi ATCC 51908] (236 aa)
Score = 370, Expect = 8.7e-34, Identities = 94/235 (40%), Positives = 135/235 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTA-IENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           MTPH  A+ G  A  VLMPGDPLRAK+IAENFLEN  L+ DVR MLGYTG Y  K+++VMG GMG+ SI IY+ EL   Y V  IIR+GS G+ +  I + D+V+   A ++S   +    E  D  +     L   +RK A   + +K+   V  ++SSD+FY ++ +   +        VEME+  L+  A +    A  ++T +D +     ++AE+RQ     MI L L+ V +
  S:     1 MTPHINAEAGAFATTVLMPGDPLRAKYIAENFLENAVLVTDVRNMLGYTGEYQGKKISVMGSGMGIPSISIYAKELITEYGVKNIIRIGSCGAVSDKIKLMDVVMAMGASTDSAINR-TRFEHTDFAMIADFNL---LRKAADAADKLKVNYHVGNLYSSDLFYSSDEARYDLMEKYGILGVEMEAAGLYGVAAEYGANALAMMTVTDHIRQGLHLTAEERQQTLNEMIKLTLEAVSQ 234
>gi|56554499|pdb|1XE3|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase Deod From Bacillus Anthracis >gi|56554500|pdb|1XE3|B Chain B, Crystal Structure Of Purine Nucleoside Phosphorylase Deod From Bacillus Anthracis >gi|56554501|pdb|1XE3|C Chain C, Crystal Structure Of Purine Nucleoside Phosphorylase Deod From Bacillus Anthracis >gi|56554502|pdb|1XE3|D Chain D, Crystal Structure Of Purine Nucleoside Phosphorylase Deod From Bacillus Anthracis >gi|56554503|pdb|1XE3|E Chain E, Crystal Structure Of Purine Nucleoside Phosphorylase Deod From Bacillus Anthracis >gi|56554504|pdb|1XE3|F Chain F, Crystal Structure Of Purine Nucleoside Phosphorylase Deod From Bacillus Anthracis (245 aa)
Score = 370, Expect = 8.9e-34, Identities = 88/224 (39%), Positives = 129/224 (57%)
  Q:    16 AKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           AK+GEIA+ +L+PGDPLRAK+IAE FLE+    N+VRGMLG+TG Y  K V+V G GMG+ SI IY  EL   Y V  +IRVG+ G+  KD+ V D+++   A ++S   + +     D     + +L         E  + +    V ++D+FY  +  + +   D     VEME+ +L+  A K    A ++LT SD + T E  ++E+RQT F  MI +AL
  S:    17 AKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIAL 239
>gi|15642344|ref|NP_231977.1| purine nucleoside phosphorylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586162|ref|ZP_01675953.1| purine nucleoside phosphorylase [Vibrio cholerae 2740-80] >gi|121729812|ref|ZP_01682246.1| purine nucleoside phosphorylase [Vibrio cholerae V52] >gi|147673694|ref|YP_001217850.1| purine nucleoside phosphorylase [Vibrio cholerae O395] >gi|153213951|ref|ZP_01949147.1| purine nucleoside phosphorylase [Vibrio cholerae 1587] >gi|153224926|ref|ZP_01954641.1| purine nucleoside phosphorylase [Vibrio cholerae MAK 757] >gi|153803445|ref|ZP_01958031.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-3] >gi|153819759|ref|ZP_01972426.1| purine nucleoside phosphorylase [Vibrio cholerae NCTC 8457] >gi|153824074|ref|ZP_01976741.1| purine nucleoside phosphorylase [Vibrio cholerae B33] >gi|153825999|ref|ZP_01978666.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-2] >gi|153830845|ref|ZP_01983512.1| purine nucleoside phosphorylase [Vibrio cholerae 623-39] >gi|194532307|ref|YP_002067736.1| purine nucleoside phosphorylase [Vibrio cholerae MO10] >gi|81623039|sp|Q9KPM0|DEOD1_VIBCH Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|9656915|gb|AAF95490.1| purine nucleoside phosphorylase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121549574|gb|EAX59598.1| purine nucleoside phosphorylase [Vibrio cholerae 2740-80] >gi|121628441|gb|EAX60933.1| purine nucleoside phosphorylase [Vibrio cholerae V52] >gi|124115604|gb|EAY34424.1| purine nucleoside phosphorylase [Vibrio cholerae 1587] >gi|124117425|gb|EAY36168.1| purine nucleoside phosphorylase [Vibrio cholerae MAK 757] >gi|124121017|gb|EAY39760.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-3] >gi|125618359|gb|EAZ46899.1| purine nucleoside phosphorylase [Vibrio cholerae MO10] >gi|126509685|gb|EAZ72279.1| purine nucleoside phosphorylase [Vibrio cholerae NCTC 8457] >gi|126518404|gb|EAZ75627.1| purine nucleoside phosphorylase [Vibrio cholerae B33] >gi|146315577|gb|ABQ20116.1| purine nucleoside phosphorylase [Vibrio cholerae O395] >gi|148873679|gb|EDL71814.1| purine nucleoside phosphorylase [Vibrio cholerae 623-39] >gi|149740316|gb|EDM54457.1| purine nucleoside phosphorylase [Vibrio cholerae MZO-2] >gi|150423903|gb|EDN15843.1| purine nucleoside phosphorylase [Vibrio cholerae AM-19226] (241 aa)
Score = 369, Expect = 1.1e-33, Identities = 92/232 (39%), Positives = 130/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAENFL+N   + DVR M GYTG Y  ++++VMGHGMG+ S  IY  EL   Y V  IIRVGS G+  + I V D+V+   A ++S   +   I  KD       +   +++        +  DV V    S+++FY  + S+  +        VEME+  ++  A +   KA  + T SD + T E  ++E+RQ  F  MI +AL  V
  S:     3 TPHINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRKISVMGHGMGIPSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNR---IRFKDHDFAAIADYK-MVKAAEEAAKARGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSEERQNTFNEMIEIALDSV 233
>gi|40889931|pdb|1VHJ|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase >gi|40889932|pdb|1VHJ|B Chain B, Crystal Structure Of Purine Nucleoside Phosphorylase >gi|40889933|pdb|1VHJ|C Chain C, Crystal Structure Of Purine Nucleoside Phosphorylase >gi|40889934|pdb|1VHJ|D Chain D, Crystal Structure Of Purine Nucleoside Phosphorylase >gi|40889935|pdb|1VHJ|E Chain E, Crystal Structure Of Purine Nucleoside Phosphorylase >gi|40889936|pdb|1VHJ|F Chain F, Crystal Structure Of Purine Nucleoside Phosphorylase >gi|40889958|pdb|1VHW|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase With Adenosine >gi|40889959|pdb|1VHW|B Chain B, Crystal Structure Of Purine Nucleoside Phosphorylase With Adenosine >gi|40889960|pdb|1VHW|C Chain C, Crystal Structure Of Purine Nucleoside Phosphorylase With Adenosine >gi|40889961|pdb|1VHW|D Chain D, Crystal Structure Of Purine Nucleoside Phosphorylase With Adenosine >gi|40889962|pdb|1VHW|E Chain E, Crystal Structure Of Purine Nucleoside Phosphorylase With Adenosine >gi|40889963|pdb|1VHW|F Chain F, Crystal Structure Of Purine Nucleoside Phosphorylase With Adenosine (253 aa)
Score = 369, Expect = 1.2e-33, Identities = 92/232 (39%), Positives = 129/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAENFL+N   + DVR M GYTG Y  + ++VMGHGMG+ S  IY  EL   Y V  IIRVGS G+  + I V D+V+   A ++S   +   I  KD       +   +++        +  DV V    S+++FY  + S+  +        VEME+  ++  A +   KA  + T SD + T E  ++E+RQ  F  MI +AL  V
  S:     5 TPHINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRRISVMGHGMGIPSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNR---IRFKDHDFAAIADYK-MVKAAEEAAKARGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSEERQNTFNEMIEIALDSV 235
>gi|86147488|ref|ZP_01065800.1| purine nucleoside phosphorylase [Vibrio sp. MED222] >gi|85834781|gb|EAQ52927.1| purine nucleoside phosphorylase [Vibrio sp. MED222] (239 aa)
Score = 369, Expect = 1.3e-33, Identities = 87/232 (37%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE    + DVR M GYTG Y  ++V+VMGHGMG+ S  IY+ EL   + V  IIRVGS G+ ++DI V D+V+   A ++S   + I  +  D       ++       A    + +    + S+++FY  +  + ++        VEME+  ++    +   KA T+ T SD + T E  ++++RQT F +M+ +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEEVVQVCDVRNMFGYTGTYKGRKVSVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVSEDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYKMVRAAEDAAKARGVDVKVGNLFSAELFYTPDPEMFEVMDKYGIVGVEMEAAGIYGVCAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMVIALDSV 233
>gi|84387263|ref|ZP_00990284.1| purine nucleoside phosphorylase [Vibrio splendidus 12B01] >gi|84377910|gb|EAP94772.1| purine nucleoside phosphorylase [Vibrio splendidus 12B01] (239 aa)
Score = 368, Expect = 1.3e-33, Identities = 87/232 (37%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE    + DVR M GYTG Y  ++V+VMGHGMG+ S  IY+ EL   + V  IIRVGS G+ ++DI V D+V+   A ++S   + I  +  D       ++       A    + +    + S+++FY  +  + ++        VEME+  ++    +   KA T+ T SD + T E  ++++RQT F +M+ +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEEVVQVCDVRNMFGYTGTYKGRKVSVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVSEDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYKMVRAAEDAAKARGVDVKVGNLFSAELFYTPDPEMFEVMDKYGIVGVEMEAAGIYGVCAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMVIALDSV 233
>gi|90578335|ref|ZP_01234146.1| purine nucleoside phosphorylase [Vibrio angustum S14] >gi|90441421|gb|EAS66601.1| purine nucleoside phosphorylase [Vibrio angustum S14] (236 aa)
Score = 368, Expect = 1.4e-33, Identities = 86/230 (37%), Positives = 128/230 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A+ G+ A+ VLMPGDPLRA++IAE +L++ K + DVR M GYTG Y  + ++VMGHGMG+ S  IY +EL   + V  IIR+GS G+   D+ + D+++   A ++S   + I     D        L +     A    + +    V S+D+FY     +           V+ME+  ++  A +L  KA T+LT SD +   E +SAEDRQ  F  M+N+AL+
  S:     3 TPHINAELGDFAETVLMPGDPLRAQFIAETYLDDVKRVCDVRSMYGYTGTYKGQRISVMGHGMGIPSCSIYVHELIKDFGVKNIIRIGSCGAVHDDVKLMDVIIGMGASTDSKVNR-IRFSNHDFAAIADYHLLETAVNQARAQKVPVRVGNVFSADLFYSPESDLFDKMEKLGILGVDMEAAGIYGVAAELGAKALTILTVSDHIKRGEKLSAEDRQKSFNEMMNIALE 231
>gi|149913169|ref|ZP_01901703.1| purine nucleoside phosphorylase [Roseobacter sp. AzwK-3b] >gi|149813575|gb|EDM73401.1| purine nucleoside phosphorylase [Roseobacter sp. AzwK-3b] (235 aa)
Score = 367, Expect = 2.0e-33, Identities = 86/230 (37%), Positives = 129/230 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  A+ G+IAK VLMPGDP+RA+W A  FL++P+ IN VRGMLGYTG +  + VT+ G GMGM S+ IY+ EL   + V  ++R+GS G     + + D++L   A S ST +  +  E + +       L       A    I      ++SSD FY     +    +   +  VEME+  L+  A +   +A ++LT SD L+T +++S+ DR+T F  M+ +AL
  S:     1 MTIHIGAEPGDIAKTVLMPGDPMRAQWAARTFLDSPRQINAVRGMLGYTGTWRGQPVTIHGSGMGMPSLSIYANELLRDFGVTTLMRIGSCGGMQPHVGLRDVILAMTASSISTPSSSLMRELRFAPCADWGLLRAAAH-AAETRGITPHIGGIYSSDTFYDERPDLNDQMTRHGTLAVEMETAELYTLASRYGARALSVLTVSDHLLTGDAVSSADRETGFSAMVEIAL 229
>gi|22537336|ref|NP_688187.1| purine nucleoside phosphorylase [Streptococcus agalactiae 2603V/R] >gi|25011300|ref|NP_735695.1| purine nucleoside phosphorylase [Streptococcus agalactiae NEM316] >gi|76787784|ref|YP_329878.1| purine nucleoside phosphorylase [Streptococcus agalactiae A909] >gi|76798516|ref|ZP_00780751.1| purine nucleoside phosphorylase [Streptococcus agalactiae 18RS21] >gi|77412247|ref|ZP_00788565.1| purine nucleoside phosphorylase [Streptococcus agalactiae CJB111] >gi|77412805|ref|ZP_00789010.1| purine nucleoside phosphorylase [Streptococcus agalactiae 515] >gi|22534207|gb|AAN00060.1|AE014245_18 purine nucleoside phosphorylase [Streptococcus agalactiae 2603V/R] >gi|23095724|emb|CAD46910.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562841|gb|ABA45425.1| purine nucleoside phosphorylase [Streptococcus agalactiae A909] >gi|76586145|gb|EAO62668.1| purine nucleoside phosphorylase [Streptococcus agalactiae 18RS21] >gi|77161101|gb|EAO72207.1| purine nucleoside phosphorylase [Streptococcus agalactiae 515] >gi|77161716|gb|EAO72709.1| purine nucleoside phosphorylase [Streptococcus agalactiae CJB111] (236 aa)
Score = 367, Expect = 2.0e-33, Identities = 97/233 (41%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   DI+V +LVL + A + S   +    E  D       +L D     A E +I      V SSD+FY                 +EME+ +L+  A + N  A  ++T SD+L    E  SAE+RQT F +M+ + L+ +
  S:     1 MSIHIEAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNTVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAINPDIHVRELVLAQAAATNSNIIRNDWPEF-DFPQIADFKLLDKAYHIAKEMDITTHVGSVLSSDVFYSNQPDRNMALGKLGVHAIEMEAAALYYLAAQHNVNALAMMTISDNLNNPEEDTSAEERQTTFTDMMKVGLETL 233
>gi|28899207|ref|NP_798812.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|153838318|ref|ZP_01990985.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus AQ3810] >gi|81727023|sp|Q87M25|DEOD1_VIBPA Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|28807431|dbj|BAC60696.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|149748307|gb|EDM59166.1| purine nucleoside phosphorylase [Vibrio parahaemolyticus AQ3810] (239 aa)
Score = 367, Expect = 2.1e-33, Identities = 88/232 (37%), Positives = 130/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G  A VVLMPGDPLRAK+IAE FLE+   + DVR M GYTG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+  +DI V D+V+   A ++S   + I  +  D       ++       A    I +    + S+++FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  ++++RQT F +M+ +AL  V
  S:     3 TPHINAEMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMFGYTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYKMVRAAEDAAKARGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMLIALDSV 233
>gi|194539576|ref|YP_002074624.1| purine nucleoside phosphorylase [Vibrio sp. Ex25] >gi|151938131|gb|EDN56972.1| purine nucleoside phosphorylase [Vibrio sp. Ex25] (239 aa)
Score = 366, Expect = 2.3e-33, Identities = 88/232 (37%), Positives = 130/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G  A VVLMPGDPLRAK+IAE FLE+   + DVR M GYTG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+  +DI V D+V+   A ++S   + I  +  D       ++       A    I +    + S+++FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  ++++RQT F +M+ +AL  V
  S:     3 TPHINAEMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMFGYTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYKMVRAAEDAAKARGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMLIALDSV 233
>gi|69248156|ref|ZP_00604645.1| Purine nucleoside phosphorylase [Enterococcus faecium DO] >gi|68194522|gb|EAN09017.1| Purine nucleoside phosphorylase [Enterococcus faecium DO] (235 aa)
Score = 366, Expect = 2.3e-33, Identities = 91/231 (39%), Positives = 134/231 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AK+GEIA  +L+PGDPLRAK+IAE FLE+P   N VRGMLG+TG Y  + ++V G GMGM S  IY++EL   Y V  +IRVG+ G+ +KD++V DLVL + A   +T +  I    +        + N +++   I      T  V  V S D FY  + +     ++     VEME+ +L+    K + +  +L+T SD L+T E  +A +RQ+ F  MI + L+
  S:     1 MSVHIEAKEGEIADKILLPGDPLRAKYIAETFLEDPVCYNQVRGMLGFTGKYKGERISVQGTGMGMPSATIYAHELIQSYGVKKLIRVGTCGALSKDVHVRDLVLAQGA---ATSSSMIEKNFQAFHFPPISDFNLLLKAYEIAKEKGYTVHVGNVLSEDSFYKDDLTETFQLAELGVLGVEMEAAALYYLGAKYHVQTLSLMTVSDHLITGEETTAAERQSTFNEMIEVGLE 230
>gi|119774113|ref|YP_926853.1| purine nucleoside phosphorylase [Shewanella amazonensis SB2B] >gi|167012097|sp|A1S477|DEOD_SHEAM Purine nucleoside phosphorylase deoD-type (PNP) >gi|119766613|gb|ABL99183.1| purine nucleoside phosphorylase [Shewanella amazonensis SB2B] (236 aa)
Score = 366, Expect = 2.4e-33, Identities = 84/229 (36%), Positives = 131/229 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A +G  A+ VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y  K ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D        L   + ++A  + I+     V S+D+FY  +  +  +        VEME+  L+  A +   +A  ++T SD + T E  ++++RQT F +MI + L
  S:     3 TPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNR-LRFKGQDFAAIADYSLLSAVVESAKTHGIQTRVGNVFSADLFYTPDPEMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSDERQTTFNDMIIMTL 230
>gi|77407812|ref|ZP_00784565.1| purine nucleoside phosphorylase [Streptococcus agalactiae COH1] >gi|77173559|gb|EAO76675.1| purine nucleoside phosphorylase [Streptococcus agalactiae COH1] (236 aa)
Score = 366, Expect = 2.6e-33, Identities = 96/233 (41%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N VR M GYTG Y    V++MG GMGM SI IY+ EL   Y V  +IRVG+AG+   DI+V +LVL + A + S   +    E  D       +L D     A E +I      V SSD+FY                 +EME+ +L+  A + N  A  ++T SD+L    E  SAE+RQT F +M+ + L+ +
  S:     1 MSIHIEAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNTVRNMFGYTGTYKGHRVSIMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAINPDIHVRELVLAQAAATNSNIIRNDWPEF-DFPQIADFKLLDKAYHIAKEMDITTHVGSVLSSDVFYSNQPDRNMALGKLGVHAIEMEAAALYYLAAQHNVNALAMMTISDNLNNPEEDTSAEERQTTFTDMMKVGLETL 233
>gi|127513740|ref|YP_001094937.1| purine nucleoside phosphorylase [Shewanella loihica PV-4] >gi|167013048|sp|A3QGT0|DEOD_SHELP Purine nucleoside phosphorylase deoD-type (PNP) >gi|126639035|gb|ABO24678.1| purine nucleoside phosphorylase [Shewanella loihica PV-4] (236 aa)
Score = 366, Expect = 2.7e-33, Identities = 87/230 (37%), Positives = 126/230 (54%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A  G  A  VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y    ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D        L   + K A E   K     V S+D+FY  +  +  +        VEME+  L+  A +   KA  ++T SD + T E  S+++RQT F  MI + L+
  S:     3 TPHINAVDGAFADTVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGVRISVMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNR-LRFKGQDFAAICDYSLLSAVVKAAEEKGTKYRVGNVFSADLFYTPDPEMFDVMEKMDVLGVEMEAAGLYGVAKEFGAKALCVVTVSDHIRTGEKTSSDERQTTFNEMIEMTLE 231
>gi|126740497|ref|ZP_01756184.1| purine nucleoside phosphorylase [Roseobacter sp. SK209-2-6] >gi|126718298|gb|EBA15013.1| purine nucleoside phosphorylase [Roseobacter sp. SK209-2-6] (234 aa)
Score = 366, Expect = 2.8e-33, Identities = 84/231 (36%), Positives = 130/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELN-DVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+ G+IA+ VLMPGDP RAKW AENFL++ +L+N+VRGMLGYTG +N   VT+ G GMGM S+ IY+ EL   +    +IR+GS G     + + D++L   A +  + ++ I  E   + +     L          E N+ +    ++SSD+FY     + +         VEME+  L+  A +   +A  +LT SD L T E++ ++ R+  F +M+ +AL+
  S:     1 MTVHIGAESGDIAETVLMPGDPYRAKWAAENFLQDARLVNEVRGMLGYTGTWNGNPVTIQGSGMGMPSLSIYANELIRDFGAKTLIRIGSCGGMQPQVKLRDVILAMSASTLGSPSRGIFRELNFAPVADWGLLQAAAKAAEKHEANLHVGG--IYSSDVFYDERPDLNEQMVRHGILGVEMEAAELYTLAARHGCRALAVLTVSDHLGTGEALPSDQRERSFGDMVEIALE 230
>gi|77405898|ref|ZP_00782979.1| purine nucleoside phosphorylase [Streptococcus agalactiae H36B] >gi|77175472|gb|EAO78260.1| purine nucleoside phosphorylase [Streptococcus agalactiae H36B] (236 aa)
Score = 365, Expect = 3.0e-33, Identities = 97/233 (41%), Positives = 130/233 (55%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   DI+V +LVL + A + S   +    E  D       +L D     A E +I      V SSD+FY                 +EME+ +L+  A + N  A  ++T SD+L    E  SAE+RQT F +M+ + L+ +
  S:     1 MSIHIEAKQGEIADKILLPGDPLRAKFIAENFLEDVVCFNTVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAINPDIHVRELVLAQAAATNSNIIRNDWPEF-DFPQIADFKLLDKAYHIAKEMDITTHVGSVLSSDVFYSNQPDRNMALGKLGVHAIEMEAAALYYLAAQHNVNALAMMTISDNLNNPEEDTSAEERQTTFTDMMKVGLETL 233
>gi|90580402|ref|ZP_01236208.1| purine nucleoside phosphorylase [Vibrio angustum S14] >gi|90438311|gb|EAS63496.1| purine nucleoside phosphorylase [Vibrio angustum S14] (235 aa)
Score = 365, Expect = 3.1e-33, Identities = 85/235 (36%), Positives = 133/235 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           MT H      + A  V+MPGDPLRAK+IAE +LE+ KL+ D+R MLGYTGYY  + ++VMGHGMG+ S+ +Y +EL   + V  IIR+GS G+  KD+++ D++L + A ++S          + +T    D L++    +A E  I +    + + D++Y  +  +           V+ME   L+  A +   ++  +LT SD  +T E  +AE+RQ  F NMI +AL+   K
  S:     1 MTAHIAGTAKDFASTVIMPGDPLRAKYIAETYLEDAKLVTDIRNMLGYTGYYKGQRISVMGHGMGIPSMVLYGHELINDFGVKRIIRIGSIGATQKDVHMRDVILAQAAGTDSPTNAKRSSGYQMATSATFDLLHNAY-MSAKEKGIDVKVGNIFTGDLYYDPDEDLISALERFGVLGVDMEVAGLYGLAHQFGIESLAILTVSDHCITGEETTAEERQLSFNNMIEIALETAIK 234
>gi|91228292|ref|ZP_01262228.1| purine nucleoside phosphorylase [Vibrio alginolyticus 12G01] >gi|91188169|gb|EAS74471.1| purine nucleoside phosphorylase [Vibrio alginolyticus 12G01] (239 aa)
Score = 365, Expect = 3.4e-33, Identities = 88/232 (37%), Positives = 129/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G  A VVLMPGDPLRAK+IAE FLE+   + DVR M GYTG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+  +DI V D+V+   A ++S   + I  +  D        +       A    I +    + S+++FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  ++++RQT F +M+ +AL  V
  S:     3 TPHINAEMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMFGYTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYNMVRAAEDAAKARGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMLIALDSV 233
>gi|15645792|ref|NP_207969.1| purine-nucleoside phosphorylase (deoD) [Helicobacter pylori 26695] >gi|3023633|sp|P56463|DEOD_HELPY Purine nucleoside phosphorylase deoD-type (PNP) >gi|2314335|gb|AAD08222.1| purine-nucleoside phosphorylase (deoD) [Helicobacter pylori 26695] (233 aa)
Score = 364, Expect = 3.8e-33, Identities = 84/233 (36%), Positives = 132/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  AK G+     L+ GDPLR  +IA+ FL++ K I +VR MLG++G Y  + +++MGHGMG+AS  IY  EL   Y V  ++R+G+ G+ +  + + D+++   A ++S   + +     D +     EL+    +TA    I L    V SSD FY        + +      +EME+  L+A A++LN KA  L + SD L+T E++S ++R   F NMI LAL+++
  S:     1 MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGRGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNR-VRFLNHDLSATPDFELSLRAYQTAKRLGIDLKVGNVFSSDFFYSFETHAFDLMAKYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERVESFDNMIILALEMM 232
>gi|157963596|ref|YP_001503630.1| purine nucleoside phosphorylase [Shewanella pealeana ATCC 700345] >gi|157848596|gb|ABV89095.1| purine nucleoside phosphorylase [Shewanella pealeana ATCC 700345] (234 aa)
Score = 364, Expect = 4.7e-33, Identities = 91/231 (39%), Positives = 138/231 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAK-YIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H   K G+ A+ ++MPGDPLRAK+IAENFLE+   + ++R MLGYTG+Y  + ++VMGHGMG+ S+ +Y++EL A + V  IIRVGS G+   D+ + D++L + A ++S T AK   G + A  +T +   +   + +K  I  N+K+ +V   S D++Y  +  +           V+ME   L+  A     ++  +LT SD  +T E  SAE RQ  F  MI LAL+
  S:     1 MTAHISGKAGDFAETIIMPGDPLRAKYIAENFLEDAVEVTNIRNMLGYTGFYKGQRISVMGHGMGIPSMVLYAHELVADFGVKRIIRVGSLGATQHDVKINDVILAQAAGTDSPTNAKRSSGYQMATSATFDLLHKAYMIAQKKQI--NVKVGNVF--SGDMYYDPDEDMIPALERFGVLGVDMEVAGLYGLAHHKGFESLAILTVSDHCLTGEETSAEARQLTFNQMIELALE 230
>gi|148976685|ref|ZP_01813372.1| purine nucleoside phosphorylase [Vibrionales bacterium SWAT-3] >gi|145964036|gb|EDK29294.1| purine nucleoside phosphorylase [Vibrionales bacterium SWAT-3] (240 aa)
Score = 364, Expect = 4.7e-33, Identities = 90/232 (38%), Positives = 132/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G  A VVLMPGDPLRAK+IAE FL+    + DVR M GYTG Y  ++V+VMGHGMG+ S  IY+ EL   + V  IIRVGS G+ ++DI V D+V+   A ++S   +   I  K        + N ++R        +  DV V    S+++FY  +  + ++        VEME+  ++    +   KA T+ T SD + T E  ++++RQT F +M+ +AL  V
  S:     3 TPHINAEMGAFADVVLMPGDPLRAKYIAETFLDEVVQVCDVRNMFGYTGTYKGRKVSVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVSEDIKVRDVVIGMGACTDSKVNR---IRFKGHDFAAIADYN-MVRAAEDAAKARGVDVKVGNLFSAELFYTPDPEMFEVMDKYGIVGVEMEAAGIYGVCAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMVIALDSV 233
>gi|109947007|ref|YP_664235.1| hypothetical protein Hac_0400 [Helicobacter acinonychis str. Sheeba] >gi|109714228|emb|CAJ99236.1| deoD [Helicobacter acinonychis str. Sheeba] (233 aa)
Score = 363, Expect = 5.0e-33, Identities = 83/233 (35%), Positives = 134/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  AK G+     ++ GDPLR  +IA+NFL++ + I +VR MLG++G Y  KE+++MGHGMG+AS  IY  EL   Y V  ++R+G+ G+ +  + + D+++   A ++S   + I     D +     EL+    +TA    I L    + +SD FY        + +      +EME+  L+A A++L+ KA  L + SD L+T E++S ++R   F NMI LAL+++
  S:     1 MTPHINAKIGDFHPQCILCGDPLRVSYIAKNFLQDAREITNVRNMLGFSGKYKGKEISLMGHGMGIASCTIYVTELVKTYQVKELLRIGTCGAISPKVGLRDIIMVTGASTDSKTNR-IRFLNHDLSATPDFELSLRAYQTAKRLEIDLKVGNIFTSDFFYSFETHAFDLLAKYNHLGIEMEAAGLYATAMELSAKALCLCSVSDHLITKEALSPKERIESFNNMIILALEMM 232
>gi|170727879|ref|YP_001761905.1| purine nucleoside phosphorylase [Shewanella woodyi ATCC 51908] >gi|169813226|gb|ACA87810.1| purine nucleoside phosphorylase [Shewanella woodyi ATCC 51908] (236 aa)
Score = 363, Expect = 5.8e-33, Identities = 86/229 (37%), Positives = 124/229 (54%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           TPH  A  G  A+ VL PGDPLRAK+IAE FLEN + + DVR M GYTG Y    ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +  + +D        L   + K A     K     V S+D+FY  +  +  +        VEME+  L+  A +   KA  ++T SD + T E  S+++RQT F  MI + L
  S:     3 TPHINAADGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMFGYTGTYKGTRISVMGSGMGIPSASIYATELIKDYGVKNLIRVGTCGAVSTDVKVRDVLIGMGACTDSQVNR-LRFKGQDFAAIADYSLLSAVVKAADAKGTKYRVGNVFSADLFYTPDPEMFDVMEKMNILGVEMEAAGLYGVAAEFGAKALCVVTVSDHIRTGEKTSSDERQTTFNEMIEMTL 230
>gi|90581528|ref|ZP_01237321.1| purine nucleoside phosphorylase [Vibrio angustum S14] >gi|90437290|gb|EAS62488.1| purine nucleoside phosphorylase [Vibrio angustum S14] (240 aa)
Score = 363, Expect = 5.9e-33, Identities = 87/232 (37%), Positives = 128/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+ K + +VR MLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   + I     D        +       A    I +    + S+D+FY  +    +         VEME+  ++  A +   KA T+ T SD ++  E+ ++E+RQ  F  MI +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAKEVCNVRSMLGFTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVRDDVKLRDVVIGMGASTDSKVNR-IRFGGHDFAAIADFGMVQNAVDAAKAKGIPVKVGNIFSADLFYNPDFEFFKTMDKYGIVGVEMEAAGIYGVAAEFGAKALTICTVSDHILRGEATTSEERQLTFNEMIEIALDSV 233
>gi|125718078|ref|YP_001035211.1| purine nucleoside phosphorylase [Streptococcus sanguinis SK36] >gi|125497995|gb|ABN44661.1| Purine nucleoside phosphorylase, family 1, putative [Streptococcus sanguinis SK36] (264 aa)
Score = 362, Expect = 6.9e-33, Identities = 97/233 (41%), Positives = 140/233 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS   D++V +LVL + A + S   +    +     +   D L+   +   I   + +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A + +  A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:    26 MSIHIAAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGQCVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNADVHVRELVLAQAAATNSNIIRNDWPQYDFPQIASFDLLD---KAYHIAKGLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQHHVDALAIMTISDSLVNPEEDTTAEERQNTFTDMMKVGLETL 258
>gi|27365088|ref|NP_760616.1| purine nucleoside phosphorylase [Vibrio vulnificus CMCP6] >gi|161486607|ref|NP_935469.2| purine nucleoside phosphorylase [Vibrio vulnificus YJ016] >gi|85540975|sp|Q7MI41|DEOD1_VIBVY Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|81587827|sp|Q8DBS9|DEOD1_VIBVU Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|27361234|gb|AAO10143.1|AE016802_186 Purine-nucleoside phosphorylase [Vibrio vulnificus CMCP6] (239 aa)
Score = 362, Expect = 7.3e-33, Identities = 89/232 (38%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+   + DVR M G+TG Y  ++V+VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+ + DI V D+V+   A ++S   + I  +  D       ++     + A    I +    + S+++FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  ++E+RQ  F +M+ +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGRKVSVMGHGMGIPSCSIYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSEERQNTFNDMMIVALDSV 233
>gi|108563542|ref|YP_627858.1| purine-nucleoside phosphorylase [Helicobacter pylori HPAG1] >gi|122980463|sp|Q1CS88|DEOD_HELPH Purine nucleoside phosphorylase deoD-type (PNP) >gi|107837315|gb|ABF85184.1| purine-nucleoside phosphorylase [Helicobacter pylori HPAG1] (233 aa)
Score = 362, Expect = 7.9e-33, Identities = 84/233 (36%), Positives = 132/233 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           MTPH  AK G+     L+ GDPLR  +IA+ FL++ K I +VR MLG++G Y  K +++MGHGMG+AS  IY  EL   Y V  ++R+G+ G+ +  + + D+++   A ++S   + +     D +     EL+    +TA    I L    V SSD FY        + +      +EME+  L+A A++L+ KA  L + SD L+T E++S ++R   F NMI LAL+++
  S:     1 MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAMGASTDSKTNR-VRFLNHDLSATPDFELSLRAYQTAKRLGIDLKVGNVFSSDFFYSFETHAFDLMAQYNHLAIEMEAAGLYATAMELSAKALCLCSVSDHLITKEALSPKERVESFDNMIILALEMM 232
>gi|37199609|dbj|BAC95440.1| purine-nucleoside phosphorylase [Vibrio vulnificus YJ016] (254 aa)
Score = 361, Expect = 8.7e-33, Identities = 89/232 (38%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FLE+   + DVR M G+TG Y  ++V+VMGHGMG+ S  IY+ EL   Y V  IIRVGS G+ + DI V D+V+   A ++S   + I  +  D       ++     + A    I +    + S+++FY  +  +  +        VEME+  ++  A +   KA T+ T SD + T E  ++E+RQ  F +M+ +AL  V
  S:    18 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGRKVSVMGHGMGIPSCSIYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNR-IRFKGHDFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSEERQNTFNDMMIVALDSV 248
>gi|55821125|ref|YP_139567.1| purine nucleoside phosphorylase [Streptococcus thermophilus LMG 18311] >gi|55737110|gb|AAV60752.1| purine nucleoside phosphorylase (family 1) [Streptococcus thermophilus LMG 18311] (236 aa)
Score = 361, Expect = 9.4e-33, Identities = 93/233 (39%), Positives = 134/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+G+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + ++VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGIYKGERISVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMETAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|139473942|ref|YP_001128658.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes str. Manfredo] >gi|134272189|emb|CAM30435.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes str. Manfredo] (237 aa)
Score = 361, Expect = 1.0e-32, Identities = 91/233 (39%), Positives = 137/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKG+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY               + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ + L+ +
  S:     1 MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMGVTTHVG----NVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLATQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKIGLETL 233
>gi|90411527|ref|ZP_01219537.1| purine nucleoside phosphorylase [Photobacterium profundum 3TCK] >gi|90327417|gb|EAS43770.1| purine nucleoside phosphorylase [Photobacterium profundum 3TCK] (234 aa)
Score = 360, Expect = 1.1e-32, Identities = 88/235 (37%), Positives = 136/235 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           MT H   K  + A  V+MPGDPLRAK+IAE +LE+ K + D+R MLG+TGYY    V+VMGHGMG+ S+ +Y +EL   + V  IIR+GS G+  KD+++ D++L + A ++S            +T    D L+      A +N + +    + + D++Y  +  +E I++  K  V  V+ME   L+  A +   +A  +LT SD  +T E  +AE+RQ  F +MI +AL+   K
  S:     1 MTAHINGKPEDFADTVIMPGDPLRAKYIAETYLEDVKQVTDIRNMLGFTGYYKGHRVSVMGHGMGIPSMVLYGHELIHDFGVKRIIRIGSIGATQKDVHMRDVILAQAAGTDSPTNAKRSSGYHMATSATFDLLHHAY-TVAQQNQVDVKVGNIFTGDLYYDPD--MEMISALEKFGVLGVDMEVAGLYGLAHQFGIEALGILTVSDHCITGEETTAEERQLSFNHMIEIALETAIK 234
>gi|89072595|ref|ZP_01159167.1| purine nucleoside phosphorylase [Photobacterium sp. SKA34] >gi|89051699|gb|EAR57152.1| purine nucleoside phosphorylase [Photobacterium sp. SKA34] (240 aa)
Score = 360, Expect = 1.4e-32, Identities = 86/232 (37%), Positives = 128/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ K + +VR MLG+TG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   + I     D        +       A    I +    + S+D+FY  +    +         VEME+  ++  A +   KA T+ T SD ++  E+ ++E+RQ  F  MI +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLDDAKEVCNVRSMLGFTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVRDDVKLRDVVIGMGASTDSKVNR-IRFGGHDFAAIADFGMVQNAVDAAKAKGIPVKVGNIFSADLFYNPDFEFFKTMDKYGIVGVEMEAAGIYGVAAEFGAKALTICTVSDHILRGEATTSEERQLTFNEMIEIALDSV 233
>gi|115378983|ref|ZP_01466115.1| purine nucleoside phosphorylase [Stigmatella aurantiaca DW4/3-1] >gi|115364022|gb|EAU63125.1| purine nucleoside phosphorylase [Stigmatella aurantiaca DW4/3-1] (223 aa)
Score = 358, Expect = 2.0e-32, Identities = 86/215 (40%), Positives = 120/215 (55%)
  Q:    27 MPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKT-AIENNIKLTDV-VVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           MPGDPLRA++IAE FL  PK I  VR M GYTG +  ++++VMGHGMG+ S+ IY+ EL   Y   V+IRVGS G+  +D+ V  +++   A+   T +K   +   D       +   V R   A E   ++  V  V S+D+FY    S+  +        +EME   L+  A +   +A  LLT SD L T E +S+E+RQT F  MI LAL V
  S:     1 MPGDPLRARYIAERFLTQPKQITSVRNMYGYTGTFQGRKLSVMGHGMGIPSLSIYATELIKEYGARVLIRVGSCGAIRRDVPVRSVII---AHGAGTDSKVNRMRLLDHDFPAVADFGLVRRAVEAAERRSRVARVGSVFSTDLFYHPQGSLLDVLERMGLLAIEMEVAGLYGVAAEHGARALGLLTVSDQLRTGEVLSSEERQTSFDEMIELALDV 214
>gi|92112956|ref|YP_572884.1| purine-nucleoside phosphorylase [Chromohalobacter salexigens DSM 3043] >gi|91796046|gb|ABE58185.1| purine-nucleoside phosphorylase [Chromohalobacter salexigens DSM 3043] (243 aa)
Score = 358, Expect = 2.1e-32, Identities = 85/230 (36%), Positives = 133/230 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSD--ELND--VIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A  G  A  VLMPGDPLRA++IAE FLE+ + +N VR MLG+TG Y  + ++VMG GMG+ S+ IY+ EL   Y V  ++RVGS G+   D+ V D+V+   A ++S   +        +  +G D   + D  + R T    + + T V V    S+D+FY  + ++ ++        VEME+  L+    +   +A T+ T SD ++  E++ A+ RQT F +M+ + L+
  S:     3 TPHIDAPAGAFADTVLMPGDPLRAQFIAETFLEDVECVNRVRNMLGFTGTYRGRRLSVMGSGMGIPSLSIYAKELITDYGVKRLVRVGSCGAVRDDVAVNDIVVGMGACTDSGVNR--------ARFKGHDFAAIADYALTRHTVDAASARGTPVKVGNLFSADLFYSPDEAMFEVMKRHGVLGVEMEAAGLYGVCAEFGARALTVCTVSDHILKGEALDAQTRQTGFHDMMAITLE 231
>gi|71903344|ref|YP_280147.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS6180] >gi|71802439|gb|AAX71792.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS6180] (256 aa)
Score = 358, Expect = 2.2e-32, Identities = 92/233 (39%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKG+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY               + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ +AL+ +
  S:    20 MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGRRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMGVTTHVG----NVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLAAQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKVALETL 252
>gi|116334174|ref|YP_795701.1| purine-nucleoside phosphorylase [Lactobacillus brevis ATCC 367] >gi|116099521|gb|ABJ64670.1| purine-nucleoside phosphorylase [Lactobacillus brevis ATCC 367] (235 aa)
Score = 358, Expect = 2.2e-32, Identities = 94/235 (40%), Positives = 133/235 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYI---GIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           M+ H  AK G+IA  VL+PGDPLRAK+IAE FLENP   N VR   GYTG Y  K ++V G GMG+ SI IY+ EL + Y V  + RVG++G  + D++V D+VL + A ++S+        GI     +  G   L D     A +  I +    V + D FY      +++  D      EMES +LF  A K + +A ++LT S+ L+T ES + E+R+  F +MI +AL    K
  S:     1 MSNHLEAKMGDIADTVLLPGDPLRAKYIAETFLENPVCYNTVRNAFGYTGTYKGKRISVQGTGMGIPSISIYTNELISEYGVKTLFRVGTSGGMSPDVHVRDVVLAQAASTDSSIIHNTFGGGIYYAAISDFG---LLDTAYHVAQDLKISVRVGNVLAEDRFYNDEMDRQKLV-DYGVIATEMESTALFMLAAKYHVRALSVLTISNHLMTGESTTPEEREKSFNDMIRVALDTAAK 234
>gi|11595686|emb|CAC18350.1| putative purine-nucleotide phosphorylase [Streptococcus salivarius] >gi|12054920|emb|CAC21185.1| putative purine-nucleoside phosphorylase [Streptococcus thermophilus] (236 aa)
Score = 358, Expect = 2.3e-32, Identities = 98/233 (42%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|54307836|ref|YP_128856.1| purine nucleoside phosphorylase [Photobacterium profundum SS9] >gi|90412506|ref|ZP_01220509.1| purine nucleoside phosphorylase [Photobacterium profundum 3TCK] >gi|81615574|sp|Q6LUH1|DEOD1_PHOPR Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|46912259|emb|CAG19054.1| putative purine nucleoside phosphorylase [Photobacterium profundum SS9] >gi|90326543|gb|EAS42949.1| purine nucleoside phosphorylase [Photobacterium profundum 3TCK] (241 aa)
Score = 357, Expect = 3.1e-32, Identities = 85/232 (36%), Positives = 128/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IAE FL++ K + +VR M GYTG Y  ++++VMGHGMG+ S  IY+ EL   + V  IIRVGS G+   D+ + D+V+   A ++S   + I     D        +       A    I +    + S+D+FY  +    +         VEME+  ++  A +   KA T+ T SD ++  E+ ++E+RQ  F  M+ +AL+ V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLQDVKEVCNVRSMFGYTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVRDDVKLRDVVIGMGASTDSKVNR-IRFGGHDFAAIADFGMVQNAVDAAKAKGIPVKVGNIFSADLFYNPDFEFFKTMDKYGIVGVEMEAAGIYGVAAEFGAKALTICTVSDHILRGEATTSEERQLTFNEMMEIALESV 233
>gi|153833393|ref|ZP_01986060.1| purine nucleoside phosphorylase [Vibrio harveyi HY01] >gi|148870281|gb|EDL69211.1| purine nucleoside phosphorylase [Vibrio harveyi HY01] (235 aa)
Score = 356, Expect = 3.6e-32, Identities = 85/235 (36%), Positives = 132/235 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEK 244
           MT H      + A  V+MPGDPLRAK+IAE +L++ KL+ D+R MLGYTGYY  + ++VMGHGMG+ S+ +Y +EL   + V  IIR+GS G+  KD+++ D++L + A ++S T AK             + EL      +A +  I +    + + D++Y  +  +           V+ME   L+  A +   ++  +LT SD  +T E  +AE+RQ  F NMI +AL+   K
  S:     1 MTAHIAGSAEDFASTVIMPGDPLRAKYIAETYLDDAKLVTDIRNMLGYTGYYKGQRISVMGHGMGIPSMVLYGHELINDFGVKRIIRIGSIGATQKDVHMRDVILAQAAGTDSPTNAKR--SSGYHMATSATFELLHNAYMSAKDKGIDVKVGNIFTGDLYYDPDEDMIPALERFGVLGVDMEVAGLYGLAHQFGIESLAILTVSDHCITGEETTAEERQLSFNNMIEIALETAIK 234
>gi|157962863|ref|YP_001502897.1| purine nucleoside phosphorylase [Shewanella pealeana ATCC 700345] >gi|157847863|gb|ABV88362.1| purine nucleoside phosphorylase [Shewanella pealeana ATCC 700345] (236 aa)
Score = 356, Expect = 4.0e-32, Identities = 85/230 (36%), Positives = 124/230 (53%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  A  G     VL PGDPLRAK+IAE FLEN + + DVR MLG+TG Y    ++VMG GMG+ S  IY+ EL   Y V  +IRVG+ G+ + D+ V D+++   A ++S   + +    +D        L   + K A    IK     V S+D+FY  +  +  +        VEME+  L+  A +   KA  ++T SD + T E  ++++RQT F  MI + L+
  S:     3 TPHINAVDGAFGDTVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGVRISVMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQTNR-LRFRGQDFAAICDYGLLSAVVKAADVKGIKYRVGNVFSADLFYTPDPEMFDVMEKMDVLGVEMEAAGLYGVAKEFGAKALCVVTVSDHIRTGEKTTSDERQTTFNEMIEMTLE 231
>gi|21672786|ref|NP_660853.1| purine nucleoside phosphorylase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25008362|sp|Q8K937|DEOD_BUCAP Purine nucleoside phosphorylase deoD-type (PNP) >gi|21623434|gb|AAM68064.1| purine nucleoside phosphorylase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (236 aa)
Score = 353, Expect = 7.8e-32, Identities = 83/225 (36%), Positives = 133/225 (59%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMI 235
           T H +++K   + +VLMPGDP+RAK+IAEN+L NP  IND R ML YTGYY NK+++VM HGMG+ S  +Y  EL   Y+V  IIRVG+ G+   +I + D+V++  A ++S   + I     D       E+      TA + N K+      ++D FY  +  + +I        ++ME+  ++A A +L  +A ++ T SD ++  +++S++DR++ F NMI
  S:     3 TLHIKSEKNAFSNIVLMPGDPVRAKYIAENYLANPVQINDTRLMLAYTGYYKNKKISVMSHGMGIPSASLYVRELILEYNVKKIIRVGTCGTIQNNIKLRDIVISMGASTDSKINR-IRFNNHDYAAIADFEMIFHAFSTAKKMNFKVHIGNFFTTDSFYTESEDMLKILKKYNIIGIDMETAGIYAVAAELKAQALSICTVSDHIIKKDAVSSKDRESSFHNMI 226
>gi|145299937|ref|YP_001142778.1| purine nucleoside phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852709|gb|ABO91030.1| purine nucleoside phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] (233 aa)
Score = 353, Expect = 8.0e-32, Identities = 85/230 (36%), Positives = 134/230 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAK-----YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  A  G+ A+ V+MPGDPLRA++IAE FL + + + +VR MLGYTGYYN + ++VMGHGMG+ S+ +Y++EL   + V  IIR+GS G+  + + + D++L + A ++S T AK      +   A  S L  +  +       A E +I +    + + D++Y  + ++           ++ME   L+  A +   +A  +LT SD  +T E  +AE+RQ  F  MI LAL
  S:     1 MTAHINANPGDFAETVIMPGDPLRARYIAETFLTDAREVTNVRNMLGYTGYYNGQRISVMGHGMGIPSMVLYAHELVNDFGVKRIIRIGSLGATQRHVQMRDVILAQAAGTDSPTNAKRSAGYQMATSADFSLLHKAFTM-------AQEKSIPVKVGNIFTGDLYYDPDENLIPALEKFGVLGIDMEVAGLYGLAHQQGIEALAILTVSDHCLTGEETTAEERQLSFNQMIELAL 229
>gi|117618562|ref|YP_857514.1| purine nucleoside phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559969|gb|ABK36917.1| purine nucleoside phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (233 aa)
Score = 353, Expect = 9.0e-32, Identities = 82/230 (35%), Positives = 130/230 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  A  G+ A+ V+MPGDPLRA++IAE FL + + + +VR MLGYTGYYN + ++VMGHGMG+ S+ +Y++EL   + V  IIR+GS G+  + + + D++L + A ++S          + +T      L+    K A E  I +    + + D++Y  + ++           ++ME   L+  A +   +A  +LT SD  +T E  +AE+RQ  F  MI LAL
  S:     1 MTAHINANPGDFAETVIMPGDPLRARYIAETFLTDAREVTNVRNMLGYTGYYNGQRISVMGHGMGIPSMVLYAHELVNDFGVKRIIRIGSLGATQRHVQMRDVILAQAAGTDSPTNAKRSAGYQMATSADFALLHKAFTK-AQEKAIPVKVGNIFTGDLYYDPDENLIPALEKFGVLGIDMEVAGLYGLAHQQGIEALAILTVSDHCLTGEETTAEERQLSFNQMIELAL 229
>gi|124491658|gb|ABN13115.1| purine nucleoside phosphorylase [Pseudoalteromonas sp. i590] (233 aa)
Score = 353, Expect = 9.3e-32, Identities = 82/232 (35%), Positives = 129/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-------YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A  G+ A+ VLMPGDPLRA++IAENFL++   +  VR M G+TG Y  K V++MG GMG+ S+ IY+ EL   + V  IIR+G+ G    DI + D++  + A ++S   +       +  I   D  L G +   ++  K  + N        V ++D FY A+ +  +         V+ME+  L+  A +    A  L T SD ++T E+  A++RQ+ F  M+ +AL+ +
  S:     3 TPHINANVGDFAETVLMPGDPLRAQYIAENFLDDAVQVTGVRNMFGFTGTYKGKPVSIMGSGMGIPSMSIYARELIVSFGVKNIIRIGTCGGIGTDIKIRDVIFAQGASTDSNVNRARVRGYDFSAIADFDLLLNGVNAAKELGIKAKVGN--------VFTTDTFYQADDTFYKDLDKLGVLAVDMETAGLYGVAAEYGANAMALFTVSDHVITGEATPADERQSTFNEMVKIALESI 233
>gi|94994187|ref|YP_602285.1| Purine nucleoside phosphorylase [Streptococcus pyogenes MGAS10750] >gi|94547695|gb|ABF37741.1| Purine nucleoside phosphorylase [Streptococcus pyogenes MGAS10750] (237 aa)
Score = 352, Expect = 1.1e-31, Identities = 91/233 (39%), Positives = 138/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKG+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY        +      + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ + L+ +
  S:     1 MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMGVTTHVG----NVLSSDVFYTNMPERNMVLGKLGVKAIEMEAAALYYLAAQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKIGLETL 233
>gi|119472733|ref|ZP_01614687.1| Purine nucleoside phosphorylase [Alteromonadales bacterium TW-7] >gi|119444758|gb|EAW26062.1| Purine nucleoside phosphorylase [Alteromonadales bacterium TW-7] (233 aa)
Score = 352, Expect = 1.1e-31, Identities = 82/232 (35%), Positives = 129/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-------YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A  G+ A+ VLMPGDPLRA++IAENFL++   +  VR M G+TG Y  K V++MG GMG+ S+ IY+ EL   + V  IIR+G+ G    DI + D++  + A ++S   +       +  I   D  L G +   ++  K  + N        V ++D FY A+ +  +         V+ME+  L+  A +    A  L T SD ++T E+  A++RQ+ F  M+ +AL+ +
  S:     3 TPHINANVGDFAETVLMPGDPLRAQYIAENFLDDAVQVTGVRNMFGFTGTYKGKPVSIMGSGMGIPSMSIYARELIVSFGVKNIIRIGTCGGIGTDIKIRDVIFAQGASTDSNVNRARVRGYDFSAIADFDLLLNGVNAAKELGIKAKVGN--------VFTTDTFYQADDTFYKDLDKLGVLAVDMETAGLYGVAAEYGANAMALFTVSDHVITGEATPADERQSTFNEMVKIALESI 233
>gi|22138044|gb|AAM93389.1| deoD [Streptococcus thermophilus] (236 aa)
Score = 351, Expect = 1.2e-31, Identities = 96/233 (41%), Positives = 140/233 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+G+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N+ +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|22218129|gb|AAM94580.1|AF448502_1 deoD [Streptococcus thermophilus] (236 aa)
Score = 351, Expect = 1.3e-31, Identities = 96/233 (41%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + ++VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERISVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|117920946|ref|YP_870138.1| purine-nucleoside phosphorylase [Shewanella sp. ANA-3] >gi|117613278|gb|ABK48732.1| purine nucleoside phosphorylase [Shewanella sp. ANA-3] (234 aa)
Score = 350, Expect = 1.9e-31, Identities = 87/230 (37%), Positives = 132/230 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAK-----YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLAL 239
           MT H  A+  + A+ V+MPGDPLRAK+IAE +L +   + +VR MLGYTGYY  + ++VMGHGMG++S+ +Y +EL  F+ V  IIR+GS G+  K + + D++L + A ++S T AK     ++   A  S L  +          A E  I +    V S D++Y  +  +           ++ME   L+  A +   ++  +LT SD  +T E  +AE+RQ  F NMI LAL
  S:     1 MTAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQKHVQMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKA-------YTQANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAEERQLSFNNMIELAL 229
>gi|116627848|ref|YP_820467.1| purine nucleoside phosphorylase (family 1) [Streptococcus thermophilus LMD-9] >gi|116101125|gb|ABJ66271.1| purine-nucleoside phosphorylase [Streptococcus thermophilus LMD-9] (236 aa)
Score = 349, Expect = 2.2e-31, Identities = 94/233 (40%), Positives = 134/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+G+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|94990266|ref|YP_598366.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS10270] >gi|94543774|gb|ABF33822.1| Purine nucleoside phosphorylase [Streptococcus pyogenes MGAS10270] (256 aa)
Score = 349, Expect = 2.2e-31, Identities = 91/233 (39%), Positives = 137/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKG+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY               + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ + L+ +
  S:    20 MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMEVTTHVG----NVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLAAQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKVGLETL 252
>gi|88857620|ref|ZP_01132263.1| Purine nucleoside phosphorylase (Inosine phosphorylase) (PNP) [Pseudoalteromonas tunicata D2] >gi|88820817|gb|EAR30629.1| Purine nucleoside phosphorylase (Inosine phosphorylase) (PNP) [Pseudoalteromonas tunicata D2] (233 aa)
Score = 349, Expect = 2.4e-31, Identities = 84/232 (36%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTY--AKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A  G+ A+ VLMPGDPLRA++IAENFL++ + +  VR M G+TG Y  K V++M  GMG+ S+ IY+ EL   Y+V  +IR+G+ G    +I + D++  + A ++S    A+  G +       G  E N V     +  N+K+ +V   ++D FY A+ +            V+ME+  L+  A +   KA  L T SD ++T E+  AE+RQ  F  M+ +AL+ +
  S:     3 TPHINATLGDFAETVLMPGDPLRAQYIAENFLDDARQVTGVRNMFGFTGTYKGKPVSIMASGMGIPSMSIYARELICSYNVKNLIRIGTCGGIGSEIKIRDVIFAQGASTDSNVNRARVRGYDFAAIADFGLLE-NGVNAARNLGVNVKVGNVF--TTDTFYQADPTFYADLDKLGVLAVDMETAGLYGVAAEYGVKAMALFTVSDHVITGEATPAEERQNTFNEMVKIALESI 233
>gi|55823040|ref|YP_141481.1| purine nucleoside phosphorylase [Streptococcus thermophilus CNRZ1066] >gi|55739025|gb|AAV62666.1| purine nucleoside phosphorylase (family 1) [Streptococcus thermophilus CNRZ1066] (236 aa)
Score = 349, Expect = 2.5e-31, Identities = 95/233 (40%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+G+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + ++VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERISVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|18076391|emb|CAC82001.1| DeoD protein [Streptococcus thermophilus] (236 aa)
Score = 348, Expect = 2.9e-31, Identities = 95/233 (40%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+G+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + ++VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERISVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|50914062|ref|YP_060034.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS10394] >gi|50903136|gb|AAT86851.1| Purine nucleoside phosphorylase [Streptococcus pyogenes MGAS10394] (237 aa)
Score = 348, Expect = 3.1e-31, Identities = 91/233 (39%), Positives = 137/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKG+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY               + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ + L+ +
  S:     1 MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMGVTTHVG----NVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLAAQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKIGLETL 233
>gi|15674918|ref|NP_269092.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes M1 GAS] >gi|19745961|ref|NP_607097.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes MGAS8232] >gi|28896153|ref|NP_802503.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes SSI-1] >gi|56807875|ref|ZP_00365709.1| COG0813: Purine-nucleoside phosphorylase [Streptococcus pyogenes M49 591] >gi|71910512|ref|YP_282062.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS5005] >gi|94988386|ref|YP_596487.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS9429] >gi|94992268|ref|YP_600367.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS2096] >gi|13622060|gb|AAK33813.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes M1 GAS] >gi|19748121|gb|AAL97596.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes MGAS8232] >gi|28811403|dbj|BAC64336.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes SSI-1] >gi|71853294|gb|AAZ51317.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS5005] >gi|94541894|gb|ABF31943.1| purine nucleoside phosphorylase [Streptococcus pyogenes MGAS9429] >gi|94545776|gb|ABF35823.1| Purine nucleoside phosphorylase [Streptococcus pyogenes MGAS2096] (237 aa)
Score = 347, Expect = 3.9e-31, Identities = 91/233 (39%), Positives = 137/233 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKG+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY               + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ + L+ +
  S:     1 MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMGVTTHVG----NVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLAAQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKVGLETL 233
>gi|12746265|gb|AAK07420.1|AF320011_1 purine nucleoside phosphorylase [Streptococcus thermophilus] (236 aa)
Score = 347, Expect = 3.9e-31, Identities = 94/233 (40%), Positives = 133/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK+G+IA  +L+PGDPLRAK+IAENFLE+    N+VR M GYTG Y  + V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL   A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLANAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|62866773|gb|AAY17290.1| DeoD [Streptococcus iniae] (237 aa)
Score = 347, Expect = 4.1e-31, Identities = 91/233 (39%), Positives = 134/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A  GEIA  +L+PGDPLRAK+IAENFLE+    N++RGMLGYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A   +T +  I  +  +       +   + +   I   + +T  V  V SSD+FY               + +EME+ +L+  A +   KA  ++T SD+L    E  SA++RQT F +M+ + L+ +
  S:     1 MSIHISAAPGEIADKILLPGDPLRAKFIAENFLEDAVCFNEIRGMLGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPNVHVRELVLAQAA---ATNSNIIRNDFPEFDFPQIADFGLLDKAYHIAKELGMTTHVGNVLSSDVFYSNMPERNMALGKFGVKAIEMEAAALYYLAAQHGVKALGIMTISDNLNDPSEDTSAKERQTTFTDMMQVGLETL 233
>gi|15900722|ref|NP_345326.1| purine nucleoside phosphorylase [Streptococcus pneumoniae TIGR4] >gi|111656784|ref|ZP_01407652.1| hypothetical protein SpneT_02001935 [Streptococcus pneumoniae TIGR4] >gi|148986064|ref|ZP_01819085.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP3-BS71] >gi|149010536|ref|ZP_01831907.1| purine nucleoside phosphorylase, family 1 [Streptococcus pneumoniae SP19-BS75] >gi|168484728|ref|ZP_02709680.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC1873-00] >gi|168490924|ref|ZP_02715067.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC0288-04] >gi|182683748|ref|YP_001835495.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CGSP14] >gi|14972308|gb|AAK74966.1| purine nucleoside phosphorylase, family 1 [Streptococcus pneumoniae TIGR4] >gi|147765017|gb|EDK71946.1| purine nucleoside phosphorylase, family 1 [Streptococcus pneumoniae SP19-BS75] >gi|147921898|gb|EDK73024.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP3-BS71] >gi|172042097|gb|EDT50143.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC1873-00] >gi|182629082|gb|ACB90030.1| purine nucleoside phosphorylase, family 1 [Streptococcus pneumoniae CGSP14] >gi|183574604|gb|EDT95132.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC0288-04] (236 aa)
Score = 346, Expect = 4.9e-31, Identities = 94/233 (40%), Positives = 140/233 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A++GEIA  +L+PGDPLRAK+IAENFL++    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A + S   +    +     +   D L+   +   I   + +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A + +  A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLD---KAYHIAKKLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|170727759|ref|YP_001761785.1| purine nucleoside phosphorylase [Shewanella woodyi ATCC 51908] >gi|169813106|gb|ACA87690.1| purine nucleoside phosphorylase [Shewanella woodyi ATCC 51908] (234 aa)
Score = 346, Expect = 5.3e-31, Identities = 86/231 (37%), Positives = 132/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAK-----YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+ G+ A+ ++MPGDPLRAK+IAE +L +   + +VR MLGYTG+Y    ++VMGHGMG+ S+ +Y++EL   + V  IIRVGS G+  KD+ + D++L + A ++S T AK      +   A  S L  +          A +  I +    + S D++Y  +  +           V+ME   L+  A + + ++  +LT SD  +T E  SAE+RQ  F  MI LAL+
  S:     1 MTAHINAQAGDFAETIIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGFYKGTRISVMGHGMGIPSMVLYAHELINDFGVKRIIRVGSLGATQKDVKLHDVILAQAAGTDSPTNAKRSSGYQMATSATFSLLHKA-------YTAAQDKQISVKVGNIFSGDMYYDPDEDMIPALERFGVLGVDMEVAGLYGLAHQQHIESLAILTVSDHCITGEETSAEERQLSFNQMIELALE 230
>gi|148543353|ref|YP_001270723.1| purine nucleoside phosphorylase [Lactobacillus reuteri F275] >gi|184152763|ref|YP_001841104.1| purine nucleoside phosphorylase [Lactobacillus reuteri F275] >gi|194467513|ref|ZP_03073500.1| purine nucleoside phosphorylase [Lactobacillus reuteri 100-23] >gi|148530387|gb|ABQ82386.1| purine nucleoside phosphorylase [Lactobacillus reuteri F275] >gi|183224107|dbj|BAG24624.1| purine nucleoside phosphorylase [Lactobacillus reuteri F275] >gi|194454549|gb|EDX43446.1| purine nucleoside phosphorylase [Lactobacillus reuteri 100-23] (236 aa)
Score = 346, Expect = 5.5e-31, Identities = 92/231 (39%), Positives = 132/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----------YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  AK G+ A  VL+PGDPLRAK+IAENFLEN K +N VR   GYTG Y    ++V G GMG+ S+ IY  EL   + V  IIRVGS G    D++V D++L + + ++S            YA     +  D+          V  K  IE   K+ D+   ++D FY     +E++  D      EMES  L+  A KL+ +A ++LT SD +   E  +AE+R+  F +MIN++L+
  S:     1 MSTHINAKMGDYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNAFGYTGEYKGHRISVQGSGMGIPSMSIYINELVREFGVKTIIRVGSCGGIAPDVHVRDVLLAQGSSTDSAVTVNTFGPGFHYAPLADFKLLDTAYH-------VAGKLGIET--KVGDIF--AADRFYNDELDMEKL-RDYGILGTEMESAGLYLLAAKLHFRALSVLTVSDLIFGDEKATAEERERTFNDMINISLE 230
>gi|116493848|ref|YP_805582.1| purine-nucleoside phosphorylase [Lactobacillus casei ATCC 334] >gi|191637094|ref|YP_001986260.1| Purine-nucleoside phosphorylase [Lactobacillus casei] >gi|116103998|gb|ABJ69140.1| purine-nucleoside phosphorylase [Lactobacillus casei ATCC 334] >gi|190711396|emb|CAQ65402.1| Purine-nucleoside phosphorylase [Lactobacillus casei BL23] (238 aa)
Score = 346, Expect = 6.0e-31, Identities = 92/236 (38%), Positives = 135/236 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTY-------AKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M+ H  A KG IA VVL+PGDPLRA++IAENFL+N +  N VR   G+TG +  + V+V   GMG+ SI IY  EL   Y V  +IRVG+AG   +++ V D+VL + + ++S+          Y    A  + L  +  L D    +AI  ++      V   D FY      +++  D +    EME+ +L+  A K +  A ++LT S+ LVT E  SA++RQT F +MI LAL V + +
  S:     1 MSTHIDAPKGAIADVVLLPGDPLRAQYIAENFLDNAQRYNTVRNAFGFTGTFEGRRVSVQATGMGIPSISIYVNELIQDYGVKTLIRVGTAGGMGENVKVRDVVLAQGSSTDSSIILNTFGAGLYFAPLADFNLLREAANLADT---SAIRYHVG----NVLGEDRFYNDEMDRQKLI-DYEVLATEMETPALYLLAAKYHVHALSILTVSNHLVTGEETSAQERQTSFNDMIGLALGVAKTV 235
>gi|149189762|ref|ZP_01868043.1| purine nucleoside phosphorylase [Vibrio shilonii AK1] >gi|148836411|gb|EDL53367.1| purine nucleoside phosphorylase [Vibrio shilonii AK1] (239 aa)
Score = 346, Expect = 6.1e-31, Identities = 86/232 (37%), Positives = 128/232 (55%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDV--IRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDPLRAK+IA+ FL++   + DVR M GYTG Y  + ++VMGHGMG+ S  IY  EL   + V  IIRVGS G+  +DI V D+V+   A ++S   +   I  K+       + N V    + A    I +    + S+++FY  +  +  +        VEME+  ++  A +   KA  + T SD + T E  ++++R T F  M+ +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPLRAKYIADTFLDDAVQVCDVRNMYGYTGTYKGRRISVMGHGMGIPSCSIYVTELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNR---IRFKNHDFAAIADYNMVKNAEEAAKARGINVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSDERATTFNEMMEIALDSV 233
>gi|149007224|ref|ZP_01830888.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP18-BS74] >gi|168485782|ref|ZP_02710290.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC1087-00] >gi|168492989|ref|ZP_02717132.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC3059-06] >gi|147761262|gb|EDK68229.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP18-BS74] >gi|183571023|gb|EDT91551.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC1087-00] >gi|183577138|gb|EDT97666.1| purine nucleoside phosphorylase [Streptococcus pneumoniae CDC3059-06] (236 aa)
Score = 345, Expect = 7.0e-31, Identities = 94/233 (40%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A++GEIA  +L+PGDPLRAK+IAENFL +    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A + S   +    +     +   D L+   +   I   + +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A + +  A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVEYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLD---KAYHIAKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|15902782|ref|NP_358332.1| purine nucleoside phosphorylase (inosine phosphorylase) [Streptococcus pneumoniae R6] >gi|116515621|ref|YP_816222.1| purine nucleoside phosphorylase [Streptococcus pneumoniae D39] >gi|148990343|ref|ZP_01821529.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP6-BS73] >gi|148997089|ref|ZP_01824743.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP11-BS70] >gi|168575491|ref|ZP_02721427.1| purine nucleoside phosphorylase [Streptococcus pneumoniae MLV-016] >gi|194396826|ref|YP_002037471.1| Purine nucleoside phosphorylase [Streptococcus pneumoniae G54] >gi|15458331|gb|AAK99542.1| Purine nucleoside phosphorylase (inosine phosphorylase) [Streptococcus pneumoniae R6] >gi|116076197|gb|ABJ53917.1| purine nucleoside phosphorylase [Streptococcus pneumoniae D39] >gi|147756789|gb|EDK63829.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP11-BS70] >gi|147924372|gb|EDK75463.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP6-BS73] >gi|183578522|gb|EDT99050.1| purine nucleoside phosphorylase [Streptococcus pneumoniae MLV-016] >gi|194356493|gb|ACF54941.1| Purine nucleoside phosphorylase [Streptococcus pneumoniae G54] (236 aa)
Score = 345, Expect = 7.2e-31, Identities = 94/233 (40%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A++GEIA  +L+PGDPLRAK+IAENFL +    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A + S   +    +     +   D L+   +   I   + +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A + +  A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLD---KAYHIAKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|59711114|ref|YP_203890.1| purine nucleoside phosphorylase [Vibrio fischeri ES114] >gi|163730659|ref|ZP_02138131.1| purine nucleoside phosphorylase [Vibrio fischeri MJ11] >gi|75431811|sp|Q5E7J4|DEOD1_VIBF1 Purine nucleoside phosphorylase deoD-type 1 (PNP 1) >gi|59479215|gb|AAW85002.1| purine-nucleoside phosphorylase [Vibrio fischeri ES114] >gi|161396056|gb|EDQ20353.1| purine nucleoside phosphorylase [Vibrio fischeri MJ11] (238 aa)
Score = 345, Expect = 7.5e-31, Identities = 85/232 (36%), Positives = 131/232 (56%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVV---HSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  A+ G+ A VVLMPGDP+RAK+IAE FL++   + DVR M G+TG Y  ++++VMGHGMG+ S  IY  EL   + V  +IRVGS G+  + I V D+V+   A ++S   +   I  KD       +  +++R   +    +  DV V    S+++FY  + S+  +        VEME+  ++  A +   KA  + T SD + T E  ++++R T F  M+ +AL  V
  S:     3 TPHINAEMGDFADVVLMPGDPIRAKYIAETFLDDVVQVCDVRNMYGFTGTYKGRKISVMGHGMGIPSCSIYMTELIKDFGVKKVIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNR---IRFKDHDFAAIADY-EMVRNAELAAQARGIDVKVGNLFSAELFYTPDPSMFDLMDKYGIVGVEMEAAGMYGVAAEYGAKALAICTVSDHIKTGEQTTSDERATTFDEMMLIALDSV 233
>gi|126650904|ref|ZP_01723120.1| purine nucleoside phosphorylase [Bacillus sp. B14905] >gi|126592569|gb|EAZ86587.1| purine nucleoside phosphorylase [Bacillus sp. B14905] (235 aa)
Score = 345, Expect = 7.7e-31, Identities = 86/233 (36%), Positives = 140/233 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDS-TLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AKKGEIA+ VL+PGDPLRA+++AE+FLEN    N+VRGM GYTG Y    ++V G GMG  S+ IY  EL   Y V  +IR+G+ G+  K+IN+ D++L +   S+S   + I +    + T + S  +    +    + N+ + +  +++SD FY    +++++    +  V  VEMES +L+  A K   KA ++LT    L+T+E ++ E+ +  F  M+++AL  +
  S:     1 MSRHLSAKKGEIAERVLLPGDPLRARFVAEHFLENAFCYNEVRGMYGYTGMYKGVPISVQGTGMGNPSMSIYGTELVNDYGVKQMIRIGTCGAMQKEINIRDIILAQAVSSDSNLTEKIFLGNNYAPTADFSLLMKAYQQAQGKKGNVFVGN--IYNSDEFY--RETLDRLHKFMEFGVLGVEMESTALYTLAAKYGVKALSILTVGSQLLTNECLTHEESEKSFYEMVDVALTTI 232
>gi|148992502|ref|ZP_01822197.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP9-BS68] >gi|168489791|ref|ZP_02713990.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP195] >gi|147928819|gb|EDK79832.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP9-BS68] >gi|183571833|gb|EDT92361.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP195] (236 aa)
Score = 344, Expect = 8.0e-31, Identities = 94/233 (40%), Positives = 139/233 (59%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A++GEIA  +L+PGDPLRAK+IAENFL++    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A + S   +    +     +   D L+   +   I     +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A + +  A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLD---KAYHIAKKFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|24374260|ref|NP_718303.1| purine nucleoside phosphorylase [Shewanella oneidensis MR-1] >gi|81461087|sp|Q8EDM4|DEOD3_SHEON Purine nucleoside phosphorylase deoD-type (PNP) >gi|24348787|gb|AAN55747.1|AE015711_4 purine nucleoside phosphorylase [Shewanella oneidensis MR-1] (234 aa)
Score = 343, Expect = 1.1e-30, Identities = 85/231 (36%), Positives = 133/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAK-----YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+  + A+ V+MPGDPLRAK+IAE +L +   + +VR MLGYTGYY  + ++VMGHGMG++S+ +Y +EL  F+ V  IIR+GS G+  + + + D++L + A ++S T AK     ++   A  S L  +          A E  I +    V S D++Y  +  +           ++ME   L+  A +   ++  +LT SD  +T E  +A++RQ  F NMI LAL+
  S:     1 MTAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKA-------YTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALE 230
>gi|15617134|ref|NP_240347.1| purine nucleoside phosphorylase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11132311|sp|P57606|DEOD_BUCAI Purine nucleoside phosphorylase deoD-type (PNP) >gi|25326475|pir||A84993 purine-nucleoside phosphorylase (EC 2.4.2.1) [imported] - Buchnera sp. (strain APS) >gi|10039199|dbj|BAB13233.1| purine nucleoside phosphorylase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (234 aa)
Score = 341, Expect = 1.8e-30, Identities = 79/232 (34%), Positives = 136/232 (58%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           TPH  +KK + + +VLMPGDP+RAK+IAE +L N   +ND R ML YTG+Y N+++++M HG+G+ S  +Y+ EL   ++V  IIR+G+ G+   DI + D+V++  A   ST +K   I   D       + + +    +I   +K+   +    ++D FY  ++ +  I        V+ME+  ++  A +L  +A ++ T SD +   E +S+++R++ F +MI LAL+ V
  S:     3 TPHINSKKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRLMLAYTGFYKNRKISIMSHGIGIPSASLYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGA---STDSKVNRIRFNDHDFAAIADFDMIYNIVSISKKMKIKVSIGNFFTTDSFYNDDKKMLNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDHITNKEFLSSKERESSFNDMIELALESV 233
>gi|120599172|ref|YP_963746.1| purine nucleoside phosphorylase [Shewanella sp. W3-18-1] >gi|146292757|ref|YP_001183181.1| purine nucleoside phosphorylase [Shewanella putrefaciens CN-32] >gi|120559265|gb|ABM25192.1| purine nucleoside phosphorylase [Shewanella sp. W3-18-1] >gi|145564447|gb|ABP75382.1| purine nucleoside phosphorylase [Shewanella putrefaciens CN-32] (234 aa)
Score = 341, Expect = 2.1e-30, Identities = 81/231 (35%), Positives = 130/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+  + ++ V+MPGDPLRAK+IAE +L +   + +VR MLGYTGYY  + ++VMGHGMG++S+ +Y +EL  F+ V  IIR+GS G+  + + + D++L + A ++S          + +T      L+    K A E  I +    V S D++Y  +  +           ++ME   L+  A +   ++  +LT SD  +T E  +A++RQ  F NMI LAL+
  S:     1 MTAHINAQPTDFSETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVQMRDVILAQAAGTDSPTNAKRSSGYQMATSATFSLLHKAYTK-ANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALE 230
>gi|149021700|ref|ZP_01835731.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP23-BS72] >gi|147930161|gb|EDK81147.1| purine nucleoside phosphorylase [Streptococcus pneumoniae SP23-BS72] (236 aa)
Score = 341, Expect = 2.2e-30, Identities = 93/233 (39%), Positives = 140/233 (60%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGA--NRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           M+ H  A++GEIA  +L+PG+PLRAK+IAENFL++    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A + S   +    +     +   D L+   +   I   + +T  V  V SSD+FY     +++E      K+  VEME+ +L+  A + +  A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 MSIHIAAQQGEIADKILLPGNPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLD---KAYHIAKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKA--VEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 233
>gi|160874953|ref|YP_001554269.1| purine nucleoside phosphorylase [Shewanella baltica OS195] >gi|160860475|gb|ABX49009.1| purine nucleoside phosphorylase [Shewanella baltica OS195] (234 aa)
Score = 340, Expect = 2.5e-30, Identities = 82/231 (35%), Positives = 130/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-TYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+  + A+ V+MPGDPLRAK+IAE +L +   + +VR MLGYTG+Y  + ++VMGHGMG++S+ +Y +EL  ++ V  IIR+GS G+  K + + D++L + A ++S T AK             +  L      TA E  I +    + S D++Y  +  +           ++ME   L+  + +   ++  +LT SD  +T E  +AE+RQ  F NMI LAL+
  S:     1 MTAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGFYQGQRISVMGHGMGISSMVLYGHELINYFGVKRIIRIGSLGATQKHVQMRDVILAQAAGTDSPTNAKR--SSGYQMATSATFSLLHKAYTTANEKGISVKVGNIFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLSHQQGIESLAILTVSDHCLTGEETTAEERQLSFNNMIELALE 230
>gi|124547175|ref|ZP_01706128.1| purine nucleoside phosphorylase [Shewanella putrefaciens 200] >gi|124509475|gb|EAY53554.1| purine nucleoside phosphorylase [Shewanella putrefaciens 200] (234 aa)
Score = 339, Expect = 3.2e-30, Identities = 81/231 (35%), Positives = 130/231 (56%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           MT H  A+  + ++ V+MPGDPLRAK+IAE +L +   + +VR MLGYTGYY  + ++VMGHGMG++S+ +Y +EL  F+ V  IIR+GS G+  + + + D++L + A ++S          + +T      L+    K A E  I +    V S D++Y  +  +           ++ME   L+  A +   ++  +LT SD  +T E  +A++RQ  F NMI LAL+
  S:     1 MTVHINAQPTDFSETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVQMRDVILAQAAGTDSPTNAKRSSGYQMATSATFSLLHKAYTK-ANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALE 230
>gi|42561357|ref|NP_975808.1| purine nucleoside phosphorylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492855|emb|CAE77450.1| Purine nucleoside phosphorylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (217 aa)
Score = 337, Expect = 5.5e-30, Identities = 88/218 (40%), Positives = 125/218 (57%)
  Q:    17 KKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHES-MSAEDRQTKFVNM 234
           K  +IA VVL+ GDP R KW  EN L + KL++DVR    YTGYY N +V+    GMG  SI IY++ELF  ++V+ IIRVG+ G+Y  DI +G ++  K A+SE      + I   D T    ++        +++ NI      VH SD+FY   R  +    +    VV+MESF+LF  A   NKKAAT+LT SD+L  H + ++A+ R+   + M
  S:     5 KNADIASVVLIAGDPKRTKWATENLLTDYKLVSDVRNAFVYTGYYKNHKVSFATSGMGQPSIAIYAHELFNDHNVNTIIRVGTCGTYNNDIKIGTVIEAKNAFSE------VNIFEPDKTGWQKNQ-------PSLDLNIGFK-ANVHCSDVFY---RISKLDIKEHNLDVVDMESFALFYLANHFNKKAATILTVSDNLNDHSNDLTAKQREIATLKM 206
>gi|83319883|ref|YP_424791.1| purine nucleoside phosphorylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283769|gb|ABC01701.1| purine nucleoside phosphorylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (217 aa)
Score = 336, Expect = 8.0e-30, Identities = 88/218 (40%), Positives = 125/218 (57%)
  Q:    17 KKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHES-MSAEDRQTKFVNM 234
           K  +IA VVL+ GDP R KW  EN L + KL++DVR    YTGYY N +V+    GMG  SI IY +ELF  ++V+ IIRVG+ G+Y  DI +G ++  K A+SE      + I   + T    ++        +++ NI L    VH SD+FY   R  +    +    VV+MESF+LF  A   NKKAAT+LT SD+L  H + ++A+ R+   + M
  S:     5 KNADIASVVLIAGDPRRTKWACENLLTDYKLVSDVRNAFVYTGYYKNHKVSFATSGMGQPSIAIYVHELFNDHNVNTIIRVGTCGTYNNDIKIGTVIEAKNAFSE------VNIFEPNKTGWQKNQ-------PSLDLNIGLK-ANVHCSDVFY---RLSKLDIKEHNLDVVDMESFALFYLANHFNKKAATILTVSDNLNDHSNDLTAKQREIATLKM 206
>gi|15639721|ref|NP_219171.1| purine nucleoside phosphorylase (deoD) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025959|ref|YP_001933731.1| purine nucleoside phosphorylase [Treponema pallidum subsp. pallidum SS14] >gi|6014953|sp|O83716|DEOD_TREPA Purine nucleoside phosphorylase deoD-type (PNP) >gi|3323039|gb|AAC65702.1| purine nucleoside phosphorylase (deoD) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018534|gb|ACD71152.1| purine nucleoside phosphorylase [Treponema pallidum subsp. pallidum SS14] (233 aa)
Score = 334, Expect = 1.2e-29, Identities = 87/233 (37%), Positives = 134/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIE------NNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           M+ H  AK  +IA  VL+PGDPLRA+++AE F  N    N+VRGMLG+TG Y    V+V G GMG+ S  IY  ELF  Y V   IRVG+AG   +++ +  +V    A ++S       I A+  S +  +   +  + +TA+         +++ +V+  SSD+FY  + S  ++ +      VEME+  L+  A K  ++A ++LT SD LVT    SA++R+  F  MI +AL+ +
  S:     1 MSIHLGAKGEDIAPRVLLPGDPLRARFVAERFFHNAYCYNEVRGMLGFTGTYKGVRVSVQGTGMGLPSHSIYVTELFQDYGVQKAIRVGTAGGLQEEVALKSVVCALGAATDS------AINARRFSGMHFAPTASWSLLRTAVSVADEMGTGVQVGNVI--SSDVFYDESGS-WRLWARYGVLAVEMETAELYTLAAKFRREALSILTISDHLVTGAVTSAQERERSFTQMIEIALEAI 231
>gi|56459285|ref|YP_154566.1| purine-nucleoside phosphorylase [Idiomarina loihiensis L2TR] >gi|56178295|gb|AAV81017.1| Purine-nucleoside phosphorylase [Idiomarina loihiensis L2TR] (236 aa)
Score = 332, Expect = 2.3e-29, Identities = 78/230 (33%), Positives = 133/230 (57%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           TPH  AK G+ A++ L PGDPLRA+ IAE  L++ +LI+D R ML +TG +    V+VMG GMGM S  +Y+ ELF  + V+ ++RVG+ G+ + ++N+ DLV+ + A ++S+  + +      + +     L++ +     +N  ++    V S+D FY  ++ +E          ++ME+ +L+A A    K+A  ++T SD + T   +SA +RQT F  M  + L+
  S:     3 TPHISAKAGDFAELCLFPGDPLRARHIAETHLDSAELISDTRNMLAFTGQFRGTPVSVMGSGMGMPSCALYAQELFQHFGVERLVRVGTCGAVSANLNLRDLVVAQGACTDSSMNQKLFGGYDFAAIADYKLLSEFVGYCQKKNQ-RVAVGNVFSTDSFYHPDKKLESRLEAMNVLALDMEAAALYAVAAIHKKQALAVMTVSDEIRTGNGLSANERQTAFNEMTKMTLE 231
>gi|27904957|ref|NP_778083.1| purine nucleoside phosphorylase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|32699543|sp|Q89A58|DEOD_BUCBP Purine nucleoside phosphorylase deoD-type (PNP) >gi|27904355|gb|AAO27188.1| purine nucleoside phosphorylase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (238 aa)
Score = 331, Expect = 3.3e-29, Identities = 79/233 (33%), Positives = 134/233 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENN--IKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           +TPH  AKKG+ +  VLMPGDPLRA++IA+N+L+N   + ++R MLGYTG Y    ++VM HG+G+ S  IY  EL + Y+V  IIR+G+ G+  + IN+ D+++   A   ST +K   +   D+      +   ++      NN  IK+      ++D+FY  N  +           ++ME+  +++ A +L  + A++ T SD ++  + MS  DR++   NMI ++L+ +
  S:     2 VTPHINAKKGDFSDCVLMPGDPLRARYIAKNYLKNAIEVTNIRSMLGYTGRYKGHRISVMSHGIGIPSSLIYVKELVSEYNVKKIIRIGTCGTVIEHININDIIICLGA---STDSKVNRLRFHDNDFSSVADFYLILDLFNSANNAGIKINIGNFFTTDLFYVKNDKLLDTLQRYNILGIDMETAGIYSLASELGIQVASICTVSDHILKKDQMSYIDRESNLNNMIYISLEAL 233
>gi|81428410|ref|YP_395410.1| purine-nucleoside phosphorylase [Lactobacillus sakei subsp. sakei 23K] >gi|78610052|emb|CAI55101.1| Purine-nucleoside phosphorylase [Lactobacillus sakei subsp. sakei 23K] (234 aa)
Score = 321, Expect = 3.8e-28, Identities = 83/231 (35%), Positives = 132/231 (57%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-------YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--EMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALK 240
           M+ H  A++G+IA+ VL+PGDPLRAK+IAE FL +    N +R   GYTGYY  + ++V   GMG+ SI IY+ EL  FY V  +IRVG+ G    D++V D+++ + A ++S   +       Y    A    L     +         +  +K+ +++  S D FY      +++    +  V+  EME+ +L+  A K N +A  +LT S+ ++T E  SAE+R+  F  MI +AL+
  S:     1 MSTHIEAQQGDIAETVLLPGDPLRAKYIAETFLTDVHRYNTIRNAFGYTGYYKGQAISVQASGMGIPSISIYANELIQFYGVKRLIRVGTCGGLGTDVHVRDVMIAQSASTDSAIIQNTFGAGLYYAPTADFKLL-----MKAYQAAQQAQIAVKVGNIL--SEDRFYNDEIDRQKL---IQYGVLGSEMEAAALYMLAAKFNVQALAVLTISNHIITGEETSAEEREKSFNEMITVALE 230
>gi|13470934|ref|NP_102503.1| purine nucleoside phosphorylase [Mesorhizobium loti MAFF303099] >gi|14021677|dbj|BAB48289.1| purine nucleoside phosphorylase [Mesorhizobium loti MAFF303099] (248 aa)
Score = 316, Expect = 1.5e-27, Identities = 82/235 (34%), Positives = 129/235 (54%)
  Q:     7 EFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES-----TYAKYIGIEAKDSTLEGSDELNDVIRKTA---IENNIKLTDVVVHSSDIFY---GANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKV 241
           E  +T H  A KG+ A+ VL+PGDP RA+W+A+ FLE P+ +N  RG LG+TG +  + V++   G+G++S  IY++EL  +Y    +IR G+ G  + +  +  LV+++ A  E+      +  Y      D  L     L   + K A   I+++  LT      +DIFY      R  E  A    +  V+ME+ +L+  A     +A +LLT  D+LVT E     +RQ  F +M  LAL++
  S:     9 EQRLTTHIEAGKGDYAETVLLPGDPQRAEWMAKTFLEAPRCVNRRRGALGFTGLFRGQPVSIQATGIGVSSFLIYAHELLDYYGARTLIRTGTCGGLSAEATLRSLVISQSARPENAENGQVFGLYDAEAGPDPAL-----LVCALAKAAELGIDHHAGLTVC----TDIFYHPEAHTRYAE--ARALGALAVDMETSALYRIAAHFGARALSLLTVVDNLVTGEQADYSERQALFTDMSRLALEI 243
>gi|194540126|ref|YP_002075168.1| purine nucleoside phosphorylase [Vibrio sp. Ex25] >gi|151938681|gb|EDN57516.1| purine nucleoside phosphorylase [Vibrio sp. Ex25] (160 aa)
Score = 315, Expect = 2.0e-27, Identities = 61/112 (54%), Positives = 80/112 (71%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES 122
           TPH  A+ G+ A+ VLMPGDPLRAK+IAE FLE+ K + DVR M G+TG Y  K+V+VMGHGMG+ S  IY +EL A Y V  +IRVGS G+   D+N+ D+V+   A ++S
  S:     3 TPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDS 114
>gi|77415214|ref|ZP_00791212.1| purine nucleoside phosphorylase, family 1 [Streptococcus agalactiae 515] >gi|77158735|gb|EAO70048.1| purine nucleoside phosphorylase, family 1 [Streptococcus agalactiae 515] (128 aa)
Score = 315, Expect = 2.1e-27, Identities = 63/113 (55%), Positives = 78/113 (69%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES 122
           M+ H  AK+GEIA  +L+PGDPLRAK+IAENFLE+    N VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   DI+V +LVL + A + S
  S:     1 MSIHIEAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNTVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAINPDIHVRELVLAQAAATNS 113
>gi|108803452|ref|YP_643389.1| purine-nucleoside phosphorylase [Rubrobacter xylanophilus DSM 9941] >gi|108764695|gb|ABG03577.1| purine and other phosphorylases, family 1 [Rubrobacter xylanophilus DSM 9941] (236 aa)
Score = 297, Expect = 2.5e-25, Identities = 79/237 (33%), Positives = 116/237 (48%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTH-ESMSAEDRQTKFVNMINLALKVVEKIN 246
           M  H RA+ G+ A+ VL+PGDPLRA++IA  F E+P+L+   RGMLGYTG Y  + V+V   GMG  S  I   EL        ++RVG+ G Y +++ +GDLV+   A  +      +      +     D ++                 VV SSD+FY        + S      VEME+ ++F  A     +A  LLT SD++      +S ED +    NM+ LAL  +  +N
  S:     1 MPVHVRAEPGDFAESVLLPGDPLRAEYIARTFFESPRLVTRERGMLGYTGSYRGRPVSVQATGMGCPSAAIVVEELVQL-GARNLLRVGTCGGYHRELQLGDLVVATAAAPQDGTVSSLTRGVPYAPAAHFDVVHAAYHAAERSGRRTFMGPVV-SSDLFYDPVEDPAGLWSRLGVLAVEMEAAAIFTIAAMRGARAGCLLTVSDTIGEEVVRISDEDLRAAVDNMVELALDTLHGLN 236
>gi|149004038|ref|ZP_01828844.1| purine nucleoside phosphorylase, family 1 [Streptococcus pneumoniae SP14-BS69] >gi|147757939|gb|EDK64947.1| purine nucleoside phosphorylase, family 1 [Streptococcus pneumoniae SP14-BS69] (145 aa)
Score = 296, Expect = 3.8e-25, Identities = 60/117 (51%), Positives = 80/117 (68%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK 126
           M+ H  A++GEIA  +L+PGDPLRAK+IAENFL++    N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  +++ V +LVL + A + S   +
  S:     1 MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVYVRELVLAQAAATNSNIVR 117
>gi|2494058|sp|Q56037|DEOD_STRTR Purine nucleoside phosphorylase deoD-type (PNP) >gi|1276873|gb|AAC44007.1| DeoD >gi|1588804|prf||2209356A deoD gene (216 aa)
Score = 279, Expect = 3.1e-23, Identities = 82/213 (38%), Positives = 117/213 (54%)
  Q:    30 DPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           DPLRAK+IAENFLE+    N+VR M GYTG Y  + ++VMG GMGM SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD  Y               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 DPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERISVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNFGMTTHVGNVLSSDEKYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 213
>gi|46199372|ref|YP_005039.1| purine nucleoside phosphorylase [Thermus thermophilus HB27] >gi|55981404|ref|YP_144701.1| purine nucleoside phosphorylase [Thermus thermophilus HB8] >gi|28949111|pdb|1ODI|A Chain A, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949112|pdb|1ODI|B Chain B, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949113|pdb|1ODI|C Chain C, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949114|pdb|1ODI|D Chain D, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949115|pdb|1ODI|E Chain E, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949116|pdb|1ODI|F Chain F, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949117|pdb|1ODK|A Chain A, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949118|pdb|1ODK|B Chain B, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949119|pdb|1ODK|C Chain C, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949120|pdb|1ODK|D Chain D, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949121|pdb|1ODK|E Chain E, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949122|pdb|1ODK|F Chain F, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949123|pdb|1ODL|A Chain A, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949124|pdb|1ODL|B Chain B, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949125|pdb|1ODL|C Chain C, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949126|pdb|1ODL|D Chain D, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949127|pdb|1ODL|E Chain E, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|28949128|pdb|1ODL|F Chain F, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|29726930|pdb|1ODJ|A Chain A, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|29726931|pdb|1ODJ|B Chain B, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|29726932|pdb|1ODJ|C Chain C, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|29726933|pdb|1ODJ|D Chain D, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|29726934|pdb|1ODJ|E Chain E, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|29726935|pdb|1ODJ|F Chain F, Purine Nucleoside Phosphorylase From Thermus Thermophilus >gi|46196997|gb|AAS81412.1| purine nucleoside phosphorylase [Thermus thermophilus HB27] >gi|55772817|dbj|BAD71258.1| purine nucleoside phosphorylase [Thermus thermophilus HB8] (235 aa)
Score = 258, Expect = 9.5e-21, Identities = 74/236 (31%), Positives = 116/236 (49%)
  Q:    10 MTP-HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M+P H RA  G++A+ VL+PGDP RA+WIA+ FL+NP+  ND RG+ GYTG Y    V+V   GMG  S  I   EL       V++RVG+AG+ + D+  G+L++ + A   + T  +Y  +E +        E+   + + A          +V S D FY       +  +       EME+ +LF        +   +L  S+ +   E    E  Q     M+ +AL+ V ++
  S:     1 MSPIHVRAHPGDVAERVLLPGDPGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQTTGMGTPSAAIVVEELVRL-GARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQY--LEGRPYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIGDPELAPPEVLQEGVRRMVEVALEAVLEV 235
>gi|15899423|ref|NP_344028.1| 5'-methylthioadenosine phosphorylase (mtaP) [Sulfolobus solfataricus P2] >gi|1709147|sp|P50389|MTAP_SULSO S-methyl-5'-thioadenosine phosphorylase (5'-methylthioadenosine phosphorylase) (MTA phosphorylase) >gi|16975003|pdb|1JDS|A Chain A, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Phosphate (Space Group P21) >gi|16975004|pdb|1JDS|B Chain B, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Phosphate (Space Group P21) >gi|16975005|pdb|1JDS|C Chain C, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Phosphate (Space Group P21) >gi|16975006|pdb|1JDS|D Chain D, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Phosphate (Space Group P21) >gi|16975007|pdb|1JDS|E Chain E, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Phosphate (Space Group P21) >gi|16975008|pdb|1JDS|F Chain F, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Phosphate (Space Group P21) >gi|16975009|pdb|1JDT|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Mta And Sulfate Ion >gi|16975010|pdb|1JDT|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Mta And Sulfate Ion >gi|16975011|pdb|1JDT|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Mta And Sulfate Ion >gi|16975012|pdb|1JDU|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase >gi|16975013|pdb|1JDU|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase >gi|16975014|pdb|1JDU|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase >gi|16975015|pdb|1JDV|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Adenosine And Sulfate Ion >gi|16975016|pdb|1JDV|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Adenosine And Sulfate Ion >gi|16975017|pdb|1JDV|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Adenosine And Sulfate Ion >gi|16975018|pdb|1JDV|D Chain D, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Adenosine And Sulfate Ion >gi|16975019|pdb|1JDV|E Chain E, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Adenosine And Sulfate Ion >gi|16975020|pdb|1JDV|F Chain F, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Adenosine And Sulfate Ion >gi|16975021|pdb|1JDZ|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase With Formycin B And Sulfate Ion >gi|16975022|pdb|1JDZ|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase With Formycin B And Sulfate Ion >gi|16975023|pdb|1JDZ|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase With Formycin B And Sulfate Ion >gi|16975024|pdb|1JE0|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Phosphate And Tris Molecule >gi|16975025|pdb|1JE0|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Phosphate And Tris Molecule >gi|16975026|pdb|1JE0|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With Phosphate And Tris Molecule >gi|16975027|pdb|1JE1|A Chain A, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Guanosine And Sulfate >gi|16975028|pdb|1JE1|B Chain B, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Guanosine And Sulfate >gi|16975029|pdb|1JE1|C Chain C, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Guanosine And Sulfate >gi|16975030|pdb|1JE1|D Chain D, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Guanosine And Sulfate >gi|16975031|pdb|1JE1|E Chain E, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Guanosine And Sulfate >gi|16975032|pdb|1JE1|F Chain F, 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complex With Guanosine And Sulfate >gi|16975037|pdb|1JP7|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase >gi|16975038|pdb|1JP7|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase >gi|16975039|pdb|1JP7|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase >gi|16975040|pdb|1JPV|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With So4 >gi|16975041|pdb|1JPV|B Chain B, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With So4 >gi|16975042|pdb|1JPV|C Chain C, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Complexed With So4 >gi|929900|emb|CAA90560.1| 5'-methylthioadenosine phosphorylase [Sulfolobus solfataricus] >gi|13816024|gb|AAK42818.1| 5'-methylthioadenosine phosphorylase (mtaP) [Sulfolobus solfataricus P2] (236 aa)
Score = 248, Expect = 1.1e-19, Identities = 77/207 (37%), Positives = 118/207 (57%)
  Q:    10 MTP-HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGD-LVLTKKAYSE-STYAKYIGIEAKDSTLEGSD---ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSL 216
           M P H  AKKGE+A+ VL+ GDP RA+ ++   L+NPKL N+ RG L YTG YN + V++  HG+G  SI I   EL A    +V IR G+ G+    IN+G+ +++T  +Y++   + +Y+    +D+    S    EL + +  +  + N+K     V SSD FY  +    +  S   +  VEME  +LF  +     K+AT+L  SD+L
  S:     1 MNPVHILAKKGEVAERVLVVGDPGRARLLS-TLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEEL-AMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYL----RDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNL 207
>gi|126465425|ref|YP_001040534.1| purine phosphorylases family protein 1 [Staphylothermus marinus F1] >gi|126014248|gb|ABN69626.1| purine and other phosphorylases, family 1 [Staphylothermus marinus F1] (241 aa)
Score = 238, Expect = 1.9e-18, Identities = 77/231 (33%), Positives = 116/231 (50%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDE--LNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           PH +AK GEIA+ V+  GDP R K +AE  L++ K++N+ RG+L  TG Y +  VT+  HGMG  S  I  +E         I R+G+AG   +D+ +GD+V+ T  AY+       +G    ++    S +  L   I +   E   +     V SSD FY  +    +  +      VEME+  LFA     N + A +L  SD+L++ +   A   + K    IN+A K V
  S:     7 PHIKAKPGEIAENVIAVGDPGRVKILAE-LLDDYKVVNEHRGLLVITGNYKDIRVTIATHGMGCPSAAIV-FEELGMLGARKITRLGTAGGMREDLEIGDIVVATGAAYTRGGCG--LGQYMPEACAPTSPDPVLTTKIMEKLGETGTRFYAGPVFSSDAFYAEDPGFAKKWNSRGVIAVEMEAAILFALGWMRNWRTAAVLVISDNLLSEKEEFATSEELK--EKINIAAKAV 234
>gi|15921217|ref|NP_376886.1| 5'-methylthioadenosine phosphorylase [Sulfolobus tokodaii str. 7] >gi|15622002|dbj|BAB65995.1| 237aa long hypothetical 5'-methylthioadenosine phosphorylase [Sulfolobus tokodaii str. 7] (237 aa)
Score = 234, Expect = 5.3e-18, Identities = 70/221 (31%), Positives = 115/221 (52%)
  Q:    10 MTP-HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTK 230
           M P H  AKKG+IA+ V++ GDP R K +++ FLE P+L+N+ RG L YTG Y  + +++  HG+G  SI I   EL       + IR G++G+   ++N+GD V+ T  +Y+ S+       E    +     E+   +  +     +K     V SSD FY  +    +  S+  +  VEME  +LF  +     ++  ++  SDSLV    +S ++ + K
  S:     1 MNPVHILAKKGDIAEKVIIAGDPSRVKSLSK-FLEEPQLVNENRGFLIYTGKYKGERISIATHGIGGPSIAIVLEEL-TMLGGRIFIRYGTSGALVPEVNIGDYVIVTGASYNPSSLVYQYFKEQACVSATPDFEITMALYNSFKNKGLKFHLGNVFSSDAFYAEDEDFAKKWSERGNIAVEMECATLFMLSKLRKIRSGAVVIISDSLVKGGWISKDELEKK 221
>gi|21910148|ref|NP_664416.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes MGAS315] >gi|21904341|gb|AAM79219.1| putative purine nucleoside phosphorylase [Streptococcus pyogenes MGAS315] (201 aa)
Score = 226, Expect = 3.9e-17, Identities = 67/194 (34%), Positives = 107/194 (55%)
  Q:    49 NDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           N+VR M GYTG Y    V+VMG GMGM SI IY+ EL   Y V  +IRVG+AG+   +++V +LVL + A + S      + ++   +  D  L   D+   + R+  +  ++      V SSD+FY               + +EME+ +L+  A + + KA  ++T SD+L    E  +AE+RQT F +M+ + L+ +
  S:     4 NEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGL--LDKAYHIAREMGVTTHVG----NVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLAAQHHVKALGIMTISDNLNDPTEDTTAEERQTTFTDMMKVGLETL 197
>gi|146304341|ref|YP_001191657.1| purine phosphorylase family 1 [Metallosphaera sedula DSM 5348] >gi|145702591|gb|ABP95733.1| purine or other phosphorylase, family 1 [Metallosphaera sedula DSM 5348] (238 aa)
Score = 225, Expect = 6.0e-17, Identities = 71/224 (31%), Positives = 120/224 (53%)
  Q:    10 MTP-HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSE-STYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHES-MSAEDRQTKFVN 233
           M P H  AKKG++A+ VL+ GDP RA+ ++ + LE+PKL+N  RG L YTG Y +  V++  HG+G  S+ I  +E          +R+G+ G+   +I +G+ ++ T  +Y+    + +Y+G     S     D ++ +I + +     +     + SSD FY  +    +  SD  +  VEME  +LF  +     K+A ++  SD+L T  + +S ED +   VN
  S:     1 MNPVHILAKKGDVAEKVLVVGDPGRAELLS-SLLESPKLVNKNRGFLVYTGLYRDTRVSIATHGIGGPSMAIV-FEELHMLGGSTFVRLGTVGALRPEIGLGEYIIPTGASYNPGGLFFQYVGDLTSVSATPDHDLVSRLITQFS-SAGYRFHVGNIFSSDAFYAEDEHFVKRWSDRGNIGVEMECATLFFLSRLRGTKSAAVVVVSDNLATGGNWISKEDLERSVVN 225
>gi|70607016|ref|YP_255886.1| 5'-methylthioadenosine phosphorylase [Sulfolobus acidocaldarius DSM 639] >gi|68567664|gb|AAY80593.1| 5'-methylthioadenosine phosphorylase [Sulfolobus acidocaldarius DSM 639] (236 aa)
Score = 219, Expect = 2.9e-16, Identities = 69/221 (31%), Positives = 111/221 (50%)
  Q:    10 MTP-HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA-YSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTK 230
           M P H  AKKG++A+ V++ GDP R ++IA+ FL++ + +N+ RG L YTG Y   +++V  HG+G  SI I   EL         +R G+ G+   DI +GD +L   A Y+ S+       E    +     EL+  +  +     +K     V SSD FY  +    +   +  +  VEME  +LF  +     ++  +L  SD+LV    +S E+ + K
  S:     1 MNPVHILAKKGDVAERVIIAGDPGRVRYIAK-FLDDVRTVNENRGFLVYTGKYKGIDISVATHGIGGPSIAIVLEELIMLGG-KTFVRFGTTGALASDIEIGDYILVSGASYNPSSIVYQYFKENVCISATPDFELSSALYNSFKNRKLKFHVGNVFSSDAFYAEDAEFAKKWYERGNIAVEMECSTLFILSRLRKVRSGAVLVVSDNLVKGGWISKEELENK 221
>gi|124027795|ref|YP_001013115.1| S-methyl-5-thioadenosine phosphorylase [Hyperthermus butylicus DSM 5456] >gi|123978489|gb|ABM80770.1| S-methyl-5-thioadenosine phosphorylase [Hyperthermus butylicus DSM 5456] (245 aa)
Score = 216, Expect = 6.1e-16, Identities = 69/208 (33%), Positives = 109/208 (52%)
  Q:    10 MTP-HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGS------DELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLV 217
           M P H R     +A  V++ GDP RA++IAE+ LE+ +L+N+ R    YTG+Y  + ++V  HG+G AS  I  +E        V++R+G+AG+   ++++GD+V+ T  AY    +   IG    D+ +  +       +L D  ++  I   + L  V   SSD FY  +    +         VEME  +L+A A      AA  L  SD+LV
  S:     1 MKPQHIRVSPDRVAAKVVVVGDPARARFIAEHLLEDAELVNEERCFHLYTGFYRGERISVAVHGVGAASSAIV-FEELRMLGAKVMVRLGTAGALMPELDIGDMVVATGAAY---VHGGTIGSYVPDACMATAPNPLLLTKLYDYAKR--IHGRVVLGPVF--SSDAFYAEDPEFAKKWFSRGIVAVEMEVATLYALAALRRFDAAAALVISDNLV 208
>gi|119718980|ref|YP_919475.1| purine phosphorylases family protein 1 [Thermofilum pendens Hrk 5] >gi|119524100|gb|ABL77472.1| purine and other phosphorylases, family 1 [Thermofilum pendens Hrk 5] (237 aa)
Score = 214, Expect = 1.1e-15, Identities = 73/235 (31%), Positives = 114/235 (48%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSE--STYAKYIGIEAKDSTLEGSD--ELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT--HESMSAEDRQTKFVNMINLALKVVEK 244
           MT     K   +A  VL+ GDP RA+ +A   LE+ +L+N+ RG+L Y G++   EV+V  HGMG A   I   EL        ++R+G+ G+   ++ VGD V+   A+      + +Y G    D  +  S   EL  ++   A    +K+    V SSD FY     V    +   +  VEME  +LFA       ++A +L  + SLV      +S  + + + V    +AL V+ K
  S:     1 MTMPYHIKAERVAGRVLVVGDPGRARLVA-GMLEDARLVNENRGLLVYNGFWRGVEVSVATHGMGGAGAAIVFEELLQLGG-RTLVRLGTTGAIRGEVEVGDFVVPSSAFHHPGGLFLQYFG----DICVSPSPDLELAWLLASEARSAGLKVWTAPVVSSDAFYAETGEVISRWASFGAVSVEMECATLFAVTRLRGARSAAILLVNGSLVQPGKRMVSESELEERLVKGAEVALDVLAK 235
>gi|94985696|ref|YP_605060.1| purine phosphorylases family protein 1 [Deinococcus geothermalis DSM 11300] >gi|94555977|gb|ABF45891.1| purine and other phosphorylase, family 1 [Deinococcus geothermalis DSM 11300] (238 aa)
Score = 212, Expect = 2.0e-15, Identities = 67/230 (29%), Positives = 111/230 (48%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYI--GIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVV 242
           H RA+ G +A+ VL+PGDP R + IAE +LE+  L  D RG+LG+TG Y    V+V   GMG  S  I + EL A      +IRVG+ G  +  +   DLV+ T    ++ T  + +     A  ++ E  +      R   + +++ L    + + D FY +     ++ +       EME+ ++F  A +   +A  L  CS+ +   + +  E        MI +AL  +
  S:     5 HVRAQPGAVAEYVLLPGDPNRTRRIAETYLESATLYTDHRGLLGFTGTYQGVPVSVQTTGMGCPSAAIVAEEL-ARLGAKTLIRVGTLGGASPQVQPADLVIATATVPNDGTTRQLLNGAPYAPAASFEVVEAAVRAARAQEVPHHVGL----IMTEDAFYASTPEHARLWASRGVLGFEMEASAVFLVAAQHGLRAGCLTACSNDIGDPQLVPEEVLAAGVDRMIRVALGAI 232
>gi|118431293|ref|NP_147653.2| S-methyl-5-thioadenosine phosphorylase [Aeropyrum pernix K1] >gi|116062615|dbj|BAA79977.2| S-methyl-5-thioadenosine phosphorylase [Aeropyrum pernix K1] (244 aa)
Score = 209, Expect = 4.4e-15, Identities = 65/205 (31%), Positives = 104/205 (50%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA---YSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNI--KLTDVV----VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLV 217
           H  A  G++A +V+  GDP RA+ +A   LE+ +L++  RG+  YTG +N  EVT+  HG+G  S  +  +E       +V++R+G++G  +KD+ +GD+V+   A   +      +Y G   +   L  S    D I    I   +  +L D V    V SSD FY                 VEME  +LF+ +     ++A +L  SD L+
  S:     6 HLEAGPGDVAPLVVAVGDPGRAERLATGLLEDARLVSSARGLKVYTGSFNGSEVTIATHGIGGPSAAVV-FEELRMLGAEVLVRLGTSGGLSKDLRLGDVVVAAGAGCYWGSGGSIQYAG--ERPMCLPASP---DPILTAGIYRGLSSRLGDRVVLAPVMSSDAFYAETPEAAGRWRSLGMAAVEMELHTLFSISWIRGFRSAGVLIVSDLLL 213
>gi|159042107|ref|YP_001541359.1| purine phosphorylase family 1 [Caldivirga maquilingensis IC-167] >gi|157920942|gb|ABW02369.1| purine or other phosphorylase family 1 [Caldivirga maquilingensis IC-167] (238 aa)
Score = 198, Expect = 8.4e-14, Identities = 61/207 (29%), Positives = 103/207 (49%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA--YSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSL 216
           M  H +  KG++++ V++ GDP RA+ +A   L++ ++IN+ RG L YTG YN  E+T+  HG+G  S  I   EL +     VI+R+G+A +   DI  G +++   A   +   YA+Y+G       +   + L  +I  +   + +      ++SSD FY A   + ++        VEME   LF   +    K    L  ++ L
  S:     1 MPIHLKVSKGDVSERVIVVGDPARARQLA-GMLKDSRIINENRGFLAYTGSYNGVEITIATHGIGAPSAAIVIEELVSM-GARVIVRLGTAAALRNDIEPGTVLIPSGAGYNAGGIYAQYLGSGVIYPAVPNHEVLLKLI-SSFTNSGLNFIIGAIYSSDAFY-AEEDLPRMLGSRGVIGVEMECAILFLLGLIRGIKTGAALVVTNKL 205
>gi|50914945|ref|YP_060917.1| uridine phosphorylase [Streptococcus pyogenes MGAS10394] >gi|50904019|gb|AAT87734.1| Uridine phosphorylase [Streptococcus pyogenes MGAS10394] (259 aa)
Score = 196, Expect = 1.4e-13, Identities = 67/208 (32%), Positives = 101/208 (48%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIAS-----------DTKSQVVEMESFSLFANAIKLNKKAAT 208
           M  Y+ E  +  H + + G++ + V+MPGDP R   IAE+F +N  L+ D R  + YTG  N ++V+V   G+G  S  I   EL      D  IRVG+ G    D+  GD+V+   A   E T  +Y  IE    + LE ++ L +  +K    ++      VV   D FYG +       S              ++  EMES +LF  A  L  +  +
  S:     1 MQNYSGEVGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAEHF-DNAVLVADSREYVTYTGTLNGEKVSVTSTGIGGPSASIAMEEL-KLCGADTFIRVGTCGGIELDVKGGDIVIATGAIRMEGTSKEYAPIEFPAVADLEVTNALVNAAKKLGYTSHAG----VVQCKDAFYGQHEPERMPVSYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGS 215
>gi|15675688|ref|NP_269862.1| putative uridine phosphorylase [Streptococcus pyogenes M1 GAS] >gi|19746796|ref|NP_607932.1| putative uridine phosphorylase [Streptococcus pyogenes MGAS8232] >gi|21911149|ref|NP_665417.1| putative uridine phosphorylase [Streptococcus pyogenes MGAS315] >gi|22538207|ref|NP_689058.1| uridine phosphorylase [Streptococcus agalactiae 2603V/R] >gi|25012064|ref|NP_736459.1| uridine phosphorylase [Streptococcus agalactiae NEM316] >gi|28895166|ref|NP_801516.1| putative uridine phosphorylase [Streptococcus pyogenes SSI-1] >gi|71904242|ref|YP_281045.1| uridine phosphorylase [Streptococcus pyogenes MGAS6180] >gi|71911400|ref|YP_282950.1| uridine phosphorylase [Streptococcus pyogenes MGAS5005] >gi|76787602|ref|YP_330601.1| uridine phosphorylase [Streptococcus agalactiae A909] >gi|76798807|ref|ZP_00781020.1| uridine phosphorylase [Streptococcus agalactiae 18RS21] >gi|77409158|ref|ZP_00785871.1| uridine phosphorylase [Streptococcus agalactiae COH1] >gi|77411829|ref|ZP_00788163.1| uridine phosphorylase [Streptococcus agalactiae CJB111] >gi|77412985|ref|ZP_00789188.1| uridine phosphorylase [Streptococcus agalactiae 515] >gi|94989222|ref|YP_597323.1| uridine phosphorylase [Streptococcus pyogenes MGAS9429] >gi|94991167|ref|YP_599267.1| uridine phosphorylase [Streptococcus pyogenes MGAS10270] >gi|94993109|ref|YP_601208.1| uridine phosphorylase [Streptococcus pyogenes MGAS2096] >gi|94995041|ref|YP_603139.1| Uridine phosphorylase [Streptococcus pyogenes MGAS10750] >gi|139473139|ref|YP_001127854.1| putative uridine phosphorylase [Streptococcus pyogenes str. Manfredo] >gi|22535118|gb|AAN00931.1|AE014285_13 uridine phosphorylase [Streptococcus agalactiae 2603V/R] >gi|13622903|gb|AAK34583.1| putative uridine phosphorylase [Streptococcus pyogenes M1 GAS] >gi|19749030|gb|AAL98431.1| putative uridine phosphorylase [Streptococcus pyogenes MGAS8232] >gi|21905360|gb|AAM80220.1| putative uridine phosphorylase [Streptococcus pyogenes MGAS315] >gi|24413607|emb|CAD47685.1| Unknown [Streptococcus agalactiae NEM316] >gi|28810411|dbj|BAC63349.1| putative uridine phosphorylase [Streptococcus pyogenes SSI-1] >gi|71803337|gb|AAX72690.1| uridine phosphorylase [Streptococcus pyogenes MGAS6180] >gi|71854182|gb|AAZ52205.1| uridine phosphorylase [Streptococcus pyogenes MGAS5005] >gi|76562659|gb|ABA45243.1| uridine phosphorylase [Streptococcus agalactiae A909] >gi|76585845|gb|EAO62390.1| uridine phosphorylase [Streptococcus agalactiae 18RS21] >gi|77160997|gb|EAO72105.1| uridine phosphorylase [Streptococcus agalactiae 515] >gi|77162106|gb|EAO73083.1| uridine phosphorylase [Streptococcus agalactiae CJB111] >gi|77172242|gb|EAO75398.1| uridine phosphorylase [Streptococcus agalactiae COH1] >gi|94542730|gb|ABF32779.1| uridine phosphorylase [Streptococcus pyogenes MGAS9429] >gi|94544675|gb|ABF34723.1| Uridine phosphorylase [Streptococcus pyogenes MGAS10270] >gi|94546617|gb|ABF36664.1| Uridine phosphorylase [Streptococcus pyogenes MGAS2096] >gi|94548549|gb|ABF38595.1| Uridine phosphorylase [Streptococcus pyogenes MGAS10750] >gi|134271385|emb|CAM29605.1| putative uridine phosphorylase [Streptococcus pyogenes str. Manfredo] (259 aa)
Score = 196, Expect = 1.5e-13, Identities = 67/208 (32%), Positives = 101/208 (48%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIAS-----------DTKSQVVEMESFSLFANAIKLNKKAAT 208
           M  Y+ E  +  H + + G++ + V+MPGDP R   IAE+F +N  L+ D R  + YTG  N ++V+V   G+G  S  I   EL      D  IRVG+ G    D+  GD+V+   A   E T  +Y  IE    + LE ++ L +  +K    ++      VV   D FYG +       S              ++  EMES +LF  A  L  +  +
  S:     1 MQNYSGEVGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAEHF-DNAVLVADSREYVTYTGTLNGEKVSVTSTGIGGPSASIAMEEL-KLCGADTFIRVGTCGGIDLDVKGGDIVIATGAIRMEGTSKEYAPIEFPAVADLEVTNALVNAAKKLGYTSHAG----VVQCKDAFYGQHEPERMPVSYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGS 215
>gi|110801850|ref|YP_697699.1| uridine phosphorylase [Clostridium perfringens SM101] >gi|110682351|gb|ABG85721.1| uridine phosphorylase [Clostridium perfringens SM101] (261 aa)
Score = 193, Expect = 3.2e-13, Identities = 59/159 (37%), Positives = 82/159 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYG 171
           H     GE+ K V+MPGDP R   IA+ +L+N KLI D R  + YTGY + ++V+V   G+G  S  I   EL      D  IRVG+ G    ++  GDL++ T    +E T  +Y  IE     +   D +N ++ K A E  +     VV S D FYG
  S:    12 HIDVAPGEVGKYVIMPGDPKRCAKIAK-YLDNAKLIADKREYVTYTGYLDGEKVSVTSTGIGGPSAAIALEELVKC-GADTFIRVGTCGGIDLNVKGGDLIIATGSIRAEGTSREYAPIEF--PAVANLDVINALV-KGAKELKVPYHTGVVQSKDSFYG 166
>gi|18309369|ref|NP_561303.1| uridine phosphorylase [Clostridium perfringens str. 13] >gi|110800653|ref|YP_694832.1| uridine phosphorylase [Clostridium perfringens ATCC 13124] >gi|168204432|ref|ZP_02630437.1| uridine phosphorylase [Clostridium perfringens E str. JGS1987] >gi|168216526|ref|ZP_02642151.1| uridine phosphorylase [Clostridium perfringens NCTC 8239] >gi|18144045|dbj|BAB80093.1| probable uridine phosphorylase [Clostridium perfringens str. 13] >gi|110675300|gb|ABG84287.1| uridine phosphorylase [Clostridium perfringens ATCC 13124] >gi|170664047|gb|EDT16730.1| uridine phosphorylase [Clostridium perfringens E str. JGS1987] >gi|182381555|gb|EDT79034.1| uridine phosphorylase [Clostridium perfringens NCTC 8239] (261 aa)
Score = 191, Expect = 5.1e-13, Identities = 58/159 (36%), Positives = 82/159 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYG 171
           H     GE+ K V+MPGDP R   IA+ +L+N KL+ D R  + YTGY + ++V+V   G+G  S  I   EL      D  IRVG+ G    ++  GDL++ T    +E T  +Y  IE     +   D +N ++ K A E  +     VV S D FYG
  S:    12 HIDVAPGEVGKYVIMPGDPKRCAKIAK-YLDNAKLVADKREYVTYTGYLDGEKVSVTSTGIGGPSAAIALEELVKC-GADTFIRVGTCGGIDLNVKGGDLIIATGSIRAEGTSREYAPIEF--PAVANLDVINALV-KGAKELKVPYHTGVVQSKDSFYG 166
>gi|153815191|ref|ZP_01967859.1| hypothetical protein RUMTOR_01423 [Ruminococcus torques ATCC 27756] >gi|145847450|gb|EDK24368.1| hypothetical protein RUMTOR_01423 [Ruminococcus torques ATCC 27756] (260 aa)
Score = 186, Expect = 1.8e-12, Identities = 59/171 (34%), Positives = 82/171 (47%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE---AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYG 171
           M  Y+++     H +  KGEI K V+MPGDP R   IA+ +L+NP LI D R  + YTG  +  +V+V   G+G  S  I   EL      D  IR+G+ G    D+  GD+V++  A   E T  +Y  IE     D T      + + + K            VV   D FYG
  S:     1 MKNYSEDPNRQYHIQTAKGEIGKYVIMPGDPKRCVKIAQ-YLDNPVLIADNREYVTYTGTLDQVKVSVTSTGIGGPSAAIAMEEL-CRCGADTFIRIGTCGGMQTDVKSGDIVVSTGAIRMEGTSREYAPIEFPAVPDLT------VTNALVKAVKSKGYPFHTGVVQCKDSFYG 167
>gi|153852951|ref|ZP_01994388.1| hypothetical protein DORLON_00373 [Dorea longicatena DSM 13814] >gi|149754593|gb|EDM64524.1| hypothetical protein DORLON_00373 [Dorea longicatena DSM 13814] (261 aa)
Score = 182, Expect = 5.5e-12, Identities = 63/207 (30%), Positives = 98/207 (47%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVE-----------QIASDTKSQVVEMESFSLFANAIKLNKKAA 207
           M  Y+++     H +  KGE+ + V+MPGDP R + IA  +L++P L+   R    YTG  + ++V+V   G+G  S  I   EL      D  +R+G+ G    ++  GD+V+ T     E T  +Y  IE        + E+ + + + A E+       VV S D FYG +               +          EMES +LF  A KL  +A 
  S:     1 MKNYSEDASRQYHIQVAKGEVGRYVIMPGDPGRCEKIAA-YLDDPVLVASNREFTTYTGMLDGEKVSVTSTGIGGPSAAIAMEELVRC-GADTFVRIGTCGGMQPEVKSGDIVIATGSIRMEGTSKEYAPIEYPAV---ANLEVTNALVQAAKEDGCTWHTGVVQSKDAFYGQHEPEAMPVGYELLNKWEAWKKMGCLASEMESAALFIVAGKLRVRAG 214
>gi|66880261|ref|ZP_00405244.1| COG0813: Purine-nucleoside phosphorylase [Mycoplasma genitalium G-37] (120 aa)
Score = 179, Expect = 1.1e-11, Identities = 51/118 (43%), Positives = 76/118 (64%)
  Q:   128 IGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           +G+E  +D  L  +  L ++ ++TAI+N +   + +V   D FY   + V  +A +  S  VEME+ +L+ANAI L KKA TLLT SDSLVTHE++S+E RQ  F  M  LAL++ +K+
  S:     1 MGVEIPEDKILFATSSLVELAKETAIKNKLDFHEGLVFCEDAFYQTRKDVISLAKEKNSLAVEMEAHALYANAILLKKKALTLLTVSDSLVTHEALSSELRQKSFKQMALLALEMTQKL 119
>gi|153811574|ref|ZP_01964242.1| hypothetical protein RUMOBE_01966 [Ruminococcus obeum ATCC 29174] >gi|149832315|gb|EDM87400.1| hypothetical protein RUMOBE_01966 [Ruminococcus obeum ATCC 29174] (261 aa)
Score = 178, Expect = 1.7e-11, Identities = 63/208 (30%), Positives = 103/208 (49%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR-SVEQIASDTKSQ----------VVEMESFSLFANAIKLNKKAAT 208
           M  Y+++     H +  KGE+ + V++PGDP R K IA+ F ++P  + D R  + YTG  +  +V+V   G+G  S  I   EL+     D  +R+G+ G    ++  GD+V+   A   E T  +Y  IE    + LE  + L    +K   E +      VV   D FYG +    + ++ +  ++            EMES +LF  A  L  +A +
  S:     1 MKNYSEDASKQYHIQVGKGEVGRYVILPGDPKRCKKIAQYF-DDPVFVADNREYVTYTGTLDGVKVSVTSTGIGGPSASIAMEELYRC-GADTFVRIGTCGGMQTEVKSGDIVIATGAIRMEGTSKEYAPIEFPAVANLEVLNALVAGAKKEGCEFHTG----VVQCKDAFYGQHEPETKPVSYELMNKWEAWKRLGCLASEMESAALFVVASHLRVRAGS 215
>gi|126465600|ref|YP_001040709.1| purine-nucleoside phosphorylase [Staphylothermus marinus F1] >gi|126014423|gb|ABN69801.1| purine-nucleoside phosphorylase [Staphylothermus marinus F1] (238 aa)
Score = 176, Expect = 2.4e-11, Identities = 66/224 (29%), Positives = 117/224 (52%)
  Q:    21 IAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMG--MASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA------YSESTYAKYI-GIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHES-MSAEDRQTKFVNMINLALKVVEK 244
           ++ +V++ GDP R  ++    LENPK+I D RG++   G Y  +++T+  HG+G  MASI +   E         IIR+G+AGS  ++I +GD+VL   A         + Y+  I G  + D  L     L+++    +   NIK    +V +SD FY     ++++ ++     V+ME+  L+        +  ++L  S+SLV     ++  +   KFV +  L L+ + +
  S:    12 VSDLVIVMGDPDRV-YLLSTLLENPKIIYDRRGIVVVNGEYKGRKITLASHGIGCPMASIIL---EELGMLGAKTIIRIGTAGSLVENIGLGDIVLVAGAGYMLNGCGNNMYSPEINGGTSPDPLL-----LSEIYHYLS-HYNIKPHIGLVFTSDAFYAEENIIDKL-TNKGFIAVDMETAILYMLGWMRKWRTLSILVVSNSLVKKTPLLTTYELAEKFVELAKLVLEYLAR 234
>gi|158321396|ref|YP_001513903.1| purine phosphorylase family 1 [Alkaliphilus oremlandii OhILAs] >gi|158141595|gb|ABW19907.1| purine or other phosphorylase family 1 [Alkaliphilus oremlandii OhILAs] (244 aa)
Score = 175, Expect = 3.2e-11, Identities = 51/133 (38%), Positives = 70/133 (52%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL---------TKKAYSESTYAKYIGIEAKDSTLEGSDELN 144
           PH R  K +++ +V+MPGDP R   I E FLE+ K ++  R     TGYY   ++T    G+G AS  I   E  A      IIRVGS G+    I +GDL+L           K Y ES+Y     +E     ++ + ELN
  S:     4 PHIRCSKEDVSSMVIMPGDPKRVDRIGE-FLEDVKEVSYNREFKTITGYYKGVKITATSTGIGGASAAIAIEEHVAI-GAKYIIRVGSCGALQSHIQIGDLILPTSAIRDEGASKMYVESSYPASCDVELATIMIQKAKELN 143
>gi|56807963|ref|ZP_00365778.1| COG2820: Uridine phosphorylase [Streptococcus pyogenes M49 591] (250 aa)
Score = 175, Expect = 3.6e-11, Identities = 64/199 (32%), Positives = 95/199 (47%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIAS-----------DTKSQVVEMESFSLFANAIKLNKKAAT 208
           M  H + +  +  + V+MPGDP R   IAE+F +N  L+ D R  + YTG  N ++V+V   G+G  S  I   EL      D  IRVG+ G    D+  GD+V+   A   E T  +Y  IE    + LE ++ L +  +K    ++      VV   D FYG +       S              ++  EMES +LF  A  L  +  +
  S:     1 MQYHLQIRPCDGGRYVIMPGDPKRCPKIAEHF-DNAVLVADSREYVTYTGTLNGEKVSVTSTGIGGPSASIAMEEL-KLCGADTFIRVGTCGGIDLDVKGGDIVIATGAIRMEGTSKEYAPIEFPAVADLEVTNALVNAAKKLGYTSHAG----VVQCKDAFYGQHEPERMPVSYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGS 206
>gi|110669085|ref|YP_658896.1| uridine phosphorylase [Haloquadratum walsbyi DSM 16790] >gi|109626832|emb|CAJ53300.1| uridine phosphorylase [Haloquadratum walsbyi DSM 16790] (245 aa)
Score = 175, Expect = 3.7e-11, Identities = 63/214 (29%), Positives = 98/214 (45%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAE 225
           PH   + G+I ++ L+PGDP R   IAE+  EN + + + R        YN+  VT+   G+G  S  I   EL A   V+ +IRVG+ G+   DI +GD+++ T  A  E T  +Y     +D  L       D +R            V VH     + D FY    +  +   +     +EME+ ++F  A +    A  + T   +LVT     A+
  S:     5 PHLLIESGDINEIALIPGDPGRVNRIAEH-CENIRPVAENREYTIVNATYNDVPVTICSTGIGGPSAAIAVEEL-ARVGVETVIRVGTIGALQSDIEIGDMIVATAAAKEEGTSKRY-----EDPVLPAVPHF-DTVRALTDAAEEHTDAVPVHVGPIVTDDAFYNETDTYIEAWEEANLLAIEMEAAAVFTIARRHGLAAGAICTVDGNLVTGTQKGAD 216
>gi|145590851|ref|YP_001152853.1| purine phosphorylases family protein 1 [Pyrobaculum arsenaticum DSM 13514] >gi|145282619|gb|ABP50201.1| purine and other phosphorylases, family 1 [Pyrobaculum arsenaticum DSM 13514] (244 aa)
Score = 173, Expect = 6.5e-11, Identities = 70/234 (29%), Positives = 104/234 (44%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGD--LVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           M  H RA +G++A VV+  GDP RAK  A + L+  + +N+ R  + YTGY+  + +TV  HG+G  S  I   EL     ++V IR+G+AGS+  D+ VGD  +     A        Y G       L    +L       A+   I      V SSD FY  +    +     ++  VEME  +  A       K   +L  S+ +  H+ +   +R          AL VVE
  S:     1 MPYHIRAGEGDVAPVVIGVGDPARAKLFA-SLLDGARQVNEHRYPV-YTGYFRGRPITVAAHGIGGPSAAIAIEEL-RMLGMEVFIRIGTAGSF-GDLEVGDVVVAAAAAAPPGGVLGAYFG--GHLPPLAADPQLT-----LALAKAIGARMGYVVSSDAFYAEDPHFAEFWKSRRALAVEMECATAMALGWLRGFKTGCVLVISNIVGRHDVVDLTERFKDVFFKTLTALDVVE 225
>gi|119718978|ref|YP_919473.1| purine phosphorylases family protein 1 [Thermofilum pendens Hrk 5] >gi|119524098|gb|ABL77470.1| purine-nucleoside phosphorylase [Thermofilum pendens Hrk 5] (239 aa)
Score = 173, Expect = 7.0e-11, Identities = 43/108 (39%), Positives = 62/108 (57%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYS 120
           H  AK  +IA  V+  GDP R K ++ ++L+NP+L+N+ RG L YTG Y    VTV  H +G  S  I   EL       +I+R G+ G +  ++ VGD V+ T  +YS
  S:     6 HILAKPEDIAPRVIASGDPARVKQLS-SYLDNPRLVNENRGFLVYTGTYKGVPVTVATHMIGAPSAAIVFEELIML-GAKLIVRFGTCGGFLPEMRVGDFVIATGASYS 112
>gi|119873062|ref|YP_931069.1| purine phosphorylases family protein 1 [Pyrobaculum islandicum DSM 4184] >gi|119674470|gb|ABL88726.1| purine and other phosphorylases, family 1 [Pyrobaculum islandicum DSM 4184] (222 aa)
Score = 170, Expect = 1.2e-10, Identities = 69/236 (29%), Positives = 114/236 (48%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS------ESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           M  H  AK GEIA VV+  GDP RAK  A + +E  +L+N+ R ++ YTG    + V+++ HG+G  S+ I + E      ++V +R+G+AGS+  D+ +GD+++   A +       + +  Y    + D  L           K A   N  +  VV  SSD FY  +    +      +  VEME  +  A       K   +L  S+ +  HE +   D + +F+ +     +V+E I
  S:     1 MPYHIWAKPGEIAPVVIGVGDPARAKLFA-SLMEESQLVNENRYLV-YTGNVRGRAVSIVAHGIGGPSVAI-ALEELKMLGMEVFVRIGTAGSF-GDLKIGDVLIAAAAAAPVGGLLNAYFPGYSPPLSADPYL---------TVKLAQALNAPIGYVV--SSDAFYAEDPQFVEFWQRRGALAVEMECATAMALGWLRGFKVGCVLVISNIVGRHEVI---DLRGRFIEVFR---RVIETI 221
>gi|149921006|ref|ZP_01909466.1| uridine phosphorylase [Plesiocystis pacifica SIR-1] >gi|149818138|gb|EDM77594.1| uridine phosphorylase [Plesiocystis pacifica SIR-1] (282 aa)
Score = 167, Expect = 3.2e-10, Identities = 40/107 (37%), Positives = 60/107 (56%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYD---VDVIIRVGSAGSYTKDINVGDLVLTKKAY 119
           H   + G++A  +L+ GDP RAK +AE F ++       R  + YTG Y    ++VMG GM  A+  I   EL   ++      IIR GS G+   +I +GDLV+T+ A+
  S:    18 HIGLRPGDVAPAILLVGDPKRAKRVAEGFFDDYGDPITEREFVTYTGTYRGMPMSVMGTGMSAANTEIAVIELCQLFEDASSVAIIRAGSCGALQANIGLGDLVITQAAH 127
>gi|150017967|ref|YP_001310221.1| uridine phosphorylase [Clostridium beijerinckii NCIMB 8052] >gi|149904432|gb|ABR35265.1| uridine phosphorylase [Clostridium beijerinckii NCIMB 8052] (261 aa)
Score = 166, Expect = 3.8e-10, Identities = 44/119 (36%), Positives = 66/119 (55%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYIGIE 131
           H   ++G++ K V++PGDP R K IA  F ++PKLI D R  + YTG+ +  +V+V   G+G  S  I   EL      D  +RVG+ G    ++  GD+V+   A  +E T  +Y  IE
  S:    12 HIDVREGDVGKYVILPGDPKRCKKIAAYF-DDPKLIADNREYVTYTGFLDGVKVSVTSTGIGGPSAAIALEELVNC-GADTFVRVGTCGGMDINVKGGDVVIATGAIRAEGTSKEYAPIE 129
>gi|18312657|ref|NP_559324.1| purine nucleoside phosphorylase [Pyrobaculum aerophilum str. IM2] >gi|18160131|gb|AAL63506.1| purine nucleoside phosphorylase [Pyrobaculum aerophilum str. IM2] (221 aa)
Score = 165, Expect = 4.6e-10, Identities = 73/226 (32%), Positives = 112/226 (49%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES---TYAKYIGIE---AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMI 235
           M  H RAK  ++A VV+  GDP RAK  A + +E   L+N+ R  + YTG    K +TV+ HG+G  S  I   EL     ++V +RVG+AGS   D+NVGD+V+   A + +     A Y G     A D  L  + +L + +R        ++  VV  SSD FY  + +  +      +  VEME  +  A       K   +L  S+ +  HE++   ++ T+    I
  S:     1 MPYHIRAKPEDVAPVVIGVGDPARAKLFA-SLMEEAVLVNEHRYPV-YTGRAAGKRITVVAHGIGGPSAAIAIEEL-KMLGMEVFVRVGTAGSL-GDLNVGDVVVAAAAAAPTGGVLGAYYPGFNPPLAADPGL--TLKLAEALRA-------RVGYVV--SSDAFYAEDPNFAEFWKRRGALAVEMECAAAMALGWLRGFKTGCVLVISNVVGRHEAVDLREKFTEVFKKI 217
>gi|57641414|ref|YP_183892.1| uridine phosphorylase [Thermococcus kodakarensis KOD1] >gi|57159738|dbj|BAD85668.1| uridine phosphorylase [Thermococcus kodakarensis KOD1] (277 aa)
Score = 160, Expect = 1.9e-09, Identities = 67/223 (30%), Positives = 105/223 (47%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY-GANRS---------VEQIASDTKSQVV---EMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFV 232
           M  H   K G++A+ VL+PGDP R   I+ +  +  + I   R    +TG Y    ++V   G+G  S  I   EL A    D  IRVGS G+    I +GDL++ K A   E T  +Y+ +E    + LE +  L +      +  +I +T     S+D FY G  R             +  D +   V   EME+ +L+  A     +A  +     + VT+E   A +++   V
  S:    17 MQYHIACKPGDVARYVLLPGDPERVPKIS-SLWDEAREIAFHREYRTHTGKYKGVPISVTSTGIGGPSTAIAIEELAAI-GADTFIRVGSTGAIQPGIEIGDLIIAKAAVRLEGTSKQYVRVEYPAVADLEVTLALIEAAESLGVRYHIGIT----ASTDSFYLGQGRPGLNGYFPSFARNLVDDLRQARVTNFEMEAATLYTLANIYGLRAGCVCAVFANRVTNEFGKAGEKEAALV 248
>gi|160901788|ref|YP_001567369.1| purine phosphorylase family 1 [Petrotoga mobilis SJ95] >gi|160359432|gb|ABX31046.1| purine or other phosphorylase family 1 [Petrotoga mobilis SJ95] (262 aa)
Score = 160, Expect = 2.0e-09, Identities = 56/200 (28%), Positives = 95/200 (47%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--EMESFSLFANAIKLNKKAATLLTC 212
           H +   G++A VV++PGD  R + I    L +PK +++ RG++ YTGY+ +  V+V   GMG  S  I  YE        ++IR+GS     ++I  GD+++      +   ++Y     ++     S E+   +   A   N+     +  S   FY  NR  E     ++ +VV  +ME+ SLF  +     KA  +  C
  S:    19 HIQCGPGDVAPVVIVPGDQGRVESIISK-LHDPKKVSENRGLITYTGYHEDYPVSVTSTGMGGPSASIV-YEELINIGAKILIRIGSVAGLQEEIEEGDVIIPHACVRDDGASQY--YVPQNFPAVASPEVYLRLISAAKSLNLDFKTGINWSHSCFY--NRDPEYFQRWSRYRVVSMDMEASSLFVVSALRGVKAGFIGIC 214
>gi|119719044|ref|YP_919539.1| purine phosphorylases family protein 1 [Thermofilum pendens Hrk 5] >gi|119524164|gb|ABL77536.1| purine and other phosphorylases, family 1 [Thermofilum pendens Hrk 5] (242 aa)
Score = 160, Expect = 2.1e-09, Identities = 62/233 (26%), Positives = 106/233 (45%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST---YAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           H +A   +++  +L+ GDP R +  A + L+   ++N  RG L  TG Y  + VT+  HG+G  S  I  +E  A     V+IR G+ G  T     G + L + A  E++   Y  + G+     +T E    L  V+R    E  +     +  S D F+    +  + AS      +EMES +LFA       K   +    D+L++   +  E R+   + M+   L+ + ++
  S:    12 HIKASPEQVSPKILVCGDPGRVE-AASSLLDGATVVNRHRGYLVVTGEYRGERVTLATHGIGAPSAAIV-FEELAMLGAKVMIRAGTCGGLTPIAESGKIALIEAAAYENSGTLYQYFGGVSMPAYATPEVVLTLESVLR----EKGLSFVRGIALSHDAFHKVEENARRWAS-LGVDFLEMESATLFALGRLRGVKVGAMALVVDNLLSGSEL-VEGREELELKMVEAGLEALRRM 240
>gi|24637398|gb|AAN63676.1|AF454495_1 DeoD [Streptococcus thermophilus] (173 aa)
Score = 158, Expect = 3.0e-09, Identities = 56/169 (33%), Positives = 86/169 (50%)
  Q:    74 GMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           G ASI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     2 GDASISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMETAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 170
>gi|52426373|ref|YP_089510.1| uridine phosphorylase [Mannheimia succiniciproducens MBEL55E] >gi|52308425|gb|AAU38925.1| Udp protein [Mannheimia succiniciproducens MBEL55E] (253 aa)
Score = 156, Expect = 5.7e-09, Identities = 52/188 (27%), Positives = 88/188 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           AKV ++PGDP R++ IA+  +EN + +N  R    + GY + + + V   G+G  S+ I   EL A   V   +R+G+ G+    INVGD+++T  A      +++       +  + +    + +   A+   I+    +  SSD FY      +  +               D      EMES +LF     L  KA  +
  S:    17 AKVAIVPGDPARSERIAKE-MENAEYLNSTREFTSWLGYMDGEPIVVCSTGIGGPSVSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDILITTGAVRLDGASQHFAPLEYPAVADFA--CTNALYNAALSQGIRPYVGITASSDTFYPGQERYDTFSGKVYPKFQGTLKQWQDLNVMNYEMESATLFTMCAALGLKAGMV 214
>gi|24637420|gb|AAN63696.1|AF454496_1 DeoD [Streptococcus thermophilus] (172 aa)
Score = 156, Expect = 6.0e-09, Identities = 57/169 (33%), Positives = 86/169 (50%)
  Q:    74 GMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           GM SI IY+ EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 GMPSISIYARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 169
>gi|16762219|ref|NP_457836.1| uridine phosphorylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143708|ref|NP_807050.1| uridine phosphorylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|168223012|ref|ZP_02648244.1| probable uridine phosphorylase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227403|ref|ZP_02652634.1| probable uridine phosphorylase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168234231|ref|ZP_02659289.1| probable uridine phosphorylase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194471575|ref|ZP_03077559.1| uridine phosphorylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|25326509|pir||AC0923 probable uridine phosphorylase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504523|emb|CAD09405.1| probable uridine phosphorylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139343|gb|AAO70910.1| probable uridine phosphorylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|194457939|gb|EDX46778.1| uridine phosphorylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (247 aa)
Score = 154, Expect = 8.7e-09, Identities = 70/233 (30%), Positives = 111/233 (47%)
  Q:    10 MTPHNRAKKGEI-AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSE----STYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--EMESFSLFANAIKLNKKAATLLT-------CSDSLVTH----ESM--SAEDRQTKFVNMINLALKVV 242
           M PH R       AK  L+PGDP R   IA  FL+  +++   R      G+Y   E+ V+  G+G  S  I   EL     V+ +IR+GS G+    + +GD+++   A ++     TYA        D  L  +      + + A + NI     +V S D FY  +R  E  A  +   V+  +ME+ +L         + A+LL        C +S + H    E++    E+RQ      I+LAL+ +
  S:     1 MQPHIRLNTSMTRAKYALLPGDPGRVDRIAR-FLDKAEILGQNREFRAARGWYQGVEIVVLSTGIGGPSTAIAIEELRQV-GVNTLIRIGSCGALQDSLALGDVIIAHGAVADDGASKTYAPASYPACADPYLTAT------LIQQAKQMNISAVCGLVRSHDSFY-TDREAELDAEWSARGVLGADMETAALMVVGALRGLRTASLLNVVVAHSGCLESSINHYVQQETLCQQGEERQ------ISLALQAI 238
>gi|68057084|gb|AAX87337.1| uridine phosphorylase [Haemophilus influenzae 86-028NP] (259 aa)
Score = 154, Expect = 1.0e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    24 ATLAIVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASCHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 221
>gi|145628610|ref|ZP_01784410.1| uridine phosphorylase [Haemophilus influenzae 22.1-21] >gi|161761279|ref|YP_247997.2| uridine phosphorylase [Haemophilus influenzae 86-028NP] >gi|144979080|gb|EDJ88766.1| uridine phosphorylase [Haemophilus influenzae 22.1-21] (252 aa)
Score = 154, Expect = 1.0e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASCHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|91794424|ref|YP_564075.1| uridine phosphorylase [Shewanella denitrificans OS217] >gi|91716426|gb|ABE56352.1| uridine phosphorylase [Shewanella denitrificans OS217] (252 aa)
Score = 153, Expect = 1.1e-08, Identities = 56/186 (30%), Positives = 88/186 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLFANAIKLNKKAA 207
           A + ++PGDP R K IAE  +EN   +   R    Y  Y + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R+  +E ++ +T     SSD FY      + ++    S+ V              EMES +LF        KAA
  S:    17 ASLAIVPGDPERVKRIAE-LMENATFLASHREYTSYLAYIDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPLEFPAAADFECTTAMVAAAREAGLEPHVGIT----ASSDTFYPGQERYDTVSGRVTSRYVGSMKEWQSMGVLNYEMESATLFTMCATQGWKAA 212
>gi|146320584|ref|YP_001200295.1| uridine phosphorylase [Streptococcus suis 98HAH33] >gi|145691390|gb|ABP91895.1| uridine phosphorylase [Streptococcus suis 98HAH33] (248 aa)
Score = 153, Expect = 1.2e-08, Identities = 60/187 (32%), Positives = 86/187 (45%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR-SVEQIASDTKSQVVEMESFSLF 196
           + PH R    + A+  ++PGDP R   +AE FL++ + I   R      G Y    V V   GMG AS GI   EL A   V+ +IR+GS G+   ++ +GDLV+   A   E T   Y  ++     +   D L   +R TA+         +  S D FY  N   V+   S       +MES +LF
  S:     3 LQPHIRCDIEQGARYAILPGDPQRVDRVAE-FLDSVEFIAFNREHKTMRGSYKGVPVLVTSTGMGGASTGIAVEEL-ARIGVECMIRIGSCGALQPEMQMGDLVILNGAVRDEGTSRAY--VDPIFPAVPDPDVLF-ALRGTAMNQGFAHHVGIARSHDSFYIDNELEVDHFWSKKGVLAGDMESAALF 186
>gi|15640011|ref|NP_219464.1| uridine phosphorylase (udp) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026250|ref|YP_001934022.1| uridine phosphorylase [Treponema pallidum subsp. pallidum SS14] >gi|6136115|sp|O83990|UDP_TREPA Uridine phosphorylase (UrdPase) (UPase) >gi|3323355|gb|AAC65977.1| uridine phosphorylase (udp) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018825|gb|ACD71443.1| uridine phosphorylase [Treponema pallidum subsp. pallidum SS14] (258 aa)
Score = 152, Expect = 1.6e-08, Identities = 70/231 (30%), Positives = 110/231 (47%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE---AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANR--------SVEQ-----IASDTKSQVVEMESFSLFA-NAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFV-NMINLALKVVE 243
           H   K  +I   V++PGDP R++ IA++F  +P  +   R  + YTG      V+VM  G+G  S  I   EL         IRVG++G    DI  G +V+   A   E T  +Y  +E     D T+  +      ++  A +  ++    VV   D FYG +          + Q     IA +T +   EMES +LF   +++  +  A LL   +   T  +   ED Q     N I +A++ V+
  S:    12 HIGLKASDIGHYVILPGDPARSEKIAQHF-SHPHKVGHNREYVTYTGTLCETPVSVMSTGIGGPSTAIGVEELIHL-GAHTFIRVGTSGGMQPDILAGTVVIATGAIRFEGTSKEYAPVEFPAVPDFTVTAA------LKHAAEDVQVRHALGVVQCKDNFYGQHSPHTMPVHAELTQKWHAWIACNTLAS--EMESAALFVLGSVRRVRTGAVLLVIGNQ--TRRAQGLEDIQVHDTENAIRVAVEAVK 249
>gi|118431732|ref|NP_148386.2| uridine phosphorylase [Aeropyrum pernix K1] >gi|116063054|dbj|BAA81116.2| uridine phosphorylase [Aeropyrum pernix K1] (282 aa)
Score = 152, Expect = 1.6e-08, Identities = 38/115 (33%), Positives = 58/115 (50%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKY 127
           H R ++G++A+ VL+PGDP R   IA    +  +L+   R    +TG+Y    ++V   G+G  S  I   EL      +  IRVG+ G   +D+  G LV+   A   E T  +Y
  S:    21 HLRVRRGDVARYVLLPGDPERTDLIAR-LWDEARLVAHHREYRTWTGFYKGTSISVTSTGIGSPSTAIAVEELLRV-GAETFIRVGTMGGIREDLRPGTLVIGSAAVRMEGTSGQY 134
>gi|1573245|gb|AAC21943.1| uridine phosphorylase (udp) [Haemophilus influenzae Rd KW20] (259 aa)
Score = 152, Expect = 1.7e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    24 ATLAIVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASHHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 221
>gi|152978110|ref|YP_001343739.1| uridine phosphorylase [Actinobacillus succinogenes 130Z] >gi|150839833|gb|ABR73804.1| uridine phosphorylase [Actinobacillus succinogenes 130Z] (257 aa)
Score = 152, Expect = 1.7e-08, Identities = 52/188 (27%), Positives = 86/188 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           AK+ ++PGDP R++ IA+  ++ P+ +   R    + GY  N+ V V   G+G  S+ I   EL A   V   +R+G+ G+    INVGD+++T  A      +++       +  + S    + +   A+   I     +  SSD FY      +  +               D      EMES +LF     L  KA  +
  S:    17 AKIAVIPGDPARSERIAQR-MDKPEFLASSREFTSWLGYLENEPVVVCSTGIGGPSVSICVEEL-AQLGVGTFLRIGTTGAIQPYINVGDVLVTTGAVRLDGASRHFAPLEYPAVADFS--CTNALYSAAVAQGITPYVGITASSDTFYPGQERYDTFSGKVYPAYQGSLKQWQDLNVMNYEMESATLFTMCAALGLKAGMV 214
>gi|24637513|gb|AAN63782.1|AF454501_1 DeoD [Streptococcus thermophilus] (173 aa)
Score = 152, Expect = 1.9e-08, Identities = 57/169 (33%), Positives = 86/169 (50%)
  Q:    74 GMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           G ASI IY+ EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     2 GDASISIYARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 170
>gi|148825441|ref|YP_001290194.1| uridine phosphorylase [Haemophilus influenzae PittEE] >gi|148715601|gb|ABQ97811.1| uridine phosphorylase [Haemophilus influenzae PittEE] (252 aa)
Score = 151, Expect = 1.9e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASRHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|145637848|ref|ZP_01793495.1| uridine phosphorylase [Haemophilus influenzae PittHH] >gi|145268950|gb|EDK08906.1| uridine phosphorylase [Haemophilus influenzae PittHH] (252 aa)
Score = 151, Expect = 2.1e-08, Identities = 54/188 (28%), Positives = 88/188 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     +  +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAVVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASCHFAPLEYPAVANFECTTALYNAAKAKGIEPYVGIT----ASSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|30995365|ref|NP_438448.2| uridine phosphorylase [Haemophilus influenzae Rd KW20] >gi|37538284|sp|P43770|UDP_HAEIN Uridine phosphorylase (UrdPase) (UPase) (252 aa)
Score = 151, Expect = 2.1e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASHHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|145638815|ref|ZP_01794424.1| uridine phosphorylase [Haemophilus influenzae PittII] >gi|145272410|gb|EDK12318.1| uridine phosphorylase [Haemophilus influenzae PittII] (252 aa)
Score = 150, Expect = 2.7e-08, Identities = 53/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R  + + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  +   +     +  +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFISWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTASVRLDGASCHFAPLEYPAVANFECTTALYNAAKAKGIEPYVGIT----ASSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|127514318|ref|YP_001095515.1| uridine phosphorylase [Shewanella loihica PV-4] >gi|126639613|gb|ABO25256.1| uridine phosphorylase [Shewanella loihica PV-4] (252 aa)
Score = 150, Expect = 3.1e-08, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLF 196
           A + ++PGDP R K IAE  ++NP  +   R    Y  Y + K + +   G+G  S  I   EL A   +D  +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R+  +E +I +T     SSD FY      + +      +                EMES +LF
  S:    17 ATLAIVPGDPERVKRIAE-LMDNPTFLASHREYTSYLAYIDGKPLVICSTGIGGPSTSIAVEEL-AQLGIDTFLRVGTTGAIQPQVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAASREAGLEPHIGIT----ASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESSTLF 201
>gi|42629743|ref|ZP_00155288.1| COG2820: Uridine phosphorylase [Haemophilus influenzae R2846] (252 aa)
Score = 150, Expect = 3.1e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASRHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|146318391|ref|YP_001198103.1| uridine phosphorylase [Streptococcus suis 05ZYH33] >gi|145689197|gb|ABP89703.1| probable uridine phosphorylase [Streptococcus suis 05ZYH33] (132 aa)
Score = 149, Expect = 3.7e-08, Identities = 43/119 (36%), Positives = 61/119 (51%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYI 128
           + PH R    + A+  ++PGDP R   +AE FL++ + I   R      G Y    V V   GMG AS GI   EL A   V+ +IR+GS G+   ++ +GDLV+   A   E T   Y+
  S:     3 LQPHIRCDIEQGARYAILPGDPQRVDRVAE-FLDSVEFIAFNREHKTMRGSYKGVPVLVTSTGMGGASTGIAVEEL-ARIGVECMIRIGSCGALQPEMQMGDLVILNGAVRDEGTSRAYV 120
>gi|148827433|ref|YP_001292186.1| uridine phosphorylase [Haemophilus influenzae PittGG] >gi|148718675|gb|ABQ99802.1| uridine phosphorylase [Haemophilus influenzae PittGG] (252 aa)
Score = 149, Expect = 4.0e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFTSWLGYINGQPIIVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTAAVRLDGASHHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|119773552|ref|YP_926292.1| uridine phosphorylase [Shewanella amazonensis SB2B] >gi|119766052|gb|ABL98622.1| uridine phosphorylase [Shewanella amazonensis SB2B] (252 aa)
Score = 148, Expect = 4.3e-08, Identities = 52/186 (27%), Positives = 86/186 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--------------VEMESFSLFANAIKLNKKAA 207
           A + ++PGDP R K IAE  ++ P  +   R    Y  Y + K V V   G+G  S  I   EL A   ++  +RVG+ G+    +NVGDL++T+ +   +     +  +E    +  E +  +    R   +E ++ +T     SSD FY      + ++     +                EMES +LF        +AA
  S:    17 ATLAIVPGDPERVKRIAE-LMDKPTFLASHREFTSYLAYLDGKPVVVCSTGIGGPSTSIAVEEL-AQLGINTFLRVGTTGAIQPHVNVGDLIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHVGVT----ASSDTFYPGQERYDTVSGRVTRRFEGSMKEWQEMGVLNYEMESATLFTMCASQGWRAA 212
>gi|145632523|ref|ZP_01788257.1| uridine phosphorylase [Haemophilus influenzae 3655] >gi|144986718|gb|EDJ93270.1| uridine phosphorylase [Haemophilus influenzae 3655] (252 aa)
Score = 148, Expect = 5.0e-08, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-IEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  +      +++   +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAK-LLDNPEFLASTREFTSWLGYLNGQPVVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTASVRLDGASRHFAPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----ASSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|157960289|ref|YP_001500323.1| uridine phosphorylase [Shewanella pealeana ATCC 700345] >gi|157845289|gb|ABV85788.1| uridine phosphorylase [Shewanella pealeana ATCC 700345] (252 aa)
Score = 147, Expect = 5.6e-08, Identities = 56/186 (30%), Positives = 85/186 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA---------YSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--------------VEMESFSLFANAIKLNKKAA 207
           A + ++PGDP R K IAE  +EN   +   R    Y  Y + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T+ +         ++   Y      E   + +  S       R+  +E +I +T     SSD FY      + ++     Q                EMES +LF        +AA
  S:    17 ASLAIVPGDPERVKRIAE-LMENATFLASHREYTSYLAYIDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEYPAVANFECTTAMVAAS-------REAGLEPHIGIT----ASSDTFYPGQERYDTVSGRITRQFKGSMQEWQDLGVLNYEMESSTLFTMCASQGWRAA 212
>gi|145640214|ref|ZP_01795798.1| uridine phosphorylase [Haemophilus influenzae R3021] >gi|145274800|gb|EDK14662.1| uridine phosphorylase [Haemophilus influenzae 22.4-21] (252 aa)
Score = 147, Expect = 5.6e-08, Identities = 53/188 (28%), Positives = 88/188 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  +   +     +  +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFTSWLGYVNGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTASVRLDGASCHFAPLEYPAVANFECTTALYNAAKAKGIEPYVGIT----ASSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|145635187|ref|ZP_01790892.1| uridine phosphorylase [Haemophilus influenzae PittAA] >gi|145267608|gb|EDK07607.1| uridine phosphorylase [Haemophilus influenzae PittAA] (252 aa)
Score = 147, Expect = 5.9e-08, Identities = 53/188 (28%), Positives = 88/188 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  +   +     +  +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFTSWLGYINGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTASVRLDGASCHFAPLEYPAVANFECTTALYNAAKAKGIEPYVGIT----ASSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|24637438|gb|AAN63712.1|AF454497_1 DeoD [Streptococcus thermophilus] (174 aa)
Score = 147, Expect = 6.0e-08, Identities = 56/169 (33%), Positives = 86/169 (50%)
  Q:    74 GMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           G ASI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     3 GDASISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 171
>gi|84387160|ref|ZP_00990182.1| uridine phosphorylase [Vibrio splendidus 12B01] >gi|84378021|gb|EAP94882.1| uridine phosphorylase [Vibrio splendidus 12B01] (242 aa)
Score = 147, Expect = 6.0e-08, Identities = 38/107 (35%), Positives = 63/107 (58%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           PH    + +IA +V++ G+P RA  IA + LE+ +++++ R    +TG Y  K ++V   G+G  S+ I + E   F  V  IIRVGSAG+    I +G+L++ + A
  S:     5 PHIGVDETQIAPLVIVCGEPDRANRIA-SLLEDAEMVSENREYRIFTGAYQGKAISVCSTGIGAPSM-IIAVEELKFCGVTHIIRVGSAGAMQSHIGLGELIIAEGA 109
>gi|24637473|gb|AAN63744.1|AF454499_1 DeoD [Streptococcus thermophilus] (173 aa)
Score = 147, Expect = 6.1e-08, Identities = 56/169 (33%), Positives = 86/169 (50%)
  Q:    74 GMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           G ASI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     2 GNASISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 170
>gi|145631043|ref|ZP_01786818.1| uridine phosphorylase [Haemophilus influenzae 22.4-21] >gi|144983328|gb|EDJ90810.1| uridine phosphorylase [Haemophilus influenzae R3021] (252 aa)
Score = 147, Expect = 6.6e-08, Identities = 53/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-IEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  +      +++   +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFTSWLGYVNGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTASVRLDGASRHFAPLEYPAVANFECTTALYNAAKAKGIEPYVGIT----ASSDTFYPGQERYDTYSGKVYRDYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|42630579|ref|ZP_00156118.1| COG2820: Uridine phosphorylase [Haemophilus influenzae R2866] (252 aa)
Score = 147, Expect = 6.7e-08, Identities = 53/188 (28%), Positives = 89/188 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           A + ++PGDP R++ IA+  L+NP+ +   R    + GY N + + V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  +   +     ++ +E    +  E +  L +  +   IE  + +T     SSD FY      +  +               D      EMES +LF     L  +A  +
  S:    17 ATLAIVPGDPARSERIAKQ-LDNPEFLASTREFTSWLGYVNGQPIVVCSTGIGGPSTSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLITTASVRLDGASHHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVT----VSSDTFYPGQERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMV 214
>gi|90408145|ref|ZP_01216314.1| uridine phosphorylase [Psychromonas sp. CNPT3] >gi|90310757|gb|EAS38873.1| uridine phosphorylase [Psychromonas sp. CNPT3] (252 aa)
Score = 146, Expect = 7.6e-08, Identities = 59/225 (26%), Positives = 102/225 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKIN 246
           A + ++PGDP R K IAE  ++N   +   R    Y  Y + K + +   G+G  S  I   EL A   V   +RVG+ G+  + +NVGD+++T+ +   +     +  +E    +  E +  +    R   IE +I +T     SSD FY      + ++               D      EMES +LF        +AA +     +    E  S E  +   V+ I++ +   +K++
  S:    17 ANLAIVPGDPERVKKIAE-LMDNATFLASHREYTSYLAYIDGKAIVICSTGIGGPSTSIAIEEL-AQLGVRTFLRVGTTGAIQEHVNVGDIIVTQASVRLDGASLHFAPMEYPAVADFECTTAVVAACRDAGIEPHIGIT----ASSDTFYPGQERYDTVSGRITRRFKGSMQEWQDLGVLNYEMESSTLFTMCASQGWRAACVAGVIVNRTQQEIPSVESMKKTEVDAISIVVAAAKKLS 251
>gi|126209301|ref|YP_001054526.1| uridine phosphorylase [Actinobacillus pleuropneumoniae L20] >gi|126098093|gb|ABN74921.1| uridine phosphorylase [Actinobacillus pleuropneumoniae L20] (254 aa)
Score = 146, Expect = 8.7e-08, Identities = 43/149 (28%), Positives = 76/149 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-IEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           AKV ++PGDP R++ IA+  ++NP+ +   R    + GY   + + V   G+G  S+ I   EL A   V   +R+G+ G+    INVG++++T  A      +++   +E    +  E ++EL    +   +   + +T     SSD FY
  S:    17 AKVAIVPGDPARSERIAQK-MQNPEFLVSTREFTSWLGYVGGEPIVVCSTGIGGPSVSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGEVLVTTGAVRLDGASRHFAPLEYPAVANFECTNELYAAAKNQGVTPYVGIT----ASSDTFY 161
>gi|32035117|ref|ZP_00135169.1| COG2820: Uridine phosphorylase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|190151195|ref|YP_001969720.1| uridine phosphorylase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189916326|gb|ACE62578.1| uridine phosphorylase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (254 aa)
Score = 146, Expect = 9.0e-08, Identities = 43/149 (28%), Positives = 76/149 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-IEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           AKV ++PGDP R++ IA+  ++NP+ +   R    + GY   + + V   G+G  S+ I   EL A   V   +R+G+ G+    INVG++++T  A      +++   +E    +  E ++EL    +   +   + +T     SSD FY
  S:    17 AKVAIVPGDPARSERIAQK-MQNPEFLVSTREFTSWLGYVGGEPIVVCSTGIGGPSVSICVEEL-AQLGVRTFLRIGTTGAIQPHINVGEVLVTTGAVRLDGASRHFAPLEYPAVANFECTNELYAAAKNQGVTPYVGIT----ASSDTFY 161
>gi|170718594|ref|YP_001783796.1| uridine phosphorylase [Haemophilus somnus 2336] >gi|168826723|gb|ACA32094.1| uridine phosphorylase [Haemophilus somnus 2336] (252 aa)
Score = 146, Expect = 9.4e-08, Identities = 34/97 (35%), Positives = 53/97 (54%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A++ ++PG P R + IA   L+NPK +   R    + GY + K V V   G+G  S+ I   EL A   +   +R+G+ G+    INVGD+++T  A
  S:    17 AELAIVPGAPERVERIAR-LLDNPKFLASTREFTSWLGYIDQKAVVVCSTGIGGPSVSIAVEEL-AQLGIRTFLRIGTTGAIQPHINVGDILITTGA 111
>gi|153833295|ref|ZP_01985962.1| uridine phosphorylase [Vibrio harveyi HY01] >gi|148870431|gb|EDL69352.1| uridine phosphorylase [Vibrio harveyi HY01] (243 aa)
Score = 144, Expect = 1.2e-07, Identities = 48/126 (38%), Positives = 73/126 (57%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKYIG---IEAKDSTL 137
           PH      +IA  V++ G+P RA  IA  F +N +L+++ R    +TG Y  ++++V   G+G  S+ I   EL      DVI RVGSAG+  K I +G+L++ +         KAY  S+Y  Y     ++A DS L
  S:     5 PHIGVDNTQIAPRVIVCGEPDRANRIAALF-DNAELVSENREYRVFTGTYQGQQISVCSTGIGAPSMIIAVEELKQCGVTDVI-RVGSAGAMQKGIQLGELIVAEGAVRDEGGSKAYVRSSYPAYASFSLLKALDSYL 140
>gi|54113565|gb|AAV29416.1| NT02FT0422 [synthetic construct] (267 aa)
Score = 144, Expect = 1.3e-07, Identities = 59/222 (26%), Positives = 97/222 (43%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           A + ++PGDP R++++A+    +   +   R    Y     N+ V V+  GMG  S+ I   EL A   V   IRVG+ G+  ++I +GDL+L T     + T   Y  IE        S  LN  + ++A   N K+   +  SSD F+      +  +   +   +              EMES +LF        +A+ L T      T E +          N++ +    +E
  S:    30 ATIAILPGDPKRSEYLAKMLDTDATFLASNREYTSYLAKVANQNVIVISTGMGGPSVAICIEEL-AMIGVKKFIRVGTCGAIQENIEIGDLILSTASVRLDGTSYHYAPIEYPAV---ASFSLNTSLYRSAQTLNKKIHCGITGSSDTFFPGQDRKDNYSGYIRRHFINSLNEWRKLNVLNFEMESSALFTVCATFGLEASCLCTVLAKRTTSEYIDKSKYDEGMYNIMMIIKHSIE 262
>gi|24636988|gb|AAN63504.1|AF410175_1 putative purine-nucleotide phosphorylase [Streptococcus thermophilus] (170 aa)
Score = 144, Expect = 1.4e-07, Identities = 55/167 (32%), Positives = 85/167 (50%)
  Q:    76 ASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           ASI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 ASISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 167
>gi|118497248|ref|YP_898298.1| uridine phosphorylase [Francisella tularensis subsp. novicida U112] >gi|194323550|ref|ZP_03057327.1| uridine phosphorylase [Francisella tularensis subsp. novicida FTE] >gi|118423154|gb|ABK89544.1| uridine phosphorylase [Francisella tularensis subsp. novicida U112] >gi|194322405|gb|EDX19886.1| uridine phosphorylase [Francisella tularensis subsp. novicida FTE] (267 aa)
Score = 144, Expect = 1.5e-07, Identities = 59/222 (26%), Positives = 97/222 (43%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           A + ++PGDP R++++A+    +   +   R    Y     N+ V V+  GMG  S+ I   EL A   V   IRVG+ G+  ++I +GDL+L T     + T   Y  IE        S  LN  + ++A   N K+   +  SSD F+      +  +   +   +              EMES +LF        +A+ L T      T E +          N++ +    +E
  S:    30 ATIAILPGDPKRSEYLAKMLDTDATFLASNREYTSYLAKVANQNVIVISTGMGGPSVAICIEEL-AMIGVKKFIRVGTCGAIQENIEIGDLILSTASVRLDGTSYHYAPIEYPAV---ASFRLNTSLYRSAQTLNKKIHCGITGSSDTFFPGQDRKDNYSGYIRRHFINSLDEWRKLNVLNFEMESSALFTVCATFGLEASCLCTVLAKRTTSEYIDKSKYDEGMYNIMMIIKHSIE 262
>gi|113461660|ref|YP_719729.1| uridine phosphorylase [Haemophilus somnus 129PT] >gi|112823703|gb|ABI25792.1| uridine phosphorylase [Haemophilus somnus 129PT] (252 aa)
Score = 144, Expect = 1.5e-07, Identities = 34/97 (35%), Positives = 52/97 (53%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A++ ++PG P R + IA   L+NPK +   R    + GY   K V V   G+G  S+ I   EL A   +   +R+G+ G+    INVGD+++T  A
  S:    17 AELAIVPGAPERVERIAR-LLDNPKFLASTREFTSWLGYIGQKAVVVCSTGIGGPSVSIAVEEL-AQLGIRTFLRIGTTGAIQPHINVGDILITTGA 111
>gi|114564564|ref|YP_752078.1| uridine phosphorylase [Shewanella frigidimarina NCIMB 400] >gi|114335857|gb|ABI73239.1| uridine phosphorylase [Shewanella frigidimarina NCIMB 400] (252 aa)
Score = 144, Expect = 1.5e-07, Identities = 52/175 (29%), Positives = 83/175 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLF 196
           A + ++PGDP R K IAE  ++N   +   R    Y  Y + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R   +E +I +T     SSD FY      + ++     + V              EMES +LF
  S:    17 ATLAIVPGDPERVKRIAE-LMDNATFLASHREYTSYLAYIDGKAVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPLEFPAAADFECTTAMVAACRDAGLEPHIGIT----ASSDTFYPGQERYDTVSGRITQRYVGSMKEWQSMGVLNYEMESATLF 201
>gi|56708383|ref|YP_170279.1| uridine phosphorylase [Francisella tularensis subsp. tularensis SCHU S4] >gi|89256776|ref|YP_514138.1| uridine phosphorylase [Francisella tularensis subsp. holarctica] >gi|110670853|ref|YP_667410.1| uridine phosphorylase [Francisella tularensis subsp. tularensis FSC198] >gi|115315167|ref|YP_763890.1| uridine phosphorylase [Francisella tularensis subsp. holarctica OSU18] >gi|134302368|ref|YP_001122337.1| uridine phosphorylase [Francisella tularensis subsp. tularensis WY96-3418] >gi|156502938|ref|YP_001429003.1| uridine phosphorylase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010727|ref|ZP_02275658.1| uridine phosphorylase [Francisella tularensis subsp. holarctica FSC200] >gi|56604875|emb|CAG45959.1| uridine phosphorylase [Francisella tularensis subsp. tularensis SCHU S4] >gi|89144607|emb|CAJ79926.1| uridine phosphorylase [Francisella tularensis subsp. holarctica LVS] >gi|110321186|emb|CAL09342.1| uridine phosphorylase [Francisella tularensis subsp. tularensis FSC 198] >gi|115130066|gb|ABI83253.1| uridine phosphorylase [Francisella tularensis subsp. holarctica OSU18] >gi|134050145|gb|ABO47216.1| putative uridine phosphorylase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134253876|gb|EBA52970.1| uridine phosphorylase [Francisella tularensis subsp. holarctica 257] >gi|151569247|gb|EDN34901.1| uridine phosphorylase [Francisella tularensis subsp. tularensis FSC033] >gi|156253541|gb|ABU62047.1| uridine phosphorylase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122626|gb|EDO66755.1| hypothetical protein FTAG_00985 [Francisella tularensis subsp. holarctica FSC022] (267 aa)
Score = 143, Expect = 1.7e-07, Identities = 59/222 (26%), Positives = 97/222 (43%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVE 243
           A + ++PGDP R++++A+    +   +   R    Y     N+ V V+  GMG  S+ I   EL A   V   IRVG+ G+  ++I +GDL+L T     + T   Y  IE        S  LN  + ++A   N K+   +  SSD F+      +  +   +   +              EMES +LF        +A+ L T      T E +          N++ +    +E
  S:    30 ATIAILPGDPKRSEYLAKMLDTDATFLASNREYTSYLAKVANQNVIVISTGMGGPSVAICIEEL-AMIGVKKFIRVGTCGAIQENIEIGDLILSTASVRLDGTSYHYAPIEYPAV---ASFSLNTSLYRSAQTLNKKIHCGITGSSDTFFPGQDRKDNYSGYIRRHFINSLNEWRKLNVLNFEMESSALFTVCATFGLEASCLCTVLAKRTTSEYIDKSKYDEGMYNIMMIIKHSIE 262
>gi|59712128|ref|YP_204904.1| uridine phosphorylase [Vibrio fischeri ES114] >gi|59480229|gb|AAW86016.1| uridine phosphorylase [Vibrio fischeri ES114] (252 aa)
Score = 143, Expect = 1.8e-07, Identities = 44/149 (29%), Positives = 72/149 (48%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           A++ ++PGDP R + IAE  +ENPK +   R    Y    + K++ V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T  +       +  G     + +E       ++   +RK  ++    +   V  SSD FY
  S:    18 AEMAIIPGDPARVQKIAEQ-MENPKFLASHREYTVYLAELDGKKIVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGS------VRLDGASLHFAPMEFPAVADFDVATAMRKAVVDQGANVHTGVTASSDTFY 162
>gi|126465373|ref|YP_001040482.1| uridine phosphorylase [Staphylothermus marinus F1] >gi|126014196|gb|ABN69574.1| uridine phosphorylase [Staphylothermus marinus F1] (289 aa)
Score = 143, Expect = 1.8e-07, Identities = 39/116 (33%), Positives = 63/116 (54%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYI 128
           H   K G+++K VL+PGDP R K IA +F +    + + R  L ++G Y    ++    G+G  S  I   EL A    +  IRVG+ G+  ++I VGD++++  A   E T  +Y+
  S:    22 HLGVKPGDVSKYVLLPGDPGRVKRIA-SFWDEAWRVAEHREYLTFSGKYKGVFISATSTGIGAPSTAIAIEEL-ARVGSNTFIRVGTTGALRRNIGVGDIIISTGAVRLEGTSKQYV 136
>gi|147671999|ref|YP_001214845.1| uridine phosphorylase [Vibrio cholerae O395] >gi|146314382|gb|ABQ18922.1| uridine phosphorylase [Vibrio cholerae O395] (243 aa)
Score = 143, Expect = 1.9e-07, Identities = 48/152 (31%), Positives = 80/152 (52%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
            ++A  V++ G+P RA  IA + L N KL+ + R    ++G +  + +TV   G+G  SI I + E  A      I+RVGSAG+   +I +G+L+L + A  +   +K YIG      +   S EL   +++   E ++ +   +V S D FY
  S:    10 AQVAPRVVVCGEPNRANRIA-SLLNNAKLVAENREYRLFSGEFEGQPMTVCSTGIGAPSI-IIAVEELARSGAKAIVRVGSAGAMQSEIGLGELILVEGAVRDEGGSKAYIGAAYPAYS---SFELVLEMQRFLAEQSVPIHRGIVRSHDSFY 157
>gi|154483612|ref|ZP_02026060.1| hypothetical protein EUBVEN_01316 [Eubacterium ventriosum ATCC 27560] >gi|149735522|gb|EDM51408.1| hypothetical protein EUBVEN_01316 [Eubacterium ventriosum ATCC 27560] (253 aa)
Score = 142, Expect = 2.5e-07, Identities = 41/119 (34%), Positives = 58/119 (48%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE 131
           H +    +I K V++PGDP R K IA+ F E PK +   R    YTG    ++V+V   G+G  S  I   EL A       +R+G+ G     +  GD+V+   A   E T  +Y  IE
  S:     6 HIKLSSEDIGKYVILPGDPGRCKEIAKYFDE-PKFVTSNREYTTYTGTILGEKVSVTSTGIGGPSAAIAMEELVAC-GAHTFVRIGTCGGINTKVKSGDMVIATGAIRMEGTSREYAPIE 123
>gi|153830425|ref|ZP_01983092.1| uridine phosphorylase [Vibrio cholerae 623-39] >gi|148874099|gb|EDL72234.1| uridine phosphorylase [Vibrio cholerae 623-39] (243 aa)
Score = 142, Expect = 2.7e-07, Identities = 49/161 (30%), Positives = 82/161 (50%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           M+  +     ++A  V++ G+P RA  IA + L N KL+ + R    ++G +  + +TV   G+G  SI I + E  A      I+RVGSAG+   +I +G+L+L + A  +   +K YIG      +   S EL   +++   E ++     +V S D FY
  S:     1 MSIQSHIHVAQVAPRVVVCGEPNRANRIA-SLLNNAKLVAENREYRLFSGEFEGQPITVCSTGIGAPSI-IIAVEELARSGAKAIVRVGSAGAMQSEIGLGELILVEGAVRDEGGSKAYIGAAYPAYS---SFELVLEMQRFLAEQSVPTHRGIVRSHDSFY 157
>gi|37675871|ref|NP_936267.1| uridine phosphorylase [Vibrio vulnificus YJ016] >gi|37200410|dbj|BAC96237.1| uridine phosphorylase [Vibrio vulnificus YJ016] (242 aa)
Score = 141, Expect = 2.9e-07, Identities = 53/159 (33%), Positives = 84/159 (52%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           PH    + ++A+ V++ G+P RA  IA   LEN +LI + R    + G +  K +TV   G+G  S+ I + E         IIRVGSAG+   +I +G+L++ +         KAY ++ Y  Y    A  S L+G   L+  ++  A+  ++     VV S D FY
  S:     5 PHLCVDETQVAERVIVCGEPDRANRIAA-LLENAELIAENREYRLFNGEFQGKAITVCSTGIGAPSM-IIAVEELKQCGAKYIIRVGSAGAMQPNIALGELIVAEGAVRDEGGSKAYIDAAYPAY----ASFSLLKG---LDGYLQTQAVPYHMG----VVRSHDSFY 159
>gi|123437350|ref|XP_001309472.1| Phosphorylase family protein [Trichomonas vaginalis G3] >gi|121891200|gb|EAX96542.1| Phosphorylase family protein [Trichomonas vaginalis G3] (277 aa)
Score = 141, Expect = 3.1e-07, Identities = 38/116 (32%), Positives = 63/116 (54%)
  Q:     4 YNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGML--GYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-IIRVGSAGSYTKDINVGDLVLTKKAY 119
           +++E  + P N  KKGE+A  ++  GDP RAK +AE+  ++  +I     M+   YTG Y    V+++  GMG A   +   +  A  D  + I+R G+ GS   D+ +G   +  +AY
  S:    15 FDEEGRIQPLN-CKKGEVANRIISVGDPNRAKLMAESLDKDTPVIIRQSNMIFCTYTGKYKGVPVSIIATGMGFAMAELMVVQARAVVDGPLTIVRFGTCGSLHADVPIGCFAIADRAY 132
>gi|76802230|ref|YP_327238.1| uridine phosphorylase 2 [Natronomonas pharaonis DSM 2160] >gi|76558095|emb|CAI49681.1| uridine phosphorylase 2 [Natronomonas pharaonis DSM 2160] (241 aa)
Score = 141, Expect = 3.2e-07, Identities = 57/206 (27%), Positives = 95/206 (46%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLV 217
           PH   + GE+A + L+PGDP R   IA++  ++ +++ + R        Y  +E+T+   G+G  S  I + EL A   V+  IRVG+ G+   DI +GD+V+ T  A  E T  +Y   E+         E+ D +   A   +  +    + + D FY    +            VEME+ +LF  A +    A  + T   +L+
  S:     5 PHLLVESGELADIALVPGDPGRVDRIADH-CDDSEVVAENREYKVVNATYEGRELTICSTGIGSPSAAIAAEELAAV-GVETFIRVGTTGALQSDIEIGDMVVATGAAKDEGTTKRY---ESTAVPAVPDYEVLDSLVDAAEARDAPVHVGPIATDDAFYAETETYVAEWEAAGLLCVEMEAAALFTLARRNGLSAGAICTVDGNLI 206
>gi|126176043|ref|YP_001052192.1| uridine phosphorylase [Shewanella baltica OS155] >gi|149116143|ref|ZP_01842875.1| uridine phosphorylase [Shewanella baltica OS223] >gi|152999017|ref|YP_001364698.1| uridine phosphorylase [Shewanella baltica OS185] >gi|160873610|ref|YP_001552926.1| uridine phosphorylase [Shewanella baltica OS195] >gi|125999248|gb|ABN63323.1| uridine phosphorylase [Shewanella baltica OS155] >gi|146863997|gb|EDK49459.1| uridine phosphorylase [Shewanella baltica OS223] >gi|151363635|gb|ABS06635.1| uridine phosphorylase [Shewanella baltica OS185] >gi|160859132|gb|ABX47666.1| uridine phosphorylase [Shewanella baltica OS195] (252 aa)
Score = 140, Expect = 3.8e-07, Identities = 51/175 (29%), Positives = 82/175 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLF 196
           A + ++PGDP R K IAE  ++N   +   R    Y  Y + K V V   G+G  S  I   EL A   V+  +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R   +E +I +T     SSD FY      + +      +                EMES +LF
  S:    17 ATLAIVPGDPERVKRIAE-LMDNATFLASHREYTSYLAYADGKPVVVCSTGIGGPSTSIAVEEL-AQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVT----ASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESSTLF 201
>gi|24637456|gb|AAN63728.1|AF454498_1 DeoD [Streptococcus thermophilus] (169 aa)
Score = 140, Expect = 4.0e-07, Identities = 54/166 (32%), Positives = 84/166 (50%)
  Q:    77 SIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           SI IY+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 SISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 166
>gi|18313830|ref|NP_560497.1| uridine phosphorylase [Pyrobaculum aerophilum str. IM2] >gi|18161392|gb|AAL64679.1| uridine phosphorylase [Pyrobaculum aerophilum str. IM2] (261 aa)
Score = 140, Expect = 4.0e-07, Identities = 34/101 (33%), Positives = 53/101 (52%)
  Q:    18 KGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           +GEI + VL+PGDP R   IA+++ E  ++  + R  + Y G Y    +     G+G  S  I   EL  +   D  IRVG+ G+  + I +GDL++   A
  S:    18 QGEIPRYVLLPGDPGRVPLIAKHWDEAREVARN-REFVTYVGRYKGVSIGATSTGIGSGSTAIAVEELL-YAGADTFIRVGTTGALWRHIKLGDLIIGAAA 116
>gi|153852958|ref|ZP_01994395.1| hypothetical protein DORLON_00380 [Dorea longicatena DSM 13814] >gi|149754600|gb|EDM64531.1| hypothetical protein DORLON_00380 [Dorea longicatena DSM 13814] (104 aa)
Score = 140, Expect = 4.2e-07, Identities = 32/85 (37%), Positives = 50/85 (58%)
  Q:     1 MYEYNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYEL 85
           M  Y+ E  +  H + + G++ + V+MPGDP R   IA++F ++ KLI D R  + YTGY + ++V+V   G+G  S  I   EL
  S:     4 MQNYSGEEGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAKHF-DDAKLIADSREYITYTGYLDGEKVSVTSTGIGGPSASIALEEL 87
>gi|170728829|ref|YP_001762855.1| uridine phosphorylase [Shewanella woodyi ATCC 51908] >gi|169814176|gb|ACA88760.1| uridine phosphorylase [Shewanella woodyi ATCC 51908] (252 aa)
Score = 140, Expect = 4.3e-07, Identities = 53/186 (28%), Positives = 85/186 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--------------VEMESFSLFANAIKLNKKAA 207
           A + ++PGDP R K IAE  +E    +   R    Y  Y + K V +   G+G  S  I   EL A   V+  +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R   +E +I +T     SSD FY      + ++     Q                EMES +LF        +AA
  S:    17 ASLAIVPGDPERVKRIAE-LMEGASFLASHREYTSYLAYIDGKAVVICSTGIGGPSTSIAVEEL-AQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAASRDAGLEPHIGIT----ASSDTFYPGQERYDTVSGRVTRQFKGSMQEWQDLGVLNYEMESSTLFTMCASQGWRAA 212
>gi|27367740|ref|NP_763267.1| uridine phosphorylase [Vibrio vulnificus CMCP6] >gi|27359313|gb|AAO08257.1|AE016813_9 Uridine phosphorylase [Vibrio vulnificus CMCP6] (242 aa)
Score = 140, Expect = 4.3e-07, Identities = 52/159 (32%), Positives = 84/159 (52%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           PH    + ++A+ V++ G+P RA  IA   LEN +L+ + R    + G +  K +TV   G+G  S+ I + E         IIRVGSAG+   +I +G+L++ +         KAY ++ Y  Y    A  S L+G   L+  ++  A+  ++     VV S D FY
  S:     5 PHLCVDETQVAERVIVCGEPDRANRIAA-LLENAELVAENREYRLFNGEFQGKAITVCSTGIGAPSM-IIAVEELKQCGAKYIIRVGSAGAMQPNIALGELIVAEGAVRDEGGSKAYIDAAYPAY----ASFSLLKG---LDGYLQTQAVPYHMG----VVRSHDSFY 159
>gi|119720146|ref|YP_920641.1| uridine phosphorylase [Thermofilum pendens Hrk 5] >gi|119525266|gb|ABL78638.1| uridine phosphorylase [Thermofilum pendens Hrk 5] (290 aa)
Score = 140, Expect = 4.4e-07, Identities = 38/131 (29%), Positives = 67/131 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL---------TKKAYSESTYAKYIGIEAKDSTLEGSDEL 143
           H + + G++A  VL+PGDP R  +I+ +F +  + +   R  + +TG Y   EV+    G+G  +  I   EL         IRVG+ G+    I+VGD+++         T K Y  + Y      E  ++ +E ++ +
  S:    31 HIKCRPGDVAPTVLLPGDPERVPYIS-SFWDEYREVARHREYVTHTGRYKGVEVSATSTGIGGPAAAIAVEELLRV-GASTFIRVGTTGAIQPFIDVGDVIIVAGAVRLDGTTKQYVRAEYPAIAHFEVVEALIEAAESV 168
>gi|77362228|ref|YP_341802.1| uridine phosphorylase [Pseudoalteromonas haloplanktis TAC125] >gi|76877139|emb|CAI89356.1| putative uridine phosphorylase [Pseudoalteromonas haloplanktis TAC125] (252 aa)
Score = 140, Expect = 4.6e-07, Identities = 61/186 (32%), Positives = 86/186 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIEN-NIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV-------------------EMESFSLFANAIKLNKKAA 207
           AK+ ++PGDP RA  I++ FL+NP  +   R    Y G  N   V +   G+G  S  I   EL A   V   +R+G+ G+    IN GD+++++ +      +++    A  S    SD         A EN NI     +  SSD FY       Q   DT S  V                   EMES +LF     L  +AA
  S:    17 AKLAIVPGDPDRAARISQ-FLDNPTCLAKTREFHVYLGELNGHSVVICSTGIGGPSTSIAVEEL-AQLGVHSFLRIGTTGAIQPHINEGDILISQASVRLDGASQHF---APLSYPAVSDFFATQAMVKACENLNIDFHIGITASSDTFYPG-----QERYDTHSGYVPKSLQGSCEEWQKLGVMNYEMESATLFTMCAALGLQAA 212
>gi|113971835|ref|YP_735628.1| uridine phosphorylase [Shewanella sp. MR-4] >gi|114045957|ref|YP_736507.1| uridine phosphorylase [Shewanella sp. MR-7] >gi|117922113|ref|YP_871305.1| uridine phosphorylase [Shewanella sp. ANA-3] >gi|113886519|gb|ABI40571.1| uridine phosphorylase [Shewanella sp. MR-4] >gi|113887399|gb|ABI41450.1| uridine phosphorylase [Shewanella sp. MR-7] >gi|117614445|gb|ABK49899.1| uridine phosphorylase [Shewanella sp. ANA-3] (252 aa)
Score = 139, Expect = 4.9e-07, Identities = 50/175 (28%), Positives = 82/175 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLF 196
           A + ++PGDP R K IAE  ++N   +   R    Y  Y + K V +   G+G  S  I   EL A   V+  +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R   +E +I +T     SSD FY      + +      +                EMES +LF
  S:    17 ATLAIVPGDPERVKRIAE-LMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEEL-AQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVT----ASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLF 201
>gi|24375619|ref|NP_719662.1| uridine phosphorylase [Shewanella oneidensis MR-1] >gi|24350520|gb|AAN57106.1|AE015844_8 uridine phosphorylase [Shewanella oneidensis MR-1] (252 aa)
Score = 139, Expect = 4.9e-07, Identities = 50/175 (28%), Positives = 82/175 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLF 196
           A + ++PGDP R K IAE  ++N   +   R    Y  Y + K V +   G+G  S  I   EL A   V+  +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R   +E +I +T     SSD FY      + +      +                EMES +LF
  S:    17 ATLAIVPGDPERVKRIAE-LMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEEL-AQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVT----ASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLF 201
>gi|120600418|ref|YP_964992.1| uridine phosphorylase [Shewanella sp. W3-18-1] >gi|124545471|ref|ZP_01704664.1| uridine phosphorylase [Shewanella putrefaciens 200] >gi|146291650|ref|YP_001182074.1| uridine phosphorylase [Shewanella putrefaciens CN-32] >gi|120560511|gb|ABM26438.1| uridine phosphorylase [Shewanella sp. W3-18-1] >gi|124510814|gb|EAY54881.1| uridine phosphorylase [Shewanella putrefaciens 200] >gi|145563340|gb|ABP74275.1| uridine phosphorylase [Shewanella putrefaciens CN-32] (252 aa)
Score = 139, Expect = 4.9e-07, Identities = 50/175 (28%), Positives = 82/175 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--------------EMESFSLF 196
           A + ++PGDP R K IAE  ++N   +   R    Y  Y + K V +   G+G  S  I   EL A   V+  +RVG+ G+    +NVGD+++T+ +   +     +  +E    +  E +  +    R   +E +I +T     SSD FY      + +      +                EMES +LF
  S:    17 ATLAIVPGDPERVKRIAE-LMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEEL-AQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVT----ASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQEMGVLNYEMESATLF 201
>gi|145591801|ref|YP_001153803.1| uridine phosphorylase [Pyrobaculum arsenaticum DSM 13514] >gi|145283569|gb|ABP51151.1| uridine phosphorylase [Pyrobaculum arsenaticum DSM 13514] (261 aa)
Score = 139, Expect = 5.8e-07, Identities = 33/100 (33%), Positives = 52/100 (52%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           GE+ + VL+PGDP R   IAE + E  ++  + R  + + G Y    +     G+G  S  I   EL  +   D  IRVG+ G+  ++I +GDL++   A
  S:    19 GEVPRYVLLPGDPGRVLLIAEMWDEKREVAKN-REFVTWVGRYKGVPIAATSTGIGSGSTAIAVEELL-YVGADTFIRVGTTGALRREIKLGDLIIGTAA 116
>gi|66809805|ref|XP_638626.1| uridine phosphorylase [Dictyostelium discoideum AX4] >gi|60467230|gb|EAL65264.1| uridine phosphorylase [Dictyostelium discoideum AX4] (249 aa)
Score = 139, Expect = 5.9e-07, Identities = 38/112 (33%), Positives = 55/112 (49%)
  Q:     7 EFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           E  +TP      G++ KV ++ GDP RAK ++E      +L+  VR    Y G + + E+ VM HG+G     +   EL     V  IIR G+AGS+      G LV+   A
  S:     2 EIKVTPICLLPIGKLPKVCVVVGDPNRAKLVSEKHFVVTELVCAVREFHCYKGMWKDTEMLVMSHGIGGGGASVCFEELIQ-AGVTTIIRAGTAGSFDPRYREGSLVIATGA 112
>gi|169856068|ref|XP_001834696.1| hypothetical protein CC1G_05833 [Coprinopsis cinerea okayama7#130] >gi|116504249|gb|EAU87144.1| hypothetical protein CC1G_05833 [Coprinopsis cinerea okayama7#130] (260 aa)
Score = 138, Expect = 6.4e-07, Identities = 57/197 (28%), Positives = 95/197 (48%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPK--LINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVD-VIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDS---------TLEGSDELNDVIRKTA------IENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATL 209
           H   K GE+A  ++  G P RA  +A      PK  +++  RG L  TG + N  V+++  GMG  ++  +  E+      D VIIR+GS G    DI VG +V+ K + + +    +  +  +D+          +    EL++ +RK            + LT  V  S+D FY         +S  +       +  L A+ ++ N +AATL
  S:    20 HLGLKAGEVANRIITVGSPSRANGLASLLDAEPKPFVLSSERGFLTITGRFRNVPVSIVSIGMGSPNMDFFIREVRECVTGDMVIIRLGSCGGLV-DIPVGSVVVPKASVAINRNVDFDFVHPEDNREPAYRISKPVSADPELHETVRKAVQGAKPPQSQAVILTGTVNASADSFY---------SSQGRQTSFPDHNEDLIAHLLQSNPEAATL 224
>gi|109948007|ref|YP_665235.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Helicobacter acinonychis str. Sheeba] >gi|109715228|emb|CAK00236.1| MTA/SAH nucleosidase [Helicobacter acinonychis str. Sheeba] (236 aa)
Score = 138, Expect = 7.2e-07, Identities = 44/163 (26%), Positives = 79/163 (48%)
  Q:    53 GMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSE----STYAKYIGIEAKDST-LEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDS 215
           G + + G YN+KE+ V    +G     + +  +   + V  ++  G AGS  KD+ + DL++ ++        S +   +G   + +  +E S +LN + +K A E NI L + ++ S D F  +    E + S+ K+  VEME  S+     K       L + SD+
  S:    38 GNVFHKGVYNDKEIVVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLIKDLKINDLLVAQQLVQHDVDLSAFDHPLGFIPESAIFIETSKDLNALAKKIANEQNITLKEGIIASGDQFVHSKERKEFLTSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDN 205
>gi|86371378|gb|ABC94782.1| purine nucleoside phosphorylase [Toxoplasma gondii] (247 aa)
Score = 138, Expect = 7.4e-07, Identities = 37/111 (33%), Positives = 60/111 (54%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYT-KDINVGDLVLTKKAYSES 122
           PH R +K ++  VV++ GDP R + +A N  E  + +   R    +   Y+++ +TV+ HG+G     I   EL A+    VIIR G+ GS   K +  GD+ +T  A +E+
  S:     8 PHIRLRKEDVEPVVIIVGDPARTEEVA-NMCEKKQELAYNREYRSFRVVYDSQPITVISHGIGCPGTSIAIEEL-AYLGAKVIIRAGTCGSLKPKTLKQGDVCVTYAAVNET 117
>gi|15600904|ref|NP_232534.1| uridine phosphorylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586855|ref|ZP_01676636.1| uridine phosphorylase [Vibrio cholerae 2740-80] >gi|121726992|ref|ZP_01680188.1| uridine phosphorylase [Vibrio cholerae V52] >gi|153221854|ref|ZP_01952719.1| uridine phosphorylase [Vibrio cholerae MAK 757] >gi|153817712|ref|ZP_01970379.1| uridine phosphorylase [Vibrio cholerae NCTC 8457] >gi|153821654|ref|ZP_01974321.1| uridine phosphorylase [Vibrio cholerae B33] >gi|194532397|ref|YP_002067825.1| uridine phosphorylase [Vibrio cholerae MO10] >gi|9657521|gb|AAF96047.1| uridine phosphorylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121548898|gb|EAX58939.1| uridine phosphorylase [Vibrio cholerae 2740-80] >gi|121630626|gb|EAX63015.1| uridine phosphorylase [Vibrio cholerae V52] >gi|124119347|gb|EAY38090.1| uridine phosphorylase [Vibrio cholerae MAK 757] >gi|125618449|gb|EAZ46988.1| uridine phosphorylase [Vibrio cholerae MO10] >gi|126511754|gb|EAZ74348.1| uridine phosphorylase [Vibrio cholerae NCTC 8457] >gi|126520851|gb|EAZ78074.1| uridine phosphorylase [Vibrio cholerae B33] (243 aa)
Score = 138, Expect = 7.6e-07, Identities = 46/152 (30%), Positives = 80/152 (52%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
            ++A  V++ G+P RA  IA + L N +L+ + R    ++G +  + +TV   G+G  S+ I + E  A      I+RVGSAG+   +I +G+L+L + A  +   +K YIG      +   S EL   +++   E ++ +   +V S D FY
  S:    10 AQVAPRVVVCGEPNRANRIA-SLLNNAELVAENREYRLFSGEFEEQPITVCSTGIGAPSM-IIAVEELARSGAKAIVRVGSAGAMQSEIGLGELILVEGAVRDEGGSKAYIGAAYPAYS---SFELVVEMQRFLAEQSVPIHRGIVRSHDSFY 157
>gi|149190402|ref|ZP_01868674.1| uridine phosphorylase [Vibrio shilonii AK1] >gi|148835781|gb|EDL52746.1| uridine phosphorylase [Vibrio shilonii AK1] (252 aa)
Score = 138, Expect = 7.7e-07, Identities = 53/194 (27%), Positives = 88/194 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV-EMESFSLFANAIKLNKKAATLLT-CSDS 215
           A + ++PGDP R + IAE  ++ P+ +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+   D+NVGD+++T  +       +  G     + +E       ++   +++ AIE    +   V  SSD FY      +  +     +    ME +      +    ++ATLLT C+ S
  S:    18 ATLAIIPGDPARVQKIAE-LMDEPEFLASQREYTVYRAKLDGKTVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQSDVNVGDMIVTTGS------VRLDGASLHFAPMEFPAVADFDVATAMKEAAIEAGSTVHTGVTASSDTFYPGQERYDTFSGRVVRRFQGSMEEWQQMG-VLNFEMESATLLTMCASS 208
>gi|91224723|ref|ZP_01259983.1| uridine phosphorylase [Vibrio alginolyticus 12G01] >gi|91190269|gb|EAS76538.1| uridine phosphorylase [Vibrio alginolyticus 12G01] (243 aa)
Score = 138, Expect = 7.9e-07, Identities = 40/116 (34%), Positives = 69/116 (59%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKY 127
           PH    + +IA +V++ G+P RA  IA  F ++ +++++ R    +TG Y  K V+V   G+G  S+ I + E      V  ++RVGSAG+    I++G+L++ +         KAY +S+Y  Y
  S:     5 PHIGVDETQIAPLVIVCGEPDRANRIAVLF-DDAEMVSENREYRVFTGNYKGKPVSVCSTGIGAPSM-IIAVEELKQCGVTHVVRVGSAGAMQSGIHLGELIIAEGAVRDEGGSKAYVDSSYPAY 127
>gi|194541072|ref|YP_002076106.1| phosphorylase family [Vibrio sp. Ex25] >gi|151939627|gb|EDN58454.1| phosphorylase family [Vibrio sp. Ex25] (243 aa)
Score = 138, Expect = 7.9e-07, Identities = 39/116 (33%), Positives = 68/116 (58%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKY 127
           PH    + ++A +V++ G+P RA  IA   L++ ++I++ R    +TG Y ++ V+V   G+G  S+ I + E      V  ++RVGSAG+    I +G+L++ +         KAY +S Y  Y
  S:     5 PHIGVDETQVAPLVIVCGEPDRANRIAA-LLDDAEMISENREYRVFTGKYKDQPVSVCSTGIGAPSM-IIAVEELKQCGVTHVVRVGSAGAMQSGIQLGELIIAEGAVRDEGGSKAYVDSAYPAY 127
>gi|153212898|ref|ZP_01948515.1| uridine phosphorylase [Vibrio cholerae 1587] >gi|124116276|gb|EAY35096.1| uridine phosphorylase [Vibrio cholerae 1587] (243 aa)
Score = 137, Expect = 9.0e-07, Identities = 46/152 (30%), Positives = 80/152 (52%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
            ++A  V++ G+P RA  IA + L N +L+ + R    ++G +  + +TV   G+G  S+ I + E  A      I+RVGSAG+   +I +G+L+L + A  +   +K YIG      +   S EL   +++   E ++ +   +V S D FY
  S:    10 AQVAPRVVVCGEPNRANRIA-SLLNNAELVAENREYRLFSGEFEEQPITVCSTGIGAPSM-IIAVEELARSGAKAIVRVGSAGAMQPEIGLGELILVEGAVRDEGGSKAYIGAAYPAYS---SFELVVEMQRFLAEQSVPIHRGIVRSHDSFY 157
>gi|186686567|ref|YP_001869763.1| purine phosphorylase family 1 [Nostoc punctiforme PCC 73102] >gi|186469019|gb|ACC84820.1| purine or other phosphorylase, family 1 [Nostoc punctiforme PCC 73102] (257 aa)
Score = 137, Expect = 9.3e-07, Identities = 62/195 (31%), Positives = 98/195 (50%)
  Q:     5 NKEFYMTPHNRAKKGEIA-KVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYY-NNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-IE---AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY-------GAN----RSVEQIASDTKSQVV---EMESFSLFANA 199
           NK FY     +   G    ++ L+ G+P R+  IA+ + ++ +L+++ RG+  Y GY  N + +     GMG  S+ I   EL     +  IIR+G+ G+    I VG +V++  A      A  I  +E   A D  L  +  L    R+  +E+ I +T     S D FY        AN    RS+  I  + +   +   EMES +LF  A
  S:     3 NKRFYHIGFGQDDLGSSPPRIALLSGEPERSHLIAQTYFQDVRLLSENRGLNSYVGYLPNGRSILSATSGMGAPSLSIVVNELIQV-GIRQIIRIGTCGAIQPYIPVGSVVISSAALCRQGAANDIAPVEYPAAADPFL--TVALVKAARELKVEHYIGIT----ASVDTFYEGQERTDSANPNLMRSLHGITEEYRRLNILNYEMESGTLFKMA 210
>gi|90413285|ref|ZP_01221279.1| Putative uridine phosphorylase [Photobacterium profundum 3TCK] >gi|90325686|gb|EAS42149.1| Putative uridine phosphorylase [Photobacterium profundum 3TCK] (255 aa)
Score = 137, Expect = 9.4e-07, Identities = 43/149 (28%), Positives = 72/149 (48%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           A++ ++PGDP R + IA N ++NP+ +   R    + G  + K V V   G+G  S  I   EL A   +   +RVG+ G+    INVGD+++T  +       +  G     + +E       ++   +++  IE    +   V  SSD FY
  S:    19 AELAIIPGDPARVEKIA-NLMDNPEFLASSREYTLFRGVLDGKTVIVCSTGIGGPSTSIAVEEL-AQLGIRTFLRVGTTGAIQPHINVGDMIVTTGS------VRLDGASLHFAPMEFPAVADFDVATAMKQAVIEEGATVHTGVTASSDTFY 163
>gi|126460442|ref|YP_001056720.1| uridine phosphorylase [Pyrobaculum calidifontis JCM 11548] >gi|126250163|gb|ABO09254.1| uridine phosphorylase [Pyrobaculum calidifontis JCM 11548] (261 aa)
Score = 137, Expect = 9.5e-07, Identities = 31/100 (31%), Positives = 53/100 (53%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           G++ + VL+PGDP R   IA+++ E  ++  + R    + G Y    +     G+G  S  I   EL  +   D +IRVG+ G+  ++I +GDL++   A
  S:    19 GDVPRYVLLPGDPGRVPLIAKHWQEAREVARN-REFTTWVGIYKGVRIAATSTGIGSGSTAIAVEELL-YAGADTLIRVGTTGALKREIKLGDLIIGTAA 116
>gi|160873667|ref|YP_001552983.1| purine phosphorylase family 1 [Shewanella baltica OS195] >gi|160859189|gb|ABX47723.1| purine or other phosphorylase family 1 [Shewanella baltica OS195] (244 aa)
Score = 137, Expect = 9.8e-07, Identities = 39/109 (35%), Positives = 58/109 (53%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           + PH      +IA  V++ GDP RA  IA  + EN K +   R    +   +N  +VT+   G+G AS+ I   EL     V  IIRVGSAG+   +I +G+L++ + A
  S:     3 LQPHIAVSADDIASRVIVCGDPARAARIA-GWCENGKQVASNREFQLFNARFNGIDVTICSTGIGAASMLIALEELKQC-GVTTIIRVGSAGALQHNIGLGELIIAEGA 109
>gi|126175985|ref|YP_001052134.1| purine phosphorylases family protein 1 [Shewanella baltica OS155] >gi|149114887|ref|ZP_01841636.1| uridine phosphorylase [Shewanella baltica OS223] >gi|125999190|gb|ABN63265.1| purine and other phosphorylases, family 1 [Shewanella baltica OS155] >gi|146865336|gb|EDK50663.1| uridine phosphorylase [Shewanella baltica OS223] (244 aa)
Score = 137, Expect = 9.8e-07, Identities = 39/109 (35%), Positives = 58/109 (53%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           + PH      +IA  V++ GDP RA  IA  + EN K +   R    +   +N  +VT+   G+G AS+ I   EL     V  IIRVGSAG+   +I +G+L++ + A
  S:     3 LQPHIAVSADDIASRVIVCGDPARAARIA-GWCENGKQVASNREFQLFNARFNGIDVTICSTGIGAASMLIALEELKQC-GVTTIIRVGSAGALQHNIGLGELIIAEGA 109
>gi|55379969|ref|YP_137819.1| uridine phosphorylase [Haloarcula marismortui ATCC 43049] >gi|55232694|gb|AAV48113.1| uridine phosphorylase [Haloarcula marismortui ATCC 43049] (241 aa)
Score = 137, Expect = 1.0e-06, Identities = 52/206 (25%), Positives = 93/206 (45%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK-KAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLV 217
           PH   + G++  + L+PGDP R   IA    ++ +++ + R        Y+ +E+T+   G+G  S  I   EL A   V+ +IRVG+ G+  + I +GD+V+    A  E T  +Y   E+K        ++   +   A  N+  +    + + D FY                 VEME+ +LF+   +   ++  + T   +LV
  S:     5 PHLLVEPGDLTDIALVPGDPGRVDRIA-GLCDDHEVVAENREYKLVNATYDGRELTICSTGIGSPSTAIAVEELEAV-GVETLIRVGTTGALQEGIEIGDMVVANGAAKDEGTSQRY---ESKAVPAVPDYDVLSSLVDAAEANDEDVHVGPIATDDAFYAETDEYINDWEAAGLLAVEMEAAALFSLCRRKGLRSGAICTVDGNLV 206
>gi|119871983|ref|YP_929990.1| uridine phosphorylase [Pyrobaculum islandicum DSM 4184] >gi|119673391|gb|ABL87647.1| uridine phosphorylase [Pyrobaculum islandicum DSM 4184] (261 aa)
Score = 137, Expect = 1.0e-06, Identities = 31/100 (31%), Positives = 53/100 (53%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           GE+ + VL+PGDP R   IA+ + +N + +   R  + + G Y   ++     G+G  S  I   EL  +   D  IRVG+ G+  ++I +GD+++   A
  S:    19 GEVPRYVLLPGDPGRVPLIAK-YWDNAREVAKNREFVTWVGTYRGVQIGATSTGIGSGSTAIAIEELL-YAGADTFIRVGTTGALRREIKLGDVIIGAAA 116
>gi|126646413|ref|ZP_01718930.1| purine nucleoside phosphorylase II [Algoriphagus sp. PR1] >gi|126578045|gb|EAZ82265.1| purine nucleoside phosphorylase II [Algoriphagus sp. PR1] (284 aa)
Score = 136, Expect = 1.0e-06, Identities = 40/120 (33%), Positives = 63/120 (52%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEA 132
           H   K   +A +V   GDP R   +++ F +        R  + +TG+ N + VTVM  GMG  +I I   EL A  ++D+             IIR+G++G+   DI VG L+ ++KA    T  ++   E 
  S:    20 HLHLKPENLASLVFTVGDPDRVDLVSQYF-DQIDFKTRKREFVTHTGWINGQRVTVMSTGMGTDNIEILMTELDALVNIDLETRKVKENHTALKIIRLGTSGAMQSDIPVGSLLASEKAVGMDTLMQFYDSEG 151
>gi|123468545|ref|XP_001317490.1| Phosphorylase family protein [Trichomonas vaginalis G3] >gi|121900225|gb|EAY05267.1| Phosphorylase family protein [Trichomonas vaginalis G3] (279 aa)
Score = 136, Expect = 1.1e-06, Identities = 54/179 (30%), Positives = 92/179 (51%)
  Q:    17 KKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGM--LGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-IIRVGSAGSYTKDINVGDLVLTKKAYS--ESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGAN-RSVEQIASDTK---SQVVEMESFSL 195
           KKGE++  ++  GDP RA  I+++F ++  +I     M    YTG  N   ++V+G GMG   + +   +  A  +  + +IR G+ GS   D+ VG   ++ KAY   +S   +    E         ++L + I K   E+  +   V+  V S+D FYG+  R      S  +   S+++E+E  SL
  S:    28 KKGELSNRIITVGDPNRALKISQSFDKDFPVIVRKSNMQLTTYTGKKNGVLISVVGTGMGFTMVDLLVTQARAILEGPIYLIRFGTCGSLHADVPVGCFAISNKAYGIRQSYENEEFPYELSTKPFIMDEDLMNRIYKEFTESMPQYRSVIGPVWSADTFYGSQGRQDSNFISHNENVISKILEIEPESL 217
>gi|2267164|gb|AAC64855.1| pfs protein homolog [Helicobacter pylori] (237 aa)
Score = 136, Expect = 1.2e-06, Identities = 46/171 (26%), Positives = 81/171 (47%)
  Q:    53 GMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLV----LTKKAYSESTYAKYIGIEAKDST-LEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMS 223
           G + + G Y+NKE+ V    +G     + +  +   + V  ++  G AGS  KD+ + DL+    L +     S +   +G   + +  +E S+ LN + +K A E +I L + ++ S D F  +    E + S+ K+  VEME  S+     K       L + SD+     +MS
  S:    39 GNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFNHPLGFIPESAIFIETSESLNALAKKVANEQHIALKEGLIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEEANMS 214
>gi|15603437|ref|NP_246511.1| uridine phosphorylase [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721965|gb|AAK03656.1| Udp [Pasteurella multocida subsp. multocida str. Pm70] (252 aa)
Score = 136, Expect = 1.2e-06, Identities = 54/190 (28%), Positives = 85/190 (44%)
  Q:    20 EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA---------YSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIA--------------SDTKSQVVEMESFSLFANAIKLNKKAATL 209
           E A + + PG P R + IA+  L+ PK +   R    + GY  +K V V   G+G  S+ I   EL A   V   +R+G+ G+    INVGD+++T  A         ++   Y      E  ++  + + EL           N K+   +  +SD FY      +  +               D      EMES +LF     L  +A  +
  S:    15 EGATLAITPGAPERVEKIAK-LLDRPKFLASTREFTSWLGYIGDKAVVVCSTGIGGPSVSIAVEEL-AQLGVRTFLRIGTTGAIQPHINVGDILVTTGAVRLDGASLHFAPMEYPAVANFECTNALYKAATEL----------ANQKVYVGITAASDTFYPGQERYDTYSGKVYRHFQGSLKQWQDLNVMNFEMESATLFTMCSALGLRAGMV 215
>gi|15790752|ref|NP_280576.1| Udp1 [Halobacterium sp. NRC-1] >gi|169236495|ref|YP_001689695.1| uridine phosphorylase [Halobacterium salinarum R1] >gi|10581296|gb|AAG20056.1| uridine phosphorylase [Halobacterium sp. NRC-1] >gi|167727561|emb|CAP14349.1| uridine phosphorylase [Halobacterium salinarum R1] (258 aa)
Score = 136, Expect = 1.2e-06, Identities = 67/231 (29%), Positives = 113/231 (48%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL---------TKKAYSESTY----AKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQV--VEMESFSLFANAIKLNKKAATLLTCSDSLV--THESMSAEDR-----QTKFVNMINLALKVV 242
           PH   + G++  V L+PGDP R   IA +  ++ +++ + R        Y    +T+   G+G  S  I   EL A   V  +IRVG+ G     + VGD+++         T K Y  +TY    A  +  E  D+  E ++ + D  +  A +     T  V  + S D FY  N S + +A    + +  +EME+ ++F+ A +    A  + T   +LV  T +   ++D      Q      I++AL  V
  S:     5 PHLLVEDGDVNDVALLPGDPGRVDRIASH-CDDSEVVAENREYKVVNATYEGVSLTICSTGIGCPSAAIAIEEL-AKVGVQTVIRVGTIGGLQAGVEVGDMIVANGAAKAEGTSKRYESATYPAVPAYSVLAELVDAA-EATEGVGDHEQSAAADGPAGATVHVGPIVSDDAFY--NESDDYVADWEAANLLGIEMEAATVFSLARRRGLAAGAICTVDGNLVAGTQKGADSDDELPEKAQNNVSRAIDIALDAV 254
>gi|149908149|ref|ZP_01896813.1| uridine phosphorylase [Moritella sp. PE36] >gi|149808691|gb|EDM68624.1| uridine phosphorylase [Moritella sp. PE36] (255 aa)
Score = 136, Expect = 1.3e-06, Identities = 34/94 (36%), Positives = 53/94 (56%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A++ ++PGDP R + IA   +ENP+ +   R    Y      K+V V   G+G  S  I   EL A   V+  +RVG+ G+  ++INVGD+++T
  S:    19 AELAIIPGDPARVEKIAAQ-MENPQFLASHREYTVYLAELEGKKVVVCSTGIGGPSTSIAVEEL-AQLGVNTFLRVGTTGAIQENINVGDMIVT 110
>gi|108562515|ref|YP_626831.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Helicobacter pylori HPAG1] >gi|107836288|gb|ABF84157.1| 5'-methylthioadenosine nucleosidase [Helicobacter pylori HPAG1] (231 aa)
Score = 136, Expect = 1.3e-06, Identities = 46/171 (26%), Positives = 80/171 (46%)
  Q:    53 GMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSE----STYAKYIGIEAKDST-LEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMS 223
           G + + G Y NKE+ V    +G     + +  +   + V  ++  G AGS  KD+ + DL++  +        S +   +G   + +  +E S+ LN + +K A E +I L + V+ S D F  +    E + S+ K+  VEME  S+     K       L + SD+     +MS
  S:    33 GNVFHKGVYCNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVANQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKKVANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEEANMS 208
>gi|119946492|ref|YP_944172.1| uridine phosphorylase [Psychromonas ingrahamii 37] >gi|119865096|gb|ABM04573.1| uridine phosphorylase [Psychromonas ingrahamii 37] (252 aa)
Score = 135, Expect = 1.5e-06, Identities = 51/175 (29%), Positives = 82/175 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYS-ESTYAKYIGIEAKD-STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV--------------VEMESFSLF 196
           A + ++PGDP R K IAE  ++    +   R    Y  Y   K V V   G+G  S  I   EL A   V   +RVG+ G+   ++N GD+++T+ +   +     +  +E    +  E +  +    R+T IE +I +T     SSD FY      + ++      +               EMES +LF
  S:    17 ASLAIVPGDPDRVKKIAE-LMDGATFLASHREYTSYLAYIEGKAVVVCSTGIGGPSTSIAVEEL-AQLGVTTFLRVGTTGAIQPEVNPGDIIVTQASVRLDGASLHFAPLEYPAVANFECTMAIVAACRETGIEPHIGIT----ASSDTFYPGQERYDTVSGRVTRHLKGSMKEWQELGVLNYEMESSTLF 201
>gi|15611153|ref|NP_222804.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Helicobacter pylori J99] >gi|7674116|sp|Q9ZMY2|MTNN_HELPJ MTA/SAH nucleosidase (5'-methylthioadenosine nucleosidase) (S-adenosylhomocysteine nucleosidase) >gi|4154592|gb|AAD05666.1| putative [Helicobacter pylori J99] (230 aa)
Score = 134, Expect = 1.8e-06, Identities = 46/174 (26%), Positives = 81/174 (46%)
  Q:    53 GMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSE----STYAKYIGIEAKDST-LEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           G + + G Y+NKE+ V    +G     + +  +   + V  ++  G AGS  KD+ + DL++  +        S +   +G   + +  +E S  LN + +K A E +I L + V+ S D F  +    E + S+ K+  VEME  S+     K       L + SD+      MS ++
  S:    32 GNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDE 210
>gi|123482542|ref|XP_001323814.1| Phosphorylase family protein [Trichomonas vaginalis G3] >gi|121906686|gb|EAY11591.1| Phosphorylase family protein [Trichomonas vaginalis G3] (277 aa)
Score = 134, Expect = 2.0e-06, Identities = 66/208 (31%), Positives = 103/208 (49%)
  Q:     4 YNKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGML--GYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-IIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE---AKDSTLEGSDELNDVIRKTAIENNIKLTD--VVV---HSSDIFYGANRSVEQ-------------IASDTKSQVVEMESFSLFANAIKLN----KKAATLLT 211
           ++ E  + P N  KKGE+A  ++  GDP RAK ++E+  ++  +I     M+   YTG Y    V+++  GMG A   +   +  A  +  + I+R G+ GS   D+ +G   +  +AY      +  G     AK+S        N  +    +E   KLTD   VV    S+D FY +   ++              +A D  +   EMES+ L   A K      K AA  LT
  S:    15 FDAEDRIQPLN-CKKGEVANHIISVGDPNRAKLMSESLDKDTPVIVRQSNMIFCTYTGKYKGTPVSIIATGMGFAMAELMVVQARAVVEGPMTIVRFGTCGSLHADVPIGCFAIADRAYFVRQDFEKEGFPFEFAKESI-----PFNHELHLKVLEEFKKLTDYRTVVGPDTSADTFYPSQGRLDDNFVMENEKVIPTLLAQDKDALSFEMESYLLAFLAHKFPEAQMKTAAVCLT 244
>gi|37680561|ref|NP_935170.1| uridine phosphorylase [Vibrio vulnificus YJ016] >gi|37199309|dbj|BAC95141.1| uridine phosphorylase [Vibrio vulnificus YJ016] (252 aa)
Score = 134, Expect = 2.1e-06, Identities = 53/194 (27%), Positives = 90/194 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVE----QIASDTKSQVVEMESFSLFANAIKLNKKAATLLT-CSDS 215
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T  +       +  G     + +E       ++   ++  A+E+   +   V  SSD FY      +    ++ S  +  + E +   +    +    ++ATLLT C+ S
  S:    18 ATLAIIPGDPARVQKIAEE-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGS------VRLDGASLHFAPMEFPAVADFDVATAMKAAALESGATVHTGVTASSDTFYPGQERYDTFTGRVVSRFQGSMKEWQEMGV----LNFEMESATLLTMCASS 208
>gi|51893293|ref|YP_075984.1| uridine phosphorylase [Symbiobacterium thermophilum IAM 14863] >gi|51856982|dbj|BAD41140.1| uridine phosphorylase [Symbiobacterium thermophilum IAM 14863] (249 aa)
Score = 134, Expect = 2.3e-06, Identities = 40/110 (36%), Positives = 54/110 (49%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSE 121
           PH + + G++A  VL+PGDP R   IA   L+  + I   R     TG +    V+    G+G  S  I   EL       V+IRVGSAG+    I VGDL++   A  E
  S:     6 PHIQCRPGDVAPFVLLPGDPGRIHAIAAQ-LDRWEQIACNREYRTITGTFRGMPVSATSTGIGGPSTAIAVEELIRV-GARVLIRVGSAGALQPGIRVGDLLVAVGAVRE 113
>gi|126459428|ref|YP_001055706.1| purine phosphorylase family protein 1 [Pyrobaculum calidifontis JCM 11548] >gi|126249149|gb|ABO08240.1| purine and other phosphorylase, family 1 [Pyrobaculum calidifontis JCM 11548] (221 aa)
Score = 134, Expect = 2.3e-06, Identities = 36/94 (38%), Positives = 55/94 (58%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSY 103
           M  H  AK+G+IA +V+  GDP RA+  A + +E  +L+N  R  + YTG+   + VTV  HG+G  S  I   EL     ++  +R+G+AGS+
  S:     1 MPYHIWAKEGDIAPLVIGVGDPGRAELFA-SLMEEAQLVNRNRFPV-YTGWVGGRRVTVAVHGVGAPSAAIVLEEL-KMLGMERFVRIGTAGSF 91
>gi|120435974|ref|YP_861660.1| phosphorylase family protein [Gramella forsetii KT0803] >gi|117578124|emb|CAL66593.1| phosphorylase family protein [Gramella forsetii KT0803] (289 aa)
Score = 134, Expect = 2.3e-06, Identities = 44/131 (33%), Positives = 68/131 (51%)
  Q:    20 EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKT 150
           EIA  V+  GDP R + I+ +F ++ ++    R    +TG Y  K +TVM  GMG  +I I   EL A  ++D+             IIR+G+ GS  K+I VG  ++++ A        Y     KD +    D  N  + +T
  S:    25 EIANTVITVGDPARVQKISVHF-DSIEVKKQKREFCTHTGIYKGKRITVMSTGMGTDNIDIALTELDALVNIDLKAKKIKDKLTSLDIIRIGTTGSIRKEIPVGSYIISELALGFDGLMHYY----KDDSFLKKDIANAFVEQT 163
>gi|110668553|ref|YP_658364.1| uridine phosphorylase [Haloquadratum walsbyi DSM 16790] >gi|109626300|emb|CAJ52758.1| uridine phosphorylase [Haloquadratum walsbyi DSM 16790] (274 aa)
Score = 134, Expect = 2.3e-06, Identities = 38/109 (34%), Positives = 59/109 (54%)
  Q:    20 EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYI 128
           +IA+ VL+PG+P R + I E + +   +  D R     TG Y    ++V   G+G  S  I   EL A    +  IRVGS G+ + D+ VGDL+++  A   E T ++Y+
  S:    21 DIAETVLLPGNPGRVETITEMW-DQSTVRGDHREFRTATGTYQETPISVTSTGIGGPSAAIAVEEL-ARIGAETFIRVGSCGALSADVAVGDLIISSGAIRQEGTSSEYV 128
>gi|56415771|ref|YP_152846.1| uridine phosphorylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56130028|gb|AAV79534.1| probable uridine phosphorylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (231 aa)
Score = 133, Expect = 2.5e-06, Identities = 68/233 (29%), Positives = 105/233 (45%)
  Q:    10 MTPHNRAKKGEI-AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV--EMESFSLFANAIKLNKKAATLLT-------CSDSLVTH----ESM--SAEDRQTKFVNMINLALKVV 242
           M PH R       AK  L+PGDP R   IA  FL+  +++   R      G+Y   E+ V+  G+G  S  I   EL     V+ +IR+GS G+   D          K Y+ ++Y         D  L  +      + + A + NI     +V S D FY  +R  E  A  +   V+  +ME+ +L         + A+LL        C +S + H    E++    E+RQ      I+LAL+ +
  S:     1 MQPHIRLNTSMTRAKYALLPGDPGRVDRIAR-FLDKAEILGQNREFRAARGWYQGVEIVVLSTGIGGPSTAIAIEELRQV-GVNTLIRIGSCGAVADD-------GASKTYAPASYPA-----CADPYLTAT------LIQQAKQMNISAVCGLVRSHDSFY-TDREAELDAEWSARGVLGADMETAALMVVGALRGLRTASLLNVVVAHSGCLESSINHYVQQETLCQQGEERQ------ISLALQAI 222
>gi|194537008|ref|YP_002072158.1| uridine phosphorylase [Vibrio cholerae V51] >gi|125621621|gb|EAZ49952.1| uridine phosphorylase [Vibrio cholerae V51] (243 aa)
Score = 133, Expect = 2.5e-06, Identities = 45/152 (29%), Positives = 79/152 (51%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
            ++A  +++ G+P RA  IA + L N +L+ + R    ++G +  + +TV   G+G  S+ I + E  A      I+RVGSAG+   +I +G+L+L + A  +   +K YIG      +   S EL   +++   E ++     +V S D FY
  S:    10 AQVAPRIVVCGEPNRANRIA-SLLNNAELVAENREYRLFSGEFEEQPITVCSTGIGAPSM-IIAVEELARSGAKAIVRVGSAGTMQPEIGLGELILVEGAVRDEGGSKAYIGAAYPAYS---SFELVLEMQRFLAEQSVPTHRGIVRSHDSFY 157
>gi|145299819|ref|YP_001142660.1| uridine phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852591|gb|ABO90912.1| uridine phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] (251 aa)
Score = 133, Expect = 2.9e-06, Identities = 56/203 (27%), Positives = 92/203 (45%)
  Q:    13 HNRAKKGEI--AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV-EMESFSLFANAIKLNKKAATLLTCSDS 215
           H   KK ++  A + ++PGDP R K IAE  L+NP  +   R    + G  + K V +   G+G  S  I   EL A   ++  +R+G+ G+    +NVGD+++T  +       +  G     + +E       +    +  TA E   KL   V  SSD FY      + ++    S+    M+ +      +    ++ATLLT   S
  S:     6 HLGLKKADLQGATLAIVPGDPERVKRIAE-LLDNPVHLASHREFTTWRGEMDGKAVIICSTGIGGPSTSIAVEEL-AQLGINTFLRIGTTGAIQPHLNVGDVIVTTGS------VRLDGASLHFAPMEFPAVADFDCTTALVNTAKEMGSKLHIGVTASSDTFYPGQERYDTVSGRVVSRFQGSMKEWQAMG-VLNYEMESATLLTMCTS 206
>gi|48477195|ref|YP_022901.1| purine nucleoside phosphorylase [Picrophilus torridus DSM 9790] >gi|48429843|gb|AAT42708.1| purine nucleoside phosphorylase [Picrophilus torridus DSM 9790] (237 aa)
Score = 132, Expect = 3.1e-06, Identities = 56/210 (26%), Positives = 108/210 (51%)
  Q:    21 IAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSES---TYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRS-VEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTK 230
           +++ V++ G+  R + +  +FL N + +++  G   Y G YNNK+VT + HG+G+ SI + + +L +      IIR GS  +  ++I  G +V+  + YS +   T+ +Y+  E   S +   D + + + +      IK     V +SD  +  +R  +E++A D     +E+E   L+  A   N KA ++     +L+ ++ M A +   K
  S:    15 VSENVIIVGNLERQRTV-NSFLGNLEKVSEFAGYTSYQGEYNNKKVTTVFHGIGIPSISLITDDLISL-GARRIIRFGSCNAIKEEIEPGSVVI-PQGYSYNFGGTFRQYLNDEYSYSLIPDYDLMLNTVNELE-SLGIKTFKGRVFTSDALFTHSREFIEKMAKDNH-MALELEGAGLYLIAGLKNVKALSVHLAYGNLLNNKKMDASEISEK 223
>gi|90655829|gb|ABD96534.1| DeoD [Streptococcus thermophilus] (165 aa)
Score = 132, Expect = 3.5e-06, Identities = 52/159 (32%), Positives = 79/159 (49%)
  Q:    81 YSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLAL 239
           Y+ EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L
  S:     1 YARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGL 159
>gi|15644719|ref|NP_206889.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Helicobacter pylori 26695] >gi|3183121|sp|O24915|MTNN_HELPY MTA/SAH nucleosidase (5'-methylthioadenosine nucleosidase) (S-adenosylhomocysteine nucleosidase) >gi|2313168|gb|AAD07157.1| pfs protein (pfs) [Helicobacter pylori 26695] (231 aa)
Score = 132, Expect = 3.6e-06, Identities = 46/171 (26%), Positives = 81/171 (47%)
  Q:    53 GMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLV----LTKKAYSESTYAKYIGIEAKDST-LEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMS 223
           G + + G Y+NKE+ V    +G     + +  +   + V  ++  G AGS  KD+ + DL+    L +     S +   +G   + +  +E S+ LN + ++ A E +I L + V+ S D F  +    E + S+ K+  VEME  S+     K       L + SD+     +MS
  S:    33 GNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEEANMS 208
>gi|54308414|ref|YP_129434.1| uridine phosphorylase [Photobacterium profundum SS9] >gi|46912842|emb|CAG19632.1| Putative uridine phosphorylase [Photobacterium profundum SS9] (255 aa)
Score = 132, Expect = 3.7e-06, Identities = 42/149 (28%), Positives = 72/149 (48%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           A++ ++PGDP R + IA + ++NP+ +   R    + G  + K V V   G+G  S  I   EL A   +   +RVG+ G+    INVGD+++T  +       +  G     + +E       ++   +++  IE    +   V  SSD FY
  S:    19 AELAIIPGDPARVEKIA-SLMDNPEFLASSREYTLFRGVLDGKTVIVCSTGIGGPSTSIAVEEL-AQLGIRTFLRVGTTGAIQPHINVGDMIVTTGS------VRLDGASLHFAPMEFPAVADFDVATAMKQAVIEEGATVHTGVTASSDTFY 163
>gi|76802393|ref|YP_327401.1| uridine phosphorylase 1 [Natronomonas pharaonis DSM 2160] >gi|76558258|emb|CAI49846.1| uridine phosphorylase 1 [Natronomonas pharaonis DSM 2160] (267 aa)
Score = 132, Expect = 3.9e-06, Identities = 40/116 (34%), Positives = 58/116 (50%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYI 128
           H     G++   VL+PGDP R   IA+ + +N + + D R      G Y+ + +     G+G  S  I   EL A    +  IRVGS G+   ++ VGDLV+T  A   E T  +YI
  S:     7 HIELSDGDVDGPVLLPGDPDRIDIIADCW-DNAEPLADHREYRTAAGEYDGEPLAATSTGIGSPSAAIAVEEL-ARVGAETFIRVGSCGTIQPEVEVGDLVITTAAVRKEGTSDEYI 121
>gi|194535654|ref|YP_002070824.1| uridine phosphorylase [Vibrio cholerae RC385] >gi|150420448|gb|EDN12742.1| uridine phosphorylase [Vibrio cholerae RC385] (243 aa)
Score = 131, Expect = 4.1e-06, Identities = 46/152 (30%), Positives = 79/152 (51%)
  Q:    19 GEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK-YIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
            ++A  V++ G+P RA  IA + L N +L+ + R    ++G +  + +TV   G+G  S+ I + E  A      I+RVGSAG+   +I +G+L+L + A  +   +K YIG      +   S EL   +++   E ++     +V S D FY
  S:    10 AQVAPRVVVCGEPNRANRIA-SLLNNAELVAENREYRLFSGEFAGQPITVCSTGIGAPSM-IIAVEELARSGAKAIVRVGSAGAMQSEIGLGELILVEGAVRDEGGSKAYIGAVYPAYS---SFELVLEMQRFLAEQSVPTHRGIVRSHDSFY 157
>gi|54308624|ref|YP_129644.1| putative uridine phosphorylase [Photobacterium profundum SS9] >gi|46913053|emb|CAG19842.1| putative uridine phosphorylase [Photobacterium profundum SS9] (251 aa)
Score = 131, Expect = 5.0e-06, Identities = 48/178 (26%), Positives = 84/178 (47%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVE 189
           PH      +IAK V++ G+P R   IA   L+  ++I + R      G +N++ +T+   G+G  S  I + E      V  +IRVGS+G+   +I +GDL++ +         KAY  S +  Y      D  L    E         +  ++ + +   H   + YG  RS +   +D ++Q+ +
  S:     5 PHLCVSAEQIAKRVIVCGEPDRVNRIAA-LLDGVEIIAENREYRLMNGRFNDQLITICSTGIGAPS-AIIALEELNLCGVKQVIRVGSSGALQVNIALGDLIVAEAAVRDDGGSKAYVSSAFPAY-----ADRHLIAKME-------AYLNRSLTMPNTEQHVGQVHYGVVRSHDSFYTDNEAQLCQ 177
>gi|90655857|gb|ABD96559.1| DeoD [Streptococcus thermophilus] (165 aa)
Score = 130, Expect = 5.4e-06, Identities = 51/162 (31%), Positives = 82/162 (50%)
  Q:    81 YSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           Y+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N+ +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 YARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 162
>gi|90579059|ref|ZP_01234869.1| Putative uridine phosphorylase [Vibrio angustum S14] >gi|90439892|gb|EAS65073.1| Putative uridine phosphorylase [Vibrio angustum S14] (255 aa)
Score = 130, Expect = 5.6e-06, Identities = 36/111 (32%), Positives = 58/111 (52%)
  Q:     5 NKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           NK F++  +     G  A++ ++PGDP R + IA N ++NP+ +   R    +    + K V V   G+G  S  I   EL A   V   +RVG+ G+   +IN GD+++T
  S:     4 NKVFHLGVNKADLNG--AELAIIPGDPARVEKIA-NLMDNPEFLASSREYTVFRAKLDGKSVVVCSTGIGGPSTSIAVEEL-AQLGVTTFLRVGTTGAIQPNINPGDMIVT 110
>gi|89074532|ref|ZP_01161004.1| Putative uridine phosphorylase [Photobacterium sp. SKA34] >gi|89049636|gb|EAR55195.1| Putative uridine phosphorylase [Photobacterium sp. SKA34] (255 aa)
Score = 130, Expect = 5.6e-06, Identities = 36/111 (32%), Positives = 58/111 (52%)
  Q:     5 NKEFYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           NK F++  +     G  A++ ++PGDP R + IA N ++NP+ +   R    +    + K V V   G+G  S  I   EL A   V   +RVG+ G+   +IN GD+++T
  S:     4 NKVFHLGVNKADLNG--AELAIIPGDPARVEKIA-NLMDNPEFLASSREYTVFRAKLDGKSVVVCSTGIGGPSTSIAVEEL-AQLGVTTFLRVGTTGAIQPNINPGDMIVT 110
>gi|110004268|emb|CAK98606.1| hypothetical purine nucleoside phosphorylase II n-terminal truncated protein [Spiroplasma citri] (70 aa)
Score = 130, Expect = 5.6e-06, Identities = 29/58 (50%), Positives = 38/58 (65%)
  Q:   188 VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQTKFVNMINLALKVVEKI 245
           VEME+F+LFANA+ L K AA LLT SDS +T E  +  +RQ  F  M+ L L+   K+
  S:    13 VEMEAFALFANALTLKKSAAALLTISDSFITGELTTTAERQNNFYQMVELELESAIKL 70
>gi|119468659|ref|ZP_01611711.1| uridine phosphorylase [Alteromonadales bacterium TW-7] >gi|119447715|gb|EAW28981.1| uridine phosphorylase [Alteromonadales bacterium TW-7] (251 aa)
Score = 130, Expect = 6.0e-06, Identities = 58/186 (31%), Positives = 89/186 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA---------YSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV-------------------EMESFSLFANAIKLNKKAA 207
           AK+ ++PGDP RA  I++ FL+NP  +   R    Y G  N   V +   G+G  S  I   EL A   V   +R+G+ G+    IN G++++++ +         ++  +Y       A  + +E    L+       I+ +I +T     SSD FY       Q   DT S  V                   EMES +LF     L  +AA
  S:    17 AKLAIVPGDPDRAARISQ-FLDNPTCLAQTREFHVYLGQLNGHSVVICSTGIGGPSTSIAVEEL-AQLGVRQFLRIGTTGAIQPHINEGEILISQASVRLDGASQHFAPLSYPAVSDFYATQAMVEACKNLD-------IDFHIGIT----ASSDTFYPG-----QERYDTHSGYVPKAFQGSCEEWQKLGVMNYEMESATLFTMCAALGLQAA 212
>gi|27365398|ref|NP_760926.1| uridine phosphorylase [Vibrio vulnificus CMCP6] >gi|27361545|gb|AAO10453.1|AE016803_240 Uridine phosphorylase [Vibrio vulnificus CMCP6] (252 aa)
Score = 130, Expect = 6.5e-06, Identities = 53/194 (27%), Positives = 89/194 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVE----QIASDTKSQVVEMESFSLFANAIKLNKKAATLLT-CSDS 215
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T  +       +  G     + +E       ++   ++  A E+   +   V  SSD FY      +    ++ S  +  + E +   +    +    ++ATLLT C+ S
  S:    18 ATLAIIPGDPARVQKIAEE-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGS------VRLDGASLHFAPMEFPAVADFDVATAMKAAAQESGATVHTGVTASSDTFYPGQERYDTFTGRVVSRFQGSMKEWQDMGV----LNFEMESATLLTMCASS 208
>gi|153838661|ref|ZP_01991328.1| uridine phosphorylase [Vibrio parahaemolyticus AQ3810] >gi|149747939|gb|EDM58805.1| uridine phosphorylase [Vibrio parahaemolyticus AQ3810] (252 aa)
Score = 130, Expect = 6.6e-06, Identities = 34/94 (36%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T
  S:    18 ATLAIIPGDPARVQKIAEQ-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVT 109
>gi|91225282|ref|ZP_01260450.1| uridine phosphorylase [Vibrio alginolyticus 12G01] >gi|91189921|gb|EAS76193.1| uridine phosphorylase [Vibrio alginolyticus 12G01] (252 aa)
Score = 129, Expect = 6.8e-06, Identities = 34/94 (36%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T
  S:    18 ATLAIIPGDPARVQKIAEQ-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVT 109
>gi|28897734|ref|NP_797339.1| uridine phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|28805947|dbj|BAC59223.1| uridine phosphorylase [Vibrio parahaemolyticus RIMD 2210633] (252 aa)
Score = 129, Expect = 6.8e-06, Identities = 34/94 (36%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T
  S:    18 ATLAIIPGDPARVQKIAEQ-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVT 109
>gi|116495795|ref|YP_807529.1| uridine phosphorylase [Lactobacillus casei ATCC 334] >gi|116105945|gb|ABJ71087.1| Uridine phosphorylase [Lactobacillus casei ATCC 334] (247 aa)
Score = 129, Expect = 7.3e-06, Identities = 33/100 (33%), Positives = 52/100 (52%)
  Q:    17 KKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK 116
           + G++ +V L+ GDP R   I++++ E  K + D R  +   G Y    V++   GMG+ S  I   EL        IIR G  GS+ +DI  GDL++ +
  S:    10 QNGQLGEVTLIVGDPSRVDLISKDWSERHK-VEDSREFVLVIGKYKGHNVSICSTGMGVGSTEICIIELIE-NGAKQIIRCGGCGSWREDIEPGDLIINR 107
>gi|28900934|ref|NP_800589.1| uridine phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|153836730|ref|ZP_01989397.1| uridine phosphorylase [Vibrio parahaemolyticus AQ3810] >gi|28809380|dbj|BAC62422.1| uridine phosphorylase [Vibrio parahaemolyticus RIMD 2210633] >gi|149750079|gb|EDM60824.1| uridine phosphorylase [Vibrio parahaemolyticus AQ3810] (243 aa)
Score = 129, Expect = 7.3e-06, Identities = 37/116 (31%), Positives = 67/116 (57%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKY 127
           PH    + ++A +V++ G+P RA  IA  F ++ +++++ R    +TG Y  + V+V   G+G  S+ I + E      V  ++RVGSAG+    I +G+L++ +         K+Y +S Y  Y
  S:     5 PHIGVDETQVAPLVIVCGEPDRANRIAALF-DDAEMVSENREYRVFTGNYKGQTVSVCSTGIGAPSM-IIAVEELKQCGVTHVVRVGSAGAMQSQIQLGELIVAEGAVRDEGGSKSYVDSAYPAY 127
>gi|148656579|ref|YP_001276784.1| purine phosphorylase family 1 [Roseiflexus sp. RS-1] >gi|148568689|gb|ABQ90834.1| purine or other phosphorylase, family 1 [Roseiflexus sp. RS-1] (262 aa)
Score = 129, Expect = 8.6e-06, Identities = 33/96 (34%), Positives = 50/96 (52%)
  Q:    23 KVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYY-NNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           ++ L+ GDP RA+ IA   L N + +++ RG+  Y G   N   +     GMG  S+ I   EL     +  IIRVG++GS    I  G +V++  A
  S:    23 RIALLSGDPERARLIAHTALSNARTLSEHRGLHSYVGTLPNGAPLLSATSGMGAPSLSIVVNELVQV-GIRTIIRVGTSGSIQAHIPPGSIVISSAA 118
>gi|117621317|ref|YP_856002.1| uridine phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117562724|gb|ABK39672.1| uridine phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (251 aa)
Score = 129, Expect = 8.7e-06, Identities = 56/203 (27%), Positives = 91/203 (44%)
  Q:    13 HNRAKKGEI--AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLE----GSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVV-EMESFSLFANAIKLNKKAATLLTCSDS 215
           H   KK ++  A + ++PGDP R K IAE  L+NP  +   R    + G  + K V +   G+G  S  I   EL A   +   +R+G+ G+    +NVGD+++T  +       +  G     + +E       +    +  TA E   KL   V  SSD FY      + ++    S+    M+ +      +    ++ATLLT   S
  S:     6 HLGLKKADLQGATLAIVPGDPERVKRIAE-LLDNPVHLASHREFTTWRGEMDGKAVIICSTGIGGPSTSIAVEEL-AQLGIRTFLRIGTTGAIQPHLNVGDVIVTTGS------VRLDGASLHFAPMEFPAVADFDCTTALVNTAKELGSKLHIGVTASSDTFYPGQERYDTVSGRVVSRFQGSMKEWQAMG-VLNYEMESATLLTMCTS 206
>gi|90655814|gb|ABD96520.1| DeoD [Streptococcus thermophilus] (165 aa)
Score = 128, Expect = 8.9e-06, Identities = 51/162 (31%), Positives = 81/162 (50%)
  Q:    81 YSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           Y+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     1 YARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 162
>gi|118725667|ref|ZP_01574305.1| purine and other phosphorylases, family 1 [Clostridium cellulolyticum H10] >gi|118664947|gb|EAV71571.1| purine and other phosphorylases, family 1 [Clostridium cellulolyticum H10] (252 aa)
Score = 128, Expect = 9.1e-06, Identities = 49/187 (26%), Positives = 91/187 (48%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGA---NRSVEQIASDTKSQVVEMESFSLFA 197
           T + + ++ +IAK VL  GDP R + +A   LE+ K I   R    YTGYY    +TV   G+G  S  I   E++    ++V +R+G+      D+ +G L++ T     E+T   Y+ +           +L + + K+ ++NN +  + +  + D FY     +R  E++  D       ++ +++ A
  S:     3 TLYAKTQEKDIAKYVLFSGDPWRVETVAGQ-LEDVKHIAFAREFNTYTGYYKGVRITVTSTGIGAPSAAIAMEEMYQC-GMEVAVRMGTTMGLKDDL-LGKLIIPTGSMREEATSKTYVPVSYPAV---ADFDLINCMNKSTLQNNRQYVNGLSCTLDGFYSQMRDSRLSEKMQRDMSETFTALKKYNISA 187
>gi|149183152|ref|ZP_01861601.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Bacillus sp. SG-1] >gi|148849135|gb|EDL63336.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Bacillus sp. SG-1] (231 aa)
Score = 128, Expect = 9.8e-06, Identities = 56/204 (27%), Positives = 100/204 (49%)
  Q:    42 LENPKLINDVRGMLGYT-GYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKD-----STLEGSDELNDVIRKTAIE-NNIKLTDVVVHSSDIFYGANRSVEQIASDTKS-QVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDR--QTKFVNMINLALKVVEKI 245
           +EN K   +V G   YT G  +  EV ++  G+G  +  + +  L   +  D +I  GSAG +  ++NVGD+V++             G E        +     ++L +V  ++A E +N+K+   ++ + D F      VE I    ++ Q VEME+ ++   A +       + + SD +   ES  + D+  +T  VN  NL +K+V K+
  S:    20 IENAK--EEVIGGSQYTAGSMHGVEVVLLRSGIGKVNAAMSTAVLLERFKPDCVINTGSAGGFDAELNVGDVVISTDVRHHDVDVTAFGYEYGQVPQLPAAFTADEKLKEVAAESAKETSNVKIVSGLIATGDSFMNDPARVEAIRDKFENLQAVEMEAAAIAQVAHQFEVPFVIIRSLSD-IAGKESHVSFDQYLETAAVNSANLVMKMVSKL 230
>gi|55377336|ref|YP_135186.1| uridine phosphorylase [Haloarcula marismortui ATCC 43049] >gi|55230061|gb|AAV45480.1| uridine phosphorylase [Haloarcula marismortui ATCC 43049] (274 aa)
Score = 128, Expect = 1.0e-05, Identities = 59/216 (27%), Positives = 105/216 (48%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYG-----------ANRSVEQIASDTKSQVV--EMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDRQ 228
           H    + ++A  VL+PG+P R + + + + ++  ++ + R     TG ++   ++V   G+G  S  I   EL A    D  IRVGS G+  ++ ++GDLV+T  A   E T  +Y+    +D        +   +   A E        V  S+D FY            A+ S E+IA+  ++ V+  EME+ ++   A     +A  + T   + VT E  +  +R+
  S:    15 HLEVGEDDVADSVLLPGNPERVEKVVD-YWDDHDIVAEHREYRTATGNHDGTPISVTSTGIGGPSAAIALEEL-ARVGADSFIRVGSCGAIQEEASIGDLVITTGAVRQEGTSKEYV---REDYPASADHRIVSALVAAAEELGYDYHLGVTCSTDSFYAGQSRPGFEDFEASGSDERIAALQEAGVLNFEMEAATILTLANLYGLRAGAVCTVYANRVTGEFRTEGERK 239
>gi|24473734|gb|AAL23725.1| DeoD [Streptococcus thermophilus] (163 aa)
Score = 128, Expect = 1.1e-05, Identities = 51/159 (32%), Positives = 79/159 (49%)
  Q:    84 ELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           EL   Y V  +IRVG+AGS  +D++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     2 ELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIASFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 160
>gi|52841646|ref|YP_095445.1| purine nucleoside phosphorylase II [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628757|gb|AAU27498.1| purine nucleoside phosphorylase II [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (293 aa)
Score = 127, Expect = 1.2e-05, Identities = 33/106 (31%), Positives = 62/106 (58%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   +  EIA +++  GDP R   ++++F +  ++    R  + +TGY     +TV+  G+GM +I I   EL A  ++D+             IIR+G+ G+ T++   GD+ +++ A
  S:    17 HLDLRTEEIADLIITVGDPGRVSLVSQHF-DKIEVQRSHREFVTHTGYLGTNRITVLSTGIGMPNIDIVMNELDALANIDLSTRTVNTTKKSLTIIRLGTTGALTENCLPGDIAISRYA 134
>gi|90411816|ref|ZP_01219825.1| putative uridine phosphorylase [Photobacterium profundum 3TCK] >gi|90327378|gb|EAS43742.1| putative uridine phosphorylase [Photobacterium profundum 3TCK] (251 aa)
Score = 127, Expect = 1.2e-05, Identities = 48/178 (26%), Positives = 85/178 (47%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVE 189
           PH      +IAK V++ G+P R   IA   L+  ++I + R      G +N++ +T+   G+G  S  I + E      V  +IRVGS+G+   +I +GDL++ +         KAY  ST+  Y      D  L    E         +  ++ + +   +   + YG  RS +   +D ++Q+ +
  S:     5 PHLCVSAEQIAKRVIVCGEPDRVNRIAA-LLDGVEIIAENREYRLMNGRFNDQLITICSTGIGAPS-AIIALEELNLCGVKQVIRVGSSGALQVNIALGDLIVAEAAVRDDGGSKAYVSSTFPAY-----ADRHLIAKIE-------AYLNRSLTMPNTEQYVGQVHYGVVRSHDSFYTDNEAQLCQ 177
>gi|71018841|ref|XP_759651.1| hypothetical protein UM03504.1 [Ustilago maydis 521] >gi|46099409|gb|EAK84642.1| hypothetical protein UM03504.1 [Ustilago maydis 521] (330 aa)
Score = 127, Expect = 1.4e-05, Identities = 35/117 (29%), Positives = 58/117 (49%)
  Q:    11 TPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLI--NDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVD-VIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKY 127
           T H   K G++A  ++  GD +RA  IA+ F     +   N  R  L  TG Y    ++++  GMG + +  +  E  A    + +I+R+GS GS   D  +G +V+ K ++  S    Y
  S:    18 TYHVATKAGQVANRIITVGDQVRAHRIAKAFDGGAPIFAFNSQRNFLTLTGTYQGVPISIVAIGMGFSVVDFFVRECRAVVKGEMIIVRLGSCGSMQPDYGIGTVVVPKASFGISRNYDY 137
>gi|15790029|ref|NP_279853.1| Udp2 [Halobacterium sp. NRC-1] >gi|169235753|ref|YP_001688953.1| uridine phosphorylase [Halobacterium salinarum R1] >gi|10580457|gb|AAG19333.1| uridine phosphorylase [Halobacterium sp. NRC-1] >gi|167726819|emb|CAP13605.1| uridine phosphorylase [Halobacterium salinarum R1] (273 aa)
Score = 127, Expect = 1.5e-05, Identities = 39/116 (33%), Positives = 58/116 (50%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYI 128
           H      +IA  VL+PG+P R   I   + ++ ++ +  R     TG Y+   ++V   G+G  S  I   EL A    D  IRVGS G+   D+  GDLV+T+ A   E T  +Y+
  S:    15 HLEVAAEDIADAVLLPGNPERVDTITPLWDDHEEMAHH-REYRTATGAYDGTPISVTSTGIGSPSAAIAVEEL-ARAGADTFIRVGSCGALQADMEPGDLVITRGAVRQEGTTDEYV 129
>gi|84386610|ref|ZP_00989636.1| uridine phosphorylase [Vibrio splendidus 12B01] >gi|84378416|gb|EAP95273.1| uridine phosphorylase [Vibrio splendidus 12B01] (252 aa)
Score = 126, Expect = 1.7e-05, Identities = 33/94 (35%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD++++
  S:    18 ATLAIIPGDPARVQKIAEE-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVS 109
>gi|116334039|ref|YP_795566.1| nucleoside phosphorylase [Lactobacillus brevis ATCC 367] >gi|116099386|gb|ABJ64535.1| methylthioadenosine nucleosidase [Lactobacillus brevis ATCC 367] (230 aa)
Score = 126, Expect = 1.7e-05, Identities = 34/129 (26%), Positives = 65/129 (50%)
  Q:    51 VRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQI 179
           + G+  YTG  +++ V ++  G+G    G+ +  L   ++VD++I  GSAG+   D+N+GD+V++ +       A+  G E      + +    S E  D I   A E  +     ++ S D F  +   +++I
  S:    28 IHGLEFYTGTIHDQAVVLVRSGIGKVEAGLTTALLITQFNVDLVINSGSAGALAPDLNIGDVVVSTETAYHDADARAFGYEYGQLPQQPARFIASKEWGDKIVAAASETGLTTKQGLIVSGDQFLNSPAVIKEI 161
>gi|148978594|ref|ZP_01815021.1| uridine phosphorylase [Vibrionales bacterium SWAT-3] >gi|145962260|gb|EDK27542.1| uridine phosphorylase [Vibrionales bacterium SWAT-3] (252 aa)
Score = 126, Expect = 1.8e-05, Identities = 33/94 (35%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD++++
  S:    18 ATLAIIPGDPARVQKIAEE-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVS 109
>gi|86146957|ref|ZP_01065275.1| uridine phosphorylase [Vibrio sp. MED222] >gi|85835207|gb|EAQ53347.1| uridine phosphorylase [Vibrio sp. MED222] (252 aa)
Score = 126, Expect = 1.8e-05, Identities = 33/94 (35%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +ENP  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD++++
  S:    18 ATLAIIPGDPARVQKIAEE-MENPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVS 109
>gi|54294302|ref|YP_126717.1| hypothetical protein lpl1367 [Legionella pneumophila str. Lens] >gi|53754134|emb|CAH15607.1| hypothetical protein [Legionella pneumophila str. Lens] (293 aa)
Score = 126, Expect = 1.8e-05, Identities = 33/106 (31%), Positives = 62/106 (58%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   +  EIA +++  GDP R   ++++F +  ++    R  + +TGY     +TV+  G+GM +I I   EL A  ++D+             IIR+G+ G+ T++   GD+ +++ A
  S:    17 HLDLRTEEIADLIITVGDPGRVSLVSQHF-DKIEVQRSHREFVTHTGYLGANRITVLSTGIGMPNIDIVMNELDALANIDLSTRTVNTTKKSLTIIRLGTTGALTENCLPGDIAISRYA 134
>gi|54297326|ref|YP_123695.1| hypothetical protein lpp1371 [Legionella pneumophila str. Paris] >gi|53751111|emb|CAH12522.1| hypothetical protein [Legionella pneumophila str. Paris] (293 aa)
Score = 126, Expect = 1.8e-05, Identities = 33/106 (31%), Positives = 60/106 (56%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   +  EIA +++  GDP R   ++++F +  ++    R  + +TGY     +TV+  G+GM +I I   EL A  ++D+             IIR+G+ G  T +   GD+ +++ A
  S:    17 HLDLRTEEIADLIITVGDPGRVSLVSQHF-DKIEVQRSHREFVTHTGYLGTNRITVLSTGIGMPNIDIVMNELDALANIDLSTRTVNTNKKSLTIIRLGTTGGVTANCMPGDIAISRYA 134
>gi|15641047|ref|NP_230679.1| uridine phosphorylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587379|ref|ZP_01677149.1| uridine phosphorylase [Vibrio cholerae 2740-80] >gi|121728153|ref|ZP_01681188.1| uridine phosphorylase [Vibrio cholerae V52] >gi|147674560|ref|YP_001216502.1| uridine phosphorylase [Vibrio cholerae O395] >gi|153215078|ref|ZP_01949795.1| uridine phosphorylase [Vibrio cholerae 1587] >gi|153800965|ref|ZP_01955551.1| uridine phosphorylase [Vibrio cholerae MZO-3] >gi|153819298|ref|ZP_01971965.1| uridine phosphorylase [Vibrio cholerae NCTC 8457] >gi|153822391|ref|ZP_01975058.1| uridine phosphorylase [Vibrio cholerae B33] >gi|153824933|ref|ZP_01977600.1| uridine phosphorylase [Vibrio cholerae MZO-2] >gi|153828098|ref|ZP_01980765.1| uridine phosphorylase [Vibrio cholerae 623-39] >gi|194531791|ref|YP_002067233.1| uridine phosphorylase [Vibrio cholerae MO10] >gi|194534706|ref|YP_002069909.1| uridine phosphorylase [Vibrio cholerae RC385] >gi|9655498|gb|AAF94193.1| uridine phosphorylase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548382|gb|EAX58444.1| uridine phosphorylase [Vibrio cholerae 2740-80] >gi|121629550|gb|EAX61973.1| uridine phosphorylase [Vibrio cholerae V52] >gi|124114941|gb|EAY33761.1| uridine phosphorylase [Vibrio cholerae 1587] >gi|124123556|gb|EAY42299.1| uridine phosphorylase [Vibrio cholerae MZO-3] >gi|125617745|gb|EAZ46300.1| uridine phosphorylase [Vibrio cholerae MO10] >gi|125621083|gb|EAZ49429.1| uridine phosphorylase [Vibrio cholerae V51] >gi|126510158|gb|EAZ72752.1| uridine phosphorylase [Vibrio cholerae NCTC 8457] >gi|126520098|gb|EAZ77321.1| uridine phosphorylase [Vibrio cholerae B33] >gi|146316443|gb|ABQ20982.1| uridine phosphorylase [Vibrio cholerae O395] >gi|148876340|gb|EDL74475.1| uridine phosphorylase [Vibrio cholerae 623-39] >gi|149741445|gb|EDM55475.1| uridine phosphorylase [Vibrio cholerae MZO-2] >gi|150419500|gb|EDN11827.1| uridine phosphorylase [Vibrio cholerae RC385] >gi|150422339|gb|EDN14300.1| uridine phosphorylase [Vibrio cholerae AM-19226] (258 aa)
Score = 125, Expect = 2.1e-05, Identities = 32/94 (34%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  ++NP  +   R    Y    + + V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T
  S:    23 ATLAIIPGDPARVQKIAE-LMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVT 114
>gi|117618045|ref|YP_857659.1| uridine phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559452|gb|ABK36400.1| uridine phosphorylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (241 aa)
Score = 125, Expect = 2.2e-05, Identities = 38/119 (31%), Positives = 60/119 (50%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY-SESTYAKYI 128
           + PH + +  +IA+ V++ GDP R   IA   L+   ++   R      G+Y    VTV   G+G AS  + + E         +IRVGSAG+   +I +GDL++ + A  SE     Y+
  S:     3 LLPHLQCRPDQIAERVVLCGDPARVDRIAGQ-LDECDVLGQHREFRLINGHYRGLPVTVCSTGIGGAS-AVIALEELVQAGARALIRVGSAGALQHEIALGDLIVVEGAVRSEGASQAYL 120
>gi|8670903|emb|CAB94933.1| uridine phosphorylase [Vibrio cholerae] (253 aa)
Score = 125, Expect = 2.5e-05, Identities = 32/94 (34%), Positives = 49/94 (52%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  ++NP  +   R    Y    + + V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T
  S:    18 ATLAIIPGDPARVQKIAE-LMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVT 109
>gi|24637490|gb|AAN63760.1|AF454500_1 DeoD [Streptococcus thermophilus] (172 aa)
Score = 125, Expect = 2.5e-05, Identities = 50/162 (30%), Positives = 81/162 (50%)
  Q:    81 YSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           Y+ EL   Y V  +IRVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I   + +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SDSLV   E  +AE+RQ  F +M+ + L+ +
  S:     8 YARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDSLVNPDEDTTAEERQNTFTDMMKVGLETL 169
>gi|90961836|ref|YP_535752.1| 5'-methylthioadenosine nucleosidase / S-adenosylhomocysteine nucleosidase [Lactobacillus salivarius UCC118] >gi|90821030|gb|ABD99669.1| 5'-methylthioadenosine nucleosidase / S-adenosylhomocysteine nucleosidase [Lactobacillus salivarius UCC118] (228 aa)
Score = 124, Expect = 2.8e-05, Identities = 37/131 (28%), Positives = 64/131 (48%)
  Q:    49 NDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-----IEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQI 179
           + + G+  Y+G  N KEV +   G+G    G+ +  L A Y VD +I  GSAG   + ++VGD+VL+  A      A   G     +  +        +L + I K A E+N+   + ++ + D F  ++  +  I
  S:    26 DTIGGIDFYSGTINGKEVVLTRSGIGKVQAGVTTGLLIANYKVDAVINSGSAGGIGEGLHVGDVVLSTGAAYHDADATAFGYKPGQLPQQPQIYTADKDLLEAISKAAKESNLVAKEGLIVTGDQFVSSSEKIAAI 161
>gi|148358947|ref|YP_001250154.1| purine nucleoside phosphorylase II [Legionella pneumophila str. Corby] >gi|148280720|gb|ABQ54808.1| purine nucleoside phosphorylase II [Legionella pneumophila str. Corby] (293 aa)
Score = 124, Expect = 2.8e-05, Identities = 37/136 (27%), Positives = 69/136 (50%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIR 148
           H   +  EIA +++  GDP R   ++++F +  ++    R  + +TGY     +TV+  G+GM +I I   EL A  ++D+             IIR+G+ G  T     GD+ +++ A    +   Y   +         DEL++ ++
  S:    17 HLDLRTEEIADLIITVGDPGRVSLVSQHF-DKIEVQRSHREFVTHTGYLGTNRITVLSTGIGMPNIDIVMNELDALANIDLSTRTVNTNKKSLTIIRLGTTGGVTASCLPGDIAISRYAIGFDSLIDYYQYQPMGVLETIRDELSNYLK 164
>gi|113461614|ref|YP_719683.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus somnus 129PT] >gi|112823657|gb|ABI25746.1| methylthioadenosine nucleosidase [Haemophilus somnus 129PT] (229 aa)
Score = 124, Expect = 3.0e-05, Identities = 49/190 (25%), Positives = 89/190 (46%)
  Q:    37 IAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           I  + +EN  +++ + G   Y G   +KEV ++  G+G  +  + +  L   +  D++I  GSAG  +  + VGD+V+ T+  Y ++      YAK   + A         +L  ++   A +  I LT  ++ S D F  +   +  I ++    V +EME+ ++     K N     +   SD      SMS E+
  S:    15 ILASLIENKNVVH-IAGCTIYQGNIQDKEVALLQSGIGKVAAAMGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTAFGYAKG-QLPACPPAFISDPKLTALVANVAKQQGINLTSGLICSGDSFINSAEKLAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASMSFEE 209
>gi|52425592|ref|YP_088729.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Mannheimia succiniciproducens MBEL55E] >gi|52307644|gb|AAU38144.1| Pfs protein [Mannheimia succiniciproducens MBEL55E] (229 aa)
Score = 124, Expect = 3.0e-05, Identities = 44/159 (27%), Positives = 77/159 (48%)
  Q:    37 IAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKS-QVVEMESFSL 195
           I  N + N + +  V G   Y G  N K+V ++  G+G  +  I +  L      DV++  GSAG     + VGD+V+ T+ AY ++      YAK   + A  +T    ++L  + ++ A      +   ++ S D F      + QI +D  +   VEME+ ++
  S:    15 ILANLMRN-QTVTQVAGCTIYEGLINGKQVALLQSGIGKVAAAIGTTALLQLAKPDVVLNTGSAGGVADGLKVGDIVISTETAYHDADVTAFGYAKG-QLPACPATFISDEKLTALAKQVAQAQGHNVKRGLICSGDSFIAGGERLAQIKADFPNVTAVEMEAAAI 178
>gi|157368493|ref|YP_001476482.1| uridine phosphorylase [Serratia proteamaculans 568] >gi|157320257|gb|ABV39354.1| uridine phosphorylase [Serratia proteamaculans 568] (253 aa)
Score = 124, Expect = 3.1e-05, Identities = 32/97 (32%), Positives = 52/97 (53%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A++ ++PGDP R + IA+  +ENP  +   R    +    + K V V   G+G  S  I   EL A   +   +R+G+ G+   +INVGD+++T  A
  S:    19 AQLAIVPGDPQRVEKIAK-LMENPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGIRTFLRIGTTGAIQSNINVGDVLVTTAA 113
>gi|153834721|ref|ZP_01987388.1| uridine phosphorylase [Vibrio harveyi HY01] >gi|148868860|gb|EDL67924.1| uridine phosphorylase [Vibrio harveyi HY01] (252 aa)
Score = 123, Expect = 3.9e-05, Identities = 33/94 (35%), Positives = 48/94 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLT 115
           A + ++PGDP R + IAE  +E P  +   R    Y    + K V V   G+G  S  I   EL A   V   +RVG+ G+    +NVGD+++T
  S:    18 ATLAIIPGDPARVQKIAEE-MEKPVFLASHREYTLYRAELDGKPVVVCSTGIGGPSTSIAVEEL-AQLGVRTFLRVGTTGAIQPHVNVGDMIVT 109
>gi|67480067|ref|XP_655398.1| purine nucleoside phosphorylase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56472531|gb|EAL50012.1| purine nucleoside phosphorylase, putative [Entamoeba histolytica HM-1:IMSS] (318 aa)
Score = 123, Expect = 4.1e-05, Identities = 36/104 (34%), Positives = 57/104 (54%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLI--NDVRGMLGYTGYY--NNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTK 116
           H +    ++A  ++M GDP R   IAE   +  K I   D RG+   TGY   +   ++V+ HGMG  S  I   E+ A   +D+             IIR+G++G+      +G  ++TK
  S:    19 HLQVTANDVANNIIMVGDPERVPKIAELVFDKSKDIFRKDHRGLCVMTGYTIGDGMRLSVITHGMGTGSAEIVLNEVLALKAIDINSRTPIEVKEPVNIIRIGTSGALQSSTKLGTTIITK 139
>gi|145298179|ref|YP_001141020.1| uridine phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850951|gb|ABO89272.1| uridine phosphorylase [Aeromonas salmonicida subsp. salmonicida A449] (241 aa)
Score = 123, Expect = 4.2e-05, Identities = 35/109 (32%), Positives = 56/109 (51%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           + PH + +  +IA+ V++ GDP R   IA N L +  ++   R      G Y    +TV   G+G AS  I + E         ++RVGSAG+   +I +GDL++ + A
  S:     3 LLPHLQCRPDQIAERVVLCGDPARVDRIA-NQLASCDVLGQHREFRLINGRYQGLPITVCSTGIGGAS-AIIALEELVQAGARALVRVGSAGALQHEIALGDLIVVEGA 109
>gi|91201101|emb|CAJ74160.1| strongly similar to uridine phosphorylase [Candidatus Kuenenia stuttgartiensis] (259 aa)
Score = 122, Expect = 5.2e-05, Identities = 56/195 (28%), Positives = 93/195 (47%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLIND----VRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIE----NNIKLTDVVVHSSDIFYGANRSVEQIASDT--KSQVVEMESFSLFANAIKLNKKAATLLTCSDSL 216
           AK+ L+PGDP R++ IAE+  +     N+     R    Y    + +++ +   G+G  S  I   EL A   +   IRVG++G+  + I++GD+++T  A       +  G     + +E     N  I  + IE    + IK    +  SSD FY      +     T  K Q +  E  SL  N +    +A+T+LT + S+
  S:    17 AKIALLPGDPFRSQIIAESISKTYGTGNERLAWKREYCSYLTEVSGQKILITSTGIGGPSASIAVDEL-AQLGIQTFIRVGTSGAIQEYIDIGDVIITTGA------VRLDGASTHYAPIEYPAVANHEIIYSLIEGAKYSRIKYHVGITASSDTFYQGEERSDSFRKYTLRKFQGITKELQSL--NVLNYEMEASTVLTLTASM 212
>gi|77978485|ref|ZP_00833913.1| COG2820: Uridine phosphorylase [Yersinia intermedia ATCC 29909] (253 aa)
Score = 122, Expect = 5.2e-05, Identities = 54/190 (28%), Positives = 86/190 (45%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVE----QIASDTKSQVVEMESFSLFANAIKLNKKAATLLT 211
           A + ++PGDP R + IA+  ++NP  +   R    +    + K V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A       +  G     + +E    + D    TA+ N  K      H     SSD FY      +    ++ S  K  + E +S  +    +    ++ATLLT
  S:    19 ATLAIVPGDPQRVEKIAK-LMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLVTTAA------VRLDGASLHFAPME-FPAVADFTCTTALVNAAKSVGATTHIGVTASSDTFYPGQERYDTFSGRVVSRFKGSMEEWQSMGV----MNYEMESATLLT 204
>gi|15602059|ref|NP_245131.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Pasteurella multocida subsp. multocida str. Pm70] >gi|12720415|gb|AAK02278.1| Pfs [Pasteurella multocida subsp. multocida str. Pm70] (229 aa)
Score = 122, Expect = 5.3e-05, Identities = 45/185 (24%), Positives = 79/185 (42%)
  Q:    42 LENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIG-----IEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKS-QVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           L   K +  V     Y G  + K V ++  G+G  +  I +  L      D++I  GSAG     +NVGD+V++ +           G     + A  +  +  ++L  +  K A++   ++   ++ S D F      + QI +D  +   VEME+ ++       N     +   SDS     SMS E+
  S:    19 LMQDKRVTQVASCTIYEGMIHGKAVALLQSGIGKVAAAIGATLLLEMCKPDLVINTGSAGGVATGLNVGDIVISDETVYHDADVTAFGYAKGQLPACPARFQSDEKLVQLAEKIAVQQQQQVKRGLICSGDSFIQGGTPLAQIKADFPTVMAVEMEATAIAQVCHAFNVPFVVVRAISDSGDGEASMSFEE 209
>gi|156742305|ref|YP_001432434.1| purine phosphorylase family 1 [Roseiflexus castenholzii DSM 13941] >gi|156233633|gb|ABU58416.1| purine or other phosphorylase family 1 [Roseiflexus castenholzii DSM 13941] (262 aa)
Score = 121, Expect = 6.8e-05, Identities = 36/114 (31%), Positives = 56/114 (49%)
  Q:     5 NKEFYMTPHNRAKKGE-IAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYY-NNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           N   Y     R+  G+   ++ L+ GDP RA+ IA+  L   +++++ RG+    G   N   +     GMG  S+ I   EL     V  IIRVG++GS    I  G +V++  A
  S:     4 NDRLYHIGFGRSDLGDDPPRIALLSGDPERARLIAQTALRGARVLSENRGLHSSVGTLPNGAPILSATSGMGAPSLSIVVNELVQV-GVRTIIRVGTSGSIQLHIPPGSIVISSAA 118
>gi|86130181|ref|ZP_01048781.1| purine nucleoside phosphorylase II [Cellulophaga sp. MED134] >gi|85818856|gb|EAQ40015.1| purine nucleoside phosphorylase II [Dokdonia donghaensis MED134] (302 aa)
Score = 120, Expect = 7.5e-05, Identities = 35/106 (33%), Positives = 58/106 (54%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   K  +IA  ++  GDP R   + + F ++ +     R     TG Y  KE+TV+  G+G  +I I   EL A  ++D+             IIR+G++G+  KDI V   ++++ A
  S:    29 HLNIKPQDIATTIITVGDPDRVDTVTKYF-DSVRFTTQKREFKTSTGTYKGKEITVISTGIGTDNIDIVLNELDALVNIDLETRAVKDTHTTLDIIRIGTSGAIQKDIPVDSFLISRYA 146
>gi|159040976|ref|YP_001540228.1| uridine phosphorylase [Caldivirga maquilingensis IC-167] >gi|157919811|gb|ABW01238.1| uridine phosphorylase [Caldivirga maquilingensis IC-167] (275 aa)
Score = 120, Expect = 7.7e-05, Identities = 40/113 (35%), Positives = 53/113 (46%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAY----SESTYA 125
           H   K GE     L+PGDP R   IA +  +  +L  + R    Y G Y    V     G+G  S  I   EL A   V  +IRVG+ GS    + VGDL++ + A     + S YA
  S:    13 HLVLKPGETTPYALLPGDPGRVDLIA-SMWDEVRLKVENREYRTYVGTYRGVPVMATSTGIGGPSASIAIEEL-ASLGVGTLIRVGTTGSLWASVKVGDLIIARGAVRLDGASSNYA 127
>gi|37528245|ref|NP_931590.1| uridine phosphorylase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36787682|emb|CAE16789.1| uridine phosphorylase (UDRPase) [Photorhabdus luminescens subsp. laumondii TTO1] (251 aa)
Score = 120, Expect = 7.7e-05, Identities = 53/190 (27%), Positives = 88/190 (46%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVE----QIASDTKSQVVEMESFSLFANAIKLNKKAATLLT 211
           A + ++PGDP R + IA   ++NP  +  +R    +    +   V V   G+G  S  I   EL A   V   +R+G+ G+  ++INVGD+++T  A       +  G     + +E    + D    TA+    K   V VH     SSD FY      +    ++ S  K  + E ++  +    +    ++ATLLT
  S:    17 ATLAIVPGDPKRVEKIAR-LMDNPVHLASLREFTSWRAEIDGTAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQENINVGDVLVTTAA------VRLDGASLHFAPME-FPAVADFECTTALYEAAKDLGVTVHVGVTASSDTFYPGQERYDTYSGRVVSRFKGSMAEWQAMGV----MNYEMESATLLT 202
>gi|170718679|ref|YP_001783873.1| adenosylhomocysteine nucleosidase [Haemophilus somnus 2336] >gi|168826808|gb|ACA32179.1| Adenosylhomocysteine nucleosidase [Haemophilus somnus 2336] (229 aa)
Score = 120, Expect = 7.8e-05, Identities = 48/190 (25%), Positives = 89/190 (46%)
  Q:    37 IAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSEST-----YAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           I  + +EN  +++ + G   Y G   +KEV ++  G+G  +  + +  L   +  D++I  GSAG  +  + VGD+V+ T+  Y ++      YAK   + A         +L  ++   A +  I LT  ++ S D F  +   +  I ++    V +EME+ ++     K N     +   SD      S+S E+
  S:    15 ILASLIENKNVVH-IAGCTIYQGNIQDKEVALLQSGIGKVAAAMGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTAFGYAKG-QLPACPPAFISDPKLTALVENVAEQQGINLTSGLICSGDSFINSAEKLAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASISFEE 209
>gi|86141585|ref|ZP_01060131.1| purine nucleoside phosphorylase II [Flavobacterium sp. MED217] >gi|85832144|gb|EAQ50599.1| purine nucleoside phosphorylase II [Leeuwenhoekiella blandensis MED217] (290 aa)
Score = 120, Expect = 8.0e-05, Identities = 37/111 (33%), Positives = 62/111 (55%)
  Q:     8 FYMTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
            ++ PH      ++A  V+  GDP R + + ++F ++ +     R     TG Y  K +TV+  G+G  +I I   EL A  ++D              IIR+G++GS  KDI V  ++LT++A
  S:    19 LHLLPH------QLADTVITVGDPDRVEQVTKHF-DSIEFSVQKREFKTTTGVYQGKRITVISTGIGTDNIDIVLNELDALANIDFKTRTLKKDLKELNIIRLGTSGSIQKDIPVDRILLTERA 135
>gi|124002870|ref|ZP_01687722.1| purine nucleoside phosphorylase II [Microscilla marina ATCC 23134] >gi|123992098|gb|EAY31485.1| purine nucleoside phosphorylase II [Microscilla marina ATCC 23134] (285 aa)
Score = 120, Expect = 8.3e-05, Identities = 34/97 (35%), Positives = 58/97 (59%)
  Q:    20 EIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTK 116
           +IA  +L  GDP R + ++  F +  +L    R  + +TG  N K VTV+  GMG  +I I   EL A  ++D+             IIR+G++G+  +DI +  L++++
  S:    26 QIADTILTVGDPNRVEMVSRYF-DKIELRIQKREFVTHTGLLNGKRVTVISSGMGTDNIEILMTELDALVNIDLKTRTPNPSTRSLSIIRLGTSGALQQDIPLDSLLVSE 134
>gi|90655839|gb|ABD96543.1| DeoD [Streptococcus thermophilus] (165 aa)
Score = 120, Expect = 8.8e-05, Identities = 49/162 (30%), Positives = 79/162 (48%)
  Q:    81 YSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVV--VHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVT-HESMSAEDRQTKFVNMINLALKVV 242
           Y+ EL   Y V  + RVG+AGS  ++++V +LVL + A   +T +  I  +            N + +   I  N  +T  V  V SSD+FY               + VEME+ +L+  A +    A  ++T SD LV   E  +AE+RQ  F +M+ + L+ +
  S:     1 YARELIVDYGVKKLTRVGTAGSLNENVHVRELVLAQAA---ATNSNIIRNDWPQYDFPQIANFNLLDKAYHIAKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEAAALYYLAAQHQVDALAIMTISDCLVNPDEDTTAEERQNTFTDMMKVGLETL 162
>gi|91226817|ref|ZP_01261470.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Vibrio alginolyticus 12G01] >gi|91188948|gb|EAS75232.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Vibrio alginolyticus 12G01] (231 aa)
Score = 119, Expect = 1.1e-04, Identities = 47/190 (24%), Positives = 82/190 (43%)
  Q:    37 IAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKT-AIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           I +  + N K +N   G   ++G  N+ EV V+  G+G  +  + +  L   Y  DV+I  GSAG +   +N+GD+V++ +           G E      + +  +  D+L D+  K  A   N      ++ + D F       E I     S + VEME+ ++     + N     +   SD       MS ++
  S:    15 ILKQAITNCKTVNKA-GCTFFSGQINDVEVVVLQSGIGKVAAAVGTTILLDEYQPDVVINTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEIGQMAGQPAAFKADDKLMDLAEKALAQMENTHAVRGLICTGDAFVCTAERQEFIRKHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDE 210
>gi|145635065|ref|ZP_01790771.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittAA] >gi|145267673|gb|EDK07671.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittAA] (229 aa)
Score = 119, Expect = 1.1e-04, Identities = 42/170 (24%), Positives = 74/170 (43%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L     +D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKDVALLQSGIGKVAAAIGTTALLQLVKLDFVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEE 209
>gi|194467101|ref|ZP_03073088.1| purine or other phosphorylase family 1 [Lactobacillus reuteri 100-23] >gi|194454137|gb|EDX43034.1| purine or other phosphorylase family 1 [Lactobacillus reuteri 100-23] (244 aa)
Score = 119, Expect = 1.2e-04, Identities = 39/115 (33%), Positives = 53/115 (46%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK 126
           PH +          ++ GDP R     E FLEN +     R      G Y NK + VM  G+G  S GI   EL    +V  +IRVGSAG+  K I +G+L++   A  +    K
  S:     6 PHTQLTTEINTDSAVIVGDPARVDKATE-FLENAQGWAFNREYKSIIGTYRNKRILVMSTGIGAPSAGIGVEELHNV-NVKNVIRVGSAGAMQKGIGLGELIIGDGAVRDDGLTK 118
>gi|37524898|ref|NP_928242.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36784323|emb|CAE13201.1| MTA/SAH nucleosidase [Includes: 5'-methylthioadenosine nucleosidase ; S-adenosylhomocysteine nucleosidase ] [Photorhabdus luminescens subsp. laumondii TTO1] (233 aa)
Score = 119, Expect = 1.2e-04, Identities = 38/139 (27%), Positives = 63/139 (45%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKD-----STLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQI-ASDTKSQVVEMESFSL 195
           YTG  N  E+ ++  G+G  S  I +  L      DVII  GSAG     + +GD+V++++     T     G E        +     D+L D+  K     N+     ++ S D F      + +I A+  +   VEME+ ++
  S:    34 YTGKLNGVEIALLKSGIGKVSAAIGTTLLLEHCQPDVIINTGSAGGLDPKLQIGDIVVSREVRYHDTDVTAFGYEPGQMAQCPAAFVADDQLIDLAEKCIHSLNLNAVRGLICSGDAFINGAEPLARIRATFPQVTAVEMEAAAI 178
>gi|75766379|pdb|2BSX|A Chain A, Crystal Structure Of The Plasmodium Falciparum Purine Nucleoside Phosphorylase Complexed With Inosine (253 aa)
Score = 118, Expect = 1.3e-04, Identities = 57/183 (31%), Positives = 83/183 (45%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMG-------HGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKD-INVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASD---TKSQVVEMESFSL 195
           H +  K +I  VVL+ GDP R   I        K++ D    L Y   Y + E    G       HG+G A   +  +E        VIIR GS GS   D I  GD+ +   A  E   +  + I   D    G  ++ D + K A E N+ + + +  SSD++Y  N+ +     D     + VVEME  +L
  S:     7 HLKISKEQITPVVLVVGDPGRVDKI--------KVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAV-CFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLL-IHG-DFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYY-PNKIIPSRLEDYSKANAAVVEMELATL 188
>gi|53729280|ref|ZP_00348362.1| COG0775: Nucleoside phosphorylase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209101|ref|YP_001054326.1| MTA/SAH nucleosidase [Actinobacillus pleuropneumoniae L20] >gi|190150968|ref|YP_001969493.1| MTA/SAH nucleosidase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126097893|gb|ABN74721.1| MTA/SAH nucleosidase [Actinobacillus pleuropneumoniae L20] >gi|189916099|gb|ACE62351.1| MTA/SAH nucleosidase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (232 aa)
Score = 118, Expect = 1.3e-04, Identities = 38/146 (26%), Positives = 63/146 (43%)
  Q:    37 IAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASD 182
           I  N +   K+I ++ G   Y G  NN +V ++  G+G  +  + +  L      DVII  GSAG    ++NVGD+V++ +           G E     A  +    +++L  V  K            ++ S D+F      + QI  D
  S:    17 ILRNLMVEAKVI-EIAGCKIYDGKINNTQVALLQSGIGKVAAAVGTALLLELTKPDVIINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNAVSGLICSGDVFVNGAEKIAQIRQD 166
>gi|124506185|ref|XP_001351690.1| uridine phosphorylase, putative [Plasmodium falciparum 3D7] >gi|18539480|gb|AAL74412.1|AF426159_1 purine nucleoside phosphorylase [Plasmodium falciparum] >gi|23504618|emb|CAD51497.1| uridine phosphorylase, putative [Plasmodium falciparum 3D7] (245 aa)
Score = 118, Expect = 1.3e-04, Identities = 57/183 (31%), Positives = 83/183 (45%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMG-------HGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKD-INVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASD---TKSQVVEMESFSL 195
           H +  K +I  VVL+ GDP R   I        K++ D    L Y   Y + E    G       HG+G A   +  +E        VIIR GS GS   D I  GD+ +   A  E   +  + I   D    G  ++ D + K A E N+ + + +  SSD++Y  N+ +     D     + VVEME  +L
  S:     7 HLKISKEQITPVVLVVGDPGRVDKI--------KVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAV-CFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLL-IHG-DFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYY-PNKIIPSRLEDYSKANAAVVEMELATL 188
>gi|145631271|ref|ZP_01787044.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae 22.4-21] >gi|144983198|gb|EDJ90693.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae R3021] (229 aa)
Score = 118, Expect = 1.5e-04, Identities = 42/170 (24%), Positives = 75/170 (44%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D++I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  + + VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDLVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEE 209
>gi|59713713|ref|YP_206488.1| uridine phosphorylase [Vibrio fischeri ES114] >gi|59481961|gb|AAW87600.1| uridine phosphorylase [Vibrio fischeri ES114] (244 aa)
Score = 118, Expect = 1.6e-04, Identities = 35/116 (30%), Positives = 60/116 (51%)
  Q:    12 PHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTK---------KAYSESTYAKY 127
           PH    + +++  V++ G+P R   I E  ++N +L+ + R    + G Y    +T+   G+G  S+ I + E         +IRVGSAG+    I +G+L++ +         KAY  S Y  Y
  S:     5 PHICVDENQVSPYVIVCGEPDRVNRIVE-LMDNVELLAENREYRVFNGVYKGTTITICSTGIGAPSM-IIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAY 127
>gi|148828364|ref|YP_001293117.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittGG] >gi|148719606|gb|ABR00734.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittGG] (229 aa)
Score = 117, Expect = 1.8e-04, Identities = 42/170 (24%), Positives = 74/170 (43%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  + + VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEE 209
>gi|77957916|ref|ZP_00821960.1| COG2820: Uridine phosphorylase [Yersinia bercovieri ATCC 43970] >gi|77961750|ref|ZP_00825581.1| COG2820: Uridine phosphorylase [Yersinia mollaretii ATCC 43969] (253 aa)
Score = 117, Expect = 1.8e-04, Identities = 53/190 (27%), Positives = 85/190 (44%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVH-----SSDIFYGANRSVE----QIASDTKSQVVEMESFSLFANAIKLNKKAATLLT 211
           A + ++PGDP R + IA+  ++NP  +   R    +    + K V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A       +  G     + +E    + D    TA+ N  K      H     SSD FY      +    ++    K  + E +S  +    +    ++ATLLT
  S:    19 ATLAIVPGDPQRVEKIAK-LMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQSHINVGDVLVTTAA------VRLDGASLHFAPME-FPAVADFACTTALVNAAKSVGATTHIGVTASSDTFYPGQERYDTFSGRVVRRFKGSMEEWQSMGV----MNYEMESATLLT 204
>gi|148543836|ref|YP_001271206.1| methylthioadenosine nucleosidase [Lactobacillus reuteri F275] >gi|184153237|ref|YP_001841578.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Lactobacillus reuteri F275] >gi|148530870|gb|ABQ82869.1| methylthioadenosine nucleosidase [Lactobacillus reuteri F275] >gi|183224581|dbj|BAG25098.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Lactobacillus reuteri F275] (231 aa)
Score = 117, Expect = 1.9e-04, Identities = 32/124 (25%), Positives = 65/124 (52%)
  Q:    59 GYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYA----KYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASD 182
           G  NN++V ++  G+G    GI +  L      DV+I  GSAG   + ++VGD+V+ T+ AY +        +Y  +  K+   + SD+    + K   +  + +   ++ S D F  ++ ++++I ++
  S:    36 GKINNQDVVLVESGIGKVEAGITTEHLITDCGADVVINSGSAGGIGEGLHVGDIVISTETAYHDVDATAFNYRYGQLPGKEPRFKASDQWGQALEKAGEKTGLNVKRGLIVSGDQFIASSEAIKEILNN 164
>gi|149372842|ref|ZP_01891863.1| phosphorylase family protein [unidentified eubacterium SCB49] >gi|149354539|gb|EDM43104.1| phosphorylase family protein [unidentified eubacterium SCB49] (295 aa)
Score = 117, Expect = 2.1e-04, Identities = 34/106 (32%), Positives = 59/106 (55%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVD-------------VIIRVGSAGSYTKDINVGDLVLTKKA 118
           H   K G+IA  ++  GDP R   IA++F +  +L    R     TG Y NK +T++  G+G  +I I   EL A  ++D               +R+G++G+   +I +   ++++KA
  S:    22 HLALKPGQIADTIITVGDPERVMDIAKHF-DTIELEVQRREFKTITGRYKNKRLTIVSTGIGTDNIDIVFNELDALVNIDFESRTIKPMHTALTFVRIGTSGAIQSEIPINSFLISEKA 139
>gi|21957137|gb|AAM84033.1|AE013645_1 uridine phosphorylase [Yersinia pestis KIM] >gi|45437882|gb|AAS63431.1| uridine phosphorylase [Yersinia pestis biovar Microtus str. 91001] (268 aa)
Score = 117, Expect = 2.1e-04, Identities = 32/97 (32%), Positives = 50/97 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A + ++PGDP R + IA+  ++NP  +   R    +    + K V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A
  S:    34 ATLAIVPGDPQRVEKIAK-LMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLVTTAA 128
>gi|16123920|ref|NP_407233.1| uridine phosphorylase [Yersinia pestis CO92] >gi|51594605|ref|YP_068796.1| uridine phosphorylase [Yersinia pseudotuberculosis IP 32953] >gi|108806236|ref|YP_650152.1| uridine phosphorylase [Yersinia pestis Antiqua] >gi|108810344|ref|YP_646111.1| uridine phosphorylase [Yersinia pestis Nepal516] >gi|145600653|ref|YP_001164729.1| uridine phosphorylase [Yersinia pestis Pestoides F] >gi|153946882|ref|YP_001399263.1| uridine phosphorylase [Yersinia pseudotuberculosis IP 31758] >gi|153997157|ref|ZP_02022290.1| uridine phosphorylase [Yersinia pestis CA88-4125] >gi|161484894|ref|NP_667782.2| uridine phosphorylase [Yersinia pestis KIM] >gi|161511319|ref|NP_994554.2| uridine phosphorylase [Yersinia pestis biovar Microtus str. 91001] >gi|162421353|ref|YP_001607969.1| uridine phosphorylase [Yersinia pestis Angola] >gi|165926345|ref|ZP_02222177.1| uridine phosphorylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939178|ref|ZP_02227729.1| uridine phosphorylase [Yersinia pestis biovar Orientalis str. IP275] >gi|166011700|ref|ZP_02232598.1| uridine phosphorylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213610|ref|ZP_02239645.1| uridine phosphorylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401847|ref|ZP_02307335.1| uridine phosphorylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420958|ref|ZP_02312711.1| uridine phosphorylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426258|ref|ZP_02318011.1| uridine phosphorylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468709|ref|ZP_02333413.1| uridine phosphorylase [Yersinia pestis FV-1] >gi|170026161|ref|YP_001722666.1| uridine phosphorylase [Yersinia pseudotuberculosis YPIII] >gi|186893606|ref|YP_001870718.1| uridine phosphorylase [Yersinia pseudotuberculosis PB1/+] >gi|8670901|emb|CAB94934.1| uridine phosphorylase [Yersinia pseudotuberculosis] >gi|51587887|emb|CAH19490.1| uridine phosphorylase [Yersinia pseudotuberculosis IP 32953] >gi|108773992|gb|ABG16511.1| uridine phosphorylase [Yersinia pestis Nepal516] >gi|108778149|gb|ABG12207.1| uridine phosphorylase [Yersinia pestis Antiqua] >gi|115349399|emb|CAL22372.1| uridine phosphorylase [Yersinia pestis CO92] >gi|145212349|gb|ABP41756.1| uridine phosphorylase [Yersinia pestis Pestoides F] >gi|149289463|gb|EDM39541.1| uridine phosphorylase [Yersinia pestis CA88-4125] >gi|152958377|gb|ABS45838.1| uridine phosphorylase [Yersinia pseudotuberculosis IP 31758] >gi|162354168|gb|ABX88116.1| uridine phosphorylase [Yersinia pestis Angola] >gi|165912951|gb|EDR31577.1| uridine phosphorylase [Yersinia pestis biovar Orientalis str. IP275] >gi|165921869|gb|EDR39066.1| uridine phosphorylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989469|gb|EDR41770.1| uridine phosphorylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205283|gb|EDR49763.1| uridine phosphorylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961087|gb|EDR57108.1| uridine phosphorylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048740|gb|EDR60148.1| uridine phosphorylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054777|gb|EDR64581.1| uridine phosphorylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752695|gb|ACA70213.1| uridine phosphorylase [Yersinia pseudotuberculosis YPIII] >gi|186696632|gb|ACC87261.1| uridine phosphorylase [Yersinia pseudotuberculosis PB1/+] (253 aa)
Score = 117, Expect = 2.1e-04, Identities = 32/97 (32%), Positives = 50/97 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A + ++PGDP R + IA+  ++NP  +   R    +    + K V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A
  S:    19 ATLAIVPGDPQRVEKIAK-LMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLVTTAA 113
>gi|126664227|ref|ZP_01735219.1| purine nucleoside phosphorylase II [Flavobacteria bacterium BAL38] >gi|126623759|gb|EAZ94455.1| purine nucleoside phosphorylase II [Flavobacteria bacterium BAL38] (288 aa)
Score = 116, Expect = 2.2e-04, Identities = 35/104 (33%), Positives = 57/104 (54%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTK 116
           H   K G++AK ++  GD  R + I ++F ++ +     R     TG Y  K +TVM  G+G  +I I   EL A  +VD+             I+R+G++GS   DI     V+++
  S:    17 HINLKPGQVAKDIIFVGDQNRVEKITKHF-DSIEFTTQKREFKTQTGTYKGKRITVMSTGIGPDNIDIVMNELDALVNVDLATRTVKTELTSLNIVRIGTSGSLQADIPCDSFVMSQ 132
>gi|77973687|ref|ZP_00829233.1| COG2820: Uridine phosphorylase [Yersinia frederiksenii ATCC 33641] (253 aa)
Score = 116, Expect = 2.3e-04, Identities = 32/97 (32%), Positives = 50/97 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A + ++PGDP R + IA+  ++NP  +   R    +    + K V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A
  S:    19 ATLAIVPGDPQRVEKIAK-LMDNPIHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLVTTAA 113
>gi|77359503|ref|YP_339078.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; MtnN [Pseudoalteromonas haloplanktis TAC125] >gi|76874414|emb|CAI85635.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; MtnN [Pseudoalteromonas haloplanktis TAC125] (235 aa)
Score = 116, Expect = 2.3e-04, Identities = 49/204 (24%), Positives = 92/204 (45%)
  Q:    42 LENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-AKDSTLEGSDELNDVIRKTAIENNIKLTDV-----VVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDR-QTKFVNMINLALKVVEKI 245
           ++NP+ +    G   YTG      VT++  G+G  +  I +  L   +  D +I  GSAG +   +NVGD+V++ +           G E  +   +      +  +   A +   +++DV     ++ + DIF      +E+  SD  + + VEME  S+      LN     + + SD        S E+  +T  +N   + + ++EK+
  S:    20 MQNPQTLTKA-GFTFYTGELAGNTVTLVQSGIGKVASTIATTLLIDNFAPDCVINTGSAGGFDPSLNVGDVVISSEVRHHDVDVTAFGYEIGQVPQMPAGFAAHPKLVAAAEQTIAQISDVKTLVGLICTGDIFMCDPIRIEKARSDFPTMLAVEMEGASIAQTCHTLNTPFVVIRSMSDIAGKESPQSFEEYLETASINSSKMVVALLEKL 230
>gi|16273135|ref|NP_439372.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae Rd KW20] >gi|1172449|sp|P45113|MTNN_HAEIN MTA/SAH nucleosidase (5'-methylthioadenosine nucleosidase) (S-adenosylhomocysteine nucleosidase) >gi|1574146|gb|AAC22869.1| pfs protein (pfs) [Haemophilus influenzae Rd KW20] (229 aa)
Score = 116, Expect = 2.3e-04, Identities = 42/170 (24%), Positives = 73/170 (42%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEE 209
>gi|123440643|ref|YP_001004637.1| uridine phosphorylase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122087604|emb|CAL10385.1| uridine phosphorylase [Yersinia enterocolitica subsp. enterocolitica 8081] (253 aa)
Score = 116, Expect = 2.4e-04, Identities = 32/97 (32%), Positives = 50/97 (51%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A + ++PGDP R + IA+  ++NP  +   R    +    + K V V   G+G  S  I   EL A   V   +R+G+ G+    INVGD+++T  A
  S:    19 ATLAIVPGDPQRVEKIAK-LMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGVRTFLRIGTTGAIQPHINVGDVLVTTAA 113
>gi|47168426|pdb|1NW4|A Chain A, Crystal Structure Of Plasmodium Falciparum Purine Nucleoside Phosphorylase In Complex With Immh And Sulfate >gi|47168427|pdb|1NW4|B Chain B, Crystal Structure Of Plasmodium Falciparum Purine Nucleoside Phosphorylase In Complex With Immh And Sulfate >gi|47168428|pdb|1NW4|C Chain C, Crystal Structure Of Plasmodium Falciparum Purine Nucleoside Phosphorylase In Complex With Immh And Sulfate >gi|47168429|pdb|1NW4|D Chain D, Crystal Structure Of Plasmodium Falciparum Purine Nucleoside Phosphorylase In Complex With Immh And Sulfate >gi|47168430|pdb|1NW4|E Chain E, Crystal Structure Of Plasmodium Falciparum Purine Nucleoside Phosphorylase In Complex With Immh And Sulfate >gi|47168431|pdb|1NW4|F Chain F, Crystal Structure Of Plasmodium Falciparum Purine Nucleoside Phosphorylase In Complex With Immh And Sulfate >gi|47168594|pdb|1Q1G|A Chain A, Crystal Structure Of Plasmodium Falciparum Pnp With 5'- Methylthio-Immucillin-H >gi|47168595|pdb|1Q1G|B Chain B, Crystal Structure Of Plasmodium Falciparum Pnp With 5'- Methylthio-Immucillin-H >gi|47168596|pdb|1Q1G|C Chain C, Crystal Structure Of Plasmodium Falciparum Pnp With 5'- Methylthio-Immucillin-H >gi|47168597|pdb|1Q1G|D Chain D, Crystal Structure Of Plasmodium Falciparum Pnp With 5'- Methylthio-Immucillin-H >gi|47168598|pdb|1Q1G|E Chain E, Crystal Structure Of Plasmodium Falciparum Pnp With 5'- Methylthio-Immucillin-H >gi|47168599|pdb|1Q1G|F Chain F, Crystal Structure Of Plasmodium Falciparum Pnp With 5'- Methylthio-Immucillin-H (276 aa)
Score = 116, Expect = 2.5e-04, Identities = 57/183 (31%), Positives = 83/183 (45%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMG-------HGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKD-INVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASD---TKSQVVEMESFSL 195
           H +  K +I  VVL+ GDP R   I        K++ D    L Y   Y + E    G       HG+G A   +  +E        VIIR GS GS   D I  GD+ +   A  E   +  + I   D    G  ++ D + K A E N+ + + +  SSD++Y  N+ +     D     + VVEME  +L
  S:     9 HLKISKEQITPVVLVVGDPGRVDKI--------KVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAV-CFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLL-IHG-DFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYY-PNKIIPSRLEDYSKANAAVVEMELATL 190
>gi|68249762|ref|YP_248874.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae 86-028NP] >gi|68057961|gb|AAX88214.1| MTA/SAH nucleosidase [Haemophilus influenzae 86-028NP] (230 aa)
Score = 116, Expect = 2.6e-04, Identities = 41/170 (24%), Positives = 74/170 (43%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K++ ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  + + VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKDIALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEMAEKQGQSVKRGLICSGDSFINSEDKIAQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEE 209
>gi|50119145|ref|YP_048312.1| uridine phosphorylase [Pectobacterium atrosepticum SCRI1043] >gi|49609671|emb|CAG73104.1| uridine phosphorylase [Erwinia carotovora subsp. atroseptica SCRI1043] (256 aa)
Score = 116, Expect = 2.7e-04, Identities = 32/97 (32%), Positives = 49/97 (50%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKA 118
           A + ++PGDP R + IA   ++NP  +   R    +    + K V V   G+G  S  I   EL A   +   +RVG+ G+    INVGD+++T  A
  S:    19 ATLAIVPGDPERVEKIAR-LMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEEL-AQLGIRTFLRVGTTGAIQPGINVGDVLVTTAA 113
>gi|46395046|gb|AAS91661.1| MTA/SAH nucleosidase; 5'-methylthioadenosine nucleosidase; S-adenosylhomocysteine nucleosidase [Haemophilus influenzae] (229 aa)
Score = 114, Expect = 4.4e-04, Identities = 42/170 (24%), Positives = 72/170 (42%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K V ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKNVALLQSGIGKVAAAIGTTALLQLAKPDFVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGEASMSFEE 209
>gi|145637029|ref|ZP_01792692.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittHH] >gi|145269683|gb|EDK09623.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittHH] (230 aa)
Score = 114, Expect = 4.7e-04, Identities = 42/170 (24%), Positives = 72/170 (42%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K V ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      SMS E+
  S:    34 FEGKINGKNVALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQEQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEE 209
>gi|194539253|ref|YP_002074308.1| MTA/SAH nucleosidase [Vibrio sp. Ex25] >gi|151937808|gb|EDN56656.1| MTA/SAH nucleosidase [Vibrio sp. Ex25] (231 aa)
Score = 113, Expect = 5.2e-04, Identities = 46/190 (24%), Positives = 82/190 (43%)
  Q:    37 IAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKT-AIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           I +  + N K +N   G   ++G  N+ EV V+  G+G  +  + +  L   Y  DV+I  GSAG +   +N+GD+V++ +           G E      + +  +  ++L D+  K  A   N      ++ + D F       E I     S + VEME+ ++     + N     +   SD       MS ++
  S:    15 ILKEAITNCKTVNKA-GCTFFSGRINDVEVVVLQSGIGKVAAAVGTTILLDEYQPDVVINTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMDLAEKALAQMENTHAVRGLICTGDAFVCTAERQEFIRKHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDE 210
>gi|42631518|ref|ZP_00157056.1| COG0775: Nucleoside phosphorylase [Haemophilus influenzae R2866] (229 aa)
Score = 113, Expect = 6.0e-04, Identities = 41/170 (24%), Positives = 74/170 (43%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D++I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      S+S E+
  S:    34 FEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDLVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASISFEE 209
>gi|148826175|ref|YP_001290928.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittEE] >gi|148716335|gb|ABQ98545.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittEE] (229 aa)
Score = 112, Expect = 6.7e-04, Identities = 41/170 (24%), Positives = 74/170 (43%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D++I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      S+S E+
  S:    34 FEGKINGKDVVLLQSGIGKVAAAIGTTALLQLAKPDLVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASISFEE 209
>gi|194468392|ref|ZP_03074378.1| Adenosylhomocysteine nucleosidase [Lactobacillus reuteri 100-23] >gi|194453245|gb|EDX42143.1| Adenosylhomocysteine nucleosidase [Lactobacillus reuteri 100-23] (231 aa)
Score = 112, Expect = 6.8e-04, Identities = 31/124 (25%), Positives = 65/124 (52%)
  Q:    59 GYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYA----KYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASD 182
           G  NN++V ++  G+G    GI +  L      +V+I  GSAG   + ++VGD+V+ T+ AY +        +Y  +  K+   + SD+    + K   +  + +   ++ S D F  ++ ++++I ++
  S:    36 GKINNQDVVLVESGIGKVEAGITTEHLITDCGANVVINSGSAGGIGEGLHVGDIVISTETAYHDVDATAFNYRYGQLPGKEPRFKASDQWGQALEKAGEKTGLNVKRGLIVSGDQFIASSEAIKEILNN 164
>gi|154483833|ref|ZP_02026281.1| hypothetical protein EUBVEN_01537 [Eubacterium ventriosum ATCC 27560] >gi|149735324|gb|EDM51210.1| hypothetical protein EUBVEN_01537 [Eubacterium ventriosum ATCC 27560] (230 aa)
Score = 112, Expect = 7.0e-04, Identities = 46/163 (28%), Positives = 77/163 (47%)
  Q:    42 LENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSEST------YAKYIGIEAKDSTLEGSDELNDVIRKTAIEN--NIKLTDVVVHSSDIFYGANRSVEQIASDTKSQVVEMESFSLFANAIKLNK 204
           LEN + I ++  M  Y G    KEV  +  G+G  +  I +  L + + V  ++  G AGS   DIN+ D+V++  A           YAK +  +   S  +  + L  + + +A E   ++K+ +  V S D F G + +   +         EME  S+ A+   LNK
  S:    19 LENVE-IKNIAAMDFYKGTLAGKEVVAVKCGIGKVNAAICAQILVSVFGVSALVNTGVAGSLNNDINICDIVVSTSALEHDMDVTPLGYAKGVIPDMDQSEFKADENLIKLAKDSAEEAGLDVKIFEGKVVSGDQFIGTHEAKVYLRDTFNGDCAEMEGASI-AHTAYLNK 187
>gi|88805593|ref|ZP_01121112.1| phosphorylase family protein [Robiginitalea biformata HTCC2501] >gi|88784411|gb|EAR15581.1| phosphorylase family protein [Robiginitalea biformata HTCC2501] (288 aa)
Score = 112, Expect = 7.0e-04, Identities = 28/106 (26%), Positives = 61/106 (57%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   + G++A+ +++ GDP R   ++ +F ++ +     R    +TG    + ++V+  G+G  +I I   E+ A +++D              ++R+G++G+  KDI V   V+++ A
  S:    18 HLNLRPGDLAETIILVGDPERVPQVSRHF-DSVEFSVSKREFTTHTGTLGKQRLSVVSTGIGTDNIDIVLNEIDALFNIDFETRQPRAATTRLRLVRIGTSGALQKDIPVDSFVISEYA 135
>gi|145627795|ref|ZP_01783596.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae 22.1-21] >gi|144979570|gb|EDJ89229.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae 22.1-21] (229 aa)
Score = 112, Expect = 7.4e-04, Identities = 41/170 (24%), Positives = 73/170 (42%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      S+S E+
  S:    34 FEGKINGKDVVLLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGEASISFEE 209
>gi|46128809|ref|ZP_00201937.1| COG0775: Nucleoside phosphorylase [Haemophilus influenzae R2846] (231 aa)
Score = 112, Expect = 7.6e-04, Identities = 41/170 (24%), Positives = 73/170 (42%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K V ++  G+G  +  I +  L      D++I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      S+S E+
  S:    34 FEGKINGKNVALLQSGIGKVAAAIGTMALLQLAKPDLVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGEASISFEE 209
>gi|89072508|ref|ZP_01159080.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Photobacterium sp. SKA34] >gi|89051612|gb|EAR57065.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Photobacterium sp. SKA34] (232 aa)
Score = 112, Expect = 7.6e-04, Identities = 47/154 (30%), Positives = 78/154 (50%)
  Q:    42 LENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVL-TKKAYSESTYAKY---IGIEAKDSTLEGSDE-LNDVIRK--TAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSL 195
           LEN +  N   G   YTG  N  +V ++  G+G  +  + +  L   +  DV+I  GSAG +   +NVGD+V+ T+  Y ++    +   IG  A+      SDE L DV  +  TA+         ++ + D F  +      I ++ +S V VEME+ ++
  S:    20 LENCETHNKA-GCTLYTGTLNGADVVLLQSGIGKVAAAVGTAVLLETFQPDVVINTGSAGGFESSLNVGDVVISTEVRYHDADVTAFGYEIGQMAQQPAAFLSDEKLMDVAEQALTALPEKPHAVRGLICTGDAFVCSAEKQNFIRTNFQSVVAVEMEAAAI 180
>gi|121308586|dbj|BAF43682.1| MTA/SAH nucleosidase [Vibrio fischeri] (231 aa)
Score = 112, Expect = 7.8e-04, Identities = 44/181 (24%), Positives = 83/181 (45%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNI-KLTDV-----VVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMS--------AEDRQTKFVNMINL 237
           YTG  N  +V ++  G+G  +  + +  L A ++VDV++  GSAG +   +N+GD+V++ +           G E      + +  + D    T  E  + +++D      ++ + D+F       E I +   S + VEME+ ++     + N     +   SD       MS        A+      +NM+ L
  S:    34 YTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMSDKHAVRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEFLPLAAQSSSEMVLNMVTL 229
>gi|59712735|ref|YP_205511.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Vibrio fischeri ES114] >gi|163731024|ref|ZP_02138491.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Vibrio fischeri MJ11] >gi|59480836|gb|AAW86623.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Vibrio fischeri ES114] >gi|161395670|gb|EDQ19972.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Vibrio fischeri MJ11] (231 aa)
Score = 112, Expect = 8.2e-04, Identities = 44/181 (24%), Positives = 83/181 (45%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNI-KLTDV-----VVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMS--------AEDRQTKFVNMINL 237
           YTG  N  +V ++  G+G  +  + +  L A ++VDV++  GSAG +   +N+GD+V++ +           G E      + +  + D    T  E  + +++D      ++ + D+F       E I +   S + VEME+ ++     + N     +   SD       MS        A+      +NM+ L
  S:    34 YTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMSDKHAVRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEFLPLAAQSSSEMVLNMVTL 229
>gi|89100833|ref|ZP_01173685.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Bacillus sp. NRRL B-14911] >gi|89084479|gb|EAR63628.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Bacillus sp. NRRL B-14911] (234 aa)
Score = 111, Expect = 9.0e-04, Identities = 46/188 (24%), Positives = 88/188 (46%)
  Q:    58 TGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKD-----STLEGSDELNDVIRKTAIE-NNIKLTDVVVHSSDIFYGANRSVEQIASD-TKSQVVEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAEDR--QTKFVNMINLALKVVEKI 245
           +G  +  EV ++  G+G  +  + S  L   +  D II  GSAG +  ++NVGD+V++ +           G E        +  E   +L  +    A E ++I+    ++ + D F   +  VE I +  T  Q VEME+ ++   + +       + + SD +   ES  + D+  +   ++  NL +K+V  +
  S:    35 SGKMDGAEVILLRSGIGKVNAAMSSAILLERFKPDYIINTGSAGGFNPELNVGDVVISTEVRHHDVDVTAFGYEYGQVPQLPAAFEADQDLIRIAEDCAREISDIQTVRGLIATGDSFMSDHERVEAIRTKFTDLQAVEMEAAAIAQVSYQFGTPFVVIRSLSD-IAGKESDVSFDQFLEKAALHSANLVMKIVSSL 230
>gi|153807734|ref|ZP_01960402.1| hypothetical protein BACCAC_02016 [Bacteroides caccae ATCC 43185] >gi|149129343|gb|EDM20557.1| hypothetical protein BACCAC_02016 [Bacteroides caccae ATCC 43185] (329 aa)
Score = 111, Expect = 9.1e-04, Identities = 34/106 (32%), Positives = 55/106 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   K   +A  V++ GDP R   +A +F EN +   + R     TG Y  K +TV+  G+G  +I I   EL A  ++D              ++R+G+ G    +  VG  V ++K+
  S:    57 HLHVKPEWLADKVILVGDPGRVALVASHF-ENKECEVESREFKTITGTYKGKRITVVSTGIGCDNIDIVMNELDALANIDFETREEKEQFRQLELVRIGTCGGLQPNTPVGTFVCSQKS 174
>gi|34541057|ref|NP_905536.1| phosphorylase family protein [Porphyromonas gingivalis W83] >gi|188995022|ref|YP_001929274.1| putative purine nucleoside phosphorylase [Porphyromonas gingivalis ATCC 33277] >gi|34397372|gb|AAQ66435.1| phosphorylase family protein [Porphyromonas gingivalis W83] >gi|188594702|dbj|BAG33677.1| putative purine nucleoside phosphorylase [Porphyromonas gingivalis ATCC 33277] (292 aa)
Score = 111, Expect = 9.5e-04, Identities = 32/106 (30%), Positives = 55/106 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVD-------------VIIRVGSAGSYTKDINVGDLVLTKKA 118
           H   +  ++A  V++ GDP R   +A  F E  +     R     TG+Y +K +TV  HG+G  +I I   EL A  ++D              ++RVG++G    +  +G  V  +++
  S:    22 HLHIRPEQLADKVILVGDPARVDAVASRF-ERIECNVSNREFHTVTGWYGDKRITVQSHGIGSDNIDIVLNELDALANIDFDTRQVKDRLRKLTLVRVGTSGGLQDNTPIGSYVAAERS 139
>gi|85058085|ref|YP_453787.1| uridine phosphorylase [Sodalis glossinidius str. 'morsitans'] >gi|84778605|dbj|BAE73382.1| uridine phosphorylase [Sodalis glossinidius str. 'morsitans'] (255 aa)
Score = 111, Expect = 9.7e-04, Identities = 40/149 (26%), Positives = 65/149 (43%)
  Q:    22 AKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIEAKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFY 170
           A + ++PGDP R + IA   + NP  +   R    +      K V V   G+G  S  I   EL     +   +RVG+ G+    INVGD+++T  A      +++    A  +  + +      + + A +   +L   V  SSD FY
  S:    19 ATLAIVPGDPQRVEKIAR-LMTNPVHLATHREFTTWRAELEGKSVVVCSTGIGGPSTSIAVEELSQL-GIRTFLRVGTTGAIQNAINVGDVLVTTAAVRLDGASQHFAPLAFPAVADFA--CTTALVQAAKQRGARLHVGVTASSDTFY 163
>gi|116511655|ref|YP_808871.1| uridine phosphorylase [Lactococcus lactis subsp. cremoris SK11] >gi|116107309|gb|ABJ72449.1| Uridine phosphorylase [Lactococcus lactis subsp. cremoris SK11] (238 aa)
Score = 111, Expect = 9.9e-04, Identities = 37/117 (31%), Positives = 56/117 (47%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK 126
           +  H + KK +  +  ++ GDP R   +A+ FL   + +   R      G Y NKEV V+  G+G  S  I   EL     V  IIRVGSAG+    I +G+ ++ + A  +    K
  S:     4 LQAHIQLKKTDAVEDAIIVGDPARVDQVAK-FLTEFRELKYNREFRSLRGTYKNKEVLVLSTGVGAPSAAIAIEELHNI-GVKRIIRVGSAGALQLGIGLGNPIIGEGAVRDDGLTK 118
>gi|145639263|ref|ZP_01794869.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittII] >gi|145271566|gb|EDK11477.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae PittII] (231 aa)
Score = 111, Expect = 1.0e-03, Identities = 40/170 (23%), Positives = 74/170 (43%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K++ ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  + + VEME+ ++       N     +   SD      S+S E+
  S:    34 FEGKINGKDIALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEMAEKQGQSVKRGLICSGDSFINSEDKIAQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASISFEE 209
>gi|125624513|ref|YP_001032996.1| uridine phosphorylase [Lactococcus lactis subsp. cremoris MG1363] >gi|124493321|emb|CAL98292.1| uridine phosphorylase [Lactococcus lactis subsp. cremoris MG1363] (238 aa)
Score = 111, Expect = 1.0e-03, Identities = 37/117 (31%), Positives = 56/117 (47%)
  Q:    10 MTPHNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAK 126
           +  H + KK +  +  ++ GDP R   +A+ FL   + +   R      G Y NKEV V+  G+G  S  I   EL     V  IIRVGSAG+    I +G+ ++ + A  +    K
  S:     4 LQAHIQLKKTDAVEDAIIVGDPARVDQVAK-FLTEFRELKYNREFRSLRGTYKNKEVLVLSTGVGAPSAAIAIEELHNI-GVKRIIRVGSAGALQLGIGLGNPIIGEGAVRDDGLTK 118
>gi|60680668|ref|YP_210812.1| putative purine nucleoside phosphorylase/uridine phosphorylase family protein [Bacteroides fragilis NCTC 9343] >gi|60492102|emb|CAH06865.1| putative purine nucleoside phosphorylase/uridine phosphorylase family protein [Bacteroides fragilis NCTC 9343] (292 aa)
Score = 111, Expect = 1.1e-03, Identities = 34/106 (32%), Positives = 55/106 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   K   +A  V++ GDP R   +A +F EN +   + R     TG Y  K +TV+  G+G  +I I   EL A  ++D              ++R+G+ G    +  VG  V ++K+
  S:    20 HLHVKPEWLADKVILVGDPGRVALVASHF-ENKECEVESREFKTVTGTYKGKRITVVSTGIGCDNIDIVVNELDALANIDFQTREEKEHLRSLELVRIGTCGGLQPNTPVGTFVCSEKS 137
>gi|53712467|ref|YP_098459.1| purine nucleoside phosphorylase II [Bacteroides fragilis YCH46] >gi|52215332|dbj|BAD47925.1| purine nucleoside phosphorylase II [Bacteroides fragilis YCH46] (292 aa)
Score = 111, Expect = 1.1e-03, Identities = 34/106 (32%), Positives = 55/106 (51%)
  Q:    13 HNRAKKGEIAKVVLMPGDPLRAKWIAENFLENPKLINDVRGMLGYTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDV-------------IIRVGSAGSYTKDINVGDLVLTKKA 118
           H   K   +A  V++ GDP R   +A +F EN +   + R     TG Y  K +TV+  G+G  +I I   EL A  ++D              ++R+G+ G    +  VG  V ++K+
  S:    20 HLHVKPEWLADKVILVGDPGRVALVASHF-ENKECEVESREFKTVTGTYKGKRITVVSTGIGCDNIDIVVNELDALANIDFQTREEKEHLRSLELVRIGTCGGLQPNTPVGTFVCSEKS 137
>gi|145641178|ref|ZP_01796758.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae R3021] >gi|145274015|gb|EDK13881.1| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [Haemophilus influenzae 22.4-21] (229 aa)
Score = 110, Expect = 1.1e-03, Identities = 41/170 (24%), Positives = 73/170 (42%)
  Q:    57 YTGYYNNKEVTVMGHGMGMASIGIYSYELFAFYDVDVIIRVGSAGSYTKDINVGDLVLTKKAYSESTYAKYIGIE-----AKDSTLEGSDELNDVIRKTAIENNIKLTDVVVHSSDIFYGANRSVEQIASDTKSQV-VEMESFSLFANAIKLNKKAATLLTCSDSLVTHESMSAED 226
           + G  N K+V ++  G+G  +  I +  L      D +I  GSAG   K + VGD+V++ +           G E     A  +      +L D+ ++ A +    +   ++ S D F  +   + QI +D  +   VEME+ ++       N     +   SD      S+S E+
  S:    34 FEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDFVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIKADFPNVTGVEMEAAAIAQVCYAFNVPFVVVRAISDGGDGKASISFEE 209