>gi|26553560|ref|NP_757494.1| cytidine deaminase [Mycoplasma penetrans HF-2] >gi|26453566|dbj|BAC43898.1| cytidine deaminase [Mycoplasma penetrans HF-2] (140 aa)
Score = 706, Expect = 3.0e-73, Identities = 140/140 (100%), Positives = 140/140 (100%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSVKQG 140
           MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSVKQG
  S:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSVKQG 140
>gi|154288102|ref|XP_001544846.1| predicted protein [Ajellomyces capsulatus NAm1] >gi|150408487|gb|EDN04028.1| predicted protein [Ajellomyces capsulatus NAm1] (141 aa)
Score = 277, Expect = 1.7e-23, Identities = 62/133 (46%), Positives = 76/133 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +S   L T+  K     E A+ PYSKFRV A +   +  F  G NVEN SYPV +C ER A STAV  GHKN   I + TD    A+PCGMCRQFM EF       +Y++  +GKY   T+GE+L   F   DL
  S:     7 VSAAELQTLSSKAIAAKEAAHCPYSKFRVGACLLTEEREFIVGANVENVSYPVGVCAERCAFSTAVVAGHKNFRAIAVATDIVPGASPCGMCRQFMREFCPP-SFPVYLYGGDGKYTVKTMGELLPHSFGPNDL 139
>gi|145235827|ref|XP_001390562.1| hypothetical protein An03g06870 [Aspergillus niger] >gi|134058251|emb|CAK38443.1| unnamed protein product [Aspergillus niger] (142 aa)
Score = 276, Expect = 2.7e-23, Identities = 59/133 (44%), Positives = 76/133 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +S   L T+  K     + AY PYSKFRV A I      F  G NVEN+SYPV  C ER A  +A+  GH+N   I + TD    A+PCGMCRQFMSEF  + +  I++++ EG Y   T+GE+L   F   D 
  S:     8 LSAQELETLSTKAIAAKDTAYCPYSKFRVGACILTESGEFVQGANVENASYPVGTCAERVAFGSAIVAGHRNFKAIAVATDIKPPASPCGMCRQFMSEFT-TPEFPIFMYDGEGNYTLTTMGELLPSSFGPSDF 140
>gi|1345713|sp|P47718|CDD_MYCPI Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|401785|gb|AAA25433.1| cytidine deaminase (133 aa)
Score = 270, Expect = 1.3e-22, Identities = 55/124 (44%), Positives = 82/124 (66%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS--NTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           F KL E+I NAYVPYS FRV+ +   D  ++ GVN+ENS+Y  T+C ER+A+S+ +++G K I  +Y+LTD+      TPCG+CRQ +SEF +  +  I  +N +G+   YT+ ++L   F K  L
  S:     8 FQKLNELISNAYVPYSNFRVSCLLLTDGGWFAGVNIENSAYSPTICAERSAVSSMITSGFKQIFKVYILTDTIVKDIGTPCGVCRQVLSEFAKP-ETPIITYNLKGEKFFYTLEQLLPFAFNKDAL 132
>gi|154483544|ref|ZP_02025992.1| hypothetical protein EUBVEN_01248 [Eubacterium ventriosum ATCC 27560] >gi|149735454|gb|EDM51340.1| hypothetical protein EUBVEN_01248 [Eubacterium ventriosum ATCC 27560] (129 aa)
Score = 265, Expect = 4.4e-22, Identities = 58/122 (47%), Positives = 76/122 (62%)
  Q:    12 KLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           K  E +  AY PYSKF+V +    D   Y G N+ENSS+  T+C ER AIS AVS GHKNI  I +++ S  F  PCG+CRQ M EFM   D ++ + N  GK IK YT+ E+L   F+ +D+
  S:     9 KALEAMNYAYAPYSKFKVGAALITDGVVYTGCNIENSSFGATICAERCAISKAVSEGHKNIQKIAIVSSSGDFTPPCGICRQVMEEFMA--DGTVVLSN--GKEIKEYTVRELLPAGFSAEDM 127
>gi|144575091|gb|AAZ43800.2| cytidine deaminase [Mycoplasma synoviae 53] (136 aa)
Score = 263, Expect = 8.4e-22, Identities = 57/126 (45%), Positives = 85/126 (67%)
  Q:     8 TIFIKLKEVIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           T F KL+E+++ +Y PYSKF+V++I    +D+ Y GVNVEN+S+P T+C E  A+S +V  G K     +I++L+ S+ + +PCG+CRQ MSEFM  DD  IY ++  G Y   T+ EILK    + D+
  S:     6 TFFNKLQELLKKSYSPYSKFQVSAIAVDNNDNEYEGVNVENASFPCTVCAETLALSASVLRGSKPGTFKEIHILSSSDNYISPCGLCRQVMSEFMH-DDAKIYQYSQNGDYRLETLSEILKHPVRRDDI 133
>gi|134300319|ref|YP_001113815.1| cytidine deaminase [Desulfotomaculum reducens MI-1] >gi|134053019|gb|ABO50990.1| cytidine deaminase [Desulfotomaculum reducens MI-1] (142 aa)
Score = 263, Expect = 8.7e-22, Identities = 51/121 (42%), Positives = 76/121 (62%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           KE  E AYVPYSKF+V A++   +   + G NVEN+S+ +T C ER AI  AVS G++    + ++ D  T  +PCG CRQ M+EF  + D  +++ N  G+Y   T+ E+L G FT +D++
  S:    13 KEAREKAYVPYSKFKVGAALLTQEGKVFTGCNVENASFGLTCCAERTAIFKAVSEGNREFVALAVIADVPTLCSPCGACRQVMAEF--AGDMKVHMANLHGQYKTITVSELLPGYFTAEDME 132
>gi|13507804|ref|NP_109753.1| cytidine deaminase [Mycoplasma pneumoniae M129] >gi|2493557|sp|P75051|CDD_MYCPN Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|1673744|gb|AAB95737.1| cytidine deaminase [Mycoplasma pneumoniae M129] (133 aa)
Score = 258, Expect = 3.4e-21, Identities = 54/126 (42%), Positives = 87/126 (69%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSN-GHKNITDIYLLTDSNT-FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +++L+ +  KL+EV+ +AY P+SKF+VA +  A++  +YGVN+EN+SYPVTLC ER+AI+  V++ G   I  +++  D+ T   +PCGMCRQ + EF  +D   ++    +  + ++TI EILKG F
  S:     2 KVDLDWVHHKLQEVVNHAYTPFSKFKVACMLVANNQAFYGVNIENASYPVTLCAERSAIANMVTSIGKATIDYVFVYFDTKTPTNSPCGMCRQNIFEF-ATDKTQLFCIEKDKSFKQFTIPEILKGGF 128
>gi|110800920|ref|YP_696696.1| cytidine deaminase [Clostridium perfringens ATCC 13124] >gi|168204745|ref|ZP_02630750.1| cytidine deaminase [Clostridium perfringens E str. JGS1987] >gi|168215643|ref|ZP_02641268.1| cytidine deaminase [Clostridium perfringens NCTC 8239] >gi|182624380|ref|ZP_02952164.1| cytidine deaminase [Clostridium perfringens D str. JGS1721] >gi|110675567|gb|ABG84554.1| cytidine deaminase [Clostridium perfringens ATCC 13124] >gi|170663606|gb|EDT16289.1| cytidine deaminase [Clostridium perfringens E str. JGS1987] >gi|177910383|gb|EDT72760.1| cytidine deaminase [Clostridium perfringens D str. JGS1721] >gi|182381986|gb|EDT79465.1| cytidine deaminase [Clostridium perfringens NCTC 8239] (132 aa)
Score = 257, Expect = 3.5e-21, Identities = 57/123 (46%), Positives = 73/123 (59%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K  E  E AY PYS F+V A+    D   Y G NVEN+S+  T C ER AI   VS G + +  + L+ D N++  PCG+CRQ + EF E  D  I+I   E  YI+ T+ EIL G FTKKDL+
  S:     8 KALEARELAYCPYSNFKVGAAALFEDGKIYTGCNVENASFGATNCAERTAIFKGVSEGARVLKAMALVGDLNSYTYPCGICRQVIVEFAEDKDIKIFIVKSEDDYIETTLDEILPGSFTKKDLE 131
>gi|18310998|ref|NP_562932.1| cytidine deaminase [Clostridium perfringens str. 13] >gi|110802418|ref|YP_699297.1| cytidine deaminase [Clostridium perfringens SM101] >gi|18145680|dbj|BAB81722.1| cytidine deaminase [Clostridium perfringens str. 13] >gi|110682919|gb|ABG86289.1| cytidine deaminase [Clostridium perfringens SM101] (132 aa)
Score = 256, Expect = 5.1e-21, Identities = 56/123 (45%), Positives = 73/123 (59%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K  E  E AY PYS F+V A+    D   Y G N+EN+S+  T C ER AI   VS G + +  + L+ D N++  PCG+CRQ + EF E  D  I+I   E  YI+ T+ EIL G FTKKDL+
  S:     8 KALEARELAYCPYSNFKVGAAALFEDGKIYTGCNIENASFGATNCAERTAIFKGVSEGARVLKAMALVGDLNSYTYPCGICRQVIVEFAEDKDIKIFIVKSEDDYIETTLDEILPGSFTKKDLE 131
>gi|148380898|ref|YP_001255439.1| cytidine deaminase [Clostridium botulinum A str. ATCC 3502] >gi|153932790|ref|YP_001385206.1| cytidine deaminase [Clostridium botulinum A str. ATCC 19397] >gi|153936850|ref|YP_001388675.1| cytidine deaminase [Clostridium botulinum A str. Hall] >gi|153940963|ref|YP_001392223.1| cytidine deaminase [Clostridium botulinum F str. Langeland] >gi|168179377|ref|ZP_02614041.1| cytidine deaminase [Clostridium botulinum NCTC 2916] >gi|168181632|ref|ZP_02616296.1| cytidine deaminase [Clostridium botulinum Bf] >gi|170755803|ref|YP_001782579.1| cytidine deaminase [Clostridium botulinum B1 str. Okra] >gi|170761320|ref|YP_001788259.1| cytidine deaminase [Clostridium botulinum A3 str. Loch Maree] >gi|148290382|emb|CAL84509.1| cytidine deaminase [Clostridium botulinum A str. ATCC 3502] >gi|152928834|gb|ABS34334.1| cytidine deaminase [Clostridium botulinum A str. ATCC 19397] >gi|152932764|gb|ABS38263.1| cytidine deaminase [Clostridium botulinum A str. Hall] >gi|152936859|gb|ABS42357.1| cytidine deaminase [Clostridium botulinum F str. Langeland] >gi|169121015|gb|ACA44851.1| cytidine deaminase [Clostridium botulinum B1 str. Okra] >gi|169408309|gb|ACA56720.1| cytidine deaminase [Clostridium botulinum A3 str. Loch Maree] >gi|182669720|gb|EDT81696.1| cytidine deaminase [Clostridium botulinum NCTC 2916] >gi|182675072|gb|EDT87033.1| cytidine deaminase [Clostridium botulinum Bf] (132 aa)
Score = 253, Expect = 1.2e-20, Identities = 59/127 (46%), Positives = 76/127 (59%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + I  K  E  ENAYVPYSKFRV A++   D++ Y G N+EN+SY  T C ER AI  A+S GHK I  I ++     +  PCG+CRQ +SEF +  +  I I   +  Y    + EIL G FTKKDL
  S:     4 DEIIKKAIEARENAYVPYSKFRVGAALLTEDNAIYTGCNIENASYGATNCAERTAIFKAISEGHKKIKAIAVVGSLEEYTYPCGICRQVISEFADG-NIDIIIVKDKNNYEIKKLDEILPGAFTKKDL 130
>gi|70726349|ref|YP_253263.1| cytidine deaminase [Staphylococcus haemolyticus JCSC1435] >gi|68447073|dbj|BAE04657.1| cytidine deaminase [Staphylococcus haemolyticus JCSC1435] (134 aa)
Score = 250, Expect = 2.6e-20, Identities = 49/125 (39%), Positives = 80/125 (64%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           F + +E    AYVPYS F+V +  K  D   +YG NVEN++YP T+C ER+++  A+S G++  +   I +  DS   ++PCG CRQ + E  + DD  +Y+ N +G+ ++ T+G++L   F+ KDL+
  S:     8 FQEAREAQSRAYVPYSNFKVGAYLKTKDGRTFYGANVENAAYPATICAERSSLVAAISEGYRPGDFESITVTVDSEKPSSPCGTCRQVLKELCD-DDMPVYMTNHKGELLESTVGDLLPHGFSGKDLE 134
>gi|78043042|ref|YP_360385.1| cytidine deaminase [Carboxydothermus hydrogenoformans Z-2901] >gi|77995157|gb|ABB14056.1| cytidine deaminase [Carboxydothermus hydrogenoformans Z-2901] (132 aa)
Score = 247, Expect = 5.0e-20, Identities = 55/129 (42%), Positives = 80/129 (62%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           MS++  N ++ K KE  ENAYVPYS F+V A++       Y G N+EN+SY +T+C ER AI+ A+S G K +  I ++ D+    +PCG CRQFM+EF      +IY+ N  G   ++T+ +IL   FT
  S:     1 MSDLK-NLLYEKAKEARENAYVPYSGFKVGAAVLGESGKIYQGANIENASYGLTICAERVAITKAISEGEKKLKAILVVGDTPGPISPCGACRQFMAEFKIE---TIYLANLAGDIKEFTLEQILPYYFT 126
>gi|28211642|ref|NP_782586.1| cytidine deaminase [Clostridium tetani E88] >gi|28204084|gb|AAO36523.1| cytidine deaminase [Clostridium tetani E88] (141 aa)
Score = 247, Expect = 5.1e-20, Identities = 58/135 (42%), Positives = 81/135 (60%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           M++I+   +  K  E  E AYVPYS F+V A+I   D++ Y G N+EN+S+  T C ER AI  A+S G   I  I +L   + F  PCG+CRQ ++EF + +   I   N +   +K T+ EIL G FTKKDLD+
  S:     7 MNKIDYKELIKKAMEARELAYVPYSNFKVGAAILTEDNNIYNGCNIENASFGATNCAERTAIFKAISEGKTKIKAIAILGRKDEFTYPCGICRQVIAEFGDKNTIVILAKNIDEYEVK-TLEEILPGAFTKKDLDI 141
>gi|147677229|ref|YP_001211444.1| cytidine deaminase [Pelotomaculum thermopropionicum SI] >gi|146273326|dbj|BAF59075.1| cytidine deaminase [Pelotomaculum thermopropionicum SI] (156 aa)
Score = 247, Expect = 5.4e-20, Identities = 50/116 (43%), Positives = 70/116 (60%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AY PYSKFRV A+I   +  +Y G N+EN+SY +T C ER A+  AVSNG ++   I +   S+ +  PCG CRQ ++EF E  D  +++ N  G+Y    + E+L   F KK L
  S:    20 ERAYAPYSKFRVGAAILTREGRYYTGCNIENASYGLTCCAERVALFKAVSNGERDFEAIAVTAGSDEYCAPCGACRQALAEFGE--DIKVFMANGRGEYRMQRLAELLPASFGKKAL 134
>gi|116872894|ref|YP_849675.1| cytidine deaminase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741772|emb|CAK20896.1| cdd [Listeria welshimeri serovar 6b str. SLCC5334] (131 aa)
Score = 247, Expect = 6.0e-20, Identities = 54/124 (43%), Positives = 77/124 (62%)
  Q:    10 FIKL-KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           FI L K+  E AYVPYSKF V A++  ADD    G N+EN+S+ +T C ER AI  AVS G ++   + ++ D++   +PCG CRQ +SEF  + D  + + N  GK    T+ E+L G FT +D+
  S:     6 FISLAKQAREFAYVPYSKFPVGAALVTADDEVVLGCNIENASFGLTNCAERTAIFKAVSEGKRDFKQLVVVADTDGPVSPCGACRQVISEFC-APDMPVILTNLTGKTATVTVKELLPGAFTSEDM 130
>gi|189520649|ref|XP_001923622.1| PREDICTED: similar to cytidine deaminase [Danio rerio] (139 aa)
Score = 243, Expect = 1.6e-19, Identities = 54/133 (40%), Positives = 76/133 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           MS  N   +  + +E  + AY PYS+FRV A++  +D + + G NVEN+ Y   LC ER AIS AVS GH     I + +D  + F +PCG CRQFM EF    D  +Y+   +G + + T+ E+L   F   DL
  S:     1 MSSCNPQVLVQRSQEARKLAYCPYSRFRVGAAVLTSDGTVFTGCNVENACYTAGLCAERTAISKAVSEGHTTFKAIAIASDLEDRFISPCGACRQFMREFGSQWD--VYLSKTDGSFKQMTVEELLPCSFGPDDL 133
>gi|15894822|ref|NP_348171.1| cytidine deaminase [Clostridium acetobutylicum ATCC 824] >gi|15024494|gb|AAK79511.1|AE007664_8 Cytidine deaminase, cdd [Clostridium acetobutylicum ATCC 824] (132 aa)
Score = 243, Expect = 1.8e-19, Identities = 55/130 (42%), Positives = 77/130 (59%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++ + +  K  E  + AY PYSKF+V +   AD+   Y G N+EN+SY  T C ER AI  AVS GH  +  I ++     +  PCG+CRQ ++EF  S+D  I +    G+YI  T+ EIL G FTK+DL
  S:     1 MDYSELVYKALEARKKAYAPYSKFKVGAAVIADNGEIYTGCNIENASYGATNCAERTAIFKAVSEGHTKLNAIAIVGVEKDYTYPCGICRQVIAEF-ASEDMKIVLGKNSGEYIVKTLEEILPGAFTKEDL 130
>gi|15613929|ref|NP_242232.1| cytidine deaminase [Bacillus halodurans C-125] >gi|22256725|sp|Q9KD53|CDD_BACHD Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|10173982|dbj|BAB05085.1| cytidine deaminase [Bacillus halodurans C-125] (132 aa)
Score = 243, Expect = 1.9e-19, Identities = 50/122 (40%), Positives = 76/122 (62%)
  Q:    13 LKEVI---ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +KE I   E AYVPYS+F+V A++   D S   G N+EN+SY +T C ER A+  A S G +++  I ++ D+     PCG CRQ M+E   + D  +Y+ N +G   + T+ E+L G FT +D++
  S:     7 IKEAIQAREGAYVPYSRFQVGAALLMKDGSVIRGANIENASYGLTNCAERTALFKAYSEGRRDVVAIAVVADTKRPVPPCGACRQVMAELCPA-DTKVYLGNLQGDIQEITVSELLPGAFTAEDMN 131
>gi|12044902|ref|NP_072712.1| cytidine deaminase [Mycoplasma genitalium G37] >gi|1345712|sp|P47298|CDD_MYCGE Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|1045725|gb|AAC71268.1| cytidine deaminase [Mycoplasma genitalium G37] >gi|166078633|gb|ABY79251.1| cytidine deaminase [synthetic Mycoplasma genitalium JCVI-1.0] (130 aa)
Score = 242, Expect = 2.0e-19, Identities = 48/128 (37%), Positives = 85/128 (66%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS-NTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           ++NL  I  +L+ +++ AY P+S F+VA +  A++  ++GVN+ENSS+PVTLC ER+AI++ V++GH+ I  +++  ++ N   +PCGMCRQ + EF       ++  + +  Y +++I E+L   F K
  S:     2 KVNLEWIIKQLQMIVKRAYTPFSNFKVACMIIANNQTFFGVNIENSSFPVTLCAERSAIASMVTSGHRKIDYVFVYFNTKNKSNSPCGMCRQNLLEF-SHQKTKLFCIDNDSSYKQFSIDELLMNGFKK 129
>gi|119888972|ref|XP_873476.2| PREDICTED: similar to cytidine deaminase [Bos taurus] (146 aa)
Score = 242, Expect = 2.1e-19, Identities = 47/129 (36%), Positives = 77/129 (59%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++  + +  +E  ++AY PYS+F V A++   D   + G N+EN+ YP+++C ER AI  A+S G+K    I + +D  + F +PCG CRQ M EF    D ++Y+   +G Y+  T+ E+L   F  +DL
  S:    14 HVQRLLLSCQEAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACYPLSVCAERTAIQKAISEGYKEFRAIAIASDLQDDFISPCGACRQVMREF--GTDWAVYMTKLDGTYVVRTVRELLPESFGPEDL 142
>gi|22256726|sp|Q9S3M0|CDD_BACPY Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|5689648|emb|CAB51906.1| cytidine deaminase [Sporosarcina psychrophila] (136 aa)
Score = 242, Expect = 2.4e-19, Identities = 49/136 (36%), Positives = 83/136 (61%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSVKQ 139
           +++  +  + K+  E AYVPYSKF V A++   D + Y+G N+ENS+Y +T C ER A   AVS+G ++   + ++ D+    +PCG CRQ ++EF       +Y+ N +G   + T+ ++L G F+K+DL  + +Q
  S:     1 MDVEKLIAESKKAREQAYVPYSKFPVGAALLAEDGTIYHGCNIENSAYSMTNCAERTAFFKAVSDGVRSFKALAVVADTEGPVSPCGACRQVIAEFCNG-SMPVYLTNLKGDIEETTVAKLLPGAFSKEDLSYAAEQ 136
>gi|71894403|ref|YP_278511.1| cytidine deaminase [Mycoplasma synoviae 53] (123 aa)
Score = 241, Expect = 2.5e-19, Identities = 52/118 (44%), Positives = 79/118 (66%)
  Q:    16 VIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++ +Y PYSKF+V++I    +D+ Y GVNVEN+S+P T+C E  A+S +V  G K     +I++L+ S+ + +PCG+CRQ MSEFM  DD  IY ++  G Y   T+ EILK    + D+
  S:     1 MLKKSYSPYSKFQVSAIAVDNNDNEYEGVNVENASFPCTVCAETLALSASVLRGSKPGTFKEIHILSSSDNYISPCGLCRQVMSEFMH-DDAKIYQYSQNGDYRLETLSEILKHPVRRDDI 120
>gi|114798713|ref|YP_760013.1| cytidine deaminase [Hyphomonas neptunium ATCC 15444] >gi|114738887|gb|ABI77012.1| cytidine deaminase [Hyphomonas neptunium ATCC 15444] (131 aa)
Score = 241, Expect = 2.5e-19, Identities = 47/115 (40%), Positives = 69/115 (60%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +E+   AYVPYS++RV A++  AD +   G NVEN+S+  T C ER A+ TAV+ GH++   I + T+     TPCG+CRQ ++EF       +  F  EG   +YT+ E+L   F
  S:    13 REMQARAYVPYSEYRVGAALLTADGTVVTGCNVENASFGATCCAERTAVFTAVAAGHRDFRAIAVATNGADAGTPCGICRQVLAEFSADGALEVVCFTPEGAEARYTLAELLPHAF 128
>gi|30264371|ref|NP_846748.1| cytidine deaminase [Bacillus anthracis str. Ames] >gi|47529822|ref|YP_021171.1| cytidine deaminase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47567865|ref|ZP_00238573.1| cytidine deaminase [Bacillus cereus G9241] >gi|49187196|ref|YP_030448.1| cytidine deaminase [Bacillus anthracis str. Sterne] >gi|49481312|ref|YP_038356.1| cytidine deaminase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141203|ref|YP_085627.1| cytidine deaminase [Bacillus cereus E33L] >gi|118479470|ref|YP_896621.1| cytidine deaminase [Bacillus thuringiensis str. Al Hakam] >gi|165872057|ref|ZP_02216697.1| cytidine deaminase [Bacillus anthracis str. A0488] >gi|166995885|ref|ZP_02262345.1| cytidine deaminase [Bacillus cereus AH820] >gi|167634650|ref|ZP_02392970.1| cytidine deaminase [Bacillus anthracis str. A0442] >gi|167638499|ref|ZP_02396775.1| cytidine deaminase [Bacillus anthracis str. A0193] >gi|170687458|ref|ZP_02878675.1| cytidine deaminase [Bacillus anthracis str. A0465] >gi|170707393|ref|ZP_02897847.1| cytidine deaminase [Bacillus anthracis str. A0389] >gi|177653250|ref|ZP_02935502.1| cytidine deaminase [Bacillus anthracis str. A0174] >gi|190567033|ref|ZP_03019949.1| cytidine deaminase [Bacillus anthracis Tsiankovskii-I] >gi|196034298|ref|ZP_03101707.1| cytidine deaminase [Bacillus cereus W] >gi|196039308|ref|ZP_03106614.1| cytidine deaminase [Bacillus cereus NVH0597-99] >gi|196046381|ref|ZP_03113607.1| cytidine deaminase [Bacillus cereus 03BB108] >gi|30259029|gb|AAP28234.1| cytidine deaminase [Bacillus anthracis str. Ames] >gi|47504970|gb|AAT33646.1| cytidine deaminase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47555542|gb|EAL13885.1| cytidine deaminase [Bacillus cereus G9241] >gi|49181123|gb|AAT56499.1| cytidine deaminase [Bacillus anthracis str. Sterne] >gi|49332868|gb|AAT63514.1| cytidine deaminase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974672|gb|AAU16222.1| cytidine deaminase [Bacillus cereus E33L] >gi|118418695|gb|ABK87114.1| cytidine deaminase [Bacillus thuringiensis str. Al Hakam] >gi|164712188|gb|EDR17725.1| cytidine deaminase [Bacillus anthracis str. A0488] >gi|167513347|gb|EDR88717.1| cytidine deaminase [Bacillus anthracis str. A0193] >gi|167530102|gb|EDR92837.1| cytidine deaminase [Bacillus anthracis str. A0442] >gi|170127637|gb|EDS96510.1| cytidine deaminase [Bacillus anthracis str. A0389] >gi|170668653|gb|EDT19399.1| cytidine deaminase [Bacillus anthracis str. A0465] >gi|172081532|gb|EDT66604.1| cytidine deaminase [Bacillus anthracis str. A0174] >gi|190562024|gb|EDV15993.1| cytidine deaminase [Bacillus anthracis Tsiankovskii-I] >gi|195992840|gb|EDX56799.1| cytidine deaminase [Bacillus cereus W] >gi|196022851|gb|EDX61532.1| cytidine deaminase [Bacillus cereus 03BB108] >gi|196029935|gb|EDX68536.1| cytidine deaminase [Bacillus cereus NVH0597-99] (132 aa)
Score = 241, Expect = 2.7e-19, Identities = 53/121 (43%), Positives = 71/121 (58%)
  Q:    13 LKEVIE---NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++E IE    AYVPYSKF+V A++   D   Y G NVEN+SY +  C ER A+  AVS G K    I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:     7 IQEAIEARKQAYVPYSKFQVGAALLTQDGKVYRGCNVENASYGLCNCAERTALFKAVSEGDKEFVAIAIVADTKRPVPPCGACRQVMVELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 130
>gi|16803503|ref|NP_464988.1| hypothetical protein lmo1463 [Listeria monocytogenes EGD-e] >gi|46907691|ref|YP_014080.1| cytidine deaminase [Listeria monocytogenes str. 4b F2365] >gi|47093469|ref|ZP_00231232.1| cytidine deaminase [Listeria monocytogenes str. 4b H7858] >gi|47095414|ref|ZP_00233024.1| cytidine deaminase [Listeria monocytogenes str. 1/2a F6854] >gi|153166871|ref|ZP_01927339.1| cytidine deaminase [Listeria monocytogenes FSL N1-017] >gi|153174590|ref|ZP_01930091.1| cytidine deaminase [Listeria monocytogenes FSL N3-165] >gi|153179515|ref|ZP_01932734.1| cytidine deaminase [Listeria monocytogenes F6900] >gi|153183818|ref|ZP_01934635.1| cytidine deaminase [Listeria monocytogenes J0161] >gi|153190885|ref|ZP_01938216.1| cytidine deaminase [Listeria monocytogenes J2818] >gi|153196241|ref|ZP_01940649.1| cytidine deaminase [Listeria monocytogenes 10403S] >gi|153202298|ref|ZP_01943927.1| cytidine deaminase [Listeria monocytogenes HPB2262] >gi|167014711|ref|ZP_02277244.1| cytidine deaminase [Listeria monocytogenes FSL J1-194] >gi|167214468|ref|ZP_02284775.1| cytidine deaminase [Listeria monocytogenes FSL R2-503] >gi|167217558|ref|ZP_02287194.1| cytidine deaminase [Listeria monocytogenes FSL J1-175] >gi|167404441|ref|ZP_02309237.1| cytidine deaminase [Listeria monocytogenes FSL J2-003] >gi|167454064|ref|ZP_02320287.1| cytidine deaminase [Listeria monocytogenes FSL J2-064] >gi|16410892|emb|CAC99541.1| lmo1463 [Listeria monocytogenes] >gi|46880960|gb|AAT04257.1| cytidine deaminase [Listeria monocytogenes str. 4b F2365] >gi|47016235|gb|EAL07158.1| cytidine deaminase [Listeria monocytogenes str. 1/2a F6854] >gi|47018145|gb|EAL08915.1| cytidine deaminase [Listeria monocytogenes str. 4b H7858] >gi|126943470|gb|EBA21191.1| cytidine deaminase [Listeria monocytogenes J0161] >gi|127634523|gb|EBA23909.1| cytidine deaminase [Listeria monocytogenes 10403S] >gi|127765608|gb|EBA25955.1| cytidine deaminase [Listeria monocytogenes J2818] >gi|133727277|gb|EBA28975.1| cytidine deaminase [Listeria monocytogenes FSL N1-017] >gi|133730194|gb|EBA31892.1| cytidine deaminase [Listeria monocytogenes FSL N3-165] >gi|133733000|gb|EBA34698.1| cytidine deaminase [Listeria monocytogenes F6900] >gi|133735581|gb|EBA37279.1| cytidine deaminase [Listeria monocytogenes HPB2262] (131 aa)
Score = 241, Expect = 2.8e-19, Identities = 53/124 (42%), Positives = 76/124 (61%)
  Q:    10 FIKL-KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           FI L K+  E AYVPYSKF V A++   DD    G N+EN+S+ +T C ER AI  AVS G ++   + ++ D++   +PCG CRQ +SEF  + D  + + N  GK    T+ E+L G FT +D+
  S:     6 FISLAKQAREFAYVPYSKFPVGAALVTKDDEVVLGCNIENASFGLTNCAERTAIFKAVSEGKRDFKQLVVVADTDGPVSPCGACRQVISEFC-APDMPVILTNLTGKTATVTVKELLPGAFTSEDM 130
>gi|42783427|ref|NP_980674.1| cytidine deaminase [Bacillus cereus ATCC 10987] >gi|42739356|gb|AAS43282.1| cytidine deaminase [Bacillus cereus ATCC 10987] (132 aa)
Score = 241, Expect = 3.0e-19, Identities = 53/121 (43%), Positives = 71/121 (58%)
  Q:    13 LKEVIE---NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++E IE    AYVPYSKF+V A++   D   Y G NVEN+SY +  C ER A+  AVS G K    I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:     7 IQEAIEARKQAYVPYSKFQVGAALLTRDGKVYRGCNVENASYGLCNCAERTALFKAVSEGDKEFVAIAIVADTKRPVPPCGACRQVMVELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 130
>gi|116666976|pdb|2D30|A Chain A, Crystal Structure Of Cytidine Deaminase Cdd-2 (Ba4525) From Bacillus Anthracis At 2.40a Resolution >gi|116666977|pdb|2D30|B Chain B, Crystal Structure Of Cytidine Deaminase Cdd-2 (Ba4525) From Bacillus Anthracis At 2.40a Resolution (141 aa)
Score = 241, Expect = 3.2e-19, Identities = 53/121 (43%), Positives = 71/121 (58%)
  Q:    13 LKEVIE---NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++E IE    AYVPYSKF+V A++   D   Y G NVEN+SY +  C ER A+  AVS G K    I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:    16 IQEAIEARKQAYVPYSKFQVGAALLTQDGKVYRGCNVENASYGLCNCAERTALFKAVSEGDKEFVAIAIVADTKRPVPPCGACRQVMVELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 139
>gi|13358095|ref|NP_078369.1| cytidine deaminase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761876|ref|YP_001752616.1| cytidine deaminase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920301|ref|ZP_02690660.2| cytidine deaminase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508666|ref|ZP_02689504.2| cytidine deaminase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701794|ref|ZP_02553619.2| cytidine deaminase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11266266|pir||E82878 cytidine deaminase UU531 [imported] - Ureaplasma urealyticum >gi|6899535|gb|AAF30944.1|AE002152_3 cytidine deaminase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827453|gb|ACA32715.1| cytidine deaminase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902715|gb|EDT49004.1| cytidine deaminase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676134|gb|EDT88039.1| cytidine deaminase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701073|gb|EDU19355.1| cytidine deaminase [Ureaplasma parvum serovar 6 str. ATCC 27818] (131 aa)
Score = 240, Expect = 3.3e-19, Identities = 50/118 (42%), Positives = 75/118 (63%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSN-TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           N I++ L E+++ +Y PYS + VA+    D  F  GVNVEN S+ +T C ERNAI  A++NG K    +Y++T +N   A+PCG CRQ + EF +  D  I +FN +G Y +Y + ++L
  S:     4 NDIYMGLLELLKKSYSPYSNYPVAAYVDTDLGFISGVNVENGSFGLTSCAERNAIFNAIANGAKTFKTVYIITKNNGDIASPCGACRQVIFEFFKK-DAKIVVFNNDGTYKEYNVEQLL 121
>gi|66880266|ref|ZP_00405249.1| COG0295: Cytidine deaminase [Mycoplasma genitalium G-37] (128 aa)
Score = 240, Expect = 3.5e-19, Identities = 48/127 (37%), Positives = 84/127 (66%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS-NTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           +NL  I  +L+ +++ AY P+S F+VA +  A++  ++GVN+ENSS+PVTLC ER+AI++ V++GH+ I  +++  ++ N   +PCGMCRQ + EF       ++  + +  Y +++I E+L   F K
  S:     1 MNLEWIIKQLQMIVKRAYTPFSNFKVACMIIANNQTFFGVNIENSSFPVTLCAERSAIASMVTSGHRKIDYVFVYFNTKNKSNSPCGMCRQNLLEF-SHQKTKLFCIDNDSSYKQFSIDELLMNGFKK 127
>gi|154290352|ref|XP_001545772.1| hypothetical protein BC1G_15730 [Botryotinia fuckeliana B05.10] >gi|150847752|gb|EDN22945.1| hypothetical protein BC1G_15730 [Botryotinia fuckeliana B05.10] (169 aa)
Score = 240, Expect = 3.5e-19, Identities = 50/114 (43%), Positives = 69/114 (60%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYS FRV A+I   +  +  G NVEN++YPV  C ER A   A++ GHK    I + TD +  A+PCGMCRQF+ EF E  D  I++F+  G ++   +GE+L   F  + L
  S:    45 AYCPYSNFRVGATILTNEGKYVDGANVENAAYPVGTCAERVAFGKAITEGHKGFKTIAVATDISPPASPCGMCRQFIREFCEL-DMPIFMFDKNGDFMVARLGELLPLSFGPEAL 158
>gi|119484038|ref|XP_001261922.1| cytidine deaminase, putative [Neosartorya fischeri NRRL 181] >gi|119410078|gb|EAW20025.1| cytidine deaminase, putative [Neosartorya fischeri NRRL 181] (153 aa)
Score = 240, Expect = 4.0e-19, Identities = 50/118 (42%), Positives = 68/118 (57%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEI 123
           L T+  K      NAY PYSKFRV A +      +  G NVEN +YPV  C ER A  TAV+ GH++   + + TD    A+PCGMCRQFM EF       +++++ +G Y   T+GE+
  S:    12 LETLSSKAIAAKANAYCPYSKFRVGACVLTKTGEYIAGANVENVAYPVGTCAERVAFGTAVAAGHQDFKAVAVATDITPGASPCGMCRQFMREFTPP-SFPVFMYDGQGNYAVRTMGEV 129
>gi|116494999|ref|YP_806733.1| cytidine deaminase [Lactobacillus casei ATCC 334] >gi|191638505|ref|YP_001987671.1| Cytidine deaminase [Lactobacillus casei] >gi|116105149|gb|ABJ70291.1| cytidine deaminase [Lactobacillus casei ATCC 334] >gi|190712807|emb|CAQ66813.1| Cytidine deaminase [Lactobacillus casei BL23] (129 aa)
Score = 240, Expect = 4.0e-19, Identities = 47/117 (40%), Positives = 70/117 (59%)
  Q:    18 ENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           ENAYVPYS F V +  +  D  + G NVEN+SY ++ C ER+AI  AVS G+  + ++ ++ D+     PCG CRQ +SEF    +  I + N  G+ ++ T   +L G F+K DL+
  S:    13 ENAYVPYSHFAVGAAVRVGDRIFSGANVENASYGLSNCAERSAIFAAVSAGYSKLDELLVIADTKGPVAPCGACRQVISEFF-GPNAVITLANVAGQSVQTTPQALLPGAFSKGDLN 128
>gi|73662497|ref|YP_301278.1| cytidine deaminase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495012|dbj|BAE18333.1| cytidine deaminase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (141 aa)
Score = 238, Expect = 6.7e-19, Identities = 45/125 (36%), Positives = 81/125 (64%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           F ++++   NAY PYS F+V +  +  D   YYG NVEN++YP+ +C ER+++  A+++G++  +   I +  D++  ++PCG CRQ M E  + D+  +Y+ N +G   + ++GE+L   F+ KDL+
  S:    15 FSEVRKAQANAYAPYSNFKVGAYLRTKDGKAYYGGNVENAAYPMAICAERSSLVAAIADGYRPGDFESITVTVDADEPSSPCGACRQVMKELCD-DEMPVYMTNHKGDMTELSVGELLPLGFSGKDLN 141
>gi|118589678|ref|ZP_01547083.1| cytidine deaminase [Stappia aggregata IAM 12614] >gi|118437764|gb|EAV44400.1| cytidine deaminase [Stappia aggregata IAM 12614] (132 aa)
Score = 238, Expect = 6.9e-19, Identities = 47/124 (37%), Positives = 77/124 (62%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRVASICKA-DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +L+ +F   K V ENAY PYS F V +  +A D + + G NVEN+SYPV++C E  A+S  ++ G++ I +  ++ D+    TPCGMCRQ + EF  +D+  +++ + +G    +T+ E+L   F
  S:     3 DLDALFEAAKAVRENAYAPYSNFLVGAALRAPDGTVFTGCNVENASYPVSVCAEGGAVSAMIAAGYREIAEAVVIGDA-ALCTPCGMCRQRLKEF-GTDELVVHVADLDGIRRSFTMDELLPAAF 125
>gi|160903259|ref|YP_001568840.1| cytidine deaminase [Petrotoga mobilis SJ95] >gi|160360903|gb|ABX32517.1| cytidine deaminase [Petrotoga mobilis SJ95] (132 aa)
Score = 237, Expect = 7.6e-19, Identities = 54/130 (41%), Positives = 78/130 (60%)
  Q:     4 INLNTIFIKLKE----VIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +N  TI  KL E      ENAY PYS F+V +   +DD   + G NVEN+SY +++C ERNAI +AV+ G +    + ++ +      PCG CRQ M+EF + D   +Y+ N +GK  K  + E+L   F+ KDL
  S:     1 MNDKTIVEKLYEEAMKARENAYAPYSNFKVGACLLSDDGEIFSGCNVENASYGLSICAERNAIFSAVAKGKREFKAMLVVAEGEAPVKPCGACRQVMAEFGDFD---VYLANTKGKIEKTRVSELLPNAFSPKDL 132
>gi|116627671|ref|YP_820290.1| cytidine deaminase [Streptococcus thermophilus LMD-9] >gi|116100948|gb|ABJ66094.1| cytidine deaminase [Streptococcus thermophilus LMD-9] (132 aa)
Score = 237, Expect = 7.6e-19, Identities = 53/129 (41%), Positives = 75/129 (58%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           M +  ++ I  + +EV  NAYVPYS FRV A++   D   Y G N+EN+S+ +T C ER AI  AVS GH++   I +  D+    +PCG CRQ M+EF + D   I I   +   +  T+GE+L   FT
  S:     1 MVDTEISQIIEEAEEVAGNAYVPYSHFRVGAALLTNDGQMYKGCNIENASFGLTNCAERTAIFKAVSEGHRDFEMIVVYGDTEQPISPCGACRQVMAEFFKQDSKVILIAE-DKSTVVMTVGELLPYSFT 129
>gi|70982805|ref|XP_746930.1| cytidine deaminase [Aspergillus fumigatus Af293] >gi|66844555|gb|EAL84892.1| cytidine deaminase, putative [Aspergillus fumigatus Af293] >gi|159123814|gb|EDP48933.1| cytidine deaminase, putative [Aspergillus fumigatus A1163] (151 aa)
Score = 237, Expect = 8.1e-19, Identities = 48/118 (40%), Positives = 69/118 (58%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEI 123
           L T+  K      NAY PYSKFRV A +      +  G N+EN +YPV  C ER A  TA++ GH++   + + TD    A+PCGMCRQFM EF  +    +++++ +G Y   T+GE+
  S:    12 LETLSSKAIAAKANAYCPYSKFRVGACVLTKAGEYIAGANIENVAYPVGTCAERVAFGTAIAAGHQDFKAVAVATDITPGASPCGMCRQFMREFT-TPSFPVFMYDGQGNYAVRTMGEV 129
>gi|145590312|ref|YP_001152314.1| cytidine deaminase [Pyrobaculum arsenaticum DSM 13514] >gi|145282080|gb|ABP49662.1| cytidine deaminase [Pyrobaculum arsenaticum DSM 13514] (127 aa)
Score = 237, Expect = 8.6e-19, Identities = 49/128 (38%), Positives = 76/128 (59%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +  +  K +EVI NAY PYS F+VA++ K      Y GVN+EN+SY +T+C ER A+  AVS G ++I  + + TD++    PCG CRQ ++EF  +   ++ +     K +   + E+L   FTK+ L
  S:     1 MEELIAKAREVINNAYAPYSSFKVAAVVKTKSGKVYTGVNIENASYGLTVCAERVAVFKAVSEGDRDIDTVVVYTDTDEPTPPCGACRQVIAEFNPN---ALIVMAGRKKTVTAKLSELLPNAFTKERL 126
>gi|15924558|ref|NP_372092.1| cytidine deaminase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927148|ref|NP_374681.1| cytidine deaminase [Staphylococcus aureus subsp. aureus N315] >gi|21283249|ref|NP_646337.1| cytidine deaminase [Staphylococcus aureus subsp. aureus MW2] >gi|49486403|ref|YP_043624.1| cytidine deaminase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651961|ref|YP_186465.1| cytidine deaminase [Staphylococcus aureus subsp. aureus COL] >gi|87160675|ref|YP_494223.1| cytidine deaminase [Staphylococcus aureus subsp. aureus USA300] >gi|88195377|ref|YP_500181.1| cytidine deaminase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268052|ref|YP_001246995.1| cytidine deaminase [Staphylococcus aureus subsp. aureus JH9] >gi|150394120|ref|YP_001316795.1| cytidine deaminase [Staphylococcus aureus subsp. aureus JH1] >gi|151221683|ref|YP_001332505.1| cytidine deaminase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979886|ref|YP_001442145.1| cytidine deaminase [Staphylococcus aureus subsp. aureus Mu3] >gi|161509796|ref|YP_001575455.1| cytidine deaminase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728526|ref|ZP_02760803.1| cytidine deaminase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13701366|dbj|BAB42660.1| cytidine deaminase [Staphylococcus aureus subsp. aureus N315] >gi|14247339|dbj|BAB57730.1| cytidine deaminase [Staphylococcus aureus subsp. aureus Mu50] >gi|21204689|dbj|BAB95385.1| cytidine deaminase [Staphylococcus aureus subsp. aureus MW2] >gi|49244846|emb|CAG43307.1| cytidine deaminase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286147|gb|AAW38241.1| cytidine deaminase [Staphylococcus aureus subsp. aureus COL] >gi|87126649|gb|ABD21163.1| cytidine deaminase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202935|gb|ABD30745.1| cytidine deaminase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741121|gb|ABQ49419.1| cytidine deaminase [Staphylococcus aureus subsp. aureus JH9] >gi|149946572|gb|ABR52508.1| cytidine deaminase [Staphylococcus aureus subsp. aureus JH1] >gi|150374483|dbj|BAF67743.1| cytidine deaminase, homotetrameric [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722021|dbj|BAF78438.1| cytidine deaminase [Staphylococcus aureus subsp. aureus Mu3] >gi|160368605|gb|ABX29576.1| cytidine deaminase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (134 aa)
Score = 237, Expect = 8.6e-19, Identities = 45/125 (36%), Positives = 81/125 (64%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           F ++++  + +Y PYS+F+V +  K  D   +YG NVEN+SYP+++C ER ++ +A+S G++  +   I +  D++  ++PCG CRQ + E  + DD  +Y+ N +G  +  T+ E+L   F+ KDL+
  S:     8 FQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASLVSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCD-DDMPVYMTNHKGDMVMMTVAELLPFGFSGKDLE 134
>gi|121714785|ref|XP_001275002.1| cytidine deaminase, putative [Aspergillus clavatus NRRL 1] >gi|119403158|gb|EAW13576.1| cytidine deaminase, putative [Aspergillus clavatus NRRL 1] (141 aa)
Score = 237, Expect = 8.9e-19, Identities = 47/102 (46%), Positives = 63/102 (61%)
  Q:    21 YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGE 122
           Y PYSKFRV A +      F  G NVEN SYPV +C ER A  TAV+ G++    + + TD    A+PCGMCRQFM EF  S    +++++ +G Y+  T+GE
  S:    26 YCPYSKFRVGACVLTKTGEFIMGANVENVSYPVGICAERVAFGTAVAGGYQEFKAVAVATDITPGASPCGMCRQFMREFT-SPSFPVFMYDGQGNYVVRTMGE 127
>gi|167038222|ref|YP_001665800.1| cytidine deaminase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039068|ref|YP_001662053.1| cytidine deaminase [Thermoanaerobacter sp. X514] >gi|166853308|gb|ABY91717.1| cytidine deaminase [Thermoanaerobacter sp. X514] >gi|166857056|gb|ABY95464.1| cytidine deaminase [Thermoanaerobacter pseudethanolicus ATCC 33223] (135 aa)
Score = 236, Expect = 9.7e-19, Identities = 49/121 (40%), Positives = 73/121 (60%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K+  E AYVPYS F+V A +   D   Y G N+EN+SY +T C ER A+ +A +NG + +  I ++ D+    +PCG CRQ M E +  +D  + + N +G Y   T+ ++L G FT KDL+
  S:    14 KDAREKAYVPYSHFKVGACVLTEDGKAYQGCNIENASYGLTNCAERTALFSAYANGDRKLKAIAVVADTEGPVSPCGACRQVMME-LGGEDMVVILSNMKGDYAVVTVKDLLPGAFTSKDLE 134
>gi|16800568|ref|NP_470836.1| hypothetical protein lin1500 [Listeria innocua Clip11262] >gi|16413973|emb|CAC96731.1| lin1500 [Listeria innocua] (131 aa)
Score = 236, Expect = 1.1e-18, Identities = 52/124 (41%), Positives = 75/124 (60%)
  Q:    10 FIKL-KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           FI L K+  E AYVPYSKF V A++   DD    G N+EN+S+ +T C ER AI  AVS G ++   + ++ D+    +PCG CRQ +SEF  + D  + + N  GK    T+ ++L G FT +D+
  S:     6 FISLAKQAREFAYVPYSKFPVGAALVTKDDEVVLGCNIENASFGLTNCAERTAIFKAVSEGKRDFKQLVVVADTEGPVSPCGACRQVISEFC-APDMPVILTNLTGKTATVTVKDLLPGAFTSEDM 130
>gi|27468173|ref|NP_764810.1| cytidine deaminase [Staphylococcus epidermidis ATCC 12228] >gi|57867010|ref|YP_188711.1| cytidine deaminase [Staphylococcus epidermidis RP62A] >gi|27315719|gb|AAO04854.1|AE016748_88 cytidine deaminase [Staphylococcus epidermidis ATCC 12228] >gi|57637668|gb|AAW54456.1| cytidine deaminase [Staphylococcus epidermidis RP62A] (134 aa)
Score = 236, Expect = 1.2e-18, Identities = 48/125 (38%), Positives = 80/125 (64%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           F +++E  +NAY PYS F+V +  K  D   +YG NVEN++YP+ +C ER+++ +A+S G++  +   I +  D++  ++PCG CRQ M E  +  D  +Y+ N  G  I+ T+ E+L   F+ KDL+
  S:     8 FKEVREAQKNAYAPYSNFKVGAYLKTKDGRCFYGANVENAAYPMGICAERSSLVSAISEGYQPGDFESITVTVDADKPSSPCGACRQVMMELCDK-DMPVYMTNQNGDMIEATVDELLPLGFSGKDLN 134
>gi|15900731|ref|NP_345335.1| cytidine deaminase [Streptococcus pneumoniae TIGR4] >gi|15902790|ref|NP_358340.1| cytidine deaminase [Streptococcus pneumoniae R6] >gi|111657485|ref|ZP_01408231.1| hypothetical protein SpneT_02001310 [Streptococcus pneumoniae TIGR4] >gi|116516117|ref|YP_816230.1| cytidine deaminase [Streptococcus pneumoniae D39] >gi|149004049|ref|ZP_01828855.1| cytidine deaminase [Streptococcus pneumoniae SP14-BS69] >gi|149007216|ref|ZP_01830880.1| cytidine deaminase [Streptococcus pneumoniae SP18-BS74] >gi|168485790|ref|ZP_02710298.1| cytidine deaminase [Streptococcus pneumoniae CDC1087-00] >gi|168492997|ref|ZP_02717140.1| cytidine deaminase [Streptococcus pneumoniae CDC3059-06] >gi|14972318|gb|AAK74975.1| cytidine deaminase [Streptococcus pneumoniae TIGR4] >gi|15458339|gb|AAK99550.1| Cytidine deaminase [Streptococcus pneumoniae R6] >gi|116076693|gb|ABJ54413.1| cytidine deaminase [Streptococcus pneumoniae D39] >gi|147757950|gb|EDK64958.1| cytidine deaminase [Streptococcus pneumoniae SP14-BS69] >gi|147761254|gb|EDK68221.1| cytidine deaminase [Streptococcus pneumoniae SP18-BS74] >gi|183570966|gb|EDT91494.1| cytidine deaminase [Streptococcus pneumoniae CDC1087-00] >gi|183576910|gb|EDT97438.1| cytidine deaminase [Streptococcus pneumoniae CDC3059-06] (129 aa)
Score = 235, Expect = 1.4e-18, Identities = 47/115 (40%), Positives = 71/115 (61%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E  ++AYVPYS F + ++  A D S Y GVN+EN+SYP+T CGER AI  A+S G +  +++ +   +    +PCG CRQ M+EF E  D  + +   +   ++ T+GE+L   FT
  S:    12 ETSKHAYVPYSHFPIGAVLVAKDGSVYTGVNIENASYPLTNCGERTAIFKAISEGQREFSELIVYGQTEKPISPCGACRQVMAEFFEQ-DLKVTLVAKDKSTVEMTVGELLPYSFT 126
>gi|30022379|ref|NP_834010.1| cytidine deaminase [Bacillus cereus ATCC 14579] >gi|168136441|ref|ZP_02579670.1| cytidine deaminase [Bacillus cereus B4264] >gi|29897937|gb|AAP11211.1| Cytidine deaminase [Bacillus cereus ATCC 14579] (132 aa)
Score = 235, Expect = 1.5e-18, Identities = 51/130 (39%), Positives = 72/130 (55%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +N   + ++  E  + AYVPYSKF+V A++       Y G NVEN+SY +  C ER A+  AVS G K    I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:     1 MNSKQLILEAIEARKQAYVPYSKFQVGAALLTRGGKVYRGCNVENASYGLCNCAERTALFKAVSEGDKEFVAIAVVADTKRPVPPCGACRQVMVELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 130
>gi|49483816|ref|YP_041040.1| cytidine deaminase [Staphylococcus aureus subsp. aureus MRSA252] >gi|82751171|ref|YP_416912.1| cytidine deaminase [Staphylococcus aureus RF122] >gi|49241945|emb|CAG40640.1| cytidine deaminase [Staphylococcus aureus subsp. aureus MRSA252] >gi|82656702|emb|CAI81129.1| cytidine deaminase [Staphylococcus aureus RF122] (134 aa)
Score = 235, Expect = 1.5e-18, Identities = 45/125 (36%), Positives = 80/125 (64%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           F ++++  + +Y PYS F+V +  K  D   +YG NVEN+SYP+++C ER ++ +A+S G++  +   I +  D++  ++PCG CRQ + E  + DD  +Y+ N +G  +  T+ E+L   F+ KDL+
  S:     8 FQEVRKAQQESYSPYSHFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASLVSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCD-DDMPVYMTNHKGDMVMMTVAELLPFGFSGKDLE 134
>gi|58037289|ref|NP_082452.1| cytidine deaminase [Mus musculus] >gi|62296704|sp|P56389|CDD_MOUSE Cytidine deaminase (Cytidine aminohydrolase) >gi|99031657|pdb|1ZAB|A Chain A, Crystal Structure Of Mouse Cytidine Deaminase Complexed With 3-Deazauridine >gi|99031658|pdb|1ZAB|B Chain B, Crystal Structure Of Mouse Cytidine Deaminase Complexed With 3-Deazauridine >gi|99031659|pdb|1ZAB|C Chain C, Crystal Structure Of Mouse Cytidine Deaminase Complexed With 3-Deazauridine >gi|99031660|pdb|1ZAB|D Chain D, Crystal Structure Of Mouse Cytidine Deaminase Complexed With 3-Deazauridine >gi|112490584|pdb|2FR5|A Chain A, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Tetrahydrouridine >gi|112490585|pdb|2FR5|B Chain B, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Tetrahydrouridine >gi|112490586|pdb|2FR5|C Chain C, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Tetrahydrouridine >gi|112490587|pdb|2FR5|D Chain D, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Tetrahydrouridine >gi|112490590|pdb|2FR6|A Chain A, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Cytidine >gi|112490591|pdb|2FR6|B Chain B, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Cytidine >gi|112490592|pdb|2FR6|C Chain C, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Cytidine >gi|112490593|pdb|2FR6|D Chain D, Crystal Structure Of Mouse Cytidine Deaminase Complexed With Cytidine >gi|12843205|dbj|BAB25898.1| unnamed protein product [Mus musculus] >gi|29747846|gb|AAH50114.1| Cytidine deaminase [Mus musculus] >gi|123229365|emb|CAM18875.1| cytidine deaminase [Mus musculus] >gi|148681316|gb|EDL13263.1| cytidine deaminase [Mus musculus] (146 aa)
Score = 235, Expect = 1.6e-18, Identities = 46/129 (35%), Positives = 76/129 (58%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++  + +  +E  ++AY PYS+F V A++   D   + G N+EN+ YP+ +C ER AI  A+S G+K+   I + +D    F +PCG CRQ M EF    D ++Y+   +G ++  T+ E+L   F  +DL
  S:    14 HVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACYPLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREF--GTDWAVYMTKPDGTFVVRTVQELLPASFGPEDL 142
>gi|110004477|emb|CAK98814.1| probable cytidine deaminase protein [Spiroplasma citri] (131 aa)
Score = 234, Expect = 1.8e-18, Identities = 54/126 (42%), Positives = 78/126 (61%)
  Q:     8 TIFIKLKEVIENAYVPYSKFRVASICKADDSF-YYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           T F KLK + + AY  YS FRV++IC   D     GVNVEN++Y  T+C ER A++   + G++  +I   YL TDS    +PCG+CRQF+ E ++     I I+N +G+    TI ++L   FTK+DL
  S:     3 TYFKKLKLLSKRAYALYSNFRVSAICLLKDGVEVIGVNVENAAYAATICAERTALAQVYALGYRKTDIVKFYLYTDSKQAGSPCGICRQFLWELVDH-RIPIEIYNQKGESYVLTIKDLLPYGFTKEDL 130
>gi|148990353|ref|ZP_01821539.1| cytidine deaminase [Streptococcus pneumoniae SP6-BS73] >gi|147924382|gb|EDK75473.1| cytidine deaminase [Streptococcus pneumoniae SP6-BS73] (129 aa)
Score = 234, Expect = 1.9e-18, Identities = 46/115 (40%), Positives = 71/115 (61%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E  ++AYVPYS F + ++  A D S Y GVN+EN+SYP+T CGER A+  A+S G +  +++ +   +    +PCG CRQ M+EF E  D  + +   +   ++ T+GE+L   FT
  S:    12 ETSKHAYVPYSHFPIGAVLVAKDGSVYTGVNIENASYPLTNCGERTAVFKAISEGQREFSELIVYGQTEKPISPCGACRQVMAEFFEQ-DLKVTLVAKDKSTVEMTVGELLPYSFT 126
>gi|45200974|ref|NP_986544.1| AGL123Wp [Ashbya gossypii ATCC 10895] >gi|44985744|gb|AAS54368.1| AGL123Wp [Ashbya gossypii ATCC 10895] (139 aa)
Score = 234, Expect = 2.0e-18, Identities = 49/116 (42%), Positives = 68/116 (58%)
  Q:    18 ENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEG-KYIKYTIGEILKGRFTKKDL 133
           E +Y PYSKFRV   I  A   +  G NVEN+SYP  +C ER A+  AV+ GH N   I L  DS+   TPCG+CRQ + EF++    ++ + N +G K ++ T+ E+L   F    L
  S:    21 ELSYSPYSKFRVGCCILTASGEYIVGANVENASYPAGICAERTAVVKAVTAGHTNWVCIALSGDSSDVVTPCGICRQVLREFVDPKKLTVIMMNADGSKVLQRTLEELLPYSFGPDSL 138
>gi|65321673|ref|ZP_00394632.1| COG0295: Cytidine deaminase [Bacillus anthracis str. A2012] (132 aa)
Score = 233, Expect = 2.1e-18, Identities = 52/121 (42%), Positives = 70/121 (57%)
  Q:    13 LKEVIE---NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++E IE    AYVPYSKF+V A++   D   Y G NVEN+SY +  C E  A+  AVS G K    I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:     7 IQEAIEARKQAYVPYSKFQVGAALLTQDGKVYRGCNVENASYGLCNCAEXTALFKAVSEGDKEFVAIAIVADTKRPVPPCGACRQVMVELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 130
>gi|20806970|ref|NP_622141.1| cytidine deaminase [Thermoanaerobacter tengcongensis MB4] >gi|20515450|gb|AAM23745.1| Cytidine deaminase [Thermoanaerobacter tengcongensis MB4] (135 aa)
Score = 233, Expect = 2.6e-18, Identities = 47/121 (38%), Positives = 74/121 (61%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           KE  ENAY PYS F+V A +   D + Y G N+EN+S+ +T+C ER A+  A S G + +  I ++ D++   +PCG CRQ M E +  +D  + + N +G +   T+ ++L G FT KD++
  S:    14 KEARENAYAPYSNFKVGACVLTEDGNIYKGCNIENASFGLTVCAERVAMFNAYSGGERKLKAIAVVADTDGPVSPCGACRQVMME-LGGEDMVVILSNMKGDHAIMTVRDLLPGAFTSKDME 134
>gi|45387777|ref|NP_991242.1| cytidine deaminase [Danio rerio] >gi|41107631|gb|AAH65476.1| Cytidine deaminase [Danio rerio] (159 aa)
Score = 232, Expect = 2.9e-18, Identities = 50/124 (40%), Positives = 76/124 (61%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           K +E  + AY PYSKFRV A++   D + + G NVEN+ + + +C ER AIS AVS G+++   I + +D    F +PCG CRQFM EF    +  +Y+   +G Y++ T+ E+L   F  +DL +
  S:    27 KSQEAKKFAYCPYSKFRVGAALLTHDGTVFTGCNVENACFNLGICAERVAISKAVSEGYRDFKAIAIASDMCENFISPCGGCRQFMREF--GSNWEVYLSKPDGSYVEMTVEELLPASFGPEDLKM 150
>gi|50550903|ref|XP_502924.1| hypothetical protein [Yarrowia lipolytica] >gi|49648792|emb|CAG81115.1| unnamed protein product [Yarrowia lipolytica CLIB122] (149 aa)
Score = 232, Expect = 2.9e-18, Identities = 49/115 (42%), Positives = 69/115 (60%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +Y PYSKFRV ++   +   +  G NVEN+SY   +C ER AI+ A+  GHK    I + +D +   +PCG+CRQF+ E+  S D  IY+F  +GKY   TI E+L   F  + LD
  S:    22 SYSPYSKFRVGAVLLTESGEWIQGANVENASYGGAICAERVAITRAIMEGHKKFKAIGVASDLSVVCSPCGICRQFIREW--STDIPIYLFTKDGKYTMQTIKELLPLSFGPEHLD 135
>gi|157822603|ref|NP_001102158.1| cytidine deaminase [Rattus norvegicus] >gi|149024378|gb|EDL80875.1| cytidine deaminase (predicted) [Rattus norvegicus] (146 aa)
Score = 232, Expect = 3.1e-18, Identities = 46/129 (35%), Positives = 76/129 (58%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++  + +  +E  ++AY PYS+F V A++   D   + G NVEN+ YP+ +C ER AI  A+S G+K+   I + +D    F +PCG CRQ M EF    + ++Y+   +G ++  T+ E+L   F  +DL
  S:    14 HVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNVENACYPLGVCAERTAIQKAISEGYKDFRAIAIASDLQEEFISPCGACRQVMREF--GTNWAVYMTKPDGTFVVRTVQELLPASFGPEDL 142
>gi|163942057|ref|YP_001646941.1| cytidine deaminase [Bacillus weihenstephanensis KBAB4] >gi|163864254|gb|ABY45313.1| cytidine deaminase [Bacillus weihenstephanensis KBAB4] (132 aa)
Score = 232, Expect = 3.2e-18, Identities = 50/130 (38%), Positives = 71/130 (54%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +N   +  +  E  + AYVPYSKF+V A++   D   Y G NVEN+SY +  C ER A+  A+S G      I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:     1 MNSKQLIQEATEARKRAYVPYSKFQVGAALLTQDGKIYRGCNVENASYGLCNCAERTALFKAISEGDNEFVAIAVVADTKRPVPPCGACRQVMIELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 130
>gi|148997081|ref|ZP_01824735.1| cytidine deaminase [Streptococcus pneumoniae SP11-BS70] >gi|168575499|ref|ZP_02721435.1| cytidine deaminase [Streptococcus pneumoniae MLV-016] >gi|194398262|ref|YP_002037479.1| cytidine deaminase [Streptococcus pneumoniae G54] >gi|147756781|gb|EDK63821.1| cytidine deaminase [Streptococcus pneumoniae SP11-BS70] >gi|183578488|gb|EDT99016.1| cytidine deaminase [Streptococcus pneumoniae MLV-016] >gi|194357929|gb|ACF56377.1| cytidine deaminase [Streptococcus pneumoniae G54] (129 aa)
Score = 232, Expect = 3.3e-18, Identities = 47/115 (40%), Positives = 70/115 (60%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E  ++AYVPYS F + ++  A D S Y GVN+EN+SYP+T CGER AI  A+S G +  +++ +   +    +PCG CRQ M EF E  D  + +   +   ++ T+GE+L   FT
  S:    12 ETSKHAYVPYSHFPIGAVLVAKDGSVYTGVNIENASYPLTNCGERTAIFKAISEGQREFSELIVYGQTEKPISPCGACRQVMVEFFEQ-DLKVTLVAKDKSTVEMTVGELLPYSFT 126
>gi|124027705|ref|YP_001013025.1| cytidine deaminase [Hyperthermus butylicus DSM 5456] >gi|123978399|gb|ABM80680.1| Cytidine deaminase [Hyperthermus butylicus DSM 5456] (150 aa)
Score = 231, Expect = 4.1e-18, Identities = 41/99 (41%), Positives = 65/99 (65%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           ++L  +F + K+VI N+Y PYS   VA++  ADD + Y GVNVEN SY +T+C ER A++  ++ G + I  + +++D+     PCG CRQ ++EF + D
  S:     6 VDLEELFQRAKQVIGNSYAPYSGVHVAAVVLADDGTVYLGVNVENVSYGLTICAERAAVAAMITAGRRRIKAVAIVSDTTLPLPPCGACRQVIAEFADDD 105
>gi|118444585|ref|YP_878553.1| cytidine deaminase [Clostridium novyi NT] >gi|118135041|gb|ABK62085.1| cytidine deaminase [Clostridium novyi NT] (132 aa)
Score = 231, Expect = 4.5e-18, Identities = 53/116 (45%), Positives = 72/116 (62%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AY PYSKF+V A++   D   Y G N+EN+SY  T C ER AI +AV+ G+K +  I L+ D +T+ TPCG+CRQ +SEF + +   I I N E  Y    + +   G FTK+DL
  S:    15 ETAYSPYSKFKVGAAVIMDDGKIYGGCNIENASYGATNCAERTAIFSAVAQGNKKLKAIALVGDLSTYTTPCGICRQVISEFSDENTDIILIKN-ENDYKIKKLEDFFPGGFTKEDL 130
>gi|125973583|ref|YP_001037493.1| cytidine deaminase [Clostridium thermocellum ATCC 27405] >gi|196253076|ref|ZP_03151718.1| cytidine deaminase [Clostridium thermocellum DSM 4150] >gi|125713808|gb|ABN52300.1| cytidine deaminase [Clostridium thermocellum ATCC 27405] >gi|196197501|gb|EDX92356.1| cytidine deaminase [Clostridium thermocellum DSM 4150] (128 aa)
Score = 230, Expect = 5.4e-18, Identities = 45/117 (38%), Positives = 73/117 (62%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           +++ +N+Y PYSKFRV A++       + GVN+EN+S+  T+C ER A+  AVS G + I  + + +DS+ +  PCG+CRQ + EF + DD  +   N  G++  + +GE+L   F K
  S:    11 EDIKKNSYSPYSKFRVGAAVLAKSGKVFTGVNIENASFGATVCAERTAVFKAVSEGEREIAAVAISSDSDEYTFPCGICRQVLREFGD-DDTKVICGNKNGEFTVFRLGELLPNAFFK 127
>gi|115373698|ref|ZP_01460992.1| cytidine deaminase [Stigmatella aurantiaca DW4/3-1] >gi|115369245|gb|EAU68186.1| cytidine deaminase [Stigmatella aurantiaca DW4/3-1] (134 aa)
Score = 229, Expect = 6.4e-18, Identities = 50/129 (38%), Positives = 75/129 (58%)
  Q:     2 SEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           ++I    +F +  +V E A+VPYS+F V A+I   D S   G NVEN++Y +T+C ER A  +AV+ GH     + ++ D+ T   PCGMCRQ M+EF    D  I     +G+  +Y + E+L   FT+
  S:     3 ADIPWEALFQQAAKVRERAHVPYSRFPVGAAILFEDGSVVTGCNVENATYGLTVCAERGAFVSAVAQGHSRPVAVAIVVDTPTPCPPCGMCRQVMAEF-AGPDLPIRSRTLQGEEARYALRELLPYAFTR 131
>gi|118101171|ref|XP_001234309.1| PREDICTED: hypothetical protein [Gallus gallus] (136 aa)
Score = 229, Expect = 6.8e-18, Identities = 49/128 (38%), Positives = 71/128 (55%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           L  +  + +E  + AY PYS+F V A++  A    + G NVEN+ Y + +C ER AI  A+S GH     + + +D + F TPCG CRQ M EF    D  +Y+   +G YI  T+ E+L   F  +DL
  S:     7 LQLLLRRCREAKDCAYCPYSRFPVGAAVVTAGGEIFSGCNVENACYSLGVCAERIAIQKAISEGHTRFRAMAIASDMSDFITPCGACRQVMREF--GTDWDLYLTKPDGTYIVKTLQELLPLSFGPEDL 133
>gi|148986072|ref|ZP_01819093.1| cytidine deaminase [Streptococcus pneumoniae SP3-BS71] >gi|148992510|ref|ZP_01822205.1| cytidine deaminase [Streptococcus pneumoniae SP9-BS68] >gi|149010528|ref|ZP_01831899.1| cytidine deaminase [Streptococcus pneumoniae SP19-BS75] >gi|149021708|ref|ZP_01835739.1| cytidine deaminase [Streptococcus pneumoniae SP23-BS72] >gi|168489783|ref|ZP_02713982.1| cytidine deaminase [Streptococcus pneumoniae SP195] >gi|182683756|ref|YP_001835503.1| cytidine deaminase [Streptococcus pneumoniae CGSP14] >gi|147765009|gb|EDK71938.1| cytidine deaminase [Streptococcus pneumoniae SP19-BS75] >gi|147921906|gb|EDK73032.1| cytidine deaminase [Streptococcus pneumoniae SP3-BS71] >gi|147928827|gb|EDK79840.1| cytidine deaminase [Streptococcus pneumoniae SP9-BS68] >gi|147930169|gb|EDK81155.1| cytidine deaminase [Streptococcus pneumoniae SP23-BS72] >gi|182629090|gb|ACB90038.1| cytidine deaminase [Streptococcus pneumoniae CGSP14] >gi|183571765|gb|EDT92293.1| cytidine deaminase [Streptococcus pneumoniae SP195] (129 aa)
Score = 228, Expect = 8.3e-18, Identities = 46/115 (40%), Positives = 70/115 (60%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E  ++AYVPYS F + ++  A D + Y GVN+EN+SYP+T CGER AI  A+S G +  +++ +   +    +PCG CRQ M EF E  D  + +   +   ++ T+GE+L   FT
  S:    12 ETSKHAYVPYSHFPIGAVLVAKDGNVYTGVNIENASYPLTNCGERTAIFKAISEGQREFSELIVYGQTEKPISPCGACRQVMVEFFEQ-DLKVTLVAKDKSTVEMTVGELLPYSFT 126
>gi|154249683|ref|YP_001410508.1| cytidine deaminase [Fervidobacterium nodosum Rt17-B1] >gi|154153619|gb|ABS60851.1| cytidine deaminase [Fervidobacterium nodosum Rt17-B1] (137 aa)
Score = 227, Expect = 1.1e-17, Identities = 51/132 (38%), Positives = 77/132 (58%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           E  +N +    KEV E AY PYS F+V A +   +   + GVNVEN+SY +T C ER AI  AVS G ++   + ++ +++    PCG CRQ M+EF    +  + + N +G +I+ T+ E+L   F K DL+
  S:     7 ERKINELIEIAKEVREQAYAPYSNFKVGAVLVTKNGKVFTGVNVENASYGLTNCAERTAIFKAVSEGERDFDTLVVIANTDKPVAPCGACRQVMAEF---GNFKVILANTKGDWIETTVQELLPYGFDKSDLE 136
>gi|110645436|gb|AAI18901.1| Cytidine deaminase [Xenopus tropicalis] (151 aa)
Score = 227, Expect = 1.3e-17, Identities = 52/119 (43%), Positives = 68/119 (57%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT-FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E  + A+ PYSKFRV A++  AD     G NVEN+ Y + +C ER AI  AVS G+K    I + +D  T F TPCG CRQ M EF    D  IY+    G Y + T+ ++L   F  +DL
  S:    30 EAKQRAHCPYSKFRVGAALLTADGKVILGCNVENACYALGICAERTAIQKAVSEGYKEFRAIAVASDVETEFITPCGACRQVMREFGAEWD--IYLTKPSGTYTRTTLRQLLPMSFGPEDL 148
>gi|62857659|ref|NP_001017217.1| cytidine deaminase [Xenopus (Silurana) tropicalis] >gi|89269568|emb|CAJ82852.1| cytidine deaminase [Xenopus tropicalis] (151 aa)
Score = 227, Expect = 1.3e-17, Identities = 52/119 (43%), Positives = 68/119 (57%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT-FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E  + A+ PYSKFRV A++  AD     G NVEN+ Y + +C ER AI  AVS G+K    I + +D  T F TPCG CRQ M EF    D  IY+    G Y + T+ ++L   F  +DL
  S:    30 EAKQRAHCPYSKFRVGAALLTADGKVILGCNVENACYALGICAERTAIQKAVSEGYKEFRAIAVASDVETEFITPCGACRQVMREFGAEWD--IYLTKPSGTYTRTTLRQLLPMSFGPEDL 148
>gi|263657|gb|AAB24946.1| cytidine deaminase; CDD [Homo sapiens] (145 aa)
Score = 227, Expect = 1.3e-17, Identities = 47/120 (39%), Positives = 71/120 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +E  ++AY PYS F V A++   +   + G N+EN+ YP+ +C ER AI  AVS G+K+   I + +D  + F +PCG CRQ M EF    +  +Y+   +G YI  T+ E+L   F  +DL
  S:    22 QEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREF--GTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDL 141
>gi|32450432|gb|AAH54036.1| Cytidine deaminase [Homo sapiens] (146 aa)
Score = 227, Expect = 1.3e-17, Identities = 47/120 (39%), Positives = 71/120 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +E  ++AY PYS F V A++   +   + G N+EN+ YP+ +C ER AI  AVS G+K+   I + +D  + F +PCG CRQ M EF    +  +Y+   +G YI  T+ E+L   F  +DL
  S:    23 QEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREF--GTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDL 142
>gi|38492430|pdb|1MQ0|A Chain A, Crystal Structure Of Human Cytidine Deaminase >gi|38492431|pdb|1MQ0|B Chain B, Crystal Structure Of Human Cytidine Deaminase (140 aa)
Score = 226, Expect = 1.5e-17, Identities = 47/120 (39%), Positives = 71/120 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +E  ++AY PYS F V A++   +   + G N+EN+ YP+ +C ER AI  AVS G+K+   I + +D  + F +PCG CRQ M EF    +  +Y+   +G YI  T+ E+L   F  +DL
  S:    17 QEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREF--GTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDL 136
>gi|57044256|ref|XP_544519.1| PREDICTED: similar to cytidine deaminase [Canis familiaris] (146 aa)
Score = 226, Expect = 1.5e-17, Identities = 46/120 (38%), Positives = 69/120 (57%)
  Q:     9 IFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           + +  +E  ++AY PYS F V A+I   D   + G N+EN  YP+ +C ER AI  A+S GH+    I + +D  + F +PCG CRQFM EF    +  +Y+   +G Y+  T+ E+L   F
  S:    18 LLLSCQEAKKSAYCPYSHFPVGAAILTQDGRIFSGCNIENVCYPLGVCAERTAIQKAISEGHREFRAIAISSDLQDDFISPCGACRQFMREF--GSNWVVYMTKPDGTYVVSTVLELLPAPF 137
>gi|11386157|ref|NP_001776.1| cytidine deaminase [Homo sapiens] >gi|114554458|ref|XP_001161389.1| PREDICTED: cytidine deaminase isoform 2 [Pan troglodytes] >gi|1705718|sp|P32320|CDD_HUMAN Cytidine deaminase (Cytidine aminohydrolase) >gi|598149|gb|AAA57254.1| cytidine deaminase >gi|2769252|emb|CAA04113.1| cytidine deaminase [Homo sapiens] >gi|4321793|gb|AAD15828.1| cytidine deaminase [Homo sapiens] >gi|55664524|emb|CAH73474.1| cytidine deaminase [Homo sapiens] >gi|119615338|gb|EAW94932.1| cytidine deaminase, isoform CRA_b [Homo sapiens] (146 aa)
Score = 225, Expect = 1.9e-17, Identities = 47/120 (39%), Positives = 71/120 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +E  ++AY PYS F V A++   +   + G N+EN+ YP+ +C ER AI  AVS G+K+   I + +D  + F +PCG CRQ M EF    +  +Y+   +G YI  T+ E+L   F  +DL
  S:    23 QEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREF--GTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDL 142
>gi|153953549|ref|YP_001394314.1| cytidine deaminase [Clostridium kluyveri DSM 555] >gi|146346430|gb|EDK32966.1| Cdd [Clostridium kluyveri DSM 555] (138 aa)
Score = 225, Expect = 2.0e-17, Identities = 50/115 (43%), Positives = 68/115 (59%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           AY PYSKFRV A++   D + Y G N+EN SY  T C ER A+  AVS GH+++  I +   +  +  PCG+CRQ +SEF   +D  I I   E +Y+   + EIL   F KK L+
  S:    17 AYAPYSKFRVGAAVLTGDGNIYTGCNIENVSYGATNCAERTAVFKAVSEGHRDLRAIAIAGSNKEYTYPCGICRQVISEFAR-EDMEIIIVKNENEYMVKKLEEILPYAFIKKHLE 131
>gi|108758788|ref|YP_633844.1| cytidine deaminase [Myxococcus xanthus DK 1622] >gi|108462668|gb|ABF87853.1| cytidine deaminase [Myxococcus xanthus DK 1622] (134 aa)
Score = 223, Expect = 3.0e-17, Identities = 49/128 (38%), Positives = 73/128 (57%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           EI    +F +   V   A+VPYS+F V A++  AD +   G NVEN++Y +T+C ERNA + AV+ GH     + ++ D+     PCGMCRQ M+EF    +  +     +G   +YT+G +L   FTK
  S:     4 EIPWERLFEEAARVRARAHVPYSRFPVGAAVLFADGAVVAGCNVENATYGLTVCAERNAFAAAVAQGHTQPVAVAIVVDTPEPCPPCGMCRQVMAEF-GGQELPVRSRTPQGGEARYTLGGLLPHAFTK 131
>gi|71279710|ref|YP_268699.1| cytidine deaminase [Colwellia psychrerythraea 34H] >gi|71145450|gb|AAZ25923.1| cytidine deaminase [Colwellia psychrerythraea 34H] (139 aa)
Score = 223, Expect = 3.2e-17, Identities = 49/120 (40%), Positives = 67/120 (55%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           KE  + AY PYSKF V AS    D     G NVEN+SY +T+C ERN IS AV  G +    I + T+ +    PCG CRQ ++EF E     + + +   + I +T+ ++L   FT KDL
  S:    17 KEAYQRAYAPYSKFHVGASALTTDGDIVNGCNVENASYGLTICAERNCISHAVVQGKQMFKFIMIYTEQDKLTPPCGACRQVIAEFFEQSALVVAVNHKNDRKI-WTVQQLLPDAFTPKDL 136
>gi|124522801|ref|ZP_01697235.1| cytidine deaminase [Bacillus coagulans 36D1] >gi|124495882|gb|EAY43523.1| cytidine deaminase [Bacillus coagulans 36D1] (130 aa)
Score = 223, Expect = 3.7e-17, Identities = 49/119 (41%), Positives = 68/119 (57%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E+ + AYVPYS F V A +       Y G N+EN+SY ++ C ER AI  AVS G +    + +  D++    PCG CRQ MSEF E  D  + + N +G     T+GE+L G F+K D+
  S:    12 EIRKAAYVPYSHFEVGACLITKSGKEYLGCNIENASYGLSNCAERTAIFKAVSEGEREFQYMVIAGDTDEPIVPCGACRQVMSEFCEK-DMPVLLVNTKGDRRLTTVGELLPGAFSKDDM 130
>gi|108998740|ref|XP_001096632.1| PREDICTED: similar to cytidine deaminase [Macaca mulatta] (146 aa)
Score = 223, Expect = 3.7e-17, Identities = 46/120 (38%), Positives = 71/120 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +E  ++AY PYS F V A++   +   + G N+EN+ YP+ +C ER AI  AVS G+K+   I + +D  + F +PCG CRQ M EF    +  +Y+   +G Y+  T+ E+L   F  +DL
  S:    23 QEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFKAIAISSDMQDDFISPCGACRQVMREF--GTNWPVYMTKPDGTYVVMTVQELLPSSFGPEDL 142
>gi|119872593|ref|YP_930600.1| cytidine deaminase [Pyrobaculum islandicum DSM 4184] >gi|119674001|gb|ABL88257.1| cytidine deaminase [Pyrobaculum islandicum DSM 4184] (138 aa)
Score = 222, Expect = 4.4e-17, Identities = 48/120 (40%), Positives = 69/120 (57%)
  Q:    12 KLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           K + VI NAY PYS F+VA++ K      Y GVNVEN+SY +T+C ER A+  AVS G ++I  + + TD+     PCG CRQ ++EF      ++ +     K I   + E+L   F K+
  S:    21 KARAVINNAYAPYSNFKVAAVVKTKSGKVYTGVNVENASYGLTICAERVAVFKAVSEGDRDIDVVVVYTDTEEPTPPCGACRQVIAEFNPD---ALIVMASRTKVITVRLSELLPRPFIKR 138
>gi|126725061|ref|ZP_01740904.1| cytidine deaminase [Rhodobacterales bacterium HTCC2150] >gi|126706225|gb|EBA05315.1| cytidine deaminase [Rhodobacterales bacterium HTCC2150] (131 aa)
Score = 222, Expect = 4.8e-17, Identities = 48/117 (41%), Positives = 67/117 (57%)
  Q:    19 NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           NA+ PYSKF V A+I  AD + Y G NVEN +YP   C E  AI+     G + I ++ ++ DS    TPCG CRQ ++EF  + D  + +    G+ IK T+GE+L G F    +D 
  S:    15 NAHAPYSKFLVGAAIRTADGTVYQGCNVENIAYPEGTCAEAGAIAAMCVAGERKIAEVCVVADSPLPVTPCGGCRQKLAEF-SAPDVVVTMATLGGEEIKTTVGELLPGAFGPDHMDF 131
>gi|152994670|ref|YP_001339505.1| cytidine deaminase [Marinomonas sp. MWYL1] >gi|150835594|gb|ABR69570.1| cytidine deaminase [Marinomonas sp. MWYL1] (139 aa)
Score = 222, Expect = 5.0e-17, Identities = 51/126 (40%), Positives = 69/126 (54%)
  Q:     9 IFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +F   KE +  AYVPYS+F V A+I  A    Y G NVEN+++P   C E  AI++ V  G   I DI+++       TPCG CRQ + EF  S D  I+I   EG     T+ E+L   F  ++LD
  S:    10 LFALAKEAMNKAYVPYSRFHVGAAILTAGGRIYSGCNVENAAFPEGTCAEAGAIASMVLGGDTLIKDIFVIGKGEELVTPCGGCRQKIREF-SSVDTMIHICGAEGVRKSLTMNELLPFSFGPENLD 135
>gi|153894879|ref|ZP_02015462.1| cytidine deaminase [Halorubrum lacusprofundi ATCC 49239] >gi|151586102|gb|EDN49526.1| cytidine deaminase [Halorubrum lacusprofundi ATCC 49239] (133 aa)
Score = 221, Expect = 6.1e-17, Identities = 45/121 (37%), Positives = 76/121 (62%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           ++ +++A+VPYS++RV A++  AD + Y G N+EN++Y  +L  E  A++ AV NGH+    I + +      TPCGMCRQ ++EF  +DD  +     +G+  +YT+GE+L    ++  LD
  S:     8 RDALDDAHVPYSEYRVGAALRTADGTVYTGCNIENANYSNSLHAEEVALAEAVKNGHREFDRIAVTSGVRDGVTPCGMCRQSLTEF-AADDLIVVCDEGDGETSEYTLGELLPNTISEDTLD 128
>gi|1431583|emb|CAA66974.1| pcd1+ [Schizosaccharomyces pombe] (133 aa)
Score = 221, Expect = 6.1e-17, Identities = 52/133 (39%), Positives = 81/133 (60%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADD--SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           M + ++  +F ++KE ++ +Y PYS F V +   +DD  ++ YG NVEN+SY   +C ER AI+ AVS G+     I +++ +    TPCG+CRQ + EF  S D ++Y+F+ +G Y   TI E+L   F   DL
  S:     1 MEKEDIEKLFQEVKESLQYSYCPYSNFAVGACVVSDDKNTYIYGANVENASYGNCICAERVAITKAVSMGYTKFMAIGVMS-AKGRVTPCGICRQVIREF--SKDINVYMFHDDGGYDMKTIEELLPDSFGPDDL 132
>gi|150017966|ref|YP_001310220.1| cytidine deaminase [Clostridium beijerinckii NCIMB 8052] >gi|149904431|gb|ABR35264.1| cytidine deaminase [Clostridium beijerinckii NCIMB 8052] (133 aa)
Score = 220, Expect = 6.8e-17, Identities = 51/119 (42%), Positives = 77/119 (64%)
  Q:    15 EVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + +ENAY PYS ++V S +   D+ ++ G N+EN+SY +T C ERNAI  A SNG++  ++  I +++D NT ATPCG CRQ + E +E     I + N + + I   I E+L   FT++DL
  S:    13 KAMENAYSPYSNYKVGSCVVTKDNKYFIGANIENASYGLTNCAERNAIFQAYSNGYRKEDVKAIAIVSDGNTLATPCGACRQVLVELLEK-HTPIVLSNKKTEKIT-DIEELLPMSFTEEDL 132
>gi|54297345|ref|YP_123714.1| hypothetical protein lpp1390 [Legionella pneumophila str. Paris] >gi|53751130|emb|CAH12541.1| hypothetical protein [Legionella pneumophila str. Paris] (131 aa)
Score = 220, Expect = 7.0e-17, Identities = 50/110 (45%), Positives = 68/110 (61%)
  Q:    15 EVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           +V+ NAY PYSKF VA+ IC   ++FY GVNVEN SY +T C E +AI   V+ G + I  I +L  +N   +PCG CRQ + EF  S D  +++ N E  +   TI E+L
  S:    14 KVLVNAYAPYSKFSVAACICTDKNNFYTGVNVENISYGLTTCAEVSAICNMVTAGERKIKSIVVLAANNLLCSPCGACRQRIHEF-SSSDTMVHLCNKETIFHSITINELL 123
>gi|52841665|ref|YP_095464.1| cytidine deaminase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628776|gb|AAU27517.1| cytidine deaminase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (131 aa)
Score = 220, Expect = 7.5e-17, Identities = 50/110 (45%), Positives = 68/110 (61%)
  Q:    15 EVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           +V+ NAY PYSKF VA+ IC   ++FY GVNVEN SY +T C E +AI   V+ G + I  I +L  +N   +PCG CRQ + EF  S D  +++ N E  +   TI E+L
  S:    14 KVLVNAYAPYSKFSVAACICTDKNNFYTGVNVENISYGLTTCAEVSAICNMVTAGERKIKSIVVLAANNLLCSPCGACRQRIHEF-SSSDTMVHLCNKETIFHSITINELL 123
>gi|54294530|ref|YP_126945.1| hypothetical protein lpl1606 [Legionella pneumophila str. Lens] >gi|53754362|emb|CAH15846.1| hypothetical protein [Legionella pneumophila str. Lens] (131 aa)
Score = 220, Expect = 7.5e-17, Identities = 50/110 (45%), Positives = 68/110 (61%)
  Q:    15 EVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           +V+ NAY PYSKF VA+ IC   ++FY GVNVEN SY +T C E +AI   V+ G + I  I +L  +N   +PCG CRQ + EF  S D  +++ N E  +   TI E+L
  S:    14 KVLVNAYAPYSKFSVAACICTDKNNFYTGVNVENISYGLTTCAEVSAICNMVTAGERKIKSIVVLAANNLLCSPCGACRQRIHEF-SSSDTMVHLCNKETIFYSITINELL 123
>gi|71910756|ref|YP_282306.1| cytidine deaminase [Streptococcus pyogenes MGAS5005] >gi|94990566|ref|YP_598666.1| cytidine deaminase [Streptococcus pyogenes MGAS10270] >gi|71853538|gb|AAZ51561.1| cytidine deaminase [Streptococcus pyogenes MGAS5005] >gi|94544074|gb|ABF34122.1| Cytidine deaminase [Streptococcus pyogenes MGAS10270] (129 aa)
Score = 220, Expect = 7.6e-17, Identities = 46/112 (41%), Positives = 67/112 (59%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E AYVPYS F V +  K  D + Y G N+EN S+ +T CGER AI  A+S+GHK + +I +  ++    +PCG CRQ M+EF +       I    G+ ++ T+G++L   FT
  S:    15 EYAYVPYSHFPVGAALKTKDGTIYTGCNIENVSFGLTNCGERTAIFKAISDGHKELVEIAIYGETMQPVSPCGACRQVMAEFFDPSSLVTLIAK-NGQTVEMTVGDLLPYSFT 126
>gi|51891671|ref|YP_074362.1| cytidine deaminase [Symbiobacterium thermophilum IAM 14863] >gi|51855360|dbj|BAD39518.1| cytidine deaminase [Symbiobacterium thermophilum IAM 14863] (137 aa)
Score = 220, Expect = 7.9e-17, Identities = 45/113 (39%), Positives = 66/113 (58%)
  Q:    21 YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           YVPYS+F V A++   D + Y G N+EN+S+ +T C ER AI   VS G +    I ++ D++   +PCG CRQ MSEF    D  + + N +G     ++ ++L G FT  DL
  S:    18 YVPYSRFAVGAAVLAEDGTLYTGCNIENASFGLTNCAERTAIFKMVSEGRRRFKAIAVIADTDGPCSPCGACRQVMSEF--GPDARVILTNLKGDTWTGSVRDLLPGAFTSADL 129
>gi|18312182|ref|NP_558849.1| cytidine deaminase [Pyrobaculum aerophilum str. IM2] >gi|18159619|gb|AAL63031.1| cytidine deaminase [Pyrobaculum aerophilum str. IM2] (127 aa)
Score = 220, Expect = 8.0e-17, Identities = 47/116 (40%), Positives = 70/116 (60%)
  Q:    16 VIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           +I+ AY PYSKF+VASI K      Y GVN+EN+SY +T+C ER A+  AVS G ++I  + + TD++    PCG CRQ ++EF  +   ++ +     K I   + E+L   F+ K
  S:    11 IIDRAYAPYSKFKVASIVKTKSGKIYTGVNIENASYGLTICAERVAVFKAVSEGDRDIDTVIIYTDTDEPTPPCGACRQVIAEFNPN---ALIVMASRKKVITQRLSELLPNVFSLK 124
>gi|72080496|ref|YP_287554.1| cytidine deaminase [Mycoplasma hyopneumoniae 7448] >gi|71913620|gb|AAZ53531.1| cytidine deaminase [Mycoplasma hyopneumoniae 7448] (131 aa)
Score = 220, Expect = 8.1e-17, Identities = 47/125 (37%), Positives = 83/125 (66%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRVASI-CKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNG--HKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           +N IF++L+++ + AY PYS F VA+I       F+ GVNVEN+ +P T+C ER AI+ A+++G   K   +I++ + +++ F  PCG C Q  +EF  S+  SI+++N + ++ + T+ ++L  +F K
  S:     1 MNKIFLELEKLSKKAYCPYSDFAVAAILVTTSGQFFKGVNVENAVFPATICAERVAITQAIASGVEPKTFKEIHIYSPNTDKFIIPCGQCLQVCAEFF-SEKVSIFLYNSKSEFRERTLNQLLPNQFNK 128
>gi|172056861|ref|YP_001813321.1| cytidine deaminase [Exiguobacterium sibiricum 255-15] >gi|171989382|gb|ACB60304.1| cytidine deaminase [Exiguobacterium sibiricum 255-15] (132 aa)
Score = 220, Expect = 8.2e-17, Identities = 44/116 (37%), Positives = 68/116 (58%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AYVPYSKF+V A++   D   ++G N+EN++Y +  C ER AI +A +   +    + ++ D+     PCG CRQ + E  ++ D  +Y+ N  G   + T+G +L G FTK DL
  S:    15 EKAYVPYSKFQVGAALLTKDGQVFHGCNIENAAYGLCNCAERTAIFSAWAQDAREYAAMAVVADTEGPVAPCGQCRQVLFEMCDA-DMPVYLTNLTGDVTETTVGALLPGAFTKGDL 130
>gi|148358966|ref|YP_001250173.1| cytidine deaminase [Legionella pneumophila str. Corby] >gi|148280739|gb|ABQ54827.1| cytidine deaminase [Legionella pneumophila str. Corby] (131 aa)
Score = 220, Expect = 8.7e-17, Identities = 50/110 (45%), Positives = 68/110 (61%)
  Q:    15 EVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           +V+ NAY PYSKF VA+ IC   ++FY GVNVEN SY +T C E +AI   V+ G + I  I +L  +N   +PCG CRQ + EF  S D  +++ N E  +   TI E+L
  S:    14 KVLVNAYAPYSKFSVAACICTDKNNFYTGVNVENISYGLTTCAEVSAICNMVTAGERKIKSIVVLAANNLLCSPCGACRQRIHEF-SSSDTMVHLCNKETIFHSITINELL 123
>gi|160947546|ref|ZP_02094713.1| hypothetical protein PEPMIC_01481 [Peptostreptococcus micros ATCC 33270] >gi|158446680|gb|EDP23675.1| hypothetical protein PEPMIC_01481 [Peptostreptococcus micros ATCC 33270] (131 aa)
Score = 219, Expect = 8.9e-17, Identities = 53/119 (44%), Positives = 66/119 (55%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E  + AY PYS F V AS+       Y G N+EN+SY  T+C ER AI  A+ +G K IT I ++   N+   PCG+CRQ M EF  +DDC I I   E +Y      EIL   F  KDL
  S:    13 ESQKKAYTPYSNFNVGASVLTDSGKIYGGCNIENASYTPTVCAERVAIFKAIYDGEKKITKIAVVGKENSLTYPCGVCRQVMKEFC-TDDCEIIIIRNEQEYKIIKFSEILPYSFGPKDL 131
>gi|159901099|ref|YP_001547346.1| cytidine deaminase [Herpetosiphon aurantiacus ATCC 23779] >gi|159894138|gb|ABX07218.1| cytidine deaminase [Herpetosiphon aurantiacus ATCC 23779] (135 aa)
Score = 219, Expect = 1.1e-16, Identities = 45/130 (34%), Positives = 71/130 (54%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++   +    K   E AY PYS+F+V A++  A    ++G N+EN++YPV LC ER+A++ A S G      + ++ D+     PCGMCRQFM E   + D  + + N   +    T  E+L G F+ + L
  S:     3 VDYQALLANAKTARERAYTPYSRFKVGAAVLTASGQIFHGCNIENAAYPVCLCAERSALAAAWSAGETEFIALAVVADTPGPVAPCGMCRQFMFEL--APDLPVLLANLAEQTQHTTPRELLPGGFSPESL 131
>gi|149183350|ref|ZP_01861788.1| cytidine deaminase [Bacillus sp. SG-1] >gi|148848947|gb|EDL63159.1| cytidine deaminase [Bacillus sp. SG-1] (132 aa)
Score = 218, Expect = 1.1e-16, Identities = 48/131 (36%), Positives = 72/131 (54%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +N   +  + K   + AYVPYSKF V A++   D   Y+G N+EN++Y +  C ER A+  A S G K  T + ++ D+     PCG CRQ +SE     D  + + N  G   + T+ EIL G F+ +DL+
  S:     1 MNNEQLITEAKIARDRAYVPYSKFGVGAALLTEDGKVYHGCNIENAAYSMCNCAERTALFKAYSEGDKKFTKLAVVADTKRPVPPCGACRQVISELCPP-DMKVVLSNLNGDIQELTVSEILPGAFSPEDLN 131
>gi|145605339|ref|XP_365095.2| hypothetical protein MGG_09940 [Magnaporthe grisea 70-15] >gi|145013157|gb|EDJ97798.1| hypothetical protein MGG_09940 [Magnaporthe grisea 70-15] (517 aa)
Score = 218, Expect = 1.2e-16, Identities = 49/114 (42%), Positives = 69/114 (60%)
  Q:    20 AYVPYSKFRV-ASICKADD--SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD-DCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYS FRV A++   DD  S+  G NVEN+SYPV  C ER A+  AV+ GH+    + + TD    A+PCGMCRQF+ EF  SD    I++F+ +  ++   +  +L   F  + L
  S:   392 AYCPYSNFRVGATLLSIDDKNSYISGANVENASYPVGTCAERVALGKAVTEGHRRFRALAVSTDITPPASPCGMCRQFIREF--SDLHMPIFMFDKDNDFVVMKLEALLPLSFGPEQL 507
>gi|15675193|ref|NP_269367.1| cytidine deaminase [Streptococcus pyogenes M1 GAS] >gi|13622359|gb|AAK34088.1| putative cytidine deaminase [Streptococcus pyogenes M1 GAS] (129 aa)
Score = 218, Expect = 1.3e-16, Identities = 46/112 (41%), Positives = 67/112 (59%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E AYVPYS F V +  K  D + Y G N+EN S+ +T CGER AI  A+S+GHK + +I +  ++    +PCG CRQ M+EF +       I    G+ ++ T+G++L   FT
  S:    15 EYAYVPYSHFPVGAALKTKDGTIYTGCNIENVSFGLTNCGERTAIFKAISDGHKELVEIAIYGETMQPVSPCGACRQVMAEFFDPSSLVTLIAK-NGQTVEMTVGDLLLYSFT 126
>gi|19746162|ref|NP_607298.1| cytidine deaminase [Streptococcus pyogenes MGAS8232] >gi|21910405|ref|NP_664673.1| cytidine deaminase [Streptococcus pyogenes MGAS315] >gi|28895981|ref|NP_802331.1| cytidine deaminase [Streptococcus pyogenes SSI-1] >gi|50914278|ref|YP_060250.1| cytidine deaminase [Streptococcus pyogenes MGAS10394] >gi|56807530|ref|ZP_00365458.1| COG0295: Cytidine deaminase [Streptococcus pyogenes M49 591] >gi|71903580|ref|YP_280383.1| cytidine deaminase [Streptococcus pyogenes MGAS6180] >gi|94988676|ref|YP_596777.1| cytidine deaminase [Streptococcus pyogenes MGAS9429] >gi|94992499|ref|YP_600598.1| cytidine deaminase [Streptococcus pyogenes MGAS2096] >gi|94994488|ref|YP_602586.1| cytidine deaminase [Streptococcus pyogenes MGAS10750] >gi|139473698|ref|YP_001128414.1| cytidine deaminase [Streptococcus pyogenes str. Manfredo] >gi|19748341|gb|AAL97797.1| putative cytidine deaminase [Streptococcus pyogenes MGAS8232] >gi|21904603|gb|AAM79476.1| putative cytidine deaminase [Streptococcus pyogenes MGAS315] >gi|28811231|dbj|BAC64164.1| putative cytidine deaminase [Streptococcus pyogenes SSI-1] >gi|50903352|gb|AAT87067.1| Cytidine deaminase [Streptococcus pyogenes MGAS10394] >gi|71802675|gb|AAX72028.1| cytidine deaminase [Streptococcus pyogenes MGAS6180] >gi|94542184|gb|ABF32233.1| cytidine deaminase [Streptococcus pyogenes MGAS9429] >gi|94546007|gb|ABF36054.1| Cytidine deaminase [Streptococcus pyogenes MGAS2096] >gi|94547996|gb|ABF38042.1| Cytidine deaminase [Streptococcus pyogenes MGAS10750] >gi|134271945|emb|CAM30183.1| cytidine deaminase [Streptococcus pyogenes str. Manfredo] (129 aa)
Score = 218, Expect = 1.3e-16, Identities = 46/112 (41%), Positives = 66/112 (58%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E AYVPYS F V +  K  D + Y G N+EN S+ +T CGER AI  A+S+GHK + +I +  ++    +PCG CRQ M+EF         I    G+ ++ T+G++L   FT
  S:    15 EYAYVPYSHFPVGAALKTKDGTIYTGCNIENVSFGLTNCGERTAIFKAISDGHKELVEIAIYGETMQPVSPCGACRQVMAEFFAPSSLVTLIAK-NGQTVEMTVGDLLPYSFT 126
>gi|89068558|ref|ZP_01155955.1| Cytidine deaminase [Oceanicola granulosus HTCC2516] >gi|89045977|gb|EAR52037.1| Cytidine deaminase [Oceanicola granulosus HTCC2516] (130 aa)
Score = 218, Expect = 1.4e-16, Identities = 44/120 (36%), Positives = 72/120 (60%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + V ENA+ PYS+F+V A++     + + G NVEN +YP   C E  AI+  V+ G   I ++ +++DS T  TPCG CRQ ++EF  + +  + +   +G  ++ T+GE+L G F K  +
  S:     8 RAVRENAHAPYSRFKVGAALRTTSGAVFTGCNVENVAYPEGTCAEAGAIAAMVAGGFTAIAEMAVVSDSETPVTPCGGCRQKLAEF-AAPNVPVTLATLDGATLETTVGELLPGVFAKDHM 127
>gi|71726731|gb|AAZ39529.1| cytidine deaminase [Biomphalaria glabrata] (139 aa)
Score = 217, Expect = 1.5e-16, Identities = 48/114 (42%), Positives = 69/114 (60%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYSKF+V A++   D   + G NVEN SY +T+C ER+A+  AVS GH     I + ++  + + +PCG CRQF+ EF    D  +Y+   +  +IK + GE+L   FT  DL
  S:    18 AYCPYSKFQVGAAVLTEDGKVFTGCNVENVSYSLTICAERSALVKAVSEGHTRFKAIAVASNMPDKYISPCGACRQFLLEF--GKDYDVYMTKPDHTFIKSSPGELLPHGFTPLDL 131
>gi|118372387|ref|XP_001019390.1| cytidine deaminase family protein [Tetrahymena thermophila SB210] >gi|89301157|gb|EAR99145.1| cytidine deaminase family protein [Tetrahymena thermophila SB210] (155 aa)
Score = 217, Expect = 1.7e-16, Identities = 54/124 (43%), Positives = 73/124 (58%)
  Q:    10 FIKL-KEVIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +IKL +EV + AY PYSKF V  I    D   + GVNVEN+SY +T+C ERNAI +AV+ G K+I+ I +   +    +PCG CRQ + EF  ++   + + N  G Y       IL G F  KDL
  S:    25 YIKLAQEVKKKAYCPYSKFHVGCILFDQDGKMHEGVNVENASYGLTICAERNAIISAVTKGMKSISLIVINCKTEKVGSPCGACRQVIGEF-SNEKTIVVLSNDNGLYEITDFESILPGAFGPKDL 149
>gi|19115233|ref|NP_594321.1| cytidine deaminase Pcd1 [Schizosaccharomyces pombe] >gi|19862844|sp|Q09190|CDD_SCHPO Putative cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|6448609|emb|CAB61215.1| cytidine deaminase Pcd1 [Schizosaccharomyces pombe] (133 aa)
Score = 217, Expect = 1.9e-16, Identities = 51/133 (38%), Positives = 81/133 (60%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADD--SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           M + ++  +F ++K+ ++ +Y PYS F V +   +DD  ++ YG NVEN+SY   +C ER AI+ AVS G+     I +++ +    TPCG+CRQ + EF  S D ++Y+F+ +G Y   TI E+L   F   DL
  S:     1 MEKEDIEKLFQEVKKSLQYSYCPYSNFAVGACVVSDDKNTYIYGANVENASYGNCICAERVAITKAVSMGYTKFMAIGVMS-AKGRVTPCGICRQVIREF--SKDINVYMFHDDGGYDMKTIEELLPDSFGPDDL 132
>gi|89210866|ref|ZP_01189249.1| Cytidine deaminase, homotetrameric [Halothermothrix orenii H 168] >gi|89159506|gb|EAR79171.1| Cytidine deaminase, homotetrameric [Halothermothrix orenii H 168] (133 aa)
Score = 217, Expect = 1.9e-16, Identities = 47/129 (36%), Positives = 70/129 (54%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + T+  K +E  E +Y PYS F   A++   +   + G N+EN+SY +T C ER AI  AVS G+     + ++ D+     PCG CRQ + EF  S D  + + N  G  ++ T  E+L G F + DLD
  S:     5 IKTLIKKAREAREKSYSPYSNFATGAAVLTKEGKIFTGCNIENASYGLTNCAERTAIFKAVSEGYTEFEALAVVADTTRPVPPCGACRQVIREF--SPDMKVIMGNLSGNTVETTAKELLPGAFNRGDLD 132
>gi|158320286|ref|YP_001512793.1| cytidine deaminase [Alkaliphilus oremlandii OhILAs] >gi|158140485|gb|ABW18797.1| cytidine deaminase [Alkaliphilus oremlandii OhILAs] (140 aa)
Score = 216, Expect = 2.2e-16, Identities = 52/122 (42%), Positives = 75/122 (61%)
  Q:    13 LKEVIE---NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           ++E IE   NAYVPYSKF V A++   +   Y G N+E +SY  T C ER AI  AVS G +NI  I +++D + +  PCG+CRQ + E+    D  + I   E ++  YTI ++L   FT +DL+
  S:     7 VREAIEAKKNAYVPYSKFPVGAALLTKEGKVYRGCNIECASYGGTNCAERTAIFKAVSEGDRNIEAIAVVSDLDDYTYPCGICRQVIVEY--GRDIKLIIGKSEEEFKVYTINDLLPNSFTPEDLE 130
>gi|116181992|ref|XP_001220845.1| hypothetical protein CHGG_01624 [Chaetomium globosum CBS 148.51] >gi|88185921|gb|EAQ93389.1| hypothetical protein CHGG_01624 [Chaetomium globosum CBS 148.51] (172 aa)
Score = 216, Expect = 2.2e-16, Identities = 48/133 (36%), Positives = 74/133 (55%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK---NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++     T+    ++    AY PYS+FRV A++  A   +  G NVEN+SYPVT C ER A+  AV +G+        + + TD+   A+PCGMCRQF+ EF +     I +F+ +  Y+   + E+L   F   +L
  S:    22 LTPTEFTTLLAHAQDAKTRAYCPYSRFRVGAALLTAAGDYVLGANVENASYPVTTCAERVALGRAVVDGYHLRGGFRAVAVATDAGEPASPCGMCRQFIREFCDL-SVPIIMFDKDTNYVVMKLEELLPLSFGPDNL 157
>gi|126652810|ref|ZP_01724955.1| Cdd [Bacillus sp. B14905] >gi|126590346|gb|EAZ84466.1| Cdd [Bacillus sp. B14905] (137 aa)
Score = 215, Expect = 2.6e-16, Identities = 48/131 (36%), Positives = 73/131 (55%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           I+++ +  + K+  E AYVPYSKF+V A++        +G N+EN+ Y +T C ER A   AVS G      I ++ D+     PCG CRQ M EF  +    +Y+ N +G     ++GE+L   FT +DL+
  S:     3 IDMHALLEESKKAREKAYVPYSKFKVGAALLTKAGEVIHGCNIENAGYSMTNCAERTAFFKAVSEGTYEFEAIAIVADTEGPCAPCGACRQVMMEFC-APTMPVYLTNLKGDVTVTSVGELLPFAFTTEDLE 133
>gi|114770336|ref|ZP_01447874.1| cytidine deaminase [alpha proteobacterium HTCC2255] >gi|114549173|gb|EAU52056.1| cytidine deaminase [alpha proteobacterium HTCC2255] (131 aa)
Score = 215, Expect = 2.7e-16, Identities = 51/129 (39%), Positives = 73/129 (56%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           ++ + +  K V+ NA+VPYS F V ASI   D S   G NVEN+S+  T+C ER AIS+ ++ G   I  I +   ++T  TPCG+CRQ + EF    +  +   N +G Y   +I E+L   F   DLD
  S:     7 IDRLLVAAKSVMSNAHVPYSSFHVGASILYEDGSIEVGCNVENASFGATICAERTAISSGIAKGKTAIEAICVTNLTDTMVTPCGICRQVIWEF--GKNLPVICSNKDGDYKILSISELLPHAF---DLD 131
>gi|77406483|ref|ZP_00783538.1| cytidine deaminase [Streptococcus agalactiae H36B] >gi|77409387|ref|ZP_00786086.1| cytidine deaminase [Streptococcus agalactiae COH1] >gi|77411032|ref|ZP_00787387.1| cytidine deaminase [Streptococcus agalactiae CJB111] >gi|77413249|ref|ZP_00789446.1| cytidine deaminase [Streptococcus agalactiae 515] >gi|77160709|gb|EAO71823.1| cytidine deaminase [Streptococcus agalactiae 515] >gi|77162956|gb|EAO73912.1| cytidine deaminase [Streptococcus agalactiae CJB111] >gi|77171996|gb|EAO75166.1| cytidine deaminase [Streptococcus agalactiae COH1] >gi|77174918|gb|EAO77732.1| cytidine deaminase [Streptococcus agalactiae H36B] (138 aa)
Score = 215, Expect = 2.8e-16, Identities = 51/128 (39%), Positives = 74/128 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           M  I L  + +K  E   NAYVPYSKF V A++  A+   + G NVEN SY +  C ER AI  AVS G+K+ ++I +  ++    +PCG CRQ M EF  + +  + +    GK ++ T+GE+L   F
  S:    10 MGNIELKKLAVKASE---NAYVPYSKFPVGAALRTAEGKIFTGCNVENISYGLANCAERTAIFKAVSEGYKDFSEIAIYGNTEEPISPCGACRQVMVEFF-NKNAKVTLIAKNGKTVETTVGELLPYSF 134
>gi|126458639|ref|YP_001054917.1| cytidine deaminase [Pyrobaculum calidifontis JCM 11548] >gi|126248360|gb|ABO07451.1| cytidine deaminase [Pyrobaculum calidifontis JCM 11548] (127 aa)
Score = 215, Expect = 3.0e-16, Identities = 42/85 (49%), Positives = 56/85 (65%)
  Q:    14 KEVIENAYVPYSKFRVASICKA-DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           K V+ NAY PYSKF+VA+  K      Y GVNVEN+SY +T+C ER AI  AVS G ++I  + +  D++    PCG CRQ ++EF
  S:     9 KAVLNNAYAPYSKFKVAAAVKTRSGKVYTGVNVENASYGLTVCAERVAIFKAVSEGDRDIEVVAVYVDADEPVAPCGACRQVIAEF 94
>gi|46106109|ref|XP_380585.1| hypothetical protein FG00409.1 [Gibberella zeae PH-1] (162 aa)
Score = 215, Expect = 3.0e-16, Identities = 41/82 (50%), Positives = 55/82 (67%)
  Q:    21 YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           Y PYS+FRV A++  ++     G NVEN+SYPV  C ER A+ TAV++GH+    I + TD    A+PCGMCRQF+ EF + D
  S:    44 YCPYSQFRVGATVLSSEGKLTSGANVENASYPVGTCAERVALGTAVTSGHRGFRAIAVATDIAPPASPCGMCRQFIREFCKLD 126
>gi|54020100|ref|YP_115738.1| cytidine deaminase [Mycoplasma hyopneumoniae 232] >gi|53987273|gb|AAV27474.1| cytidine deaminase [Mycoplasma hyopneumoniae 232] (131 aa)
Score = 214, Expect = 3.9e-16, Identities = 46/125 (36%), Positives = 82/125 (65%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRVASI-CKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNG--HKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           +  IF++L+++ + AY PYS F VA+I       F+ GVNVEN+ +P T+C ER AI+ A+++G   K   +I++ + +++ F  PCG C Q  +EF  S+  SI+++N + ++ + T+ ++L  +F K
  S:     1 MKKIFLELEKLSKKAYCPYSDFAVAAILVTTSGQFFKGVNVENAVFPATICAERVAITQAIASGIEPKTFKEIHIYSPNTDKFIIPCGQCLQVCAEFF-SEKVSIFLYNSKSEFRERTLNQLLPNQFNK 128
>gi|126328515|ref|XP_001377496.1| PREDICTED: hypothetical protein [Monodelphis domestica] (393 aa)
Score = 214, Expect = 4.0e-16, Identities = 47/120 (39%), Positives = 65/120 (54%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +E  + AY PYS F V A++   D   + G N+EN+SYP+  C ER AI  A+S G+K    I + ++  N F  PCG CRQ M EF       +Y+   +G Y   T+ E+L   F   DL
  S:   270 QEAKKFAYCPYSNFPVGAALLTLDGKIFSGCNIENASYPLGTCAERTAIQKAISEGYKEFRAIAITSNMKNDFIAPCGACRQVMREF--GKHWYVYMTKEDGTYDVRTVHELLPASFGPDDL 389
>gi|116332953|ref|YP_794480.1| cytidine deaminase [Lactobacillus brevis ATCC 367] >gi|116098300|gb|ABJ63449.1| cytidine deaminase [Lactobacillus brevis ATCC 367] (130 aa)
Score = 213, Expect = 4.5e-16, Identities = 42/114 (36%), Positives = 67/114 (58%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           +++ AY PYS F V A+   A    Y G N+EN+S+  T C ER AI + ++ G  + T + +  +++    PCG+CRQ ++EF ++ D  IY+ N +G +   T+  IL G FT
  S:    14 MLDKAYTPYSHFHVGAAAVGASGKIYGGCNIENASFGATNCAERTAIFSGIAAGETHFTALLVTGNTDGPIAPCGICRQVIAEFFDA-DAPIYLTNQKGAFTATTVAAILPGAFT 127
>gi|22537114|ref|NP_687965.1| cytidine deaminase [Streptococcus agalactiae 2603V/R] >gi|25010995|ref|NP_735390.1| cytidine deaminase [Streptococcus agalactiae NEM316] >gi|76788280|ref|YP_329669.1| cytidine deaminase [Streptococcus agalactiae A909] >gi|22533975|gb|AAM99837.1|AE014235_10 cytidine deaminase [Streptococcus agalactiae 2603V/R] >gi|23095395|emb|CAD46600.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563337|gb|ABA45921.1| cytidine deaminase [Streptococcus agalactiae A909] (129 aa)
Score = 213, Expect = 4.7e-16, Identities = 51/128 (39%), Positives = 74/128 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           M  I L  + +K  E   NAYVPYSKF V A++  A+   + G NVEN SY +  C ER AI  AVS G+K+ ++I +  ++    +PCG CRQ M EF  + +  + +    GK ++ T+GE+L   F
  S:     1 MGNIELKKLAVKASE---NAYVPYSKFPVGAALRTAEGKIFTGCNVENISYGLANCAERTAIFKAVSEGYKDFSEIAIYGNTEEPISPCGACRQVMVEFF-NKNAKVTLIAKNGKTVETTVGELLPYSF 125
>gi|156373955|ref|XP_001629575.1| predicted protein [Nematostella vectensis] >gi|156216578|gb|EDO37512.1| predicted protein [Nematostella vectensis] (148 aa)
Score = 213, Expect = 4.9e-16, Identities = 47/116 (40%), Positives = 66/116 (56%)
  Q:    18 ENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E +Y PYSKFRV S +   D+  + G NVEN+SY + +C ER A+  AVS G +    I + TD   +  PCG CRQF++EF    D  +Y+ + +  Y    I ++L   FT  DL
  S:    29 EFSYSPYSKFRVGSAVLTNDNRIFTGCNVENASYGIGICAERTALVKAVSEGFRGFKAIAVCTDVAAYTGPCGACRQFIAEF--GLDIEVYMCSTDHSYQLLLIKDLLPRAFTPMDL 143
>gi|15828850|ref|NP_326210.1| cytidine deaminase (cytidine aminohydrolase) (CDA) [Mycoplasma pulmonis UAB CTIP] >gi|14089793|emb|CAC13552.1| CYTIDINE DEAMINASE (CYTIDINE AMINOHYDROLASE) (CDA) [Mycoplasma pulmonis] (112 aa)
Score = 213, Expect = 4.9e-16, Identities = 49/105 (46%), Positives = 69/105 (65%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRVASIC--KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFN 110
           +N I+ +LK ++E +Y PYSKF+VASI   K    F  GVNVEN++YP  +C ER+A+  A+S+G K  +I  IY+ + SN    PC  CRQ M+E M+ +   I I N
  S:     1 MNEIYNELKTLLEKSYSPYSKFKVASIVLDKGGKKFK-GVNVENAAYPSGICAERSALFGAISHGFKPGSIDKIYIFSSSNEPIAPCLGCRQVMTELMDENALVILISN 108
>gi|55820858|ref|YP_139300.1| cytidine deaminase [Streptococcus thermophilus LMG 18311] >gi|55822774|ref|YP_141215.1| cytidine deaminase [Streptococcus thermophilus CNRZ1066] >gi|55736843|gb|AAV60485.1| cytidine deaminase [Streptococcus thermophilus LMG 18311] >gi|55738759|gb|AAV62400.1| cytidine deaminase [Streptococcus thermophilus CNRZ1066] (114 aa)
Score = 213, Expect = 5.0e-16, Identities = 46/108 (42%), Positives = 64/108 (59%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           M +  ++ I  + +E   NAYVPYS FRV A++   D   Y G N+EN+S+ +T C ER AI  AVS GH++   I +  D+    +PCG CRQ M+EF + D   I I
  S:     5 MVDTEISQIIEEAEEAAGNAYVPYSHFRVGAALLTNDGQMYKGCNIENASFGLTNCAERTAIFKAVSEGHRDFEMIVVYGDTEQPISPCGACRQVMAEFFKQDSKVILI 113
>gi|47227442|emb|CAG04590.1| unnamed protein product [Tetraodon nigroviridis] (130 aa)
Score = 213, Expect = 5.1e-16, Identities = 46/114 (40%), Positives = 68/114 (59%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYS F V A++  AD +   G NVEN+S+ +T+C ER A+  AV  GH+  T I +  D  ++F  PCG CRQ + EF    D ++Y+   +G Y + ++ E+L   FT + L
  S:    15 AYCPYSHFPVGAALLTADGAIVTGCNVENASFGLTVCAERVAVQRAVVEGHRRFTAIAVTCDIEDSFVGPCGACRQVLMEF--GSDWTVYLTKPDGSYRRTSLRELLPLAFTPEHL 128
>gi|56421024|ref|YP_148342.1| cytidine deaminase [Geobacillus kaustophilus HTA426] >gi|56380866|dbj|BAD76774.1| cytidine deaminase [Geobacillus kaustophilus HTA426] (140 aa)
Score = 213, Expect = 5.1e-16, Identities = 46/130 (35%), Positives = 71/130 (54%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + +  + ++ K+  E AYVPYSKF V A++     S Y G N+EN++Y V  C ER A+  A S G K  T + ++ D+     PCG CRQ ++E     D  + + N +G     T+ E+L   F+ +DL
  S:     9 VEIEQLIVEAKKARELAYVPYSKFPVGAALLTKGGSVYRGCNIENAAYSVCNCAERTALFKAYSEGEKEFTALAVIADTPRPVPPCGACRQVIAELCHG-DMKVILANLKGDVKVMTVSELLPEAFSAEDL 138
>gi|119946491|ref|YP_944171.1| CMP/dCMP deaminase, zinc-binding [Psychromonas ingrahamii 37] >gi|119865095|gb|ABM04572.1| cytidine deaminase [Psychromonas ingrahamii 37] (135 aa)
Score = 212, Expect = 5.9e-16, Identities = 50/124 (40%), Positives = 78/124 (62%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKN--ITDIYLLTDSNT----FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           F +LK++++NA  PYS F VA+I    + + Y GVNVE+++YP T+C ERNAI TAV+ G K   + +I+L+  +       A PCG CRQ ++E    +D  +Y +    +  +++I E+L   F   DL
  S:     6 FTELKKLLDNAQAPYSGFNVAAIVITRNGNLYKGVNVESAAYPTTICAERNAIHTAVTEGMKKGEVKEIHLIARNAAKALIKAQPCGGCRQVIAE-QSGNDAIVYSYASALEIEQHSINELLPFAFLGDDL 135
>gi|154686790|ref|YP_001421951.1| hypothetical protein RBAM_023600 [Bacillus amyloliquefaciens FZB42] >gi|154352641|gb|ABS74720.1| Cdd [Bacillus amyloliquefaciens FZB42] (136 aa)
Score = 212, Expect = 6.0e-16, Identities = 46/116 (39%), Positives = 66/116 (56%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + AYVPYS FRV A++   D   Y G N+EN++Y +  C ER AI  AVS G      + +  D+    +PCG CRQ +SE   S D  + + N +G+  + T  E+L G F+ +DL
  S:    15 DTAYVPYSNFRVGAALLTKDGKVYRGCNIENAAYSMCNCAERTAIFKAVSEGDTEFAMLAVAADTPGPVSPCGACRQVISELC-SKDMLVILTNLQGQIKEMTAEELLPGAFSSEDL 130
>gi|126733253|ref|ZP_01749000.1| Cytidine deaminase [Roseobacter sp. CCS2] >gi|126716119|gb|EBA12983.1| Cytidine deaminase [Roseobacter sp. CCS2] (149 aa)
Score = 212, Expect = 6.3e-16, Identities = 45/115 (39%), Positives = 65/115 (56%)
  Q:    14 KEVIENAYVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           + V ENAY PYSKF+V +  K A  + Y G NVEN +YP   C E  AI+  V+ G   I +I ++ DS    +PCG CRQ ++EF +  D  + +   +G   + T+  +L G F
  S:    27 RAVRENAYAPYSKFKVGAALKTASGTVYTGCNVENVAYPEGTCAEAGAIAAMVAGGDTTIAEIAVIADSPKPVSPCGGCRQKIAEFAQG-DVKVTLATTDGVVHETTVAALLPGSF 141
>gi|146297317|ref|YP_001181088.1| cytidine deaminase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410893|gb|ABP67897.1| cytidine deaminase [Caldicellulosiruptor saccharolyticus DSM 8903] (135 aa)
Score = 212, Expect = 7.2e-16, Identities = 46/112 (41%), Positives = 69/112 (61%)
  Q:     1 MSEIN--LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWE 112
           ++EI+  L +I    KE    AY PYS F+V A++       Y G N+EN+SY +T+C ER A+  A+S GHK+I  I+++   N   +PCG CRQ M E   + D +IY+ N++
  S:     4 LTEIDNTLKSILNLAKEQQSRAYAPYSNFKVGAAVLTQSGKMYLGCNIENASYSLTICAERVALFKAISEGHKDIKTIFVIGPQNEPISPCGACRQVMLEL--AKDATIYLSNYD 116
>gi|88772680|gb|EAR03959.1| Cytidine deaminase [Alteromonas macleodii 'Deep ecotype'] (149 aa)
Score = 211, Expect = 7.6e-16, Identities = 43/117 (36%), Positives = 68/117 (58%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +N++ PYS F+V A++       + G NVE++++P+  C E  AI   V+ G K IT I + + +N F  PCG CRQ ++EF   D+  + + +  G+  + TIGE+L   F   DLD
  S:    32 KNSHSPYSNFKVGAAVLTPSGETFAGCNVESAAFPLGQCAEATAIGNMVTQGQKRITHIVIASPNNEFCFPCGGCRQKIAEF-APDETPVTMVSQSGEKFETTIGELLPNAFRAHDLD 148
>gi|6478520|gb|AAF13876.1|AF187304_1 cytidine deaminase [Bacillus caldolyticus] >gi|5689607|emb|CAB51902.1| cytidine deaminase [Bacillus caldolyticus] (132 aa)
Score = 211, Expect = 7.8e-16, Identities = 46/130 (35%), Positives = 71/130 (54%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + +  + ++ K+  E AYVPYSKF V A++     S Y G N+EN++Y V  C ER A+  A S G K  T + ++ D+     PCG CRQ ++E     D  + + N +G     T+ E+L   F+ +DL
  S:     1 MEIEQLIVEAKKARELAYVPYSKFPVGAALLTKGGSVYRGCNIENAAYSVCNCAERTALFKAYSEGEKEFTALAVIADTPRPVPPCGACRQVIAELCHG-DMKVILANLKGDVKVMTVSELLPEAFSAEDL 130
>gi|104774145|ref|YP_619125.1| cytidine deaminase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514235|ref|YP_813141.1| cytidine deaminase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423226|emb|CAI98054.1| Cytidine deaminase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093550|gb|ABJ58703.1| cytidine deaminase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (139 aa)
Score = 211, Expect = 8.5e-16, Identities = 46/125 (36%), Positives = 78/125 (62%)
  Q:     9 IFIKLKEVIENAYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK-NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +F+  K+ + +AY PYS F VAS    D    + GVN+ENSS+ +T C ER AI + V+ G    I  + ++ +++   +PCG CRQ MSEFM + +  + + + +G Y ++T+ +++   FT+KD+
  S:     8 LFLLAKDHLADAYSPYSHFHVASALVTDAGEIFTGVNIENSSFGLTNCAERTAIFSWVNAGRTGKIKCLLIIGNTDRPISPCGACRQVMSEFM-APETEVILTDSQGDYERFTVEQLIPYHFTEKDI 133
>gi|126273634|ref|XP_001387274.1| hypothetical protein PICST_39066 [Pichia stipitis CBS 6054] >gi|126213144|gb|EAZ63251.1| predicted protein [Pichia stipitis CBS 6054] (151 aa)
Score = 210, Expect = 1.1e-15, Identities = 46/129 (35%), Positives = 75/129 (58%)
  Q:     8 TIFIKLKEVIENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           T+  K+ E  + +Y PYSKFRV  ++      +  G N+EN+SY   +C ER AIS A+  G++    I + +DS    +PCG+CRQF+ EF    +  IY+F  +G +IK  + ++L   F  ++L ++
  S:    20 TLKQKVLEARDLSYSPYSKFRVGCTLITESGQYVSGANIENASYGACICAERTAISKALLEGNRKFKVIAISSDSKEPISPCGICRQFIREF--GPNVPIYMFGADGSFIKVFLQDLLPLSFGPENLGVN 147
>gi|156050789|ref|XP_001591356.1| hypothetical protein SS1G_07982 [Sclerotinia sclerotiorum 1980] >gi|154692382|gb|EDN92120.1| hypothetical protein SS1G_07982 [Sclerotinia sclerotiorum 1980] (217 aa)
Score = 210, Expect = 1.2e-15, Identities = 50/133 (37%), Positives = 77/133 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNI--TDIYLLTD--SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++   L T+  +       AY PYS+FRV A+I   +  +  G NVEN++YPV  C ER A   AV+ G + +    + L TD   +  A+PCGMCRQF+ EF +  D  I++F+ +GK++   + E+L   F  + L
  S:    24 LTPTELTTLQTRSSAAKLTAYCPYSRFRVGATILTKNGEYIDGANVENAAYPVGTCAERVAFGKAVTGGSREVGFKALGLSTDGSGDVPASPCGMCRQFIREFCDL-DMPIFMFDNDGKFVVAKLEELLPMSFGPEAL 160
>gi|52081077|ref|YP_079868.1| cytidine/deoxycytidine deaminase [Bacillus licheniformis ATCC 14580] >gi|52786456|ref|YP_092285.1| hypothetical protein BLi02721 [Bacillus licheniformis ATCC 14580] >gi|52004288|gb|AAU24230.1| cytidine/deoxycytidine deaminase [Bacillus licheniformis ATCC 14580] >gi|52348958|gb|AAU41592.1| Cdd [Bacillus licheniformis DSM 13] (136 aa)
Score = 209, Expect = 1.3e-15, Identities = 45/116 (38%), Positives = 68/116 (58%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AYVPYSKF+V A++   D   Y G N+EN++Y +  C ER A+  A S G K+   + +  D+    +PCG CRQ +SE   S +  + + N  G+  + T+ E+L G F+ +DL
  S:    15 EFAYVPYSKFKVGAALLTEDGKVYKGCNIENAAYSLCNCAERTALFKAYSEGEKSFKMLAVAADTPGPVSPCGACRQVISELC-SPNMPVILTNLNGQVKEMTVQELLPGAFSSEDL 130
>gi|23099206|ref|NP_692672.1| cytidine:deoxycytidine deaminase [Oceanobacillus iheyensis HTE831] >gi|22777434|dbj|BAC13707.1| cytidine:deoxycytidine deaminase [Oceanobacillus iheyensis HTE831] (133 aa)
Score = 208, Expect = 1.7e-15, Identities = 48/131 (36%), Positives = 70/131 (53%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +N N +     + +++AYVPYS F V A++       Y G N+EN++YPVT C ER AI  A+S G     ++ +  ++     PCG CRQ MSEF  S    I++ N   +    TI E+L   F   DL+
  S:     1 MNKNQLLDASLKAMDSAYVPYSTFPVGAALLTKSGKLYTGCNIENAAYPVTCCAERVAIFKAISEGETQFAEMAVAANTKRPVPPCGSCRQVMSEFFTS-SMKIHLTNLNKEVKTLTIEELLPFSFQPDDLE 131
>gi|126464981|ref|YP_001040090.1| cytidine deaminase [Staphylothermus marinus F1] >gi|126013804|gb|ABN69182.1| cytidine deaminase [Staphylothermus marinus F1] (134 aa)
Score = 208, Expect = 2.1e-15, Identities = 39/98 (39%), Positives = 65/98 (66%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           + ++N++ +  K K V++N+Y PYS   VA+ +   ++S + GVNVEN+SY +T+C ER+AIS  V+ G +    + ++TD +    PCG CRQ ++EF
  S:     2 VEKLNIDFLIEKAKSVLKNSYAPYSGVHVAAAVLTRNNSVFLGVNVENASYGLTICAERSAISAMVTAGEREPIAVAIVTDLDNPIPPCGACRQVIAEF 100
>gi|114765139|ref|ZP_01444284.1| Cytidine deaminase [Roseovarius sp. HTCC2601] >gi|114542543|gb|EAU45569.1| Cytidine deaminase [Roseovarius sp. HTCC2601] (130 aa)
Score = 207, Expect = 2.2e-15, Identities = 46/121 (38%), Positives = 68/121 (56%)
  Q:    14 KEVIENAYVPYSKFRVASICKA-DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           ++V ENAYVPYS+F+V +  +A     Y G NVEN +YP   C E  AI+  V+ G   I + Y++ DS     PCG CRQ ++EF    D  + +   +G  ++ T+ E+L G F    +D
  S:     8 RDVRENAYVPYSRFKVGAALRAPSGKIYAGCNVENVAYPEGTCAEAGAIAAMVAAGETEIVEAYVIADSAHPVPPCGGCRQKLAEFARG-DTRVTLATVDGGTLETTVAELLPGAFGADHMD 128
>gi|50364958|ref|YP_053383.1| cytidine deaminase [Mesoplasma florum L1] >gi|50363514|gb|AAT75499.1| cytidine deaminase [Mesoplasma florum L1] (135 aa)
Score = 207, Expect = 2.3e-15, Identities = 49/125 (39%), Positives = 76/125 (60%)
  Q:     9 IFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +F +L ++ +N+Y PYS F+VA +   +++    GVNVEN++YP T+C ER A+S   S G+K  +I  + L TDS +  +PCG+CRQ +SE +      I I+N  G  ++  I E+L   F    L
  S:     7 VFKELLKLKDNSYSPYSNFKVACLIYLNNNEIIKGVNVENAAYPATICAERTALSQVYSLGYKKEDIKSLELYTDSESLGSPCGVCRQVISELVNW-TTPISIYNKNGFQLETNINELLPHAFEPAQL 133
>gi|157151580|ref|YP_001450370.1| cytidine deaminase [Streptococcus gordonii str. Challis substr. CH1] >gi|157076374|gb|ABV11057.1| cytidine deaminase [Streptococcus gordonii str. Challis substr. CH1] (129 aa)
Score = 207, Expect = 2.3e-15, Identities = 45/115 (39%), Positives = 66/115 (57%)
  Q:    15 EVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           E  +NAYVPYS F + ++  A D   + GVNVEN+S+ +T CGER AI  AVS G     ++ +   +    +PCG CRQ M+EF +  D  + +   +   +  T+GE+L   FT
  S:    12 ETSKNAYVPYSHFPIGAVLVAKDGRLFTGVNVENASFGLTNCGERTAIFKAVSEGALEFEELIVYGQTEKPISPCGACRQVMAEFFDK-DLKVTLVAKDKSTVVMTVGELLPYSFT 126
>gi|15807171|ref|NP_295900.1| cytidine deaminase [Deinococcus radiodurans R1] >gi|6459978|gb|AAF11726.1|AE002051_2 cytidine deaminase [Deinococcus radiodurans R1] (157 aa)
Score = 207, Expect = 2.6e-15, Identities = 42/115 (36%), Positives = 67/115 (58%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +   + AY PYSKFRV A++   D   ++G NVENSS+ +T C E++A+    + G +  TD+ + T+++  ATPCG CRQ + EF  + D  +   N +G+ I   + + L   F
  S:    31 QAAFKQAYAPYSKFRVGAALRTPDGQVFFGANVENSSFGLTRCAEQSAVQALATAGGRTFTDLVVYTEASPPATPCGACRQILFEF--APDARVVCTNAQGEVISGLVRDFLPHGF 144
>gi|16079584|ref|NP_390408.1| cytidine/deoxycytidine deaminase [Bacillus subtilis subsp. subtilis str. 168] >gi|116041|sp|P19079|CDD_BACSU Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|20663960|pdb|1JTK|A Chain A, Crystal Structure Of Cytidine Deaminase From Bacillus Subtilis In Complex With The Inhibitor Tetrahydrodeoxyuridine >gi|20663961|pdb|1JTK|B Chain B, Crystal Structure Of Cytidine Deaminase From Bacillus Subtilis In Complex With The Inhibitor Tetrahydrodeoxyuridine >gi|606744|gb|AAB59993.1| cytidine deaminase >gi|1303825|dbj|BAA12481.1| Cdd [Bacillus subtilis] >gi|2634962|emb|CAB14459.1| cytidine/deoxycytidine deaminase [Bacillus subtilis subsp. subtilis str. 168] >gi|6018365|emb|CAB57856.1| cytidine deaminase [Bacillus subtilis] >gi|227058|prf||1613422B cytidine/deoxycitidine deaminase (136 aa)
Score = 206, Expect = 3.0e-15, Identities = 43/114 (37%), Positives = 66/114 (57%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYSKF+V A++   D   Y G N+EN++Y +  C ER A+  AVS G      + +  D+    +PCG CRQ +SE   + D  + + N +G+  + T+ E+L G F+ +DL
  S:    17 AYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELC-TKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDL 130
>gi|157693030|ref|YP_001487492.1| cytidine deaminase [Bacillus pumilus SAFR-032] >gi|157681788|gb|ABV62932.1| cytidine deaminase [Bacillus pumilus SAFR-032] (132 aa)
Score = 206, Expect = 3.2e-15, Identities = 43/115 (37%), Positives = 71/115 (61%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           AYVPYSKF+V A++   D + Y G N+EN++Y +  C ER A+  A S G  +   + ++ D++   +PCG CRQ +SE   + D  + + N +G+  + T+ E+L G F+ +DL+
  S:    17 AYVPYSKFKVGAALLSNDGTVYGGCNIENAAYGMCNCAERTALFKAYSEGITSFQMLAVVADTDRPVSPCGACRQVISELC-APDMPVILTNLKGQIYETTVNELLPGAFSPEDLN 131
>gi|87120433|ref|ZP_01076328.1| hypothetical protein MED121_09578 [Marinomonas sp. MED121] >gi|86164536|gb|EAQ65806.1| hypothetical protein MED121_09578 [Marinomonas sp. MED121] (136 aa)
Score = 206, Expect = 3.5e-15, Identities = 45/120 (37%), Positives = 69/120 (57%)
  Q:    15 EVIENAYVPYSKFRVASICKA-DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + +  AYVPYS+F+V ++ +  +   Y G NVEN++YP   C E  AIS  V +G + I +IY+L +     TPCG CRQ + EF  + D  I+I   EG     ++ E+L   F  ++L+
  S:    16 KAMSKAYVPYSEFKVGAVIETLNGKVYSGCNVENAAYPEGTCAEAGAISAMVLDGEQKIDNIYVLGNGEQLVTPCGGCRQKIREF-STPDTQIHICGPEGVRKTLSMEELLPFSFGPENLN 135
>gi|150021384|ref|YP_001306738.1| cytidine deaminase [Thermosipho melanesiensis BI429] >gi|149793905|gb|ABR31353.1| cytidine deaminase [Thermosipho melanesiensis BI429] (129 aa)
Score = 206, Expect = 3.5e-15, Identities = 46/116 (39%), Positives = 67/116 (57%)
  Q:    19 NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           NAY PYS F+V A++       Y G NVEN+SY +T C ER A+  AVS G K    + ++ D+    +PCG CRQ M+EF    + ++ +   +GK  K ++ E+L   F K+ LD
  S:    15 NAYAPYSNFKVGAALLTKSGKIYTGSNVENASYGLTCCAERVAVFKAVSEGEKEFDTLVVVGDTEEPISPCGACRQVMAEF---GNFNVILVGKDGKIKKTSVEELLPYHFKKEHLD 128
>gi|110764733|ref|XP_001122944.1| PREDICTED: similar to CG8360-PA [Apis mellifera] (148 aa)
Score = 205, Expect = 3.7e-15, Identities = 53/126 (42%), Positives = 74/126 (58%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD--SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYI-KYTIGEILKGRF 128
           E ++ ++  K   V E +Y PYSKF+V A+I   D S + G NVEN+SYPV  C ER AI  AVS G +    + ++ D  +N F TPCG CRQ ++EF    D  IY+   + K + K T+  +L   F
  S:    13 EPDIQSLIKKTIAVREYSYSPYSKFKVGAAILCDDGSIFTGCNVENASYPVGTCAERTAIVKAVSEGKRKFKVLTVVADKKNNIFTTPCGFCRQAIAEF---GDILIYLTGPDMKNVLKTTLSNLLPHAF 139
>gi|71893509|ref|YP_278955.1| cytidine deaminase [Mycoplasma hyopneumoniae J] >gi|71851636|gb|AAZ44244.1| cytidine deaminase [Mycoplasma hyopneumoniae J] (131 aa)
Score = 205, Expect = 3.8e-15, Identities = 45/125 (36%), Positives = 81/125 (64%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRVASI-CKADDSFYYGVNVENSSYPVTLCGERNAISTAVSN--GHKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           +  IF++L+++ + AY PYS F VA+I       F+ GVNVEN+ +P T+C ER AI+ A+++    K   +I++ + +++ F  PCG C Q  +EF  S+  SI+++N + ++ + T+ ++L  +F K
  S:     1 MKKIFLELEKLSKKAYCPYSGFAVAAILVTTSGQFFKGVNVENAVFPATICAERVAITQAIASEIEPKTFKEIHIYSPNTDKFIIPCGQCLQVCAEFF-SEKVSIFLYNSKSEFRERTLNQLLPNQFNK 128
>gi|125985693|ref|XP_001356610.1| GA21017-PA [Drosophila pseudoobscura] >gi|195147778|ref|XP_002014851.1| GL18729 [Drosophila persimilis] >gi|54644934|gb|EAL33674.1| GA21017-PA [Drosophila pseudoobscura] >gi|194106804|gb|EDW28847.1| GL18729 [Drosophila persimilis] (158 aa)
Score = 205, Expect = 4.7e-15, Identities = 39/93 (41%), Positives = 56/93 (60%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS-NTFATPCGMCRQFMSEFMESDDCSIY 107
           E  + AY PYS F V A++  +D S Y G N+EN +Y  ++C ER A   A+S G ++     ++    N F TPCG+CRQF+SEF+   D  +Y
  S:    34 EARKQAYCPYSNFAVGAALRTSDGSIYTGCNIENGAYAASICAERTAAVKAISEGKRDFVACAVVAQQDNGFTTPCGVCRQFLSEFVNGKDIPLY 128
>gi|42781047|ref|NP_978294.1| cytidine deaminase [Bacillus cereus ATCC 10987] >gi|42736968|gb|AAS40902.1| cytidine deaminase [Bacillus cereus ATCC 10987] (131 aa)
Score = 204, Expect = 5.6e-15, Identities = 43/119 (36%), Positives = 73/119 (61%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++E AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF E     + + N +G   + T+ ++L G F+ +DL
  S:    12 KMLEKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFCEP-KMPVLLTNVKGDEKEVTVEQLLPGAFSIQDL 130
>gi|123439245|ref|XP_001310396.1| cytidine deaminase family protein [Trichomonas vaginalis G3] >gi|121892164|gb|EAX97466.1| cytidine deaminase family protein [Trichomonas vaginalis G3] (138 aa)
Score = 204, Expect = 5.6e-15, Identities = 48/116 (41%), Positives = 69/116 (59%)
  Q:    18 ENAYVPYSKFRVAS--ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +N YVPYS + V++  +CK D +   GVNVEN SYP   C ER+AI  AVSNGH++   I + +   + F  PCGMCRQ ++E+    +  +      G+  +Y I ++L   FT  DL
  S:    22 KNCYVPYSHYPVSAALLCK-DGTIVLGVNVENCSYPNGCCAERSAIFGAVSNGHRDFVSILITSKMGDDFILPCGMCRQVIAEW---GNLEVISTKGNGEIKRYHISDLLPEAFTPADL 136
>gi|50427001|ref|XP_462105.1| hypothetical protein DEHA0G13915g [Debaryomyces hansenii CBS767] >gi|49657775|emb|CAG90591.1| unnamed protein product [Debaryomyces hansenii CBS767] (149 aa)
Score = 204, Expect = 5.7e-15, Identities = 46/117 (39%), Positives = 72/117 (61%)
  Q:    19 NAYVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAISTAV-SNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEG-KYIKYTIGEILKGRFTKKDLDL 135
           +AY PYSKFRV  + + +    + G NVEN+SY   +C ER  I+ AV + GHK +  I +  DS    +PCG+CRQF+ EF    +  +++FN +G K+IK  + ++L   F  ++L +
  S:    27 SAYCPYSKFRVGCVLETSTGKRFTGANVENASYGAGICAERATITKAVQTEGHKKLKLIAISGDSEEPISPCGICRQFIREF--GPNVPVFMFNLDGSKFIKVFLQDLLPLSFGPENLGI 144
>gi|89100469|ref|ZP_01173331.1| cytidine deaminase [Bacillus sp. NRRL B-14911] >gi|89084812|gb|EAR63951.1| cytidine deaminase [Bacillus sp. NRRL B-14911] (132 aa)
Score = 204, Expect = 5.9e-15, Identities = 44/121 (36%), Positives = 69/121 (57%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K+  + AYVPYS F V A++   D   Y+G N+EN++Y +  C ER A+  A S G K  T + ++ D+     PCG CRQ +SE    +   + + N +G   + T+ E+L G F+ +DL+
  S:    11 KKARDKAYVPYSNFPVGAALLTEDGKIYHGCNIENAAYSMCNCAERTALFKAYSEGDKKYTAMAVVADTERPVPPCGACRQVISELC-PNTMKVVLANLKGDINELTVEELLPGAFSPEDLN 131
>gi|145511570|ref|XP_001441707.1| hypothetical protein GSPATT00010509001 [Paramecium tetraurelia strain d4-2] >gi|124408968|emb|CAK74310.1| unnamed protein product [Paramecium tetraurelia] (144 aa)
Score = 204, Expect = 5.9e-15, Identities = 49/118 (41%), Positives = 69/118 (58%)
  Q:    18 ENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF-MESDDCSIYIFNWEGKYIKYTIG-EILKGRFTKKDLDL 135
           E AY PYS FRV  S+   ++  Y G NVEN+SY + +C ER AI  AVS G + I+ I + +D++    PCGMCRQ + EF    +D  I     +    KY+ G E++   F  KDL++
  S:    17 ERAYCPYSNFRVGCSLLTKNNKLYTGCNVENASYGLCVCAERVAICKAVSEGDRQISTIVVSSDTDEPTFPCGMCRQTIIEFCYPGNDIKIIAIGKDHTKPKYSKGTEVIPFAFVPKDLNV 137
>gi|116617561|ref|YP_817932.1| cytidine deaminase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096408|gb|ABJ61559.1| cytidine deaminase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (129 aa)
Score = 203, Expect = 6.4e-15, Identities = 41/114 (35%), Positives = 66/114 (57%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           + + + Y PYS F V A++   +   + GVN+EN S+ +T C ER AI TA++ G ++   + +   ++    PCG CRQ M EF +  D  I++ N +GK I+  I E++ G F
  S:    12 QALNDTYTPYSHFPVGAALLGENGEIFKGVNIENVSFGLTNCAERTAIFTAIAAGQRHFHGLVISGRTDEPIAPCGACRQVMVEFFDP-DMPIWLINDQGKEIETNIAELMPGSF 125
>gi|24379554|ref|NP_721509.1| cytidine deaminase [Streptococcus mutans UA159] >gi|24377498|gb|AAN58815.1|AE014949_8 putative cytidine deaminase [Streptococcus mutans UA159] (128 aa)
Score = 203, Expect = 6.6e-15, Identities = 42/111 (37%), Positives = 65/111 (58%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +NAYVPYS F + +  K      Y G N+EN+S+ +T CGER AI  A+S G++++ +I +  ++    +PCG CRQ M+EF E     + +    GK +  T+ E+L   F
  S:    14 KNAYVPYSHFPIGAALKTKSGKIYQGCNIENASFGLTNCGERTAIFKAISEGYRDLEEIAIYGETQKPISPCGACRQVMAEFFEP-SAKVTLIAKGGKTVVMTVEELLPYSF 124
>gi|31544787|ref|NP_853365.1| hypothetical protein MGA_0361 [Mycoplasma gallisepticum R] >gi|31541633|gb|AAP56933.1| Cdd [Mycoplasma gallisepticum R] (144 aa)
Score = 203, Expect = 6.8e-15, Identities = 52/122 (42%), Positives = 78/122 (63%)
  Q:    12 KLKEVIENAYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKN----ITDIYLLTDSN-TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           +L  +++ AY  YS F VA I   D +  Y GVNVE +SYP+TLC ERNAI T +++ + +    I  I+L++DSN + A+PCGMCRQ + EF  SDD ++    ++ +  K Y   ++L   F  K +
  S:    15 ELLRLLDKAYCVYSNFHVACILVDDQNKEYQGVNVEFASYPITLCAERNAIGTMITSSNSDHLPVIKQIHLMSDSNDSNASPCGMCRQALWEF--SDDSTLITIYYKNQTKKTYQFKQLLPLGFNHKAM 141
>gi|81096737|ref|ZP_00875070.1| Cytidine deaminase, homotetrameric [Streptococcus suis 89/1591] >gi|80977212|gb|EAP40762.1| Cytidine deaminase, homotetrameric [Streptococcus suis 89/1591] (129 aa)
Score = 203, Expect = 7.1e-15, Identities = 43/112 (38%), Positives = 69/112 (61%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           + AYVPYSKF V+++  A+    + GVN+EN+S+ +T C ER AI  A+S G K+ ++I +   +    +PCG CRQ M+EF +  D  + +   +   ++ T+GE+L   FT
  S:    15 QKAYVPYSKFPVSAVLVAETGEIFTGVNIENASFGLTNCAERTAIFKAISEGVKDFSEIVIYGKTEKPISPCGACRQVMAEFFDK-DLKVTLVAKDKSTVETTVGELLPYSFT 126
>gi|56697768|ref|YP_168138.1| cytidine deaminase [Silicibacter pomeroyi DSS-3] >gi|56679505|gb|AAV96171.1| cytidine deaminase [Silicibacter pomeroyi DSS-3] (130 aa)
Score = 203, Expect = 7.6e-15, Identities = 47/119 (39%), Positives = 69/119 (57%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           V ENA+ PYS+F+V A+I  A    Y G NVEN +YP   C E  AI+  V+ G   ++++Y++ DS     PCG CRQ ++EF +  D  + + N +G     TIG++L G F    +D
  S:    10 VRENAHAPYSRFKVGAAIRGASGVVYAGCNVENIAYPEGTCAEAGAIAAMVAAGETRLSEVYVVADSPAPVPPCGGCRQKLAEFGDP-DVVVTMANLDGVETAMTIGQLLPGAFGAAHMD 128
>gi|146318738|ref|YP_001198450.1| cytidine deaminase [Streptococcus suis 05ZYH33] >gi|146320942|ref|YP_001200653.1| cytidine deaminase [Streptococcus suis 98HAH33] >gi|145689544|gb|ABP90050.1| Cytidine deaminase [Streptococcus suis 05ZYH33] >gi|145691748|gb|ABP92253.1| Cytidine deaminase [Streptococcus suis 98HAH33] (134 aa)
Score = 202, Expect = 8.3e-15, Identities = 43/112 (38%), Positives = 68/112 (60%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           + AYVPYSKF V+++  A     + GVN+EN+S+ +T C ER AI  A+S G K+ ++I +   +    +PCG CRQ M+EF +  D  + +   +   ++ T+GE+L   FT
  S:    20 QKAYVPYSKFPVSAVLVAKTGEIFTGVNIENASFGLTNCAERTAIFKAISEGVKDFSEIIIYGKTEKPISPCGACRQVMAEFFDK-DLKVTLVAKDKSTVETTVGELLPYSFT 131
>gi|47459182|ref|YP_016044.1| cytidine deaminase [Mycoplasma mobile 163K] >gi|47458511|gb|AAT27833.1| cytidine deaminase [Mycoplasma mobile 163K] (142 aa)
Score = 202, Expect = 1.0e-14, Identities = 45/94 (47%), Positives = 65/94 (69%)
  Q:     9 IFIKLKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGH-----KN--ITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           IF KLK  ++ AY  YS F VA+I + ++  Y+G N+ENSSYP  +C ER+A+  A +N H     KN  I  IY++++ N +  PCGMC Q MSEF+ ++
  S:     8 IFKKLKNHLDKAYARYSNFHVAAIVEKNNKQYFGFNIENSSYPAGICAERSAL-FAFANDHDWSFNKNHKIDAIYIISNLNDYIVPCGMCLQVMSEFLTNE 107
>gi|109897117|ref|YP_660372.1| cytidine deaminase [Pseudoalteromonas atlantica T6c] >gi|109699398|gb|ABG39318.1| cytidine deaminase [Pseudoalteromonas atlantica T6c] (132 aa)
Score = 202, Expect = 1.1e-14, Identities = 44/128 (34%), Positives = 72/128 (56%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
           + +L ++F    +V   A+ PYS +RV S   A+D   Y G NVEN S+P+  C E NA++  V+ G + + +I + + +  F +PCG CRQ + EF  S D  +++   EG+    ++ EIL   F +
  S:     5 QTDLQSLFNAALDVQAKAHAPYSDYRVGSALVAEDGKTYTGCNVENVSFPLGQCAEGNALAAMVAGGARQVREILIASPNEHFCSPCGGCRQRIFEF-ASKDTLVHMATSEGEIKTLSMNEILPFAFEQ 132
>gi|49259414|pdb|1UX0|A Chain A, Bacillus Subtilis Cytidine Deaminase With An Arg56- Gln Substitution >gi|49259415|pdb|1UX0|B Chain B, Bacillus Subtilis Cytidine Deaminase With An Arg56- Gln Substitution (136 aa)
Score = 201, Expect = 1.1e-14, Identities = 42/114 (36%), Positives = 66/114 (57%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYSKF+V A++   D   Y G N+EN++Y +  C E+ A+  AVS G      + +  D+    +PCG CRQ +SE   + D  + + N +G+  + T+ E+L G F+ +DL
  S:    17 AYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAEQTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELC-TKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDL 130
>gi|116624316|ref|YP_826472.1| cytidine deaminase [Solibacter usitatus Ellin6076] >gi|116227478|gb|ABJ86187.1| cytidine deaminase [Solibacter usitatus Ellin6076] (131 aa)
Score = 201, Expect = 1.1e-14, Identities = 43/110 (39%), Positives = 60/110 (54%)
  Q:    19 NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           NA+ PYSKF V A+I   D   + G NVEN++Y +TLC ER A+  A+S G +    + +  D+ T   PCG CRQ + EF    D  + + N  GK   Y + E+    F
  S:    18 NAFAPYSKFLVGAAIEDVDGRVHTGCNVENATYGLTLCAERVAVFKAISEGARKFRRVAVAADTETLTPPCGACRQILWEF--CGDIELVLANLSGKTETYHLKELFPKPF 126
>gi|55925253|ref|NP_001007390.1| hypothetical protein LOC492517 [Danio rerio] >gi|55250353|gb|AAH85561.1| Zgc:103586 [Danio rerio] >gi|182891650|gb|AAI64938.1| Zgc:103586 protein [synthetic construct] (133 aa)
Score = 201, Expect = 1.2e-14, Identities = 47/116 (40%), Positives = 66/116 (56%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AY PYS F V A+I     +   G NVEN+SY +T+C ER AI  AV+ G++  T I +  D  ++F  PCG CRQ + EF    D  +Y+   +G Y K ++ ++L   FT   L
  S:    15 EMAYCPYSGFPVGAAILTTGGAIVTGCNVENASYGLTVCAERTAIQRAVAEGYRRFTAIAVTCDIKDSFVGPCGACRQVLMEFGTEWD--VYLTKPDGSYRKTSLRDLLPLAFTPAHL 130
>gi|148269226|ref|YP_001243686.1| cytidine deaminase [Thermotoga petrophila RKU-1] >gi|147734770|gb|ABQ46110.1| cytidine deaminase [Thermotoga petrophila RKU-1] (132 aa)
Score = 201, Expect = 1.2e-14, Identities = 45/114 (39%), Positives = 64/114 (56%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           E  + AY  YS FRV A++       Y GVNVENSSY +T+C ER A+  AVS G +    I + +DS+    PCG CRQ + EF  SDD  + + + +G +    + ++L   F
  S:    13 EARKKAYAKYSGFRVGAALLAKSGKIYTGVNVENSSYGLTICAERVAVFKAVSEGEREFVAIAIASDSSDKTAPCGACRQVLYEF--SDDLDVIMADRDGNFEVMKLKDLLPRGF 125
>gi|148377383|ref|YP_001256259.1| cytidine deaminase (cytidine aminohydrolase) [Mycoplasma agalactiae PG2] >gi|148291429|emb|CAL58814.1| Cytidine deaminase (Cytidine aminohydrolase) [Mycoplasma agalactiae PG2] (130 aa)
Score = 201, Expect = 1.3e-14, Identities = 42/106 (39%), Positives = 70/106 (66%)
  Q:    12 KLKEVIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK 117
           KLK +++ AY P+S F+VA+I    +   Y GVNVEN+++P  LC ER+A+  +V++G +     +I++++ SN   +PC  CRQ ++EFM  D+  IY +N  G  ++
  S:     4 KLKSLLKYAYCPWSHFQVAAIAIDKNGKEYPGVNVENAAFPSGLCAERSALFGSVAHGAEVGTFKEIHIISSSNDVISPCAGCRQVLTEFM-PDNALIYQYNNSGDNVR 111
>gi|125717869|ref|YP_001035002.1| cytidine deaminase [Streptococcus sanguinis SK36] >gi|125497786|gb|ABN44452.1| Cytidine deaminase, putative [Streptococcus sanguinis SK36] (129 aa)
Score = 201, Expect = 1.3e-14, Identities = 43/112 (38%), Positives = 67/112 (59%)
  Q:    18 ENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           +NAYVPYS F + ++  A D   + GVNVEN+S+ +T CGER AI  AVS G  +  ++ +  ++    +PCG CRQ M+EF  ++D  + +   +   +  T+ E+L   FT
  S:    15 KNAYVPYSHFPIGAVLVAKDGRVFTGVNVENASFGLTNCGERTAIFKAVSEGALDFEELIVYGETEKPISPCGACRQVMAEFF-AEDLKVTLVAKDKSTVVMTVKELLPYSFT 126
>gi|85117456|ref|XP_965262.1| hypothetical protein NCU08359 [Neurospora crassa OR74A] >gi|28927068|gb|EAA36026.1| conserved hypothetical protein [Neurospora crassa OR74A] (182 aa)
Score = 201, Expect = 1.3e-14, Identities = 39/81 (48%), Positives = 55/81 (67%)
  Q:    20 AYVPYSKFRVASIC-------------------KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFME 100
           +Y PYSKFRV ++                     ++ ++  G NVEN+SYPVT C ER A   A++ GH+    + + TD +  A+PCGMCRQF+ EF E
  S:    45 SYSPYSKFRVGAVLLSTGKVNAAVTGERSSSSSSSEGTYTPGANVENASYPVTTCAERVAFGRAITEGHRGFKAVAVATDISPPASPCGMCRQFIREFCE 144
>gi|94985387|ref|YP_604751.1| cytidine deaminase, homotetrameric [Deinococcus geothermalis DSM 11300] >gi|94555668|gb|ABF45582.1| Cytidine deaminase, homotetrameric [Deinococcus geothermalis DSM 11300] (149 aa)
Score = 201, Expect = 1.4e-14, Identities = 42/121 (34%), Positives = 64/121 (52%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K     AY PYSKFRV A++   D   Y+G NVEN+SY +  C E++A+    + G +  T+I + +++   A+PCG CRQ + EF  S D  +   N  G  +   + + L   F  +  D
  S:    22 KAAFRQAYAPYSKFRVGAALRTPDGRVYFGANVENASYGLGRCAEQSAVQAMATAGGREFTEIVVYSEATPPASPCGACRQILFEF--SPDARVVCVNQHGDIVSGRVADFLPHGFRLEQRD 141
>gi|24582741|ref|NP_609195.1| CG8360 CG8360-PA [Drosophila melanogaster] >gi|7297361|gb|AAF52621.1| CG8360-PA [Drosophila melanogaster] >gi|39840962|gb|AAR31117.1| RH58379p [Drosophila melanogaster] (158 aa)
Score = 200, Expect = 1.4e-14, Identities = 39/103 (37%), Positives = 59/103 (57%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS-NTFATPCGMCRQFMSEFMESDDCSIY 107
           ++  I +   E  + AY PYS F V A++  +D + Y G N+EN +Y   +C ER A   A+S G ++     ++    N F TPCG+CRQF+SEF+   D  +Y
  S:    24 SIQEIILAATEARKQAYCPYSNFAVGAALRTSDGTIYSGCNIENGAYATCICAERTAAVKAISEGKRDFVACAVVAQQDNGFTTPCGVCRQFLSEFVNGKDIPLY 128
>gi|118727823|ref|ZP_01576410.1| cytidine deaminase [Clostridium cellulolyticum H10] >gi|118662793|gb|EAV69467.1| cytidine deaminase [Clostridium cellulolyticum H10] (129 aa)
Score = 200, Expect = 1.5e-14, Identities = 49/128 (38%), Positives = 72/128 (56%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSN-GHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           M+EI L +   + ++ ++ AY PYSKFRV A++  A    Y G N+E +S+  T C ER AI  AVS  G   I  I + +D   +  PCG+CRQ M+EF + D+  +      G+Y K   G++L   F
  S:     1 MTEIELAS---RARKAMDTAYAPYSKFRVGAALLTASGRVYTGCNIEIASFGATNCAERTAIFKAVSEEGRIKIDKIAIASDDEDYIYPCGICRQVMAEFAD-DEMELICTRKNGEYKKMRFGDLLPNAF 126
>gi|170576775|ref|XP_001893761.1| cytidine deaminase, identical [Brugia malayi] >gi|158600043|gb|EDP37402.1| cytidine deaminase, identical [Brugia malayi] (133 aa)
Score = 200, Expect = 1.7e-14, Identities = 45/130 (34%), Positives = 72/130 (55%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           I+++ +    +  ++ AY PYSKF V A++   D     G NVEN+SY  T+C ER+A++ AV+ G++    + +         PCG+CRQF+ EF   D   I I +   K I+  + +++   FT KDL
  S:     3 IDVDALTSAARLAMDRAYCPYSKFTVGAALLTKDGKIIXGGNVENASYGGTICAERSAVTRAVAEGYREFQAVAVCATPAEPTAPCGLCRQFLIEF--GDMKVIMISSTSNKRIEMQLSQLIPLSFTTKDL 131
>gi|69248163|ref|ZP_00604652.1| Cytidine deaminase, homotetrameric [Enterococcus faecium DO] >gi|68194529|gb|EAN09024.1| Cytidine deaminase, homotetrameric [Enterococcus faecium DO] (132 aa)
Score = 199, Expect = 1.9e-14, Identities = 46/119 (38%), Positives = 64/119 (53%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E ++ AYVPYS F V A +       Y G+N+EN+S+ +T C ER A   AVS G K  T + +   +    +PCG CRQ M+EF  S D  + +    G     T+  +L   FT+KDL
  S:    14 EALDKAYVPYSHFPVGACLVTESGKIYQGINIENASFGLTNCAERTAFFKAVSEGEKTFTHLVVAGHTPDPISPCGACRQVMAEFC-SPDMPVTLVGDNGVTKATTVRALLPYAFTEKDL 132
>gi|1813698|gb|AAC47631.1| cytidine deaminase [Brugia malayi] (133 aa)
Score = 199, Expect = 2.0e-14, Identities = 45/130 (34%), Positives = 72/130 (55%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           I+++ +    +  ++ AY PYSKF V A++   D     G NVEN+SY  T+C ER+A++ AV+ G++    + +         PCG+CRQF+ EF   D   I I +   K I+  + +++   FT KDL
  S:     3 IDVDALTSAARLAMDRAYCPYSKFTVGAALLTKDGKIITGGNVENASYGGTICAERSAVTRAVAEGYREFQAVAVCATPAEPTAPCGLCRQFLIEF--GDMKVIMISSTSNKRIEMQLSQLIPLSFTTKDL 131
>gi|75759783|ref|ZP_00739861.1| Cytidine deaminase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492733|gb|EAO55871.1| Cytidine deaminase [Bacillus thuringiensis serovar israelensis ATCC 35646] (131 aa)
Score = 199, Expect = 2.1e-14, Identities = 42/119 (35%), Positives = 72/119 (60%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++  AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF E     + + N +G   + T+ ++L G F+ +DL
  S:    12 KMLAKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDAPISPCGACRQVIAEFCEP-KMQVLLTNVKGDEKEVTVEQLLPGAFSIEDL 130
>gi|66805551|ref|XP_636497.1| cytidine deaminase [Dictyostelium discoideum AX4] >gi|74852411|sp|Q54I82|CDD_DICDI Probable cytidine deaminase (Cytidine aminohydrolase) >gi|60464874|gb|EAL62990.1| cytidine deaminase [Dictyostelium discoideum AX4] (147 aa)
Score = 199, Expect = 2.3e-14, Identities = 47/120 (39%), Positives = 70/120 (58%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSVKQ 139
           A+ PYS FR+ A++  +    + GVNVENSSY +T+C ER A + AVS G+K+   I + +D  + F TPCG CRQF  EF    D  +     +    K +  ++L G F+++DL    +Q
  S:    20 AHCPYSHFRIGAALLTSCGKIFTGVNVENSSYGLTICAERTAYTKAVSEGYKSFKGIVVASDLKDRFITPCGACRQFGVEF---GDFEVVCVKPDRSTFKSSTHKLLPGLFSQEDLIAKAEQ 138
>gi|49259412|pdb|1UWZ|A Chain A, Bacillus Subtilis Cytidine Deaminase With An Arg56- Ala Substitution >gi|49259413|pdb|1UWZ|B Chain B, Bacillus Subtilis Cytidine Deaminase With An Arg56- Ala Substitution (136 aa)
Score = 199, Expect = 2.3e-14, Identities = 42/114 (36%), Positives = 65/114 (57%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYSKF+V A++   D   Y G N+EN++Y +  C E  A+  AVS G      + +  D+    +PCG CRQ +SE   + D  + + N +G+  + T+ E+L G F+ +DL
  S:    17 AYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAEATALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELC-TKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDL 130
>gi|118431308|ref|NP_147677.2| cytidine deaminase [Aeropyrum pernix K1] >gi|116062630|dbj|BAA80023.2| cytidine deaminase [Aeropyrum pernix K1] (136 aa)
Score = 198, Expect = 2.4e-14, Identities = 41/95 (43%), Positives = 59/95 (62%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL-TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK 114
           AY PYS+FRV A++  +D   Y G NVENSSY +T+C ER A+  AVS G + + ++ +   DS+    PCG C Q +SEF   D   +Y+ +  G+
  S:    20 AYAPYSRFRVGAAVRTSDGRVYGGCNVENSSYGLTVCAERTAVFKAVSEGSRGVVEVAVYAADSDEPVPPCGACLQVLSEFARGDP-RVYMISRTGR 115
>gi|76802394|ref|YP_327402.1| cytidine deaminase [Natronomonas pharaonis DSM 2160] >gi|76558259|emb|CAI49847.1| cytidine deaminase [Natronomonas pharaonis DSM 2160] (130 aa)
Score = 198, Expect = 2.4e-14, Identities = 44/120 (36%), Positives = 71/120 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++ +E +Y PYS++ V A+I  AD + + G N+EN++Y  ++  E  A+S AV  GH++   I + +      TPCGMCRQ ++EF   DD  I     +G+ ++YT+GE+L    T   L
  S:    11 RKAVEQSYAPYSEYYVGAAIATADGAVFSGCNIENANYSNSVHAEELALSKAVEAGHRSFDRIAVSSARRDGVTPCGMCRQSLAEFC-GDDLRIICDGPDGR-VEYTLGELLPETITASHL 129
>gi|90408144|ref|ZP_01216313.1| cytidine deaminase [Psychromonas sp. CNPT3] >gi|90310756|gb|EAS38872.1| cytidine deaminase [Psychromonas sp. CNPT3] (133 aa)
Score = 198, Expect = 2.5e-14, Identities = 47/124 (37%), Positives = 76/124 (61%)
  Q:    10 FIKLKEVIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSN----TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           F +LK +++ +  PYS F VASI    D   Y GVNVE+++YP T C ERNA+ TA++ G K   I ++++L  +       A PCG CRQ ++E + ++D  ++ +    +  +++I E+L   F   DL
  S:     4 FNELKTLLDCSSAPYSGFNVASIVVTVDGKVYKGVNVESAAYPTTNCAERNALQTAITEGTKLGEIKEVHILARNAQKTLVQAYPCGSCRQVIAE-LSANDAMVFCYASATEIAEHSIAELLPHAFLGADL 133
>gi|157756159|ref|XP_001670423.1| Hypothetical protein CBG05906 [Caenorhabditis briggsae AF16] >gi|187034627|emb|CAP26444.1| C. briggsae CBR-CDD-2 protein [Caenorhabditis briggsae] (166 aa)
Score = 198, Expect = 2.7e-14, Identities = 46/121 (38%), Positives = 69/121 (57%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +  ++ A+ PYSKF V A++         G NVEN+SY  T+C ER+A+ +AVS GH     I ++T+ +  A+PCG+CRQF+ EF +        FN   K +  +  E+L   FT + LD
  S:    20 RTAMKRAHCPYSKFPVGAALLTESGDIILGCNVENASYGGTICAERSAVVSAVSQGHTKFRAISVVTELSEPASPCGLCRQFLVEFGDFKVIIGTAFN--SKTLITSTRELLPFAFTPESLD 139
>gi|29374825|ref|NP_813978.1| cytidine deaminase [Enterococcus faecalis V583] >gi|29342283|gb|AAO80049.1| cytidine deaminase [Enterococcus faecalis V583] (131 aa)
Score = 198, Expect = 2.8e-14, Identities = 43/119 (36%), Positives = 64/119 (53%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E + +AYVPYS F V A +  AD   Y GVN+EN+S+ +T C ER AI  A+S   +    + +  ++    +PCG CRQ M+EF +     + +   +G     T+  +L   FT KD 
  S:    13 EALAHAYVPYSNFPVGACLVTADGKMYQGVNIENASFGLTNCAERTAIFKAISEDERTFQHLVVAGNTEAPISPCGACRQVMAEFFDP-QMPVTLVGKDGATKTMTVEALLPYSFTDKDF 131
>gi|30261929|ref|NP_844306.1| cytidine deaminase [Bacillus anthracis str. Ames] >gi|47527190|ref|YP_018539.1| cytidine deaminase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184769|ref|YP_028021.1| cytidine deaminase [Bacillus anthracis str. Sterne] >gi|49481150|ref|YP_036067.1| cytidine deaminase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52143527|ref|YP_083301.1| cytidine deaminase [Bacillus cereus E33L] >gi|165869405|ref|ZP_02214064.1| cytidine deaminase [Bacillus anthracis str. A0488] >gi|166992513|ref|ZP_02258973.1| cytidine deaminase [Bacillus cereus AH820] >gi|167633474|ref|ZP_02391799.1| cytidine deaminase [Bacillus anthracis str. A0442] >gi|167638711|ref|ZP_02396986.1| cytidine deaminase [Bacillus anthracis str. A0193] >gi|177650495|ref|ZP_02933462.1| cytidine deaminase [Bacillus anthracis str. A0174] >gi|190566429|ref|ZP_03019347.1| cytidine deaminase [Bacillus anthracis Tsiankovskii-I] >gi|196033344|ref|ZP_03100756.1| cytidine deaminase [Bacillus cereus W] >gi|30256555|gb|AAP25792.1| cytidine deaminase [Bacillus anthracis str. Ames] >gi|47502338|gb|AAT31014.1| cytidine deaminase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178696|gb|AAT54072.1| cytidine deaminase [Bacillus anthracis str. Sterne] >gi|49332706|gb|AAT63352.1| cytidine deaminase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51976996|gb|AAU18546.1| cytidine deaminase [Bacillus cereus E33L] >gi|164714845|gb|EDR20363.1| cytidine deaminase [Bacillus anthracis str. A0488] >gi|167513175|gb|EDR88546.1| cytidine deaminase [Bacillus anthracis str. A0193] >gi|167531512|gb|EDR94190.1| cytidine deaminase [Bacillus anthracis str. A0442] >gi|172083639|gb|EDT68699.1| cytidine deaminase [Bacillus anthracis str. A0174] >gi|190562564|gb|EDV16531.1| cytidine deaminase [Bacillus anthracis Tsiankovskii-I] >gi|195993778|gb|EDX57734.1| cytidine deaminase [Bacillus cereus W] (131 aa)
Score = 198, Expect = 2.8e-14, Identities = 42/119 (35%), Positives = 71/119 (59%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++  AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF +     + + N +G   + T+ ++L G FT  DL
  S:    12 KMLSKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFCDP-KMPVLLTNVKGDEKEVTVEQLLPGAFTNDDL 130
>gi|15903231|ref|NP_358781.1| cytidine deaminase [Streptococcus pneumoniae R6] >gi|116516518|ref|YP_816632.1| cytidine deaminase [Streptococcus pneumoniae D39] >gi|149002688|ref|ZP_01827620.1| cytidine deaminase [Streptococcus pneumoniae SP14-BS69] >gi|149007021|ref|ZP_01830690.1| cytidine deaminase [Streptococcus pneumoniae SP18-BS74] >gi|15458820|gb|AAK99991.1| Cytidine deaminase [Streptococcus pneumoniae R6] >gi|116077094|gb|ABJ54814.1| cytidine deaminase [Streptococcus pneumoniae D39] >gi|147759299|gb|EDK66292.1| cytidine deaminase [Streptococcus pneumoniae SP14-BS69] >gi|147761325|gb|EDK68291.1| cytidine deaminase [Streptococcus pneumoniae SP18-BS74] (135 aa)
Score = 198, Expect = 2.9e-14, Identities = 47/133 (35%), Positives = 77/133 (57%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           M+ IN   +  + K+V++NAY PYSKF V A+I   D     G N+EN S+ VT C ER+AI    S G++  +I  I +  ++  +  PC +CRQ M EF E D   +++ N +G  ++  + E++   F+  ++
  S:     1 MTVINKFVLMEQAKKVLKNAYCPYSKFPVGAAILFKDGKVITGANIENVSFGVTNCAERSAIFYGASQGYRKGDILAIAVAGETEDYLPPCNICRQVMVEFCEPDTL-VFLLNGKGNILELRLEELVPYSFSSLEM 135
>gi|69936062|ref|ZP_00630922.1| Cytidine deaminase, homotetrameric [Paracoccus denitrificans PD1222] >gi|119384955|ref|YP_916011.1| cytidine deaminase [Paracoccus denitrificans PD1222] >gi|119374722|gb|ABL70315.1| cytidine deaminase [Paracoccus denitrificans PD1222] (131 aa)
Score = 198, Expect = 3.0e-14, Identities = 46/115 (40%), Positives = 64/115 (55%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +EV E AY PYS F+V A++  A    Y G NVEN +YP   C E  AI+  V+ G   I ++ ++ DS     PCG CRQ ++EF    +  + +    G  +  TIGE+L GRF
  S:     8 REVRERAYAPYSNFKVGAAVRGASGRIYAGCNVENVAYPEGTCAEAGAIAAMVAAGETEIVEVAVIADSQGPVPPCGGCRQKLAEFGRP-ETPVLLATTRGHELATTIGELLPGRF 122
>gi|145535327|ref|XP_001453402.1| hypothetical protein GSPATT00019709001 [Paramecium tetraurelia strain d4-2] >gi|124421113|emb|CAK86005.1| unnamed protein product [Paramecium tetraurelia] (144 aa)
Score = 197, Expect = 3.2e-14, Identities = 49/118 (41%), Positives = 67/118 (56%)
  Q:    18 ENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF-MESDDCSIYIFNWEGKYIKYTIG-EILKGRFTKKDLDL 135
           E AY PYS FRV  S+    +  Y G NVEN+SY + +C ER AI  AVS G + I+ I +  D++    PCGMCRQ + EF    +D  I     +    KY+ G E++   F  KDL++
  S:    17 ERAYCPYSNFRVGCSLLTKTNKIYTGCNVENASYGLCVCAERVAICKAVSEGDRQISTIVVSCDTDEPTFPCGMCRQTIIEFCYAGNDIKIIAIGKDQTKPKYSKGSEVIPFAFVPKDLNV 137
>gi|15643609|ref|NP_228655.1| cytidine/deoxycytidine deaminase [Thermotoga maritima MSB8] >gi|4981379|gb|AAD35928.1|AE001751_8 cytidine/deoxycytidine deaminase [Thermotoga maritima MSB8] (132 aa)
Score = 197, Expect = 3.5e-14, Identities = 43/101 (42%), Positives = 58/101 (57%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKY 115
           E  + AY  YS FRV A++       Y GVNVENSSY +T+C ER A+  AVS G +    I + +DS     PCG CRQ + EF  SDD  + + + +G +
  S:    13 EARKKAYAKYSGFRVGAALLTKSGKIYTGVNVENSSYGLTVCAERVAVFKAVSEGEREFVAIAIASDSPDKTAPCGACRQVLYEF--SDDLDVIMADRDGNF 112
>gi|134109233|ref|XP_776731.1| hypothetical protein CNBC2220 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50259411|gb|EAL22084.1| hypothetical protein CNBC2220 [Cryptococcus neoformans var. neoformans B-3501A] (164 aa)
Score = 197, Expect = 3.6e-14, Identities = 39/91 (42%), Positives = 57/91 (62%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYI 108
           + AY PYSKFRV A++  AD   Y G NVEN+SY   +C ER A+  AVS   ++   + +++D  +   +PCG+CRQF+ EF+  D    Y+
  S:    25 DRAYAPYSKFRVGAALLGADGRLYGGCNVENASYGAGICAERTAVVKAVSESQQSFLAVAVVSDIPSPSCSPCGICRQFLREFVSLDTPIFYV 117
>gi|154422719|ref|XP_001584371.1| hypothetical protein TVAG_070480 [Trichomonas vaginalis G3] >gi|121918618|gb|EAY23385.1| hypothetical protein TVAG_070480 [Trichomonas vaginalis G3] (139 aa)
Score = 197, Expect = 3.9e-14, Identities = 50/115 (43%), Positives = 71/115 (61%)
  Q:    19 NAYVPYSKFRVAS--ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           N+Y PYS FRV++  +C+ D S   GVNVEN SYP   C ER+AI +A+S G+K+   I + +D  + F  PCGMCRQ ++E+    +  +     +GK IK Y I ++L    T  DL
  S:    23 NSYSPYSHFRVSAALLCR-DGSIINGVNVENCSYPNGCCAERSAIYSAISQGYKDFVAILITSDMKDDFIYPCGMCRQVIAEW---GNLEVISTKADGKEIKRYHISDLLPEASTPADL 137
>gi|30019965|ref|NP_831596.1| cytidine deaminase [Bacillus cereus ATCC 14579] >gi|29895510|gb|AAP08797.1| Cytidine deaminase [Bacillus cereus ATCC 14579] (119 aa)
Score = 196, Expect = 4.5e-14, Identities = 42/118 (35%), Positives = 70/118 (59%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++  AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF +     + + N +G   + T+ ++L G FT  DL
  S:     1 MLSKAYIPYSKFPVGAALVTKEGKVYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFCDP-KMPVLLTNVKGDEKEVTVEQLLPGAFTIDDL 118
>gi|152975265|ref|YP_001374782.1| cytidine deaminase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024017|gb|ABS21787.1| cytidine deaminase [Bacillus cereus subsp. cytotoxis NVH 391-98] (131 aa)
Score = 196, Expect = 5.0e-14, Identities = 42/119 (35%), Positives = 70/119 (58%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++E AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +   ++   +PCG CRQ ++EF +     + + N +G   + T+ ++L G F   DL
  S:    12 KMLEKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERHFSYLVVTGKTDGPISPCGACRQVIAEFCDP-KMPVLLTNVKGDEKEVTVEQLLPGAFLNGDL 130
>gi|118477358|ref|YP_894509.1| cytidine deaminase [Bacillus thuringiensis str. Al Hakam] >gi|196047006|ref|ZP_03114225.1| cytidine deaminase [Bacillus cereus 03BB108] >gi|118416583|gb|ABK85002.1| cytidine deaminase [Bacillus thuringiensis str. Al Hakam] >gi|196022110|gb|EDX60798.1| cytidine deaminase [Bacillus cereus 03BB108] (131 aa)
Score = 196, Expect = 5.0e-14, Identities = 42/119 (35%), Positives = 71/119 (59%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++  AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF  +    + + N +G   + T+ ++L G FT  DL
  S:    12 KMLAKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFC-NPKMPVLLTNVKGDEKEVTVEQLLPGAFTNDDL 130
>gi|42527436|ref|NP_972534.1| cytidine deaminase [Treponema denticola ATCC 35405] >gi|41818021|gb|AAS12445.1| cytidine deaminase [Treponema denticola ATCC 35405] (136 aa)
Score = 196, Expect = 5.0e-14, Identities = 46/102 (45%), Positives = 58/102 (56%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIY 107
           L  +F    E  + AY PYS F V A+I   D S   GVN+EN SY +T C ER AI  AVS G  +   I + T D++   +PCG CRQ +SEFM  D   I+
  S:     7 LENLFKTALEAAKKAYAPYSNFHVGAAILLEDGSIVTGVNIENRSYGLTNCAERTAIFKAVSEGKTDFKAIAIATPDADYPVSPCGACRQVISEFMGGDTPVIF 110
>gi|88800950|ref|ZP_01116502.1| cytidine deaminase [Reinekea sp. MED297] >gi|88776325|gb|EAR07548.1| cytidine deaminase [Reinekea sp. MED297] (133 aa)
Score = 195, Expect = 6.3e-14, Identities = 43/115 (37%), Positives = 68/115 (59%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGH--KNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKD 132
           E AY PYS+F V AS+       + G N+ENSSY + +C ER AI+ AV+ G    +I ++ +       A+PCG CRQ +SEF++ D  ++  +N  G    +TI ++L   F+ ++
  S:    17 EKAYAPYSQFPVGASLRTRTGETFIGCNIENSSYGLGICAERTAIAAAVTAGFGPGDIEEMAVYVPDENIASPCGACRQVISEFLDKDK-TVTAYNRHGDSKTWTIEQLLPDGFSLRN 133
>gi|150390777|ref|YP_001320826.1| cytidine deaminase [Alkaliphilus metalliredigens QYMF] >gi|149950639|gb|ABR49167.1| cytidine deaminase [Alkaliphilus metalliredigens QYMF] (133 aa)
Score = 195, Expect = 6.5e-14, Identities = 49/123 (39%), Positives = 67/123 (54%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K  E  E AYVPYSKF V A++       + G N+E +SY  T C ER AI  +VS G  +I  I ++ D N +  PCG+CRQ + E+    +  + I   E +Y  YTI  +L   FT  DL+
  S:     9 KAIEAREKAYVPYSKFPVGAALLTKSGKVHTGCNIECASYGATNCAERTAIFKSVSEGDLDIDMIAVVGDENAYTYPCGICRQVIVEY--GKNIKLIIGKSEEEYKVYTIENLLPHSFTPDDLE 130
>gi|110776829|ref|XP_001119936.1| PREDICTED: similar to cytidine deaminase [Apis mellifera] (148 aa)
Score = 195, Expect = 6.6e-14, Identities = 51/126 (40%), Positives = 72/126 (57%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD--SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYI-KYTIGEILKGRF 128
           E ++ ++  K     E +Y PYSKF+  A+I   D S + G NVEN+SYPV  C ER AI  AVS G +    + ++ D  +N F TPCG CRQ ++EF    D  IY+   + K + K T+  +L   F
  S:    13 EPDIQSLIKKTIAAREYSYSPYSKFKAGAAILCDDGSIFTGCNVENASYPVGTCAERTAIVKAVSEGKRKFKVLTVVADKKNNIFTTPCGFCRQAIAEF---GDILIYLTGPDMKNVLKTTLSNLLPHAF 139
>gi|159117933|ref|XP_001709186.1| Cytidine deaminase [Giardia lamblia ATCC 50803] >gi|157437301|gb|EDO81512.1| Cytidine deaminase [Giardia lamblia ATCC 50803] (134 aa)
Score = 195, Expect = 6.8e-14, Identities = 35/81 (43%), Positives = 54/81 (66%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           E+AY+PYSK++V A+I       + G NVEN++YP+ +C ER A+  A+S G K++    ++T      +PCGMCRQ ++EF
  S:    20 EHAYIPYSKYKVGAAILTESGEIFKGCNVENAAYPIGVCAERTAVVKAISEGKKDMVACAVVTRDG--GSPCGMCRQTLNEF 99
>gi|138896063|ref|YP_001126516.1| cytidine deaminase [Geobacillus thermodenitrificans NG80-2] >gi|196248956|ref|ZP_03147656.1| cytidine deaminase [Geobacillus sp. G11MC16] >gi|134267576|gb|ABO67771.1| Cytidine deaminase [Geobacillus thermodenitrificans NG80-2] >gi|196211832|gb|EDY06591.1| cytidine deaminase [Geobacillus sp. G11MC16] (132 aa)
Score = 194, Expect = 7.0e-14, Identities = 42/130 (32%), Positives = 68/130 (52%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + +  + ++ K+  E AYVPYSKF+V A++     S Y G N+EN++Y +  C ER A+  A S G      + ++ D+     PCG CRQ ++E     D  + + N  G     T+ E+L   F  +D+
  S:     1 MKIEQLIVEAKKARELAYVPYSKFKVGAALLTKGGSVYRGCNIENAAYSMCNCAERTALFKAYSEGETEFAALAVIADTPRPVPPCGACRQVIAELCPG-DMKVILANLSGDIKIVTVNELLPEAFAAEDM 130
>gi|121534216|ref|ZP_01666041.1| cytidine deaminase [Thermosinus carboxydivorans Nor1] >gi|121307319|gb|EAX48236.1| cytidine deaminase [Thermosinus carboxydivorans Nor1] (131 aa)
Score = 194, Expect = 7.4e-14, Identities = 43/116 (37%), Positives = 67/116 (57%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AY PYS+F+V A++       Y G NVEN+SY +T+C ER AI  AVS G ++   + ++ ++     PCG CRQ M EF  +    + + N +G+  + T+ E+L   F ++ L
  S:    13 ELAYTPYSRFQVGAALLTKSGRVYTGCNVENASYSLTICAERTAIFKAVSEGERDFIALAVVANAPEPLAPCGACRQVMVEFAIN---RVILCNTDGQRRELTLDELLPYAFNERFL 126
>gi|1483233|emb|CAA62521.1| cytidine deaminase [Brugia pahangi] (133 aa)
Score = 194, Expect = 7.6e-14, Identities = 44/130 (33%), Positives = 72/130 (55%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           I+++ +    +  ++ AY PYSKF V A++   D     G NVE++SY  T+C ER+A++ AV+ G++    + +         PCG+CRQF+ EF   D   I I +   K I+  + +++   FT KDL
  S:     3 IDVDALTSAARLAMDRAYCPYSKFTVGAALLTKDGKIITGGNVESASYGGTICAERSAVTRAVAEGYREFQAVAVCATPAEPTAPCGLCRQFLIEF--GDMKVIMISSTSNKRIEMQLSQLIPLSFTTKDL 131
>gi|116491696|ref|YP_811240.1| cytidine deaminase [Oenococcus oeni PSU-1] >gi|116092421|gb|ABJ57575.1| cytidine deaminase [Oenococcus oeni PSU-1] (132 aa)
Score = 194, Expect = 8.4e-14, Identities = 42/128 (32%), Positives = 68/128 (53%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           M+E   + +     + ++ AY+PYS F V A++  ADD  + G N+EN+++  T+C ER AI +AV+ G      + +   +     PCG CRQ M E+ +     IY+ N  GK +K  +  +L   F
  S:     1 MTEAEYSALKKVADQELDKAYIPYSHFAVGAALLSADDRIFPGCNIENAAFGSTMCAERTAIFSAVAAGCHQFKALVISGRTEGAIAPCGACRQVMVEWFDK-KMPIYLTNTSGKVVKTDLDHLLPASF 128
>gi|118587400|ref|ZP_01544826.1| cytidine deaminase [Oenococcus oeni ATCC BAA-1163] >gi|118432224|gb|EAV38964.1| cytidine deaminase [Oenococcus oeni ATCC BAA-1163] (132 aa)
Score = 194, Expect = 8.5e-14, Identities = 42/128 (32%), Positives = 68/128 (53%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           M+E   + +     + ++ AY+PYS F VA+ +  ADD  + G N+EN+++  T+C ER AI +AV+ G      + +   +     PCG CRQ M E+ +     IY+ N  GK +K  +  +L   F
  S:     1 MTEAEYSALKKVADQELDKAYIPYSHFAVAAALLSADDRIFPGCNIENAAFGSTMCAERTAIFSAVAAGCHQFKALVISGRTEGAIAPCGACRQVMVEWFDK-KMPIYLTNTSGKVVKTDLDHLLPASF 128
>gi|47570605|ref|ZP_00241221.1| cytidine deaminase [Bacillus cereus G9241] >gi|47552728|gb|EAL11163.1| cytidine deaminase [Bacillus cereus G9241] (131 aa)
Score = 194, Expect = 8.9e-14, Identities = 41/119 (34%), Positives = 72/119 (60%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++  AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF +     + + N +G   + T+ ++L G F+ +DL
  S:    12 KMLAKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFCDP-KMPVLLTNVKGDEKEVTVEQLLPGAFSIEDL 130
>gi|114705465|ref|ZP_01438373.1| cytidine deaminase [Fulvimarina pelagi HTCC2506] >gi|114540250|gb|EAU43370.1| cytidine deaminase [Fulvimarina pelagi HTCC2506] (142 aa)
Score = 193, Expect = 1.0e-13, Identities = 46/127 (36%), Positives = 72/127 (56%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           + +F K K  +  AY PYS+F V A++  AD   Y G NVE+ S+P   C E  AI   V +G  +I ++ ++  +    TPCG CRQ ++EF ++ D  I++ N +   +   T+GE+L   F+  DL
  S:     3 DDLFAKAKLAMRKAYAPYSRFPVGAALRTADGRIYAGCNVESVSFPEGWCAETTAIGHLVMDGGGHIAELAVVAANLNGCTPCGGCRQRIAEFADA-DTKIHLCNVDSGVVNTVTMGELLPLVFSTDDL 130
>gi|55377335|ref|YP_135185.1| cytidine deaminase [Haloarcula marismortui ATCC 43049] >gi|55230060|gb|AAV45479.1| cytidine deaminase [Haloarcula marismortui ATCC 43049] (128 aa)
Score = 193, Expect = 1.2e-13, Identities = 46/121 (38%), Positives = 67/121 (55%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           ++ I+ AY PYS++ V A++  +D S Y G N+EN++Y  +L  E  AI  AVS+GH++   + + +      TPCGMCRQ  SEF    D S  I     +   Y +GE+L    T   LD
  S:     9 RDAIDEAYAPYSEYTVGAALETSDGSVYTGCNIENANYSNSLHAEEVAIGAAVSDGHRSFERVAVTSGKRDGVTPCGMCRQTFSEFC---DESFEIITDGDEPTVYELGELLPTTITSDHLD 127
>gi|114567082|ref|YP_754236.1| cytidine deaminase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338017|gb|ABI68865.1| cytidine deaminase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (132 aa)
Score = 192, Expect = 1.3e-13, Identities = 40/118 (33%), Positives = 69/118 (58%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           + +E  +NAY PYS F+V A++  A    Y G NVENSSY +++C ER A+  AV++G ++   + ++     +  PCG C Q ++EF  S +  + I + +  Y +Y + ++L   F+
  S:    10 RAREAQKNAYAPYSNFQVGAALLSAGGKVYTGSNVENSSYGLSICAERAAVFKAVNDGERDFALLAVVASGQGYVFPCGACLQVLAEF--SPEMKLIITDEKDHYKEYALQDMLPQIFS 126
>gi|42523887|ref|NP_969267.1| hypothetical protein Bd2449 [Bdellovibrio bacteriovorus HD100] >gi|39576094|emb|CAE80260.1| cdd [Bdellovibrio bacteriovorus HD100] (134 aa)
Score = 192, Expect = 1.4e-13, Identities = 45/117 (38%), Positives = 67/117 (57%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNG-HKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + A+ PYS   + A++  +D   + G NVEN+SY  T+C ER AI  AVS G  K I ++ +++D+     PCG CRQ ++EF  ++   I+  N +GK   +   EI    FT K LD
  S:    17 KKAHAPYSDALIGAAVLMSDGQIFNGCNVENASYGGTVCAERVAIFKAVSEGAQKLIKEVLVVSDAEKPWPPCGFCRQVIAEF-ANEHTVIHTANLQGKIKTFQFPEIFPEAFTPKHLD 134
>gi|154498430|ref|ZP_02036808.1| hypothetical protein BACCAP_02419 [Bacteroides capillosus ATCC 29799] >gi|150272498|gb|EDM99683.1| hypothetical protein BACCAP_02419 [Bacteroides capillosus ATCC 29799] (134 aa)
Score = 192, Expect = 1.4e-13, Identities = 43/118 (36%), Positives = 70/118 (59%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK-NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++E +YVPYS F V A++  AD + + G NVEN++Y  T+C ER A+  AVS GH+ +   I ++ +S  +  PCG CRQ + EF  + D ++ +   +  ++   + E+L   F  K L
  S:    13 MLERSYVPYSGFPVGAALECADGTVFTGCNVENAAYGSTICAERTALVKAVSEGHRDDWKRIAVVGNSADYCWPCGSCRQMLYEF--APDLTVLVARGDHAFVTLPLKELLPYGFGPKSL 130
>gi|150398529|ref|YP_001328996.1| cytidine deaminase [Sinorhizobium medicae WSM419] >gi|150030044|gb|ABR62161.1| cytidine deaminase [Sinorhizobium medicae WSM419] (152 aa)
Score = 192, Expect = 1.5e-13, Identities = 35/92 (38%), Positives = 54/92 (58%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           + +F+  +E +  A+ PYSKF V +  +A+D   Y G N+EN S+P   C E  AIS  V  G + IT++ ++ +      PCG CRQ ++EF
  S:    25 DELFVAAREAMAKAHAPYSKFPVGAAIRAEDGKIYTGANIENLSFPEGWCAETTAISHMVMAGQRKITEVAVVAEKLALCPPCGGCRQRLAEF 117
>gi|15963881|ref|NP_384234.1| cytidine deaminase [Sinorhizobium meliloti 1021] >gi|15073056|emb|CAC41515.1| Putative cytidine deaminase [Sinorhizobium meliloti 1021] (152 aa)
Score = 192, Expect = 1.5e-13, Identities = 35/92 (38%), Positives = 54/92 (58%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           + +F+  +E +  A+ PYSKF V +  +A+D   Y G N+EN S+P   C E  AIS  V  G + IT++ ++ +      PCG CRQ ++EF
  S:    25 DELFVAAREAMAKAHAPYSKFPVGAAIRAEDGRIYTGANIENLSFPEGWCAETTAISHMVMAGQRKITEVAVVAEKLALCPPCGGCRQRLAEF 117
>gi|110681112|ref|YP_684119.1| cytidine deaminase [Roseobacter denitrificans OCh 114] >gi|109457228|gb|ABG33433.1| cytidine deaminase [Roseobacter denitrificans OCh 114] (129 aa)
Score = 191, Expect = 1.7e-13, Identities = 47/120 (39%), Positives = 68/120 (56%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           V ENA+VPYS F+V A++  A  + Y G NVEN +YP   C E  AI+  V+ G   IT+ Y++  S    +PCG CRQ ++EF  + D  + +    G   K T+G +L G F  + + L
  S:    10 VRENAHVPYSNFKVGAALRGASGAVYVGCNVENVAYPEGTCAEAGAIAAMVAAGETVITEAYVIAGSPMPVSPCGGCRQKLAEFAGA-DVPVTMATTSGIEQKTTVGALLPGVFNTEHMSL 129
>gi|149234639|ref|XP_001523199.1| cytidine deaminase [Lodderomyces elongisporus NRRL YB-4239] >gi|146453308|gb|EDK47564.1| cytidine deaminase [Lodderomyces elongisporus NRRL YB-4239] (117 aa)
Score = 191, Expect = 1.8e-13, Identities = 39/94 (41%), Positives = 56/94 (59%)
  Q:    42 GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           GVNVEN+SY   +C ER AIS AVS G++    I +  D+     PCG+CRQF+ EF    D  +++FN  G +IK  + ++L   F  +DL +
  S:    24 GVNVENASYGAGVCAERTAISKAVSEGYRKFKAIAIAADTEEPIVPCGICRQFIREFCH--DIVLFLFNKNGDFIKVYLKDLLPMSFGPEDLGI 115
>gi|19920920|ref|NP_609196.1| CG8353 CG8353-PA [Drosophila melanogaster] >gi|7297362|gb|AAF52622.1| CG8353-PA [Drosophila melanogaster] >gi|17944360|gb|AAL48072.1| RE70243p [Drosophila melanogaster] (170 aa)
Score = 191, Expect = 1.9e-13, Identities = 39/88 (44%), Positives = 53/88 (60%)
  Q:    15 EVIENAYVPYSKFRVASI--CKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKN-ITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           +V + AYVPYS F+V +    K D   + G NVEN+++    C ER AI+ AVS G    +    L  + N F TPCG+CRQF+ EF  +D
  S:    36 QVRQRAYVPYSGFKVGAAFRAKVDGKIFTGCNVENAAFTPGSCAERTAIAKAVSEGATEFLAGAVLAYEPNVFTTPCGVCRQFIREFANAD 126
>gi|159184173|ref|NP_353166.2| cytidine deaminase [Agrobacterium tumefaciens str. C58] >gi|159139506|gb|AAK85951.2| cytidine deaminase [Agrobacterium tumefaciens str. C58] (134 aa)
Score = 191, Expect = 1.9e-13, Identities = 43/127 (33%), Positives = 69/127 (54%)
  Q:     2 SEINLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           S+   + +F    E +  AY PYSKF V +  +A+D   Y G N+EN S+P   C E +AIS  +  G K I+++ ++ +     +PCG CRQ ++EF  + +  IY+ +  G     T+ E+L   F
  S:     3 SDPKSHALFEAAVEAMAFAYAPYSKFPVGAAIRAEDGKIYTGANIENISFPQGWCAEPSAISAMIMGGAKKISEVAVIAEKLPLCSPCGGCRQKIAEF-ATPETKIYLCDETGVQKVMTMEELLPSVF 129
>gi|84499526|ref|ZP_00997814.1| Cytidine deaminase [Oceanicola batsensis HTCC2597] >gi|84392670|gb|EAQ04881.1| Cytidine deaminase [Oceanicola batsensis HTCC2597] (130 aa)
Score = 191, Expect = 2.0e-13, Identities = 47/121 (38%), Positives = 66/121 (54%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +EV ENAY PYS F+V A+I       Y GVNVEN +YP   C E  AI+  V+ G   I ++ ++ DS +    CG CRQ ++EF    +  + +    G  +  T+ EIL GRF    L+
  S:     8 REVRENAYAPYSNFKVGAAIRAGSGKVYTGVNVENVAYPEGTCAEAGAIAAMVAAGETVIAEVAVIADSPSPVPCCGGCRQKLAEF-GGPEVPVTMATLGGATLTLTLAEILPGRFAADHLE 128
>gi|114554460|ref|XP_001161344.1| PREDICTED: cytidine deaminase isoform 1 [Pan troglodytes] (187 aa)
Score = 190, Expect = 2.0e-13, Identities = 38/92 (41%), Positives = 55/92 (59%)
  Q:    42 GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           G N+EN+ YP+ +C ER AI  AVS G+K+   I + +D  + F +PCG CRQ M EF    +  +Y+   +G YI  T+ E+L   F  +DL
  S:    93 GCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREF--GTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDL 183
>gi|91089097|ref|XP_971760.1| PREDICTED: similar to cytidine deaminase, putative [Tribolium castaneum] (150 aa)
Score = 190, Expect = 2.1e-13, Identities = 41/109 (37%), Positives = 70/109 (64%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS-NTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYT-IGEILKGRF 128
           AY PYSKF+V A++     + + G N+ENS+Y V +C ER A++ A+S G ++   + ++ +  N + TPCG CRQFMSE+    +  I+I   + +++  T +G++L  +F
  S:    35 AYCPYSKFQVGAAVATTTGAIFGGCNIENSAYTVGICAERTALAKAISEGFQSFKAVAVIGNQENVYTTPCGACRQFMSEY---GNMKIFISKSDLEHVFVTDLGQLLPHQF 143
>gi|49259416|pdb|1UX1|A Chain A, Bacillus Subtilis Cytidine Deaminase With A Cys53his And An Arg56gln Substitution >gi|49259417|pdb|1UX1|B Chain B, Bacillus Subtilis Cytidine Deaminase With A Cys53his And An Arg56gln Substitution >gi|49259418|pdb|1UX1|C Chain C, Bacillus Subtilis Cytidine Deaminase With A Cys53his And An Arg56gln Substitution >gi|49259419|pdb|1UX1|D Chain D, Bacillus Subtilis Cytidine Deaminase With A Cys53his And An Arg56gln Substitution (136 aa)
Score = 190, Expect = 2.3e-13, Identities = 41/114 (35%), Positives = 65/114 (57%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           AY PYSKF+V A++   D   Y G N+EN++Y +    E+ A+  AVS G      + +  D+    +PCG CRQ +SE   + D  + + N +G+  + T+ E+L G F+ +DL
  S:    17 AYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNHAEQTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELC-TKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDL 130
>gi|126731098|ref|ZP_01746906.1| Cytidine deaminase [Sagittula stellata E-37] >gi|126708400|gb|EBA07458.1| Cytidine deaminase [Sagittula stellata E-37] (134 aa)
Score = 189, Expect = 2.8e-13, Identities = 44/121 (36%), Positives = 65/121 (53%)
  Q:    14 KEVIENAYVPYSKFRVASICKA-DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + V ENAYVPYS F+V +  K    + + G NVEN +YP   C E  AI+  V+ G   I + Y++ DS     PCG CRQ + EF +     + +   +G+    T+ ++L G FT   +D
  S:     8 RSVRENAYVPYSHFKVGAALKTPSGAVHVGCNVENVAYPEGTCAEAGAIAAMVAAGETEIVEAYVIADSPHPVPPCGGCRQKLMEFAKG-GVKVTLATVDGREFVTTVADLLPGAFTNDHMD 128
>gi|17551074|ref|NP_509384.1| CytiDine Deaminase family member (cdd-1) [Caenorhabditis elegans] >gi|1465863|gb|AAB04993.1| Cytidine deaminase protein 1 [Caenorhabditis elegans] (158 aa)
Score = 189, Expect = 2.8e-13, Identities = 47/118 (39%), Positives = 65/118 (55%)
  Q:    17 IENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +ENAY  YS F+V +    DD     G N EN+SY  T+C ER+AI TA++ GH+    I + T+     +PCG+CRQ + EF   D   I   +   + I+ T  E+L   FT K LD
  S:    23 MENAYCKYSNFKVGAALVCDDGEIIIGANHENASYGATICAERSAIVTALTKGHRKFKYIVVATELEAPCSPCGVCRQVLIEF--GDYKVILGSSTSDQIIETTTYELLPYAFTPKSLD 139
>gi|125985691|ref|XP_001356609.1| GA21012-PA [Drosophila pseudoobscura] >gi|54644933|gb|EAL33673.1| GA21012-PA [Drosophila pseudoobscura] (170 aa)
Score = 188, Expect = 3.7e-13, Identities = 42/104 (40%), Positives = 61/104 (58%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRVASICKAD--DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNIT-DIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           ++  + +   EV + AYVPYS F+V S  +A   +  + G NVEN+++    C ER A++ AVS G    +    L  + + F TPCG+CRQF+ EF  S D  IYI
  S:    26 SVQELLLAASEVRQRAYVPYSGFKVGSAFRATATNQIFTGCNVENAAFTPCSCAERTALAKAVSEGATEFSVGAVLAYEPDAFTTPCGVCRQFIREFATS-DIPIYI 131
>gi|160895173|ref|ZP_02075946.1| hypothetical protein CLOL250_02733 [Clostridium sp. L2-50] >gi|156863207|gb|EDO56638.1| hypothetical protein CLOL250_02733 [Clostridium sp. L2-50] (138 aa)
Score = 188, Expect = 3.7e-13, Identities = 43/109 (39%), Positives = 66/109 (60%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL----TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           AY PYS F+V +  K ++ S+Y G N+EN+SY  T C ER A+  AVS G + ++ I ++         +  PCG+CRQ ++EF E  DC I +   + +Y  Y++ E+L   F
  S:    20 AYAPYSNFQVGACIKMENGSYYTGCNIENASYGATNCAERTAVFKAVSEGCRKLSAIVIVGGLKNGECDYTYPCGICRQVIAEFAEQ-DCVIVVAKNKQEYRMYSVEELLPETF 132
>gi|17540514|ref|NP_501221.1| CytiDine Deaminase family member (cdd-2) [Caenorhabditis elegans] >gi|1397290|gb|AAB03151.1| Cytidine deaminase protein 2 [Caenorhabditis elegans] (166 aa)
Score = 188, Expect = 3.8e-13, Identities = 37/85 (43%), Positives = 55/85 (64%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           +  ++ A+ PYSKF V A++         G NVEN+SY  T+C ER+AI +AVS G+     I ++T+ +  A+PCG+CRQF+ EF
  S:    20 RAAMKRAHCPYSKFPVGAALLTESGEIVQGCNVENASYGGTICAERSAIVSAVSQGYTKFRAIAVVTELSEPASPCGLCRQFLVEF 105
>gi|89895852|ref|YP_519339.1| hypothetical protein DSY3106 [Desulfitobacterium hafniense Y51] >gi|109646175|ref|ZP_01370095.1| cytidine deaminase [Desulfitobacterium hafniense DCB-2] >gi|89335300|dbj|BAE84895.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109644124|gb|EAT53677.1| cytidine deaminase [Desulfitobacterium hafniense DCB-2] (139 aa)
Score = 188, Expect = 3.9e-13, Identities = 36/103 (34%), Positives = 61/103 (59%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK 114
           + ++  ++AYVPYS + V A+          G NVEN+SY +T+C ERNA+  +  +G + +  + +   ++ F +PCG CRQ + EF  S DC + + N +G+
  S:    18 RAQKAYQSAYVPYSNYPVGAATLWESGRIIAGCNVENASYGLTICAERNAVFHSAYHGERRLKAVAVAVPTDAFPSPCGACRQVLREF--SQDCLVILVNGKGQ 119
>gi|150018261|ref|YP_001310515.1| cytidine deaminase [Clostridium beijerinckii NCIMB 8052] >gi|149904726|gb|ABR35559.1| cytidine deaminase [Clostridium beijerinckii NCIMB 8052] (140 aa)
Score = 188, Expect = 4.4e-13, Identities = 47/130 (36%), Positives = 69/130 (53%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSN-------TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           I+   +  K  E  +  Y PYS F V +    DD + Y G N+EN+++  T C ER A   A+S G K  T I ++ +          F  PC +CRQ M+EF +     I I     +Y+++T+ EIL   FT K+L
  S:     2 IDAKVLIEKAFEAQKFCYTPYSNFNVGAALLCDDGTIYQGCNIENAAFTPTNCAERTAFFKAISEGKKEFTAIAVVGNKKGVKPGEGDFCAPCAVCRQVMAEFCDLKTFKIIIAKSTEEYLEHTLEEILPLAFTGKNL 139
>gi|157771366|ref|XP_001677503.1| Hypothetical protein CBG22709 [Caenorhabditis briggsae AF16] >gi|187021550|emb|CAP39239.1| C. briggsae CBR-CDD-1 protein [Caenorhabditis briggsae] (158 aa)
Score = 187, Expect = 5.0e-13, Identities = 47/123 (38%), Positives = 67/123 (54%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           K  E +E AY  YS F+V A++   D     G N EN+SY  T+C ER+A+ TA++ GH+    I + T+     +PCG+CRQF+ EF   D   I   +   + I+ T   +L   FT K LD
  S:    18 KAVEAMERAYCKYSNFKVGAALVCEDGEIIIGANHENASYGATICAERSAVVTALTKGHRKFKMIAIATELEEPCSPCGICRQFLIEF--GDYKVILGSSTSDQIIETTSYGLLPYAFTPKSLD 139
>gi|56963445|ref|YP_175176.1| cytidine deaminase [Bacillus clausii KSM-K16] >gi|56909688|dbj|BAD64215.1| cytidine deaminase [Bacillus clausii KSM-K16] (138 aa)
Score = 187, Expect = 5.0e-13, Identities = 41/116 (35%), Positives = 64/116 (55%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           ++AYVPYS F V A++   D S   G N+EN++Y +  C ER A+  A   G K    + +  D+    +PCG CRQ ++E     +  +Y+ N +G   + T+ E+L G F  +DL
  S:    15 KDAYVPYSSFAVGAALLLEDGSVVLGGNIENAAYSLANCAERTALFKAYRAGQKPFKAMAVAADTPGPVSPCGACRQVLAELCPP-EMPVYLCNLKGNVKQTTVEELLPGFFKAEDL 130
>gi|77920129|ref|YP_357944.1| cytidine deaminase [Pelobacter carbinolicus DSM 2380] >gi|77546212|gb|ABA89774.1| cytidine deaminase [Pelobacter carbinolicus DSM 2380] (136 aa)
Score = 186, Expect = 6.1e-13, Identities = 35/85 (41%), Positives = 54/85 (63%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           ++  E +Y PYS+F V A++  AD S   G N+EN+SY +TLC ER A++ AV++G ++   + L T +     PCG C Q ++EF
  S:    17 RQAAEKSYSPYSRFAVGAALLAADGSIATGCNIENASYGLTLCAERVAMARAVADGQRHFIALLLFTATAHPTPPCGACLQMLAEF 102
>gi|157273386|gb|ABV27285.1| cytidine deaminase [Candidatus Chloracidobacterium thermophilum] (142 aa)
Score = 186, Expect = 6.3e-13, Identities = 39/116 (33%), Positives = 63/116 (54%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E AY PYS F V +  +A     Y G N+EN+S+ +T+C E+ A+  A+S G +    + + TD+ T   PCG CRQ + EF    D  +   + +GK  ++++  +L   F  + L
  S:    17 EYAYAPYSGFSVGAAIQAQSGQLYTGCNIENASFGLTVCAEQVALFKALSEGERQFEAVAIATDAATPTPPCGACRQVLWEF--CGDIRVISASSQGKTAEWSLAALLPAAFDNRSL 131
>gi|146276331|ref|YP_001166490.1| cytidine deaminase [Rhodobacter sphaeroides ATCC 17025] >gi|145554572|gb|ABP69185.1| cytidine deaminase [Rhodobacter sphaeroides ATCC 17025] (130 aa)
Score = 186, Expect = 6.5e-13, Identities = 42/119 (35%), Positives = 69/119 (57%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           V ENAY PYS+F+V A++  A  + + G NVEN +YP   C E  AI+  V+ G   I ++ ++ DS     PCG CRQ ++EF  + +  + +   +G+ ++ T+ ++L G F    +D
  S:    10 VRENAYAPYSRFKVGAALRTASGTVHAGCNVENVAYPEGTCAEAGAIAAMVAAGETRIAEMVVIADSPDPVPPCGGCRQKIAEF-AAPEVPVTLCTTDGQSLRTTVADLLPGVFRAAHMD 128
>gi|126461024|ref|YP_001042138.1| cytidine deaminase [Rhodobacter sphaeroides ATCC 17029] >gi|126102688|gb|ABN75366.1| cytidine deaminase [Rhodobacter sphaeroides ATCC 17029] (130 aa)
Score = 186, Expect = 7.0e-13, Identities = 42/119 (35%), Positives = 68/119 (57%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           V ENAY PYS+F+V A++  A  + + G NVEN +YP   C E  AI+  V+ G   I +I ++ DS     PCG CRQ ++EF    +  + +   +G+ ++ ++ ++L G F    +D
  S:    10 VRENAYAPYSRFKVGAALRTASGAVHAGCNVENVAYPEGTCAEAGAIAAMVAAGETRIAEILVIADSPEPVPPCGGCRQKIAEF-AGPEVPVTLCTIDGQSLRTSVADLLPGSFRAAHMD 128
>gi|77462135|ref|YP_351639.1| cytidine deaminase [Rhodobacter sphaeroides 2.4.1] >gi|77386553|gb|ABA77738.1| cytidine deaminase [Rhodobacter sphaeroides 2.4.1] (134 aa)
Score = 186, Expect = 7.2e-13, Identities = 42/119 (35%), Positives = 68/119 (57%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           V ENAY PYS+F+V A++  A  + + G NVEN +YP   C E  AI+  V+ G   I +I ++ DS     PCG CRQ ++EF    +  + +   +G+ ++ ++ ++L G F    +D
  S:    14 VRENAYAPYSRFKVGAALRTASGAVHAGCNVENVAYPEGTCAEAGAIAAMVAAGETRIAEILVIADSPEPVPPCGGCRQKIAEF-AGPEVPVTLCTIDGQSLRTSVADLLPGSFRAAHMD 132
>gi|84514420|ref|ZP_01001784.1| Cytidine deaminase [Loktanella vestfoldensis SKA53] >gi|84511471|gb|EAQ07924.1| Cytidine deaminase [Loktanella vestfoldensis SKA53] (146 aa)
Score = 186, Expect = 7.4e-13, Identities = 47/127 (37%), Positives = 74/127 (58%)
  Q:     2 SEINLNTIFIKL----KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           S++    +F+ L    + V ENAY PYSKF+V A+I  A  + Y G NVEN +YP   C E  AI+  ++ G   I ++ ++ DS    +PCG CRQ ++EF    D ++ +   +G   + T+ ++L G F
  S:     8 SDLTQPEVFMSLIDNARAVRENAYAPYSKFKVGAAIRSASGTIYTGCNVENVAYPEGTCAEAGAIAAMIAGGDTRIAEVAVIADSPKPVSPCGGCRQKIAEFAHG-DVAVTLATMDGIVQRTTVADLLPGSF 138
>gi|157364141|ref|YP_001470908.1| cytidine deaminase [Thermotoga lettingae TMO] >gi|157314745|gb|ABV33844.1| cytidine deaminase [Thermotoga lettingae TMO] (127 aa)
Score = 185, Expect = 8.1e-13, Identities = 41/114 (35%), Positives = 65/114 (57%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           + ++ AYVPYS FRV A +       + G NVEN+SY +++C ER AI + +++G + I  + ++ D+    +PCG CRQ MSEF    D  + + N  G  I   + ++L   F
  S:    12 DAMKRAYVPYSNFRVGAVVVSKSGKIFTGCNVENASYGLSICAERVAIFSTIASGEE-IEKLVVVADTPQPVSPCGACRQVMSEF---GDFEVVLANTNGDIITTKVSDLLPHAF 122
>gi|116512241|ref|YP_809457.1| cytidine deaminase [Lactococcus lactis subsp. cremoris SK11] >gi|125623894|ref|YP_001032377.1| Cdd protein [Lactococcus lactis subsp. cremoris MG1363] >gi|116107895|gb|ABJ73035.1| cytidine deaminase [Lactococcus lactis subsp. cremoris SK11] >gi|124492702|emb|CAL97656.1| Cdd protein [Lactococcus lactis subsp. cremoris MG1363] (130 aa)
Score = 183, Expect = 1.3e-12, Identities = 41/124 (33%), Positives = 68/124 (54%)
  Q:     9 IFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKD 132
           + +  +E    AYVPYS F V A+   AD     G N+EN+S+ ++ C ER AI  A+S G K+   +Y+  ++    +PCG CRQ ++EF  + D  +Y+ + + K  + ++  +L   F   D
  S:     7 MIVAAREAASLAYVPYSHFPVGAAFLTADGQVIKGCNIENASFGLSNCAERTAIFKAISEGVKDFDALYVFGETEEPISPCGACRQVLAEFCPA-DMPVYLISKDDKVKETSVEGLLPYSFKSLD 130
>gi|116754765|ref|YP_843883.1| cytidine deaminase [Methanosaeta thermophila PT] >gi|116666216|gb|ABK15243.1| cytidine deaminase [Methanosaeta thermophila PT] (388 aa)
Score = 183, Expect = 1.5e-12, Identities = 41/112 (36%), Positives = 60/112 (53%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           + AY PYSKFRV A++       Y G NVEN+S    +C ER A++TAV+ G +    + +  + +   TPCG+CRQ M EF + D   + +    G  +     E+L   FT
  S:   271 DQAYAPYSKFRVGAAVLCGSGKIYKGANVENASSGAGICAERVAMATAVAAGEREFVALAVAGELSKPITPCGICRQMMIEFGDMD---VVMVGSNGDALMVRASELLPDAFT 380
>gi|86355850|ref|YP_467742.1| cytidine deaminase [Rhizobium etli CFN 42] >gi|86279952|gb|ABC89015.1| cytidine deaminase protein [Rhizobium etli CFN 42] (129 aa)
Score = 183, Expect = 1.6e-12, Identities = 40/109 (36%), Positives = 59/109 (54%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           A+ PYSKF V +  +A+D   Y G N+EN S+P   C E  AIS  +  G + I ++ ++ +      PCG CRQ +SEF  + D  IY+ +  G     T+ E+L   F
  S:    16 AHAPYSKFPVGAAIRAEDGKIYTGANIENLSFPQGWCAEPTAISAMIMGGARKIVEMAVIAEKLPLCPPCGGCRQKISEF-AAKDTKIYLCDEAGVQKTMTMEELLPFSF 124
>gi|51598871|ref|YP_073059.1| cytidine deaminase [Borrelia garinii PBi] >gi|51573442|gb|AAU07467.1| cytidine deaminase [Borrelia garinii PBi] (146 aa)
Score = 182, Expect = 2.1e-12, Identities = 49/129 (37%), Positives = 73/129 (56%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI----FNWEGKYIK-YTIGEILKGRFTKKDL 133
           ++N  F   ++   N+Y PYSKF+V    K   + F+ G NVEN+S+  T C ER+AIS  ++       D +LL +++  A PC +C Q M+EF + D   I      FN      K YT+ ++LK  F KK+L
  S:     8 DINKAFYMAEKARNNSYSPYSKFKVGVCIKTKTNEFFIGTNVENASFGATCCAERSAISNMIAKIGVQTID-FLLLNTSPEAIPCAICLQVMAEFFDQDTKIIITESKSFNENKMPTKIYTLKDLLKVPFDKKEL 141
>gi|46198691|ref|YP_004358.1| cytidine deaminase [Thermus thermophilus HB27] >gi|55980704|ref|YP_144001.1| cytidine deaminase [Thermus thermophilus HB8] >gi|46196314|gb|AAS80731.1| cytidine deaminase [Thermus thermophilus HB27] >gi|55772117|dbj|BAD70558.1| cytidine deaminase [Thermus thermophilus HB8] (124 aa)
Score = 182, Expect = 2.1e-12, Identities = 33/86 (38%), Positives = 52/86 (60%)
  Q:    13 LKEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           LK  +  AY PYS F V ++ +A+   + GVNVEN+S+P++ C ERNA++  V  G + +  +++ +       PCG CRQ + EF
  S:    10 LKAHVGRAYAPYSGFPVVALVEAEGEVFLGVNVENASFPLSQCAERNAVAAMVLAGKRRLERVHVYSPKGPIP-PCGGCRQVLMEF 94
>gi|159043379|ref|YP_001532173.1| cytidine deaminase [Dinoroseobacter shibae DFL 12] >gi|157911139|gb|ABV92572.1| cytidine deaminase [Dinoroseobacter shibae DFL 12] (130 aa)
Score = 181, Expect = 2.2e-12, Identities = 44/120 (36%), Positives = 67/120 (55%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           + V ENAY PYS+F+V A+I  A  + Y G NVEN +YP   C E  AI+  V+ G   +T++ ++ DS +   PCG CRQ + EF  + +  + +    G     T+ E+L G F +  +
  S:     8 RAVRENAYAPYSEFKVGAAIRAASGAVYTGCNVENVAYPEGTCAEAGAIAAMVAAGETVLTEVAVIADSPSPVPPCGGCRQKLREF-GAPETVVTLGTTGGARASMTLSELLPGAFDQSHM 127
>gi|160937135|ref|ZP_02084498.1| hypothetical protein CLOBOL_02026 [Clostridium bolteae ATCC BAA-613] >gi|158440036|gb|EDP17784.1| hypothetical protein CLOBOL_02026 [Clostridium bolteae ATCC BAA-613] (176 aa)
Score = 180, Expect = 3.0e-12, Identities = 39/109 (35%), Positives = 60/109 (55%)
  Q:    20 AYVPYSKFRVAS--ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT----DSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +Y PYS F V++  +C+ D   Y G N+EN++Y   +C ER A + AVS G +    I +       +  +  PCG+CRQ M EF   D   I +     +Y +YT+ ++L   F
  S:    55 SYAPYSHFHVSAALLCR-DGKVYTGNNIENAAYSPGICAERCAFAKAVSEGEREFEAIVICGGPDGKAGDYCPPCGVCRQVMREFCNPDSFCIILAKSAEEYREYTLAQLLPESF 168
>gi|160878912|ref|YP_001557880.1| cytidine deaminase [Clostridium phytofermentans ISDg] >gi|160427578|gb|ABX41141.1| cytidine deaminase [Clostridium phytofermentans ISDg] (175 aa)
Score = 180, Expect = 3.1e-12, Identities = 41/119 (34%), Positives = 65/119 (54%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSN----TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +++ +Y PYS F V A++    +  Y G N+EN+++  T C ER A   AVS G K+   I ++         +  PCG+CRQ M EF +     I +   E  Y  YT+ +IL   F+ K+++
  S:    50 MLKRSYAPYSSFHVGAALLTKTNKIYTGCNIENATFTPTNCAERTAFFKAVSEGEKDFVAIAVVGGRKGNIIDYCPPCGVCRQVMMEFCDPKKFIIILAKSEEDYCAYTLADILPLGFSAKNIE 173
>gi|160931536|ref|ZP_02078931.1| hypothetical protein CLOLEP_00368 [Clostridium leptum DSM 753] >gi|156869407|gb|EDO62779.1| hypothetical protein CLOLEP_00368 [Clostridium leptum DSM 753] (138 aa)
Score = 180, Expect = 3.3e-12, Identities = 43/120 (35%), Positives = 62/120 (51%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL-----TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           E  +NAY PYS F V A++   +   Y G N+EN+++  T CGER A   AVS G +    I +       +      PCG+CRQ M+EF + +   I +    G    Y + E+L   F K  L+
  S:    12 EARKNAYAPYSHFAVGAALLTKNGKVYTGCNIENAAFSPTSCGERTAFFKAVSEGEREFLAIAVAGGRTGENPENPCPPCGVCRQVMAEFCDPETFEILLATENGVEEAYLLKELLPRGFRKSRLE 137
>gi|114051311|ref|NP_001040110.1| cytidine deaminase [Bombyx mori] >gi|87248087|gb|ABD36096.1| cytidine deaminase [Bombyx mori] (186 aa)
Score = 180, Expect = 3.5e-12, Identities = 36/103 (34%), Positives = 61/103 (59%)
  Q:     6 LNTIFIKLKEVIENAYVPYSKFRV--ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD-DCSIYI 108
           +  + ++  ++ + AY PYS F V  A + + D   Y G N+ENS+   ++C ER+A++ AV +G+     + ++     F  PCG+CRQ ++EF  SD D  IY+
  S:    50 VQNLLMEAVKIRKRAYCPYSNFSVGAAILTEEDSRMYAGCNIENSTLTPSMCAERSAVAKAVCDGYTKFKCVAIVAHQREFTAPCGVCRQTLNEFCSSDGDIEIYL 155
>gi|126740716|ref|ZP_01756402.1| cytidine deaminase [Roseobacter sp. SK209-2-6] >gi|126718231|gb|EBA14947.1| cytidine deaminase [Roseobacter sp. SK209-2-6] (130 aa)
Score = 179, Expect = 4.3e-12, Identities = 43/113 (38%), Positives = 64/113 (56%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           V ENA+ PYS F+V A++     + Y G NVEN +YP   C E  AI+  V+ G   + ++Y++ DS     PCG CRQ + EF  + +  + +   EG   + TIG++L G F
  S:    10 VRENAHAPYSNFKVGAALRTPSGNVYVGCNVENVAYPEGTCAEAGAIAAMVAAGETELAEVYVVADSPDPVPPCGGCRQKLKEF-GTGEVKVTMGTVEGLERETTIGDLLPGAF 122
>gi|99081413|ref|YP_613567.1| cytidine deaminase [Silicibacter sp. TM1040] >gi|99037693|gb|ABF64305.1| cytidine deaminase [Silicibacter sp. TM1040] (164 aa)
Score = 179, Expect = 4.5e-12, Identities = 41/121 (33%), Positives = 68/121 (56%)
  Q:    16 VIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           V +NA+ PYS F+V +  +A   + Y G NVEN +YP   C E  AI+  V+ G   + + Y++ D  +   PCG CRQ + EF  + + ++ +   +G  ++ TIG++L G F    ++ S
  S:    44 VRQNAHAPYSNFKVGAAIRAKSGTVYVGCNVENVAYPEGTCAEAGAIAAMVAAGETELLEAYVIADCPSPVPPCGGCRQKLKEFGAA-EVAVTLATTDGVEMQTTIGDLLPGAFDAGHMERS 164
>gi|125974091|ref|YP_001038001.1| cytidine deaminase [Clostridium thermocellum ATCC 27405] >gi|196251521|ref|ZP_03150190.1| cytidine deaminase [Clostridium thermocellum DSM 4150] >gi|125714316|gb|ABN52808.1| cytidine deaminase [Clostridium thermocellum ATCC 27405] >gi|196199133|gb|EDX93961.1| cytidine deaminase [Clostridium thermocellum DSM 4150] (138 aa)
Score = 178, Expect = 5.5e-12, Identities = 41/117 (35%), Positives = 62/117 (52%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL-----TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + +Y PYS F V A++   D   Y G N+EN++Y  + C ER A   AVS G +  + I ++      D+     PCG+CRQ M EF +     + +      Y  +T+ +IL   F  KDL+
  S:    15 KQSYSPYSHFAVGAALLSKDGRLYTGCNIENAAYTPSNCAERTAFFKAVSEGVREFSAIAIVGGPEGADTLALCAPCGVCRQVMMEFCDPKTFEVILAKDPQHYEIFTLEQILPMGFGPKDLE 137
>gi|116249967|ref|YP_765805.1| cytidine deaminase [Rhizobium leguminosarum bv. viciae 3841] >gi|167361816|ref|ZP_02296381.1| cytidine deaminase [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|115254615|emb|CAK05689.1| putative cytidine deaminase (cytidine aminohydrolase) [Rhizobium leguminosarum bv. viciae 3841] >gi|167071343|gb|EDR75254.1| cytidine deaminase [Rhizobium leguminosarum bv. trifolii WSM1325] (129 aa)
Score = 178, Expect = 5.9e-12, Identities = 40/109 (36%), Positives = 58/109 (53%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           A+ PYSKF V +  +A+D   Y G N+EN S+P   C E  AI   +  G K I ++ ++ +      PCG CRQ +SEF  S +  IY+ +  G     T+ E+L   F
  S:    16 AHAPYSKFPVGAAIRAEDGKVYTGANIENLSFPQGWCAEPTAIGAMIMGGAKKIVEMAVIAEKLPLCPPCGGCRQKISEF-ASKETKIYLCDEAGVKKTMTMEELLPFSF 124
>gi|85720001|gb|ABC75569.1| cytidine deaminase [Ictalurus punctatus] (114 aa)
Score = 178, Expect = 6.3e-12, Identities = 42/113 (37%), Positives = 64/113 (56%)
  Q:    25 SKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS-NTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSV 137
           SKFRV A++   D + + G NVEN    + +C E+ AIS AVS GH+    I + +D  + F +PCG CRQ M EF       +Y+   +G + K T+ ++L   F  +DL  ++
  S:     1 SKFRVGAALLTQDGTVFTGCNVENVCLTLGICAEQVAISKAVSAGHRKFKAIAISSDMVDNFISPCGGCRQVMREF--GLQWEVYMSKPDGSFKKMTVNDLLPESFGPEDLQKNI 113
>gi|86137397|ref|ZP_01055974.1| cytidine deaminase [Roseobacter sp. MED193] >gi|85825732|gb|EAQ45930.1| cytidine deaminase [Roseobacter sp. MED193] (130 aa)
Score = 177, Expect = 6.6e-12, Identities = 43/113 (38%), Positives = 65/113 (57%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           V +NA+ PYS F V A+I  +  + Y G NVEN +YP   C E  AI+  V+ G + + ++Y++ DS     PCG CRQ + EF  + D  + +   +G   + TIG++L G F
  S:    10 VRKNAHAPYSNFLVGAAIRTSAGNTYVGCNVENVAYPEGTCAEAGAIAAMVAAGERELAEVYVVADSPEPVPPCGGCRQKLKEF-GAGDVKVTMGTLDGVEQETTIGDLLPGAF 122
>gi|148658474|ref|YP_001278679.1| cytidine deaminase [Roseiflexus sp. RS-1] >gi|148570584|gb|ABQ92729.1| cytidine deaminase [Roseiflexus sp. RS-1] (136 aa)
Score = 177, Expect = 6.7e-12, Identities = 39/117 (33%), Positives = 62/117 (52%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + AY PYS+F V A+   A    + G N+EN++YP T+C ER A+  A + G + I  + ++ D+    +PCG CRQ + E   +    + + N  G +    IGE+L   F+    D
  S:    20 QRAYCPYSRFAVGAAALTASGVTFPGCNIENAAYPSTICAERVALFNAYAAGEREIVALAVIADTPGPVSPCGGCRQVIFEL--APRAIVVMANLRGAWRVALIGELLPDGFSSASFD 135
>gi|153811575|ref|ZP_01964243.1| hypothetical protein RUMOBE_01967 [Ruminococcus obeum ATCC 29174] >gi|149832316|gb|EDM87401.1| hypothetical protein RUMOBE_01967 [Ruminococcus obeum ATCC 29174] (169 aa)
Score = 177, Expect = 8.1e-12, Identities = 42/114 (36%), Positives = 63/114 (55%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSN----TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +Y PYS F V A++   + ++Y G N+EN++Y  T C ER A   AVS G K    I ++   +     +A PCG+CRQ M EF + +   I +   + KY  +T+ E+    F   DL
  S:    50 SYAPYSHFHVGAALLAKNGTYYTGCNIENAAYTPTNCAERTAFFKAVSEGVKEFQAICVVGGRDGVLTGYAAPCGVCRQVMMEFCDPETFQIILAVSKDKYDVFTLRELFPLGFGPADL 168
>gi|153852952|ref|ZP_01994389.1| hypothetical protein DORLON_00374 [Dorea longicatena DSM 13814] >gi|149754594|gb|EDM64525.1| hypothetical protein DORLON_00374 [Dorea longicatena DSM 13814] (150 aa)
Score = 176, Expect = 8.6e-12, Identities = 44/119 (36%), Positives = 66/119 (55%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSN----TFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E ++ +Y PYS F+V A++   + + Y G N+EN++Y  T C ER A   AVS G K    I ++   N     +A PCG+CRQ M EF + ++  I +      Y  YT+ E+L   F   +L
  S:    21 EQLKYSYTPYSGFKVGAALLAKNGTVYTGCNIENAAYTPTNCAERTAFFKAVSEGVKEFDAICIVGGKNGVLTEYAPPCGVCRQVMMEFCDPEEFQIILATDVEHYDIYTLKELLPLGFGPGNL 144
>gi|15790030|ref|NP_279854.1| cytidine deaminase [Halobacterium sp. NRC-1] >gi|169235754|ref|YP_001688954.1| cytidine deaminase [Halobacterium salinarum R1] >gi|10580458|gb|AAG19334.1| cytidine aminohydrolase [Halobacterium sp. NRC-1] >gi|167726820|emb|CAP13606.1| cytidine deaminase [Halobacterium salinarum R1] (134 aa)
Score = 176, Expect = 8.7e-12, Identities = 41/114 (35%), Positives = 67/114 (58%)
  Q:    21 YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWE--GKYIKYTIGEILKGRFTKKDLD 134
           +VPYS+++V A++  A  + Y G N+EN++Y  +L  E  A+  AVS G  +   + + +      TPCGMCRQ ++EF  +DD +I   + +     + YT+GE+L    T  +LD
  S:    18 HVPYSEYKVGAALDTASGAVYTGCNIENANYSNSLHAEEVAVGKAVSAGDTDFQRLAVTSSQRDAVTPCGMCRQTLAEF-AADDLTILCDSGDDTAGVVTYTLGELLPDTITASNLD 133
>gi|111115448|ref|YP_710066.1| cytidine deaminase [Borrelia afzelii PKo] >gi|167942337|ref|ZP_02529411.1| cytidine deaminase [Borrelia afzelii ACA-1] >gi|110890722|gb|ABH01890.1| cytidine deaminase [Borrelia afzelii PKo] (146 aa)
Score = 176, Expect = 1.1e-11, Identities = 47/129 (36%), Positives = 73/129 (56%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI----FNWEGKYIK-YTIGEILKGRFTKKDL 133
           +++  F   ++   N+Y PYSKF+V    K   + F+ G NVEN+S+  T C ER+AIS  ++       D +LL +++  A PC +C Q M+EF + D   I      FN      K YT+ ++LK  F +K+L
  S:     8 DIDKAFYMAEKARNNSYSPYSKFKVGVCIKTKTNEFFIGTNVENASFGATCCAERSAISNMIAKIGVQTID-FLLLNTSPEAIPCAICLQVMAEFFDQDTKIIITESKSFNENKMPTKIYTLKDLLKVPFDRKEL 141
>gi|154505034|ref|ZP_02041772.1| hypothetical protein RUMGNA_02544 [Ruminococcus gnavus ATCC 29149] >gi|153794513|gb|EDN76933.1| hypothetical protein RUMGNA_02544 [Ruminococcus gnavus ATCC 29149] (153 aa)
Score = 175, Expect = 1.1e-11, Identities = 42/116 (36%), Positives = 62/116 (53%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL-----TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E +Y PYS F+V A++   + + Y G N+EN++Y  T C ER A+  AVS G K    I ++     +       PCG+CRQ M EF +  +  I + +  G     T+ EIL   F   +L
  S:    28 ERSYSPYSGFQVGAALLAENGTVYLGCNIENAAYSATNCAERTALFQAVSEGVKEFRAIAIVGGPKGSKKGELCAPCGVCRQVMMEFCDPKEFQIVLEDGNGGCFAKTLEEILPFGFGPANL 149
>gi|170735212|ref|YP_001774326.1| cytidine deaminase [Burkholderia cenocepacia MC0-3] >gi|169821250|gb|ACA95831.1| cytidine deaminase [Burkholderia cenocepacia MC0-3] (129 aa)
Score = 175, Expect = 1.1e-11, Identities = 40/116 (34%), Positives = 66/116 (56%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           K   E AY PYS+F+V A++   D + ++G NVEN+SY +  C ER A+  A++ G++  +   + ++ D++    PCG CRQ + E +   D  + + N +G     T   +L G FT
  S:    11 KAARERAYAPYSRFKVGAALLARDGTVFHGCNVENASYGLCNCAERTALFAAIAAGYRPGDFARLAVVGDTDGPIAPCGACRQVIIE-IGKPDIEVILTNLKGAVEITTAHALLPGAFT 128
>gi|194561813|ref|YP_002096837.1| Cytidine deaminase [Burkholderia cenocepacia PC184] >gi|124879962|gb|EAY67318.1| Cytidine deaminase [Burkholderia cenocepacia PC184] (129 aa)
Score = 175, Expect = 1.2e-11, Identities = 40/116 (34%), Positives = 66/116 (56%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           K   E AY PYS+F+V A++   D + ++G NVEN+SY +  C ER A+  A++ G++  +   + ++ D++    PCG CRQ + E +   D  + + N +G     T   +L G FT
  S:    11 KAARERAYAPYSRFKVGAALLARDGTVFHGCNVENASYGLCNCAERTALFAAIAAGYRPGDFARLAVVGDTDGPIAPCGACRQVIIE-IGKPDIEVILANLKGAVEITTAHALLPGAFT 128
>gi|159041314|ref|YP_001540566.1| cytidine deaminase [Caldivirga maquilingensis IC-167] >gi|157920149|gb|ABW01576.1| cytidine deaminase [Caldivirga maquilingensis IC-167] (130 aa)
Score = 175, Expect = 1.2e-11, Identities = 42/119 (35%), Positives = 72/119 (60%)
  Q:    11 IKLKE-VIENAYVPYSKFRVASIC-KADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           I+L E  + N+Y PYS  +VA++   +D   + GVNVENSSY +T+C ER A+  AV+ G++ I  + ++++ +    PCG C Q M+EF   +   +Y+ +  G   ++ + E+L   F+
  S:     9 IQLAESYLSNSYSPYSGIKVAAVAITSDGKMFPGVNVENSSYGLTICAERVAVFRAVTEGYRRIKAVVVVSNRDEI-YPCGACLQVMAEFNVEE---VYVAS-RGGIKRFKLSELLPRPFS 124
>gi|107023141|ref|YP_621468.1| cytidine deaminase, homotetrameric [Burkholderia cenocepacia AU 1054] >gi|116686619|ref|YP_839866.1| cytidine deaminase [Burkholderia cenocepacia HI2424] >gi|105893330|gb|ABF76495.1| cytidine deaminase [Burkholderia cenocepacia AU 1054] >gi|116652334|gb|ABK12973.1| cytidine deaminase [Burkholderia cenocepacia HI2424] (129 aa)
Score = 175, Expect = 1.2e-11, Identities = 40/116 (34%), Positives = 66/116 (56%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           K   E AY PYS+F+V A++   D + ++G NVEN+SY +  C ER A+  A++ G++  +   + ++ D++    PCG CRQ + E +   D  + + N +G     T   +L G FT
  S:    11 KAARERAYAPYSRFKVGAALLARDGTVFHGCNVENASYGLCNCAERTALFAAIAAGYRPGDFARLAVVGDTDGPIAPCGACRQVIIE-IGKPDIEVILTNLKGAVEITTARALLPGAFT 128
>gi|167644684|ref|YP_001682347.1| cytidine deaminase [Caulobacter sp. K31] >gi|167347114|gb|ABZ69849.1| cytidine deaminase [Caulobacter sp. K31] (142 aa)
Score = 175, Expect = 1.3e-11, Identities = 36/89 (40%), Positives = 49/89 (55%)
  Q:    18 ENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSI 106
           E +Y  YS F VA+ +   D   + GVNVEN++YP   C E+ AI   V+ G + I  + +   SN    PCG CRQ ++EF   D C I
  S:    26 ERSYARYSNFTVAAAVIDQDGRAHLGVNVENAAYPSGTCAEQTAIGAMVTAGGRGIARVLIAAGSNAVVQPCGACRQRIAEF-AVDTCEI 114
>gi|158288327|ref|XP_310208.3| AGAP009489-PA [Anopheles gambiae str. PEST] >gi|157019197|gb|EAA05898.3| AGAP009489-PA [Anopheles gambiae str. PEST] (156 aa)
Score = 175, Expect = 1.4e-11, Identities = 41/105 (39%), Positives = 61/105 (58%)
  Q:     4 INLNTIFIKLKEVIE-------NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           +  +T+   +KE+IE       NAY PYS F V A++         G NVEN ++  ++C ER A+  A+S GH+  T + +     N F  PCG CRQ ++EF  + D  IY+
  S:    15 VEYSTVDSSVKELIEAAIQVRNNAYCPYSNFPVGAALRTTTGEIVTGCNVENGTFGPSVCAERTAVCKAISEGHREFTAVAVAAYQENEFTAPCGTCRQTLAEF-SAKDIPIYL 127
>gi|187918477|ref|YP_001884040.1| cytidine deaminase [Borrelia hermsii DAH] >gi|119861325|gb|AAX17120.1| cytidine deaminase [Borrelia hermsii DAH] (151 aa)
Score = 174, Expect = 1.7e-11, Identities = 47/115 (40%), Positives = 69/115 (60%)
  Q:    19 NAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI-----FNWEGKYIK-YTIGEILKGRFTKKDL 133
           NAY PYSKF+V +  K  D+ F+ G NVEN+S+  T C E+ A+   +S+      D ++L  +   + PC +CRQ MSEF E ++  I I     FN      + YT+ ++LK  F KK+L
  S:    22 NAYSPYSKFKVGACIKTKDNLFFQGSNVENASFGATRCAEQAAMMNMISSVGTQEID-FILIATTPASVPCAICRQVMSEFFE-ENTKILITDPNQFNATKTISQTYTLNDLLKVPFNKKEL 141
>gi|156550885|ref|XP_001602321.1| PREDICTED: similar to GA21017-PA [Nasonia vitripennis] (532 aa)
Score = 174, Expect = 1.7e-11, Identities = 35/79 (44%), Positives = 51/79 (64%)
  Q:    20 AYVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS--NTFATPCGMCRQFMSEF 98
           +Y PYSKF V S  + AD S   G NVEN+S+  ++C ER A++ A+S G ++   I ++ +S      TPCG+CRQ + EF
  S:   409 SYSPYSKFAVGSALRCADGSIRTGCNVENASFSASICAERCALTKAISEGQQDFHSISVVANSIDGRLTTPCGVCRQMLCEF 490
>gi|108804344|ref|YP_644281.1| cytidine deaminase [Rubrobacter xylanophilus DSM 9941] >gi|108765587|gb|ABG04469.1| cytidine deaminase [Rubrobacter xylanophilus DSM 9941] (134 aa)
Score = 174, Expect = 1.7e-11, Identities = 42/111 (37%), Positives = 56/111 (50%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAV-SNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           PYS FRV A++   D + Y G NVEN+SY +++C ERNA+   V   G + I  + + +       PCG CRQ + EF     C   I    G    Y   EIL   F  +DL
  S:    26 PYSGFRVGAALVTGDGALYSGCNVENASYGLSVCAERNAVGAMVLGGGDRRIEFVAVHSPRAAPCLPCGACRQVLREF----GCRAVIVEEGGALRAYPFEEILPNAFGPEDL 134
>gi|159029741|emb|CAO87819.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (133 aa)
Score = 174, Expect = 1.8e-11, Identities = 33/85 (38%), Positives = 52/85 (61%)
  Q:    14 KEVIENAYVPYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL----TDSNTFATPCGMCRQFMSEF 98
           +EV + +Y PYS+FRV +    D   Y G NVEN+SY ++LC ER  ++  ++ G + +  I +      D  +  TPCG CRQ+++E 
  S:    16 REVAKLSYSPYSRFRVGAAVLTDKKIYAGTNVENASYGLSLCAERATLAQIIAAGDQKVRAIAIACIDGKDDISQLTPCGACRQWIAEL 104
>gi|24582744|ref|NP_609197.2| CG8349 CG8349-PA [Drosophila melanogaster] >gi|22947095|gb|AAF52623.2| CG8349-PA [Drosophila melanogaster] (264 aa)
Score = 173, Expect = 2.0e-11, Identities = 37/89 (41%), Positives = 54/89 (60%)
  Q:    20 AYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           AY PYSKF+V +  +A     Y G N+EN ++    C ER A++  +S G K  T   ++    + F TPCG+CRQF+ EF++ +D  IYI
  S:   137 AYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEKKYTAGAVVAYHPDGFTTPCGVCRQFILEFIQ-NDIPIYI 226
>gi|28317287|gb|AAL68088.2| AT17318p [Drosophila melanogaster] (286 aa)
Score = 173, Expect = 2.2e-11, Identities = 37/89 (41%), Positives = 54/89 (60%)
  Q:    20 AYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           AY PYSKF+V +  +A     Y G N+EN ++    C ER A++  +S G K  T   ++    + F TPCG+CRQF+ EF++ +D  IYI
  S:   159 AYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEKKYTAGAVVAYHPDGFTTPCGVCRQFILEFIQ-NDIPIYI 248
>gi|6323274|ref|NP_013346.1| Cytidine deaminase; catalyzes the modification of cytidine to uridine in vitro but native RNA substrates have not been identified, localizes to both the nucleus and cytoplasm; Cdd1p [Saccharomyces cerevisiae] >gi|2493559|sp|Q06549|CDD_YEAST Cytidine deaminase (CDA) (Cytidine aminohydrolase) >gi|49258659|pdb|1R5T|A Chain A, The Crystal Structure Of Cytidine Deaminase Cdd1, An Orphan C To U Editase From Yeast >gi|49258660|pdb|1R5T|B Chain B, The Crystal Structure Of Cytidine Deaminase Cdd1, An Orphan C To U Editase From Yeast >gi|49258661|pdb|1R5T|C Chain C, The Crystal Structure Of Cytidine Deaminase Cdd1, An Orphan C To U Editase From Yeast >gi|49258662|pdb|1R5T|D Chain D, The Crystal Structure Of Cytidine Deaminase Cdd1, An Orphan C To U Editase From Yeast >gi|662343|gb|AAB67399.1| Ylr245cp: cytidine deaminase [Saccharomyces cerevisiae] >gi|4140396|gb|AAD04031.1| cytidine deaminase Cdd1p [Saccharomyces cerevisiae] >gi|45269751|gb|AAS56256.1| YLR245C [Saccharomyces cerevisiae] >gi|151941081|gb|EDN59461.1| cytidine deaminase [Saccharomyces cerevisiae YJM789] >gi|190405307|gb|EDV08574.1| cytidine deaminase [Saccharomyces cerevisiae RM11-1a] (142 aa)
Score = 172, Expect = 3.1e-11, Identities = 44/117 (37%), Positives = 66/117 (56%)
  Q:    18 ENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT--DSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDLD 134
           E +Y PYS FRV  SI   +D  + G NVEN+SY   +C ER+A+   +  GH++     ++     +   +PCG+CRQF++EF+   D  I + N  G   K  T+GE+L   F    L+
  S:    23 ELSYSPYSHFRVGCSILTNNDVIFTGANVENASYSNCICAERSAMIQVLMAGHRSGWKCMVICGDSEDQCVSPCGVCRQFINEFV-VKDFPIVMLNSTGSRSKVMTMGELLPMAFGPSHLN 142
>gi|110635980|ref|YP_676188.1| cytidine deaminase [Mesorhizobium sp. BNC1] >gi|110286964|gb|ABG65023.1| cytidine deaminase [Mesorhizobium sp. BNC1] (131 aa)
Score = 171, Expect = 3.5e-11, Identities = 34/99 (34%), Positives = 56/99 (56%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           ++ + +F   K  +E AY PYS+F V +  + D  + + G N+EN+SYP   C E  A+   V  G   +++I ++ +      PCG CRQ +SEF+ +D
  S:     1 MSTDELFAAAKAAMERAYAPYSRFPVGAAIRTDAGAIHAGCNIENASYPEGWCAETTALGHMVMAGGGRVSEIAVVAEKMPKIVPCGGCRQRLSEFVTAD 100
>gi|119953399|ref|YP_945608.1| cytidine deaminase [Borrelia turicatae 91E135] >gi|119862170|gb|AAX17938.1| cytidine deaminase [Borrelia turicatae 91E135] (151 aa)
Score = 171, Expect = 3.7e-11, Identities = 46/115 (40%), Positives = 67/115 (58%)
  Q:    19 NAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI----FNWEGKYIK-YTIGEILKGRFTKKDL 133
           NAY PYSKF+V +  K  D+ F+ G NVEN+S+  T C E+ AI   +S+      D  L+T +   + PC +CRQ MSEF E +   +      FN      + YT+ ++LK  F K++L
  S:    22 NAYSPYSKFKVGACIKTKDNLFFQGSNVENASFGATRCAEQAAIMNMISSVGIQKIDFMLITTTPA-SVPCAICRQVMSEFFEENTKILMTDPNQFNATKTISQTYTLKDLLKIPFNKEEL 141
>gi|13472756|ref|NP_104323.1| cytidine deaminase [Mesorhizobium loti MAFF303099] >gi|14023503|dbj|BAB50109.1| cytidine/deoxycytidine deaminase [Mesorhizobium loti MAFF303099] (130 aa)
Score = 170, Expect = 4.4e-11, Identities = 37/116 (31%), Positives = 61/116 (52%)
  Q:     9 IFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           +F   +  +  AY PYSKF V +  + +D   + G N+E +SYP   C E  A+   +  G   I +I +L +     +PCG CRQ ++EF +  D  +Y+ +  G     T+G++L
  S:     5 LFEAARTAMAKAYAPYSKFPVGAALRTEDGRVFTGANIEVASYPEGWCAETTALGHYIMGGGGKIVEIAVLAERMAKCSPCGGCRQRLAEFCQP-DTKLYLCDNTGVAETVTMGDML 120
>gi|65319213|ref|ZP_00392172.1| COG0295: Cytidine deaminase [Bacillus anthracis str. A2012] (111 aa)
Score = 170, Expect = 4.7e-11, Identities = 33/86 (38%), Positives = 55/86 (63%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFME 100
           +++  AY+PYSKF V A++   +   Y G N+EN+SY +  C ER AI  AVS G ++ + + +  +++   +PCG CRQ ++EF +
  S:    12 KMLSKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIFKAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFCD 98
>gi|34498025|ref|NP_902240.1| cytidine deaminase [Chromobacterium violaceum ATCC 12472] >gi|34103880|gb|AAQ60240.1| cytidine deaminase [Chromobacterium violaceum ATCC 12472] (166 aa)
Score = 170, Expect = 5.1e-11, Identities = 34/79 (43%), Positives = 51/79 (64%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSN-GHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           AY PYS+F V A+I   +   + G NVEN+SY ++ C ER AI  A +N G + +  + + T ++  A+PCG CRQ ++EF
  S:    47 AYAPYSRFTVGAAILDGNGKIHIGCNVENASYGLSNCAERTAIFAARANHGMQEVVAVCIYTPTDKPASPCGACRQVLNEF 127
>gi|146302810|ref|YP_001190126.1| cytidine deaminase [Metallosphaera sedula DSM 5348] >gi|145701060|gb|ABP94202.1| cytidine deaminase [Metallosphaera sedula DSM 5348] (134 aa)
Score = 169, Expect = 5.6e-11, Identities = 40/114 (35%), Positives = 60/114 (52%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           +N+Y PYS  RV A++   +     G NVENSSY +++C ER A+ TAV+ G +    I +     +   PCG CRQ + EF    D  +   +  GK   + + ++L   FT K
  S:    20 KNSYSPYSGIRVGAALVGENGEVILGTNVENSSYGLSICAERVAVFTAVTKGIRKFKKIAISLSDGSGIMPCGACRQVLREF--GRDILVITRDKTGKTTTFYLDDLLPHSFTLK 132
>gi|89096562|ref|ZP_01169454.1| Cytidine deaminase [Bacillus sp. NRRL B-14911] >gi|89088577|gb|EAR67686.1| Cytidine deaminase [Bacillus sp. NRRL B-14911] (132 aa)
Score = 169, Expect = 5.8e-11, Identities = 41/97 (42%), Positives = 58/97 (59%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFN 110
           + V + AY PYS F V A++   D +   GVNVEN S   T C ER AI TA++NG+K  +   I +  ++  F  PC +CRQ ++EF  S D  +Y+ N
  S:    11 RAVKQAAYAPYSNFPVGAALLLKDGTVISGVNVENVSLGATNCAERTAIFTAIANGYKKGDFQAIAVSGNTADFLPPCSICRQVLAEFC-SPDMPVYLTN 109
>gi|56708384|ref|YP_170280.1| cytidine deaminase [Francisella tularensis subsp. tularensis SCHU S4] >gi|89256777|ref|YP_514139.1| cytidine deaminase [Francisella tularensis subsp. holarctica] >gi|110670854|ref|YP_667411.1| cytidine deaminase [Francisella tularensis subsp. tularensis FSC198] >gi|115315168|ref|YP_763891.1| cytidine deaminase [Francisella tularensis subsp. holarctica OSU18] >gi|118497247|ref|YP_898297.1| cytidine deaminase [Francisella tularensis subsp. novicida U112] >gi|134302369|ref|YP_001122338.1| cytidine deaminase [Francisella tularensis subsp. tularensis WY96-3418] >gi|156502939|ref|YP_001429004.1| cytidine deaminase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010728|ref|ZP_02275659.1| cytidine deaminase [Francisella tularensis subsp. holarctica FSC200] >gi|187931977|ref|YP_001891962.1| cytidine deaminase [Francisella tularensis subsp. mediasiatica FSC147] >gi|194323549|ref|ZP_03057326.1| cytidine deaminase [Francisella tularensis subsp. novicida FTE] >gi|56604876|emb|CAG45960.1| cytidine deaminase [Francisella tularensis subsp. tularensis SCHU S4] >gi|89144608|emb|CAJ79927.1| cytidine deaminase [Francisella tularensis subsp. holarctica LVS] >gi|110321187|emb|CAL09343.1| cytidine deaminase [Francisella tularensis subsp. tularensis FSC 198] >gi|115130067|gb|ABI83254.1| cytidine deaminase [Francisella tularensis subsp. holarctica OSU18] >gi|118423153|gb|ABK89543.1| cytidine deaminase [Francisella tularensis subsp. novicida U112] >gi|134050146|gb|ABO47217.1| cytidine deaminase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134253877|gb|EBA52971.1| cytidine deaminase [Francisella tularensis subsp. holarctica 257] >gi|151569248|gb|EDN34902.1| cytidine deaminase [Francisella tularensis subsp. tularensis FSC033] >gi|151571802|gb|EDN37456.1| cytidine deaminase [Francisella tularensis subsp. novicida GA99-3548] >gi|156253542|gb|ABU62048.1| cytidine deaminase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122627|gb|EDO66756.1| cytidine deaminase [Francisella tularensis subsp. holarctica FSC022] >gi|187712886|gb|ACD31183.1| cytidine deaminase [Francisella tularensis subsp. mediasiatica FSC147] >gi|194322404|gb|EDX19885.1| cytidine deaminase [Francisella tularensis subsp. novicida FTE] (133 aa)
Score = 169, Expect = 6.1e-11, Identities = 39/97 (40%), Positives = 57/97 (58%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFN 110
           KE   NAY P+S F+V A++   D +     N+E S   +++C ERNAI  A S G++  +I  I ++ D+    +PCG CRQ MSE +   DC I + N
  S:    14 KEAFNNAYAPFSGFKVGAALLMKDGNIINSANIETSILGLSVCAERNAIFYAYSQGYRKDDIVKIAVVADTEKAISPCGACRQIMSEHLNL-DCPIILTN 112
>gi|151570347|gb|EDN36001.1| cytidine deaminase [Francisella tularensis subsp. novicida GA99-3549] (133 aa)
Score = 169, Expect = 6.4e-11, Identities = 39/97 (40%), Positives = 57/97 (58%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFN 110
           KE   NAY P+S F+V A++   D +     N+E S   +++C ERNAI  A S G++  +I  I ++ D+    +PCG CRQ MSE +   DC I + N
  S:    14 KEAFNNAYAPFSGFKVGAALLMKDGNIINSANIETSILGLSVCAERNAIFYAYSQGYRKDDIVKIAVVADTEKAISPCGACRQIMSEHLNL-DCPIILTN 112
>gi|32477209|ref|NP_870203.1| cytidine deaminase [Rhodopirellula baltica SH 1] >gi|32447760|emb|CAD77278.1| cytidine deaminase [Rhodopirellula baltica SH 1] (166 aa)
Score = 168, Expect = 8.8e-11, Identities = 40/116 (34%), Positives = 63/116 (54%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFN-WEGKYIKYTIGEILKGRFTKKDL 133
           ++AY P+S F V A++   D     G NVEN+SY +T C ER A+ TAV+ G++    + + +     A PCG CRQ ++EF    D  +Y  +  +G      + E+L   F+  D+
  S:    50 DHAYAPHSHFYVGAALLTHDGRIVEGCNVENASYSLTQCAERTAVCTAVAGGYRMFHAVAIASIGG--AMPCGACRQVLAEF--GSDLYVYTIDVIDGDQQMRRLSELLPDAFSTSDI 163
>gi|78212207|ref|YP_380986.1| cytidine deaminase [Synechococcus sp. CC9605] >gi|78196666|gb|ABB34431.1| putative cytidine/deoxycytidine deaminase [Synechococcus sp. CC9605] (128 aa)
Score = 168, Expect = 8.9e-11, Identities = 35/98 (35%), Positives = 57/98 (58%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFA-----TPCGMCRQFMSEFMESD 102
           N  ++ ++ +    +A+ PYS F V +  + +D S   G NVEN+SY +++C ER A+ TA+S G + I       D+ + A      PCG CRQ M E + ++
  S:    11 NAESLLVQARRAASHAHCPYSNFHVGAAVRCEDGSVIDGCNVENASYGLSICAERVALFTAISQGKQPIELAMSCIDAQSDAPPESRMPCGACRQVMQELLPAN 114
>gi|118048839|ref|ZP_01517413.1| Cytidine deaminase, homotetrameric [Chloroflexus aggregans DSM 9485] >gi|117994657|gb|EAV08924.1| Cytidine deaminase, homotetrameric [Chloroflexus aggregans DSM 9485] (136 aa)
Score = 167, Expect = 1.0e-10, Identities = 39/111 (35%), Positives = 63/111 (56%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTI-GEILKGRFTKKDL 133
           PYS+F V A++  A+   + G N+EN+SYP+T+C ER A+  A       +T + ++T + T A+PCG CRQ + E   +    I + N +G   ++T   E+L   F  + L
  S:    23 PYSQFAVGAAVLTANGHIFSGANIENASYPLTICAERVALFCAHMAAAGPVTALAVVTPTPTVASPCGACRQVIFEL--APHAQIVLLNADGSDRRFTTPAELLPYGFGPEQL 133
>gi|83941304|ref|ZP_00953766.1| cytidine deaminase [Sulfitobacter sp. EE-36] >gi|83847124|gb|EAP84999.1| cytidine deaminase [Sulfitobacter sp. EE-36] (131 aa)
Score = 167, Expect = 1.1e-10, Identities = 43/119 (36%), Positives = 65/119 (54%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           V ENAY PYS F+V A++  A  + + G NVEN +YP   C E  AI+  ++ G     + Y++  S T  TPCG CRQ ++EF +  D  + +    G     T+ E+L G F +  ++
  S:    12 VQENAYAPYSNFKVGAALRTASGAVFVGCNVENVAYPEGTCAEAGAIAAMIAAGETAFVEAYVIAGSPTPVTPCGGCRQKLAEFGQG-DARVTMATLSGVEEVMTMAELLPGAFGRAHME 130
>gi|15594963|ref|NP_212752.1| cytidine deaminase (cdd) [Borrelia burgdorferi B31] >gi|167943550|ref|ZP_02530624.1| cytidine deaminase (cdd) [Borrelia burgdorferi Bol26] >gi|2688547|gb|AAC66978.1| cytidine deaminase (cdd) [Borrelia burgdorferi B31] (154 aa)
Score = 167, Expect = 1.1e-10, Identities = 46/133 (34%), Positives = 74/133 (55%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKAD-DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI----FNWEGKYIK-YTIGEILKGRFTKKDL 133
           + + +++  F   ++   N+Y PYSKF+V +  K   + F+ G NVEN+S+  T C ER+AI   ++       D +LL +++    PC +C Q M+EF   D   I      F+     IK YT+ ++LK  F KK+L
  S:     4 LKQEDIDKAFYMAEKARNNSYSPYSKFKVGACIKTKTNDFFIGTNVENASFGATCCAERSAILNMIAKIGVQEID-FLLLNTSPECIPCAICLQVMAEFFNQDTKIIITESKSFSENKTPIKIYTLKDLLKSPFDKKEL 141
>gi|78059780|ref|YP_366355.1| cytidine deaminase [Burkholderia sp. 383] >gi|77964330|gb|ABB05711.1| cytidine deaminase [Burkholderia sp. 383] (129 aa)
Score = 167, Expect = 1.1e-10, Identities = 37/106 (34%), Positives = 64/106 (60%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           PYS+F+V +  +A D + ++G NVEN+SY +  C ER AI +A++ G++  + T + ++ D++    PCG CRQ + E + + D  + + N +G     T   +L G F
  S:    20 PYSRFKVGAALQARDGTIFHGCNVENASYGLCNCAERTAIFSAIAAGYRPGDFTRLAVVGDTDGPIAPCGACRQVIIE-IGTPDIEVILANLKGAVEVTTAHALLPGAF 127
>gi|156740749|ref|YP_001430878.1| cytidine deaminase [Roseiflexus castenholzii DSM 13941] >gi|156232077|gb|ABU56860.1| cytidine deaminase [Roseiflexus castenholzii DSM 13941] (137 aa)
Score = 167, Expect = 1.2e-10, Identities = 35/109 (32%), Positives = 60/109 (55%)
  Q:    21 YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           Y PYS+F V A++  A    + G N+EN++YP  +C ER A+  A + G + I  + ++ D+    +PCG CRQ + E   +    + + N +G +   ++ E+L   FT
  S:    23 YCPYSRFAVGAAVRTASGMLFSGCNIENAAYPSAICAERVALFGAYAAGERAIVALAVIADTPEPVSPCGGCRQVIFEL--APRAVVLLANLQGAWRIVSVEELLPAGFT 130
>gi|145952868|ref|ZP_01801876.1| hypothetical protein CdifQ_04002833 [Clostridium difficile QCD-32g58] (140 aa)
Score = 167, Expect = 1.2e-10, Identities = 43/116 (37%), Positives = 65/116 (56%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD---SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++Y PYS FRV A++       Y G N+E +S   T C ER AI  A+S G K+I  I + +D   +N    PCG+CRQ + EF    D  I     +G+  +++I ++L   F+  DL
  S:    22 QHSYAPYSGFRVGAALLTKSGKVYTGCNIECASLGGTNCAERTAIFKAISEGDKDIYKIAIASDNSENNEQTYPCGICRQVIIEF--GSDIKIITGYTKGEVFEHSIKDLLPNYFSGNDL 139
>gi|16127242|ref|NP_421806.1| cytidine deaminase [Caulobacter crescentus CB15] >gi|13424650|gb|AAK24974.1| cytidine deaminase [Caulobacter crescentus CB15] (140 aa)
Score = 166, Expect = 1.3e-10, Identities = 41/128 (32%), Positives = 63/128 (49%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVS-NGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           + I   L  ++  AY  YSKF VA+ +     + +YGVNVEN++YP   C E+ AI   ++  G + I  + +   S     PCG CRQ ++EF   + C I          +    ++L   F  +DLD
  S:    12 DEIAAALPPLLSRAYARYSKFTVAAAVIDETGAVHYGVNVENAAYPQGTCAEQTAIGAMITAAGARRIDKVLIAAGSGAVVQPCGGCRQRIAEF-AGEACEIISVQGGKPTERVAFWDLLPRSFGPRDLD 140
>gi|126700054|ref|YP_001088951.1| cytidine deaminase [Clostridium difficile 630] >gi|168694062|ref|ZP_02726339.1| cytidine deaminase [Clostridium difficile QCD-37x79] >gi|168713061|ref|ZP_02745338.1| cytidine deaminase [Clostridium difficile QCD-63q42] >gi|168725151|ref|ZP_02757428.1| cytidine deaminase [Clostridium difficile QCD-76w55] >gi|168729744|ref|ZP_02762021.1| cytidine deaminase [Clostridium difficile QCD-97b34] >gi|196126580|ref|ZP_03118329.1| cytidine deaminase [Clostridium difficile ATCC 43255] >gi|196159077|ref|ZP_03119638.1| cytidine deaminase [Clostridium difficile CIP 107932] >gi|115251491|emb|CAJ69324.1| cytidine deaminase [Clostridium difficile 630] (133 aa)
Score = 166, Expect = 1.4e-10, Identities = 43/116 (37%), Positives = 65/116 (56%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD---SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           +++Y PYS FRV A++       Y G N+E +S   T C ER AI  A+S G K+I  I + +D   +N    PCG+CRQ + EF    D  I     +G+  +++I ++L   F+  DL
  S:    15 QHSYAPYSGFRVGAALLTKSGKVYTGCNIECASLGGTNCAERTAIFKAISEGDKDIYKIAIASDNSENNEQTYPCGICRQVIIEF--GSDIKIITGYTKGEVFEHSIKDLLPNYFSGNDL 132
>gi|83854781|ref|ZP_00948311.1| cytidine deaminase [Sulfitobacter sp. NAS-14.1] >gi|83842624|gb|EAP81791.1| cytidine deaminase [Sulfitobacter sp. NAS-14.1] (180 aa)
Score = 166, Expect = 1.4e-10, Identities = 43/119 (36%), Positives = 65/119 (54%)
  Q:    16 VIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           V ENAY PYS F+V A++  A  + + G NVEN +YP   C E  AI+  ++ G     + Y++  S T  TPCG CRQ ++EF +  D  + +    G     T+ E+L G F +  ++
  S:    61 VQENAYAPYSNFKVGAALRTASGAVFVGCNVENVAYPEGTCAEAGAIAAMIAAGETAFVEAYVIAGSPTPVTPCGGCRQKLAEFGQG-DARVTMATLSGVEEVMTMAELLPGAFGRAHME 179
>gi|90419753|ref|ZP_01227662.1| cytidine deaminase [Aurantimonas sp. SI85-9A1] >gi|90335794|gb|EAS49542.1| cytidine deaminase [Aurantimonas sp. SI85-9A1] (131 aa)
Score = 165, Expect = 1.7e-10, Identities = 41/127 (32%), Positives = 67/127 (52%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           + +F   K  +  A+ PYSKF V A++   D   + G NVE  S+P   C E  AI   V +G   I ++ ++ +     TPCG CRQ ++EF ++    +++ + EG   +  T+GE+L   F  + L
  S:     3 DDLFALAKSAMRRAHAPYSKFPVGAALRTTDGRIFSGCNVEVVSFPEGWCAETTAIGHLVMDGGGRIAEVAVVAEKLPLCTPCGGCRQRIAEFADA-GTKVHLCDAEGGVRETVTMGELLPRAFDPQSL 130
>gi|157113600|ref|XP_001652016.1| cytidine deaminase, putative [Aedes aegypti] >gi|108877662|gb|EAT41887.1| cytidine deaminase, putative [Aedes aegypti] (155 aa)
Score = 165, Expect = 1.8e-10, Identities = 39/97 (40%), Positives = 58/97 (59%)
  Q:     2 SEINLNTIFIKLKEVIE-------NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT-FATPCGMCRQFMSEF 98
           S +  +T+  K++E+I        NAY PYS F V A++         G NVEN ++  ++C ERNAI  A+S G +    + ++    T F +PCG CRQ +SEF
  S:    13 SVVEFSTLDAKVQELINAAIKVRNNAYCPYSNFAVGAALRTKTGEIITGCNVENGTFAPSVCAERNAICKAISEGFREFESLAVVAYQETEFTSPCGTCRQTLSEF 118
>gi|125985689|ref|XP_001356608.1| GA21010-PA [Drosophila pseudoobscura] >gi|54644932|gb|EAL33672.1| GA21010-PA [Drosophila pseudoobscura] (215 aa)
Score = 165, Expect = 1.8e-10, Identities = 38/93 (40%), Positives = 52/93 (55%)
  Q:    18 ENAYVPYSKFRVASICKADDSFYY-GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT-DSNTFATPCGMCRQFMSEFMESDDCSIYIFN 110
           + AYVPYSKF V +  ++   + Y G N+EN ++    C ER A++  VS G    T   ++      F TPCG+CRQF+ EF    D  IYI N
  S:    86 KEAYVPYSKFPVGASFRSKCGYVYSGCNIENVAFTPGCCAERTALAKGVSEGQLTYTAGAVVAYHPKGFTTPCGVCRQFLREF-ACRDFPIYIAN 179
>gi|148556951|ref|YP_001264533.1| cytidine deaminase [Sphingomonas wittichii RW1] >gi|148502141|gb|ABQ70395.1| cytidine deaminase [Sphingomonas wittichii RW1] (151 aa)
Score = 165, Expect = 1.9e-10, Identities = 49/135 (36%), Positives = 72/135 (53%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK------NITDIYLLTD----SNTFATPCGMCRQFMSEFME--SDDCSIYIFNWE-GKYIKYTIGEILKGRFTKKDLDL 135
           M E+    +    + V  NA+ PYS+F V A++  AD     G N EN+SY ++LC E  A++TA S GH        +T   L +D     +   TPCG CRQ ++E  +    D  IY  + + G +  +   E+L   F   DL L
  S:     1 MREVAGRVLIDAARGVAANAHAPYSRFGVGAAVLLADGRIVTGANFENASYGLSLCAETVALATANSEGHLRDVVAIGVTGGRLESDGSIAGSALVTPCGRCRQIINEAAQLGGHDIDIYCGSADGGAFAWFRASELLPHAFGPADLGL 149
>gi|83589463|ref|YP_429472.1| cytidine deaminase [Moorella thermoacetica ATCC 39073] >gi|83572377|gb|ABC18929.1| cytidine deaminase [Moorella thermoacetica ATCC 39073] (129 aa)
Score = 165, Expect = 2.0e-10, Identities = 39/109 (35%), Positives = 58/109 (53%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           PYS FRV A++  A    Y G N+EN+SY +T+C ER A+  AV+ G +  T + ++        PCG CRQ ++EF  + D  +      G   +  + E+L   FT K
  S:    22 PYSHFRVGAALLTAGGRVYTGCNIENASYGLTVCAERVALFQAVAAGEREFTALAVVGGDLEACFPCGACRQVLAEF--APDLEVITGRPGGSIHRRRLKELLPDTFTLK 129
>gi|58265250|ref|XP_569781.1| cytidine deaminase [Cryptococcus neoformans var. neoformans JEC21] >gi|57226013|gb|AAW42474.1| cytidine deaminase, putative [Cryptococcus neoformans var. neoformans JEC21] (138 aa)
Score = 165, Expect = 2.1e-10, Identities = 31/79 (39%), Positives = 48/79 (60%)
  Q:    30 ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-SNTFATPCGMCRQFMSEFMESDDCSIYI 108
           A++  AD  FY G NVEN+SY   +C ER A+  AVS   ++   + +++D  +   +PCG+CRQF+ EF+  D    Y+
  S:    12 AALLGADGRFYGGCNVENASYGAGICAERTAVVKAVSESQQSFLAVAVVSDIPSPSCSPCGICRQFLREFVSLDTPIFYV 91
>gi|159036412|ref|YP_001535665.1| cytidine deaminase [Salinispora arenicola CNS-205] >gi|157915247|gb|ABV96674.1| cytidine deaminase [Salinispora arenicola CNS-205] (234 aa)
Score = 163, Expect = 2.9e-10, Identities = 46/132 (34%), Positives = 62/132 (46%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           EI+   +     EV+ +AYVPYSKF V +    DD     G NVEN+SY V LC E   +S+  S G   I  +  +  +     PCG CRQ + E     +C I     E K     + E+L   F   DL+
  S:     2 EIDWGRLRAAATEVMRHAYVPYSKFPVGAAALVDDGRIVVGCNVENASYGVVLCAECGVVSSLHSTGGGRIVALSCVDATGEPLMPCGRCRQLLWE-QGGPECLI-----EAKGGPMRMAELLPHAFDVADLE 128
>gi|15673421|ref|NP_267595.1| cytidine deaminase [Lactococcus lactis subsp. lactis Il1403] >gi|12724429|gb|AAK05537.1|AE006374_2 cytidine deaminase (EC 3.5.4.5) [Lactococcus lactis subsp. lactis Il1403] (130 aa)
Score = 163, Expect = 3.4e-10, Identities = 39/114 (34%), Positives = 64/114 (56%)
  Q:    21 YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           YVPYS F V A+    D     G N+EN+S+ ++ C ER AI  A+S G K+   +Y+  ++    +PCG CRQ ++EF  + D  +++ +      + ++ E+L   F  K+LD
  S:    19 YVPYSHFPVGAAFHTTDGRIITGCNIENASFGLSNCAERTAIFKAISEGLKDFDALYVFGETEEPISPCGACRQVIAEFCPA-DMPVFLISKNDNVKETSVEELLPYSF--KNLD 130
>gi|119195875|ref|XP_001248541.1| predicted protein [Coccidioides immitis RS] >gi|90307327|gb|EAS36958.1| predicted protein [Coccidioides immitis RS] (164 aa)
Score = 162, Expect = 3.7e-10, Identities = 40/115 (34%), Positives = 59/115 (51%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           AY PYSKFRV AS+   D +F+ G NVEN+SYPV +C E+    TAV    +     Y          P  +  + +          +Y++  +GKY+  T+GE+L   F  +DL+
  S:    57 AYCPYSKFRVGASLLAEDGTFFVGANVENASYPVGICAEKCVFGTAVVIQSRRCGFRY---------HPWNITMRIIMRQFCPPSFPVYMYGNDGKYVMKTMGELLPDSFGPEDLE 163
>gi|160943892|ref|ZP_02091122.1| hypothetical protein FAEPRAM212_01393 [Faecalibacterium prausnitzii M21/2] >gi|158444568|gb|EDP21572.1| hypothetical protein FAEPRAM212_01393 [Faecalibacterium prausnitzii M21/2] (150 aa)
Score = 161, Expect = 4.9e-10, Identities = 35/81 (43%), Positives = 49/81 (60%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD-----SNTFATPCGMCRQFMSEF 98
           E AY PYS F V A++  AD   + G NVEN+++  T C ER A+  AV+ G    TDI ++       +    +PCG+CRQ + EF
  S:    21 EKAYAPYSDFMVGAALRAADGRIFTGCNVENAAFTPTSCAERTALFKAVAEGVTAFTDIAVVGSRRGEVNRQITSPCGVCRQALFEF 107
>gi|50307765|ref|XP_453876.1| unnamed protein product [Kluyveromyces lactis] >gi|49643010|emb|CAH00972.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (147 aa)
Score = 160, Expect = 7.3e-10, Identities = 35/83 (42%), Positives = 53/83 (63%)
  Q:    20 AYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK-NITDIYLLTD-SNTFATPCGMCRQFMSEFMESD 102
           +Y PYSKFRV   I   D ++  G NVEN++Y  T+C ER AI  AV++ H+ +   + + +D  + +  PCG+CRQ + EF + D
  S:    29 SYSPYSKFRVGCCILTKDGTYITGSNVENATYGATICAERAAIVKAVTSSHRADWVCVAINSDMRDNYIPPCGICRQTIREFGKED 114
>gi|110668552|ref|YP_658363.1| cytidine deaminase [Haloquadratum walsbyi DSM 16790] >gi|109626299|emb|CAJ52757.1| cytidine deaminase [Haloquadratum walsbyi DSM 16790] (138 aa)
Score = 159, Expect = 8.2e-10, Identities = 37/94 (39%), Positives = 58/94 (61%)
  Q:     7 NTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFME 100
           +T+  + +   E+AYVPYS++RV A+I   D S Y G N+EN++Y  +L  E  A++ AV +G      I + + +    TPCGMCRQ ++EF +
  S:     6 HTLIARARTAFESAYVPYSEYRVGAAIETTDGSVYTGCNIENANYSNSLHAEEVAVAAAVKDGQDTFERIAVASAARDGVTPCGMCRQTLAEFAD 100
>gi|91779355|ref|YP_554563.1| cytidine deaminase [Burkholderia xenovorans LB400] >gi|91692015|gb|ABE35213.1| cytidine deaminase [Burkholderia xenovorans LB400] (129 aa)
Score = 159, Expect = 8.8e-10, Identities = 41/125 (32%), Positives = 63/125 (50%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +N+  +  +     E AY PYSKF+V A++   D   + G NVEN+SY +  C ER A  +A++ G++      + ++ D+     PCG CRQ + E +   D  I + N  G     T  E L   F
  S:     1 MNMEQLLERAGAAREKAYAPYSKFKVGAALLTRDGKVFDGCNVENASYGLCNCAERTAFFSAIAAGYQRDQFAALAVIGDTEGPIAPCGACRQVIIE-LGGPDLPIRLGNLHGATRDTTAREQLPDAF 127
>gi|116669702|ref|YP_830635.1| cytidine deaminase [Arthrobacter sp. FB24] >gi|116609811|gb|ABK02535.1| cytidine deaminase [Arthrobacter sp. FB24] (145 aa)
Score = 158, Expect = 1.1e-09, Identities = 34/86 (39%), Positives = 44/86 (51%)
  Q:    17 IENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           ++NAY PYSKF V A+   AD     G NVEN+SY +TLC E   +      G   +   Y +  +     PCG CRQ + EF   D
  S:    30 MKNAYAPYSKFAVGAAALTADGRMVSGCNVENASYGLTLCAECTLVGNLHMTGGGLLRAFYCVDAAGNILMPCGRCRQLLYEFRAPD 116
>gi|38505859|ref|NP_942477.1| cytidine deaminase [Synechocystis sp. PCC 6803] >gi|38423883|dbj|BAD02091.1| cytidine deaminase [Synechocystis sp. PCC 6803] (138 aa)
Score = 158, Expect = 1.2e-09, Identities = 32/83 (38%), Positives = 45/83 (54%)
  Q:    15 EVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           EV +NAY PYS F V +    DD     G NVEN+SY +TLC E   +S  ++ G   +  +  +   + +  PCG CRQ + E
  S:    15 EVRQNAYAPYSHFLVGAAGLVDDGRIVVGCNVENASYGLTLCAECGLVSHLIATGGGRLLAVVCVDSQDNYLAPCGRCRQVLLE 98
>gi|187919136|ref|YP_001888167.1| cytidine deaminase [Burkholderia phytofirmans PsJN] >gi|187717574|gb|ACD18797.1| cytidine deaminase [Burkholderia phytofirmans PsJN] (129 aa)
Score = 158, Expect = 1.3e-09, Identities = 33/95 (34%), Positives = 54/95 (56%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEF 98
           +N+  +  +     E AY PYSKF+V A++   D   + G NVEN+SY +  C ER A  +A++ G++      + ++ D++    PCG CRQ + E 
  S:     1 MNMEQLLERAGVAREKAYAPYSKFKVGAALLTKDGQVFDGCNVENASYGLCNCAERTAFFSAIAAGYQRDQFAALAVIGDTDGPIAPCGACRQVIIEL 98
>gi|110599208|ref|ZP_01387448.1| Cytidine deaminase, homotetrameric [Geobacter sp. FRC-32] >gi|110549963|gb|EAT63149.1| Cytidine deaminase, homotetrameric [Geobacter sp. FRC-32] (137 aa)
Score = 158, Expect = 1.3e-09, Identities = 47/112 (41%), Positives = 63/112 (56%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           ENAY  YS F+V A++     +  +G NVEN+SY +T C ER+AI  A+S G K   I  I +      F +PCG CRQ + E M S    I+ FN  GK +   I ++L   FT
  S:    21 ENAYCAYSNFKVGAALLTKSGNIIFGSNVENASYGLTNCAERSAIFAAISRGIKPQEIDAIAISATGENF-SPCGACRQVIFE-MGSQIAVIFRFN--GKVVIERISDLLPYSFT 131
>gi|145593369|ref|YP_001157666.1| cytidine deaminase [Salinispora tropica CNB-440] >gi|145302706|gb|ABP53288.1| cytidine deaminase [Salinispora tropica CNB-440] (234 aa)
Score = 157, Expect = 1.7e-09, Identities = 45/132 (34%), Positives = 61/132 (46%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           EI+   +     EV+ +AYVPYSKF V +    DD     G NVEN+SY + LC E   IS   + G   I  +  +  +     PCG CRQ + E     +C I     E K     + E+L   F   DL+
  S:     2 EIDWERLRAAATEVMRHAYVPYSKFPVGAAALVDDGRVVVGCNVENASYGMVLCAECGVISALQATGGGRIVALSCVDATGEPLMPCGRCRQLLWEH-GGPECLI-----EAKGGALRMAELLPHAFDVTDLE 128
>gi|38505642|ref|NP_942263.1| cytidine deaminase [Synechocystis sp. PCC 6803] >gi|38423666|dbj|BAD01877.1| cytidine deaminase [Synechocystis sp. PCC 6803] (138 aa)
Score = 157, Expect = 1.7e-09, Identities = 31/83 (37%), Positives = 45/83 (54%)
  Q:    15 EVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           EV +NAY PYS F V +    DD     G N+EN+SY +TLC E   +S  ++ G   +  +  +   + +  PCG CRQ + E
  S:    15 EVRQNAYAPYSHFLVGAAGLVDDGRIVVGCNIENASYGLTLCAECGLVSHLIATGGGRLLAVVCVDSQDNYLAPCGRCRQVLLE 98
>gi|92112955|ref|YP_572883.1| cytidine deaminase [Chromohalobacter salexigens DSM 3043] >gi|91796045|gb|ABE58184.1| cytidine deaminase [Chromohalobacter salexigens DSM 3043] (140 aa)
Score = 156, Expect = 2.1e-09, Identities = 38/121 (31%), Positives = 67/121 (55%)
  Q:    13 LKEVIENAYVPYSKFRVASICKADDSFYY-GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           L  V ++ Y PYS+  V ++  A+   +Y G NVE++++   LC E  AI   ++ G + I  +Y++   +   TPCG CRQ + EF  +    I + + +G  +K YT+ ++L   F  ++L
  S:    17 LIAVRDSVYAPYSRHPVGALLIAESGRHYLGCNVESANFK-GLCAEAGAIGAMIAQGEREIVTLYVIGPGHHLCTPCGDCRQRIREF-ATPATVIVVLDGDGNPLKHYTMEQLLPDSFGPENL 137
>gi|124005835|ref|ZP_01690673.1| cytidine deaminase [Microscilla marina ATCC 23134] >gi|123988518|gb|EAY28159.1| cytidine deaminase [Microscilla marina ATCC 23134] (169 aa)
Score = 155, Expect = 2.4e-09, Identities = 44/121 (36%), Positives = 65/121 (53%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAI-STAVSNGHKNITDIYLLTD--SNTF--ATPCGMCRQFMSEFMESDDCSIYIF---NWEGKYIKYTIGEILKGRFTKKDLD 134
           +++   AY PYS F V A+I   D +   G N EN++YP  +C ER AI  T     ++ I  I +        F  A PCG CRQ M E+ E    +I +      E  Y+  +I ++L  +F KK+L+
  S:    37 EKITHQAYAPYSNFLVGAAILLDDGTVVTGSNQENAAYPSGICAERTAIYYTGAQYPNRTIKAIAVAAQRGDEVFLPAAPCGACRQAMLEYEEKQPHNIQLILQGQEEKVYVVSSIADLLPLKFGKKNLN 166
>gi|54022917|ref|YP_117159.1| cytidine deaminase [Nocardia farcinica IFM 10152] >gi|54014425|dbj|BAD55795.1| putative cytidine deaminase [Nocardia farcinica IFM 10152] (133 aa)
Score = 155, Expect = 2.6e-09, Identities = 34/97 (35%), Positives = 49/97 (50%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M EI+ N++      V+ NAY PYS+F V A+  +AD     G NVEN SY + LC E   +   ++ G   +  + +         PCG CRQ + E
  S:     1 MPEIDWNSLRDNAFRVMHNAYAPYSRFPVGAAALRADGGIVSGCNVENVSYGLGLCAETVLVGNFIAGGGGRLLAVSVTDSRGEILLPCGRCRQVLYE 98
>gi|149916200|ref|ZP_01904721.1| malic enzyme [Roseobacter sp. AzwK-3b] >gi|149809860|gb|EDM69711.1| malic enzyme [Roseobacter sp. AzwK-3b] (130 aa)
Score = 155, Expect = 2.6e-09, Identities = 35/109 (32%), Positives = 58/109 (53%)
  Q:    25 SKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           S F+V A++  A    Y G NVEN++YP   C E  AI+  V+ G   + ++ ++ DS    +PCG CRQ ++EF    +  + +   +G+     + E+L G F+   L
  S:    19 SGFKVGAAVRGASGRVYVGCNVENAAYPEGTCAETGAIAAMVAAGETALIEVAIIADSPAPISPCGGCRQRLAEF-GGGETRVIMATLDGQQATARLDELLPGAFSSVSL 127
>gi|153003537|ref|YP_001377862.1| cytidine deaminase [Anaeromyxobacter sp. Fw109-5] >gi|152027110|gb|ABS24878.1| cytidine deaminase [Anaeromyxobacter sp. Fw109-5] (138 aa)
Score = 155, Expect = 2.6e-09, Identities = 39/111 (35%), Positives = 66/111 (59%)
  Q:    23 PYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           PYS+FRV +  +A  + + G N+EN+SY +T+C ER A++ AV+ G + I  + + + ++    PCGMC Q ++EF    +  + +    G  +  T+GE+L   FTK+ L
  S:    29 PYSRFRVGAAVRAGGAVHSGCNIENASYGLTVCAERVAVAAAVAAGARRIEAVAVASGTDEPTPPCGMCLQTLAEF-AGPELPVRLVGARGGTLDTTLGELLPRAFTKRFL 138
>gi|153815192|ref|ZP_01967860.1| hypothetical protein RUMTOR_01424 [Ruminococcus torques ATCC 27756] >gi|145847451|gb|EDK24369.1| hypothetical protein RUMTOR_01424 [Ruminococcus torques ATCC 27756] (357 aa)
Score = 155, Expect = 2.9e-09, Identities = 37/105 (35%), Positives = 56/105 (53%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT----PCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           +Y PYS F+V A++       Y G N+ENS++  T C ER A   AVS G +    I ++   +   T    PCG+CRQ M+EF +     + + +   KY    + E+L
  S:   239 SYSPYSGFKVGAALLAESGRIYTGCNIENSAFSPTNCAERTAFFKAVSEGERKFRAICIIGGKDISETVCTPPCGVCRQVMAEFCDPKKFKVILASGREKYRILRLEELL 348
>gi|119964185|ref|YP_947041.1| cytidine deaminase [Arthrobacter aurescens TC1] >gi|119951044|gb|ABM09955.1| cytidine deaminase [Arthrobacter aurescens TC1] (136 aa)
Score = 154, Expect = 3.3e-09, Identities = 33/85 (38%), Positives = 42/85 (49%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           K+ ++ AY PYSKF V A+    D     G NVEN+SY +TLC E   +      G   I   Y +        PCG CRQ + EF
  S:    18 KQAMQRAYAPYSKFPVGAAALTEDGRIVSGCNVENASYGLTLCAECALVGQLHMTGGGRIAAFYCVDGQGNILMPCGRCRQLLYEF 103
>gi|149186343|ref|ZP_01864656.1| cytidine deaminase [Erythrobacter sp. SD-21] >gi|148829932|gb|EDL48370.1| cytidine deaminase [Erythrobacter sp. SD-21] (134 aa)
Score = 154, Expect = 3.4e-09, Identities = 32/83 (38%), Positives = 51/83 (61%)
  Q:    18 ENAYVPYSKFRVAS-ICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK-NITDIYLLTDSNTFATPCGMCRQFMSEFME 100
           E++Y PYS+F V S +  AD S   G N+EN+SY + LC E  A+S A+++G +  +  + +    +   TPCG CRQ ++E  +
  S:    15 EHSYSPYSRFAVGSALLFADGSVVTGTNIENASYGLALCAETVAVSKAMADGVRGGLEKVAVTGPGDMPITPCGRCRQVLNELAQ 99
>gi|156845513|ref|XP_001645647.1| hypothetical protein Kpol_541p32 [Vanderwaltozyma polyspora DSM 70294] >gi|156116313|gb|EDO17789.1| hypothetical protein Kpol_541p32 [Vanderwaltozyma polyspora DSM 70294] (151 aa)
Score = 154, Expect = 3.5e-09, Identities = 46/110 (41%), Positives = 66/110 (60%)
  Q:     4 INLNTIFIKLKEVI---ENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKN---------ITDIYLLTDSNT-FATPCGMCRQFMSEFMESDDCSIYIFNWEG 113
           ++ NTI I  +E I   E++Y PYSKFRV  SI   +     G NVE +S+  T+C ER AI   +S+   N         +  I ++ D+     TPCG+CRQ + EF+ S    I +FN +G
  S:     6 LDKNTIDILSRECIRARESSYSPYSKFRVGCSILLTNGKIIRGCNVEVASFAGTICAERTAIVKLISDDEDNNGNSTKLQQVECIGIIGDTKEGVITPCGICRQVLREFLPS-KTKIVMFNNDG 128
>gi|157371870|ref|YP_001479859.1| cytidine deaminase [Serratia proteamaculans 568] >gi|157323634|gb|ABV42731.1| cytidine deaminase [Serratia proteamaculans 568] (142 aa)
Score = 154, Expect = 3.8e-09, Identities = 40/107 (37%), Positives = 58/107 (54%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL-------TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEIL 124
           E +Y PYS F V A++       + G NVE+ SY  T C ER AI  AVS G ++   I ++       + +  ++ PCG+CRQ + EF    D  I I N   +Y  + I E+ 
  S:    19 EFSYAPYSNFTVGAALITKSGKVFTGCNVESVSYSPTTCAERVAILKAVSEGERSFEMIVVIGGPRVGESKAKGYSGPCGVCRQMIYEF--GKDIQIIIANSLDEYYVHDISELF 131
>gi|163816522|ref|ZP_02207886.1| hypothetical protein COPEUT_02712 [Coprococcus eutactus ATCC 27759] >gi|158448222|gb|EDP25217.1| hypothetical protein COPEUT_02712 [Coprococcus eutactus ATCC 27759] (167 aa)
Score = 153, Expect = 4.4e-09, Identities = 47/128 (36%), Positives = 70/128 (54%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKAD---------------DS---------FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL-----TDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           + + ++  + +K  E  + AY  YS+F+V +   A                DS          + G N+ENSSY  T+C ER A+  AVS+G+K+   I ++     T  N    PCG+CRQ +SEF  S D  +     E  Y    + E L   F
  S:     7 IEDTDIRRLIVKAVEARDMAYARYSQFKVGAALLASRENSSDAAEVVGGETDSHDRNTNEYRVFTGCNIENSSYGATICAERAAVCNAVSSGYKDFKAIAIVGGLNSTGINGITYPCGICRQVLSEF--SADMYVIAARSEDDYDMRRLSEFLPASF 161
>gi|89055478|ref|YP_510929.1| cytidine deaminase [Jannaschia sp. CCS1] >gi|88865027|gb|ABD55904.1| cytidine deaminase [Jannaschia sp. CCS1] (132 aa)
Score = 153, Expect = 4.5e-09, Identities = 41/122 (33%), Positives = 65/122 (53%)
  Q:     8 TIFIKLKEVIENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           T+  +  +V  NA+ PYS F+V  +I   + + Y G NVEN +YP   C E  AI+  ++ G   I ++ ++  S     PCG CRQ ++EF +  D  I +   +G      +G +L G+FT
  S:     5 TLIDQATQVRLNAHAPYSNFKVGCAIRSVEGNVYVGCNVENVAYPEGTCAEAGAIAAMIAAGDTRIAEVAVIAGSPAPVPPCGGCRQKLAEFADG-DTPITMATTQGATQVTQVGALLPGQFT 126
>gi|41409538|ref|NP_962374.1| cytidine deaminase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41398369|gb|AAS05990.1| Cdd [Mycobacterium avium subsp. paratuberculosis K-10] (133 aa)
Score = 153, Expect = 4.5e-09, Identities = 34/97 (35%), Positives = 50/97 (51%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M +I+ N +  K  +V   AY PYS+FRV +    DD     G NVEN SY + LC E   +    ++G   +  +  +    +  TPCG CRQ ++E
  S:     1 MPDIDWNALRDKAIDVSAGAYAPYSRFRVGAAGLVDDGRVVTGCNVENISYGLGLCAECAVVCALYASGGGRLVALACVDGRGSVLTPCGRCRQVLAE 98
>gi|18075995|emb|CAD20227.1| cytidine deaminase [Methylobacterium chloromethanicum] (137 aa)
Score = 152, Expect = 6.2e-09, Identities = 46/128 (35%), Positives = 67/128 (52%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           M+E +L+ +F     V   A+ PYS F V A++       + G NVEN++YPV  C E  AI+  ++ G + I  I +L DS    TPCG CRQ + EF    D  I     +G   +YT+ ++L   F
  S:     1 MTEPDLDALFAAATAVRARAHAPYSGFAVGAALVDDAGGVHAGCNVENAAYPVGTCAEAGAIAAMIAAGGRQIRAILVLADSPAPVTPCGACRQRIREF-AGPDTPIVSAGPDGVRARYTLEQLLPASF 128
>gi|119717759|ref|YP_924724.1| cytidine deaminase [Nocardioides sp. JS614] >gi|119538420|gb|ABL83037.1| cytidine deaminase [Nocardioides sp. JS614] (133 aa)
Score = 151, Expect = 6.9e-09, Identities = 41/133 (30%), Positives = 61/133 (45%)
  Q:     2 SEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           +E +  ++    +E + +AYVPYS+F V +    DD     G NVEN+SY V LC E   +S    +G   +T    +        PCG CRQ + E     +    +  W    +K  + E+L   F   DLD
  S:     6 TEFDWESLKAAAEEAMRHAYVPYSRFSVGAAALVDDGRTVVGCNVENASYGVGLCAECGLVSQLHISGGGRLTHFVCVNGEREIIMPCGRCRQLLHE-----NGGPGLLLWTVSGVK-RMDEVLPDAFGPDDLD 133
>gi|83856513|ref|ZP_00950042.1| cytidine deaminase [Croceibacter atlanticus HTCC2559] >gi|83850313|gb|EAP88181.1| cytidine deaminase [Croceibacter atlanticus HTCC2559] (160 aa)
Score = 151, Expect = 7.8e-09, Identities = 47/119 (39%), Positives = 63/119 (52%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSN-GHKNITDIYLLTDSNTFAT-----PCGMCRQFMSEF--MESDDCSIYIFNWEGKYIKY-TIGEILKGRFTKKDL 133
           E  + AY PYSKF V A++   D +   G N EN++YP  LC ER AI  A S    K IT + L   S+         PCG CRQ +SE+   +     IY     GK +K  ++ ++L   F K  L
  S:    32 EARDKAYAPYSKFLVGAALILEDGTIVTGNNQENAAYPSGLCAERTAIFYAGSQYPDKKITRMALSASSSNHTVMTPIPPCGACRQSISEYEIKQETPIEIYFMGQTGKVVKVSSLSDLLPLAFDKSYL 160
>gi|75761896|ref|ZP_00741821.1| Cytidine deaminase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490604|gb|EAO53895.1| Cytidine deaminase [Bacillus thuringiensis serovar israelensis ATCC 35646] (94 aa)
Score = 151, Expect = 8.3e-09, Identities = 31/79 (39%), Positives = 42/79 (53%)
  Q:    55 CGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           C ER A+  AVS G K    I ++ D+     PCG CRQ M E  +  D  +Y+ N  G   + T+GE+L G F  +DL
  S:    15 CAERTALFKAVSEGDKEFVAIAVVADTKRPVPPCGACRQVMVELCKQ-DTKVYLSNLHGDVQETTVGELLPGAFLAEDL 92
>gi|84683856|ref|ZP_01011759.1| Cytidine deaminase [Rhodobacterales bacterium HTCC2654] >gi|84668599|gb|EAQ15066.1| Cytidine deaminase [Rhodobacterales bacterium HTCC2654] (138 aa)
Score = 150, Expect = 9.1e-09, Identities = 45/134 (33%), Positives = 72/134 (53%)
  Q:     1 MSE--INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           MSE  ++  ++  + K V   AY PYS FRV A+I       + GVNVEN++YP   C E  AI+  ++ G   I +I ++ D+    TPCG CRQ ++EF       + +   +G  +  TI +++   F K  ++
  S:     1 MSENTVSEKSLLDEAKGVWPKAYAPYSGFRVGAAIRSPSGRVHLGVNVENAAYPEGTCAEAGAIAAMIAAGDTEIAEIAVVGDAPDPVTPCGGCRQKIAEFARK-GTKVTMGTLDGGEMVVTIEDLIPWAFAKAQME 136
>gi|158317677|ref|YP_001510185.1| cytidine deaminase [Frankia sp. EAN1pec] >gi|158113082|gb|ABW15279.1| cytidine deaminase [Frankia sp. EAN1pec] (199 aa)
Score = 149, Expect = 1.2e-08, Identities = 41/125 (32%), Positives = 61/125 (48%)
  Q:    16 VIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSVKQG 140
           V  +AY PYS  RV +    DD     G NVEN+SY +TLC E   +S   ++G   +     +  +     PCG CRQ + E    +   + +   +G  I+ T+GE+L G F   DL  + +Q 
  S:    61 VARHAYAPYSGLRVGAAAMVDDGRVVVGCNVENASYGLTLCAECGLVSALRASGGGRLVAFACVDGTGAPLAPCGRCRQLLHEHGGPE---LELATADG--IR-TLGELLPGAFGPADLPPAAEQA 180
>gi|50954270|ref|YP_061558.1| cytidine deaminase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950752|gb|AAT88453.1| cytidine deaminase [Leifsonia xyli subsp. xyli str. CTCB07] (136 aa)
Score = 149, Expect = 1.3e-08, Identities = 36/77 (46%), Positives = 45/77 (58%)
  Q:    21 YVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAIST-AVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           YVPYS+F V +    DD     G NVEN+SY VTLC E   +S  A+S G + I    +  D +T   PCG CRQ +SE
  S:    22 YVPYSRFPVGAAALVDDGRIVSGCNVENASYGVTLCAECGLVSALAMSGGGRLIAFTCVNGDGDTL-MPCGRCRQLLSE 99
>gi|91215149|ref|ZP_01252121.1| cytidine deaminase [Psychroflexus torquis ATCC 700755] >gi|91186754|gb|EAS73125.1| cytidine deaminase [Psychroflexus torquis ATCC 700755] (160 aa)
Score = 149, Expect = 1.4e-08, Identities = 41/103 (39%), Positives = 54/103 (52%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT------DSNTFATPCGMCRQFMSEFMESDD--CSIYIFNWEGKYIK 117
           E  +NAY PYSKF+V +    D      G N EN+S+P  LC ER AI  A +N  K I     ++      D      PCG CRQ ++E+ +  +    IY     GK IK
  S:    32 EARDNAYAPYSKFKVGAALILDTGEVVTGNNQENASFPSGLCAERTAIYAAGANYPKAIIKAMAISATSEKHDVLEPIAPCGACRQAIAEYEQKQEQPIEIYFTGTAGKVIK 143
>gi|118466769|ref|YP_883434.1| cytidine deaminase [Mycobacterium avium 104] >gi|118168056|gb|ABK68953.1| cytidine deaminase [Mycobacterium avium 104] (133 aa)
Score = 149, Expect = 1.4e-08, Identities = 33/97 (34%), Positives = 49/97 (50%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M +I+ N +  K  +    AY PYS+FRV +    DD     G NVEN SY + LC E   +    ++G   +  +  +    +  TPCG CRQ ++E
  S:     1 MPDIDWNALRDKAIDASAGAYAPYSRFRVGAAGLVDDGRVVTGCNVENISYGLGLCAECAVVCALYASGGGRLVALACVDGRGSVLTPCGRCRQVLAE 98
>gi|154507787|ref|ZP_02043429.1| hypothetical protein ACTODO_00269 [Actinomyces odontolyticus ATCC 17982] >gi|153797421|gb|EDN79841.1| hypothetical protein ACTODO_00269 [Actinomyces odontolyticus ATCC 17982] (151 aa)
Score = 148, Expect = 1.5e-08, Identities = 30/96 (31%), Positives = 51/96 (53%)
  Q:     2 SEINLNTIFIKLKEVIENAYVPYSKFRVASI-CKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           ++I+ + +  +  + +++AY PYS F V ++   AD     G NVEN+ Y VTLC E   +S  + +G   +  +  +  +     PCG CRQ + E
  S:     4 TDIDWDALLAEAIDAMKHAYCPYSNFPVGAVGLTADGWLVSGCNVENAGYGVTLCAECGMVSDLIRSGGGTLVAVVAVNGNEEPVAPCGRCRQLIYE 100
>gi|56551760|ref|YP_162599.1| cytidine deaminase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543334|gb|AAV89488.1| cytidine deaminase [Zymomonas mobilis subsp. mobilis ZM4] (161 aa)
Score = 148, Expect = 1.7e-08, Identities = 47/130 (36%), Positives = 71/130 (54%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGH-KNITDIYLLT---DSNTFAT-----PCGMCRQFMSEFMESD--DCSIYIFNWEGKYIK-YTIGEILKGRFTKKDL 133
           I + ++  K +     +Y PYS F V A++   D S   G N EN+SY +TLC E  A++TA + GH  +I  I +     D + F       PCG CRQ ++E  E    D  +Y  + EG  I+ + +  +L   F  K+L
  S:    13 ITVKSLMDKARTAARQSYSPYSAFAVGAALLLKDGSVITGTNFENASYGLTLCAETVAVATANTAGHLAHIRAIAICGGKFDEDRFIGHDIIYPCGRCRQVLNEAAEIGHYDIMVYCGSAEGSEIEPHRLSTLLPHSFGPKNL 155
>gi|156449231|ref|ZP_02055614.1| cytidine deaminase [Methylobacterium chloromethanicum CM4] >gi|156191768|gb|EDO23954.1| cytidine deaminase [Methylobacterium chloromethanicum CM4] (327 aa)
Score = 148, Expect = 1.8e-08, Identities = 45/128 (35%), Positives = 67/128 (52%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           ++E +L+ +F     V   A+ PYS F V A++       + G NVEN++YPV  C E  AI+  ++ G + I  I +L DS    TPCG CRQ + EF    D  I     +G   +YT+ ++L   F
  S:   191 VTEPDLDALFAAATAVRARAHAPYSGFAVGAALVDDAGGVHAGCNVENAAYPVGTCAEAGAIAAMIAAGGRQIRAILVLADSPAPVTPCGACRQRIREF-AGPDTPIVSAGPDGVRARYTLEQLLPASF 318
>gi|15828164|ref|NP_302427.1| cytidine deaminase [Mycobacterium leprae TN] >gi|13093718|emb|CAC31129.1| cytidine deaminase [Mycobacterium leprae] (134 aa)
Score = 148, Expect = 1.9e-08, Identities = 33/97 (34%), Positives = 48/97 (49%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M ++N +T+         N+Y PYS F V      +D     GVNVEN+SY + LC E + IS   + G   +  +Y +  +     PCG CRQ + E
  S:     1 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENASYGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYE 98
>gi|154245142|ref|YP_001416100.1| CMP/dCMP deaminase zinc-binding [Xanthobacter autotrophicus Py2] >gi|154159227|gb|ABS66443.1| CMP/dCMP deaminase zinc-binding [Xanthobacter autotrophicus Py2] (147 aa)
Score = 147, Expect = 2.0e-08, Identities = 41/125 (32%), Positives = 67/125 (53%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT------DSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFT 129
           +L  +F   K V +NAY PYS+FRV A++  A+ + + G NVEN +YP+  C E  AI+ A +     +  + +        + +   TPCG CRQ + E   S   +++ +    K +  T  ++L   FT
  S:    17 DLEALFDAAKAVSKNAYAPYSRFRVGAALLSANGTVHVGCNVENIAYPIGTCAEAGAIAAARAAEGAGLEAVAIAIYAEKEGEGHVACTPCGACRQRILEL--SPATTVHFYGLGDKVVSVTAADLLPHAFT 146
>gi|84498034|ref|ZP_00996831.1| cytidine deaminase [Janibacter sp. HTCC2649] >gi|84381534|gb|EAP97417.1| cytidine deaminase [Janibacter sp. HTCC2649] (132 aa)
Score = 146, Expect = 3.0e-08, Identities = 32/97 (32%), Positives = 50/97 (51%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           MS+I+ + +  +  E+  ++Y PYS +RV      DD     G NVEN++Y VTLC E   +S   + G   +  ++ +        PCG CRQ + E
  S:     1 MSDIDWDVLRDRAIEMTTHSYAPYSNYRVGVAGLTDDGRIVAGCNVENAAYGVTLCAECGMVSELHATGGGLLVAVFCVDGRGEALMPCGRCRQLLWE 98
>gi|194526890|ref|YP_002062414.1| cytidine deaminase [Burkholderia mallei JHU] >gi|147750900|gb|EDK57968.1| cytidine deaminase [Burkholderia mallei JHU] (197 aa)
Score = 145, Expect = 3.3e-08, Identities = 34/106 (32%), Positives = 59/106 (55%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           PYS F+V A++   D   ++G NVEN+SY +  C ER A+ +A++ G++      I ++ +++    PCG CRQ M E +      + + N +G     + G++L   F
  S:    87 PYSNFKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGEFAAIAVVGETHGPIAPCGACRQVMIE-LGKPTLEVVLTNMQGDVRVTSAGDLLPDAF 194
>gi|194521907|ref|YP_002057441.1| cytidine deaminase [Burkholderia mallei FMH] >gi|194574424|ref|YP_002109309.1| cytidine deaminase [Burkholderia mallei 2002721280] >gi|147745917|gb|EDK52995.1| cytidine deaminase [Burkholderia mallei FMH] >gi|148028663|gb|EDK86623.1| cytidine deaminase [Burkholderia mallei 2002721280] (203 aa)
Score = 145, Expect = 3.3e-08, Identities = 34/106 (32%), Positives = 59/106 (55%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           PYS F+V A++   D   ++G NVEN+SY +  C ER A+ +A++ G++      I ++ +++    PCG CRQ M E +      + + N +G     + G++L   F
  S:    93 PYSNFKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGEFAAIAVVGETHGPIAPCGACRQVMIE-LGKPTLEVVLTNMQGDVRVTSAGDLLPDAF 200
>gi|126456397|ref|YP_001076691.1| hypothetical protein BURPS1106A_A2661 [Burkholderia pseudomallei 1106a] >gi|126230165|gb|ABN93578.1| hypothetical protein BURPS1106A_A2661 [Burkholderia pseudomallei 1106a] (231 aa)
Score = 145, Expect = 3.3e-08, Identities = 34/106 (32%), Positives = 59/106 (55%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           PYS F+V A++   D   ++G NVEN+SY +  C ER A+ +A++ G++      I ++ +++    PCG CRQ M E +      + + N +G     + G++L   F
  S:   121 PYSNFKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGEFAAIAVVGETHGPIAPCGACRQVMIE-LGKPTLEVVLTNMQGDVRVTSAGDLLPDAF 228
>gi|53716809|ref|YP_104954.1| cytidine deaminase [Burkholderia mallei ATCC 23344] >gi|53722980|ref|YP_111965.1| cytidine deaminase [Burkholderia pseudomallei K96243] >gi|67641236|ref|ZP_00440019.1| COG0295: Cytidine deaminase [Burkholderia mallei GB8 horse 4] >gi|76817596|ref|YP_336223.1| cytidine deaminase [Burkholderia pseudomallei 1710b] >gi|121596453|ref|YP_990876.1| cytidine deaminase [Burkholderia mallei SAVP1] >gi|126444058|ref|YP_001063796.1| cytidine deaminase [Burkholderia pseudomallei 668] >gi|126447250|ref|YP_001077344.1| cytidine deaminase [Burkholderia mallei NCTC 10247] >gi|134278635|ref|ZP_01765349.1| cytidine deaminase [Burkholderia pseudomallei 305] >gi|161355394|ref|ZP_02101273.1| hypothetical protein Bpse110_07874 [Burkholderia pseudomallei 1106b] >gi|161368087|ref|ZP_02107658.1| hypothetical protein Bpse17_01095 [Burkholderia pseudomallei 1710a] >gi|167724898|ref|ZP_02408134.1| hypothetical protein BpseD_38109 [Burkholderia pseudomallei DM98] >gi|167743839|ref|ZP_02416613.1| hypothetical protein Bpse14_37541 [Burkholderia pseudomallei 14] >gi|167821025|ref|ZP_02452705.1| hypothetical protein Bpse9_38231 [Burkholderia pseudomallei 91] >gi|167829387|ref|ZP_02460858.1| hypothetical protein Bpseu9_37228 [Burkholderia pseudomallei 9] >gi|167850862|ref|ZP_02476370.1| hypothetical protein BpseB_36819 [Burkholderia pseudomallei B7210] >gi|167899466|ref|ZP_02486867.1| hypothetical protein Bpse7_37375 [Burkholderia pseudomallei 7894] >gi|167908619|ref|ZP_02495824.1| hypothetical protein BpseN_40739 [Burkholderia pseudomallei NCTC 13177] >gi|167916140|ref|ZP_02503231.1| hypothetical protein Bpse112_37015 [Burkholderia pseudomallei 112] >gi|167920875|ref|ZP_02507966.1| hypothetical protein BpseBC_20176 [Burkholderia pseudomallei BCC215] >gi|194315529|ref|YP_002011186.1| cytidine deaminase [Burkholderia mallei ATCC 10399] >gi|194513037|ref|YP_002025560.1| cytidine deaminase [Burkholderia pseudomallei Pasteur 52237] >gi|194518865|ref|YP_002054551.1| cytidine deaminase [Burkholderia pseudomallei S13] >gi|52213394|emb|CAH39437.1| cytidine deaminase [Burkholderia pseudomallei K96243] >gi|52422779|gb|AAU46349.1| cytidine deaminase [Burkholderia mallei ATCC 23344] >gi|76582069|gb|ABA51543.1| cytidine deaminase [Burkholderia pseudomallei 1710b] >gi|121224251|gb|ABM47782.1| cytidine deaminase [Burkholderia mallei SAVP1] >gi|126223549|gb|ABN87054.1| cytidine deaminase [Burkholderia pseudomallei 668] >gi|126240104|gb|ABO03216.1| cytidine deaminase [Burkholderia mallei NCTC 10247] >gi|134250419|gb|EBA50499.1| cytidine deaminase [Burkholderia pseudomallei 305] >gi|157933589|gb|EDO89259.1| cytidine deaminase [Burkholderia pseudomallei Pasteur 52237] >gi|160697245|gb|EDP87215.1| cytidine deaminase [Burkholderia mallei ATCC 10399] >gi|169650981|gb|EDS83674.1| cytidine deaminase [Burkholderia pseudomallei S13] (130 aa)
Score = 145, Expect = 3.3e-08, Identities = 34/106 (32%), Positives = 59/106 (55%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           PYS F+V A++   D   ++G NVEN+SY +  C ER A+ +A++ G++      I ++ +++    PCG CRQ M E +      + + N +G     + G++L   F
  S:    20 PYSNFKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGEFAAIAVVGETHGPIAPCGACRQVMIE-LGKPTLEVVLTNMQGDVRVTSAGDLLPDAF 127
>gi|145225421|ref|YP_001136099.1| cytidine deaminase [Mycobacterium gilvum PYR-GCK] >gi|145217907|gb|ABP47311.1| cytidine deaminase [Mycobacterium gilvum PYR-GCK] (140 aa)
Score = 145, Expect = 3.4e-08, Identities = 44/132 (33%), Positives = 61/132 (46%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD 134
           EI+ N +  K  +V ++AY PYS FRV +    DD     G NVEN SY + LC E   +    S+G   +  +  +        PCG CRQ + E    D   + I +  G      +GE+L   F   DLD
  S:     4 EIDWNLLRRKAIDVSQHAYAPYSGFRVGAAALVDDRRMVAGCNVENVSYGLGLCAECAVVCALHSSGGGRLVALTCVGPDGEVLMPCGRCRQVLFEHGGGD---LLIDHPLG---PKPLGELLPDAFGPADLD 130
>gi|83815011|ref|YP_445527.1| cytidine and deoxycytidylate deaminase zinc-binding domain-containing protein [Salinibacter ruber DSM 13855] >gi|83756405|gb|ABC44518.1| Cytidine and deoxycytidylate deaminase zinc-binding region domain protein [Salinibacter ruber DSM 13855] (431 aa)
Score = 145, Expect = 3.6e-08, Identities = 31/86 (36%), Positives = 46/86 (53%)
  Q:    13 LKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           ++ V   A+VP S + V +I +  +  F  GVNVE+  +   LC ERN + T  S    +   +YL  D +   TPCG CRQ ++E 
  S:   308 VRRVSRRAHVPSSGYPVGAILETQEGPFVPGVNVEHPDWARILCAERNVLGTMHSYALPSPRRLYLTCDEDPEGTPCGACRQLLAEL 394
Score = 93, Expect = 4.1e-02, Identities = 21/68 (30%), Positives = 43/68 (63%)
  Q:    12 KLKEVIENAYVPYSKFRVASICKADDSFYY-GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT 79
           + ++++  A+VP+S    A++   DD  +  GV +E++SY +T+    NA +TAV+ GH++    ++L+
  S:   178 RARDLLPRAHVPFSDAPTAAVLLLDDGRWVPGVRLESASYSLTIPALLNAYTTAVALGHESSIVAFVLS 246
>gi|160915032|ref|ZP_02077245.1| hypothetical protein EUBDOL_01040 [Eubacterium dolichum DSM 3991] >gi|158432831|gb|EDP11120.1| hypothetical protein EUBDOL_01040 [Eubacterium dolichum DSM 3991] (101 aa)
Score = 145, Expect = 3.7e-08, Identities = 35/98 (35%), Positives = 52/98 (53%)
  Q:    36 DDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           D S+  G NVEN+SY +T C ERNA+  A S G++  +I  + +    +    PCG CRQ M+E +E    +  I     K +   I E++   FT K+ 
  S:     3 DGSYICGANVENASYGLTSCAERNALFAAYSQGYRKQDIQCMAITAKQDELCPPCGACRQVMAELLEQH--TPIILASIKKQLVTNIEELMPMAFTAKEF 100
>gi|88856460|ref|ZP_01131118.1| cytidine deaminase [marine actinobacterium PHSC20C1] >gi|88814327|gb|EAR24191.1| cytidine deaminase [marine actinobacterium PHSC20C1] (138 aa)
Score = 144, Expect = 4.7e-08, Identities = 33/94 (35%), Positives = 45/94 (47%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           I+ + + +   E + +AYVPYSKF V      DD     G NVEN+SY +TLC E   +S     G   +     +        PCG CRQ + E
  S:     8 IDWDALRLVATEALSHAYVPYSKFPVGVAALVDDGRVISGANVENASYGLTLCAECTMVSALHMTGGGKLVAFTCVDGKGNALMPCGRCRQLLFE 102
>gi|149370878|ref|ZP_01890473.1| cytidine deaminase [unidentified eubacterium SCB49] >gi|149355664|gb|EDM44222.1| cytidine deaminase [unidentified eubacterium SCB49] (161 aa)
Score = 144, Expect = 5.0e-08, Identities = 40/106 (37%), Positives = 58/106 (54%)
  Q:    12 KLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAI--------STAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDC--SIYIFNWEGKYIK 117
           K ++  E AY PYS F+V A++  A+     G N EN+++P  LC ER AI          A+ N    +  +    DS T   PCG CRQ ++E+  +  C  +IY     GK +K
  S:    29 KAQQAREKAYAPYSSFKVGAAMQLANGEVVLGNNQENAAFPSGLCAERVAIFYAGATYPGVAIHNIALTVRSLEHKVDSPT--PPCGACRQAIAEYEINQKCPINIYFMGETGKVVK 143
>gi|50288583|ref|XP_446721.1| unnamed protein product [Candida glabrata] (205 aa)
Score = 144, Expect = 5.1e-08, Identities = 43/116 (37%), Positives = 65/116 (56%)
  Q:    20 AYVPYSKFRVASICKADDS----FYYGVNVENSSYPVTLCGERNAISTAVSNGH----KNITDIYLLTDS-NTFATPCGMCRQFMSEFM--ESDDCSIYIFNWEG-KYIKYTIGEILKGRFTKKDLDL 135
           +Y PYS++RV       D        G NVEN+SY  T+C ER AI+ A++            + ++ DS     +PCG+CRQ + EF+  ++    I +FN +G  Y K ++ EIL   F  + L L
  S:    78 SYSPYSRYRVGCCILVRDGERVIKVTGANVENASYGGTICAERVAITKAMTTVETRDPSQWVALGIMGDSLQDCISPCGICRQVIREFVNPKTGQVPIVMFNGDGSNYKKVSLEEILPMSFGPESLAL 205
>gi|146299314|ref|YP_001193905.1| cytidine deaminase [Flavobacterium johnsoniae UW101] >gi|146153732|gb|ABQ04586.1| cytidine deaminase [Flavobacterium johnsoniae UW101] (160 aa)
Score = 144, Expect = 5.1e-08, Identities = 44/111 (39%), Positives = 57/111 (51%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVS-NGHKNITDIYLLTDSNTFAT-----PCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILK 125
           E+ + AY PYSKFRV +    D+     G N EN++YP  LC ER AI  A S      I  + +   S+T  T     PCG CRQ ++E+    D  I I      Y    IGE+ K
  S:    32 EIRKKAYAPYSKFRVGAALLLDNGKVILGSNQENAAYPSGLCAERTAIFYAGSIYPEAKILKMAITAASDTNQTQAPIPPCGSCRQSIAEYEIKQDTPIEI------YFMGEIGEVYK 143
>gi|47565290|ref|ZP_00236332.1| cytidine deaminase [Bacillus cereus G9241] >gi|47557644|gb|EAL15970.1| cytidine deaminase [Bacillus cereus G9241] (90 aa)
Score = 144, Expect = 5.2e-08, Identities = 34/84 (40%), Positives = 44/84 (52%)
  Q:    37 DSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTI 120
           D  Y G NVEN SY +T C ER AI  AVS+  K +  I ++ D      PCG CRQ ++EF    D   ++ N  G   + TI
  S:     5 DKIYLGGNVENVSYELTNCAERTAIFNAVSHKEKEVKAIAIVVDIEGQVLPCGGCRQVIAEF-AGKDTKNFLANLNGDIKETTI 87
>gi|83717194|ref|YP_438613.1| cytidine deaminase [Burkholderia thailandensis E264] >gi|167615103|ref|ZP_02383738.1| cytidine deaminase [Burkholderia thailandensis Bt4] >gi|83651019|gb|ABC35083.1| cytidine deaminase [Burkholderia thailandensis E264] (130 aa)
Score = 144, Expect = 5.4e-08, Identities = 29/76 (38%), Positives = 47/76 (61%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEF 98
           PYS F+V A++   D   ++G NVEN+SY +  C ER A+ +A++ G++      I ++ +++    PCG CRQ M E 
  S:    20 PYSNFKVGAALATNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGEFAAIAVVGETDGPIAPCGACRQVMIEL 98
>gi|50843190|ref|YP_056417.1| cytidine deaminase [Propionibacterium acnes KPA171202] >gi|50840792|gb|AAT83459.1| cytidine deaminase [Propionibacterium acnes KPA171202] (146 aa)
Score = 143, Expect = 5.9e-08, Identities = 33/95 (34%), Positives = 49/95 (51%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           +++ + +  +  E+ + AYVPYS F V +   A+D     G NVEN+ Y VTLC E   IS  V+ G  ++     +        PCG CRQ + E
  S:    11 DVDWDALRCRAHELTKRAYVPYSHFPVGAAGLAEDGRVVVGCNVENAGYGVTLCAECGLISDLVAGGGGHLLAFCCVDAMGETIMPCGRCRQLLWE 106
>gi|120437225|ref|YP_862911.1| cytidine deaminase [Gramella forsetii KT0803] >gi|117579375|emb|CAL67844.1| cytidine deaminase [Gramella forsetii KT0803] (160 aa)
Score = 143, Expect = 6.0e-08, Identities = 40/110 (36%), Positives = 61/110 (55%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTF-------ATPCGMCRQFMSEF--MESDDCSIYIFNWEGKYIKY-TIGEIL 124
           EV +NAY PYS F+V A+I   ++    G N EN+SYP  LC ER A+  A +  + N   + +   + +          PCG CRQ + E+   + +   +Y     GK +K  +I +IL
  S:    32 EVRDNAYAPYSNFKVGAAILLENEEVVVGSNQENASYPSGLCAERTAVYAAGAK-YPNTRILKIAVTAKSLRHKVISPVPPCGACRQALIEYEVKQEEAIELYFMGETGKVVKAESIKDIL 151
>gi|150025452|ref|YP_001296278.1| cytidine deaminase [Flavobacterium psychrophilum JIP02/86] >gi|149771993|emb|CAL43469.1| Cytidine deaminase [Flavobacterium psychrophilum JIP02/86] (160 aa)
Score = 141, Expect = 1.3e-07, Identities = 49/129 (37%), Positives = 66/129 (51%)
  Q:     5 NLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVS-NGHKNITDIYLLTDSNTFAT-----PCGMCRQ--FMSEFMESDDCSIYIFNWEGK-YIKYTIGEILKGRFTKKDL 133
           ++N +  K  E+ +NAY PYSKF V A+I   +     G N EN++YP  LC ER AI  A +   +  I  + +   S   AT     PCG CRQ  F  EF +     IY     G+ Y   +I  +L   F K  L
  S:    22 DVNELMQKAIEIRKNAYAPYSKFNVGAAILLDNGKVALGSNQENAAYPSGLCAERVAIFHAGAIYPNAKIIKMAITAGSTKTATTKPIPPCGACRQSIFEYEFKQGIPIEIYFMGETGEIYKSDSIQNLLPLTFDKNFL 160
>gi|15610451|ref|NP_217832.1| cytidine deaminase [Mycobacterium tuberculosis H37Rv] >gi|15842907|ref|NP_337944.1| cytidine deaminase [Mycobacterium tuberculosis CDC1551] >gi|31794496|ref|NP_856989.1| cytidine deaminase [Mycobacterium bovis AF2122/97] >gi|121639239|ref|YP_979463.1| cytidine deaminase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663179|ref|YP_001284702.1| cytidine deaminase [Mycobacterium tuberculosis H37Ra] >gi|148824519|ref|YP_001289273.1| cytidine deaminase [Mycobacterium tuberculosis F11] >gi|167968950|ref|ZP_02551227.1| cytidine deaminase [Mycobacterium tuberculosis H37Ra] >gi|194541984|ref|YP_002077015.1| cytidine deaminase cdd [Mycobacterium tuberculosis C] >gi|2894225|emb|CAA17087.1| PROBABLE CYTIDINE DEAMINASE CDD (CYTIDINE AMINOHYDROLASE) (CYTIDINE NUCLEOSIDE DEAMINASE) [Mycobacterium tuberculosis H37Rv] >gi|13883240|gb|AAK47758.1| cytidine deaminase [Mycobacterium tuberculosis CDC1551] >gi|31620092|emb|CAD95436.1| PROBABLE CYTIDINE DEAMINASE CDD (CYTIDINE AMINOHYDROLASE) (CYTIDINE NUCLEOSIDE DEAMINASE) [Mycobacterium bovis AF2122/97] >gi|121494887|emb|CAL73370.1| Probable cytidine deaminase cdd [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124599454|gb|EAY58558.1| cytidine deaminase cdd [Mycobacterium tuberculosis C] >gi|134151450|gb|EBA43495.1| cytidine deaminase cdd [Mycobacterium tuberculosis str. Haarlem] >gi|148507331|gb|ABQ75140.1| cytidine deaminase [Mycobacterium tuberculosis H37Ra] >gi|148723046|gb|ABR07671.1| cytidine deaminase cdd [Mycobacterium tuberculosis F11] (133 aa)
Score = 140, Expect = 1.4e-07, Identities = 32/97 (32%), Positives = 46/97 (47%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M +++ N +     +    AYVPYS+F V +    DD     G NVEN SY +TLC E   +    S G   +  +  +    +   PCG CRQ + E
  S:     1 MPDVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVENVSYGLTLCAECAVVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLE 98
>gi|21223263|ref|NP_629042.1| cytidine deaminase [Streptomyces coelicolor A3(2)] >gi|13162078|emb|CAC33054.1| putative cytidine deaminase [Streptomyces coelicolor A3(2)] (130 aa)
Score = 138, Expect = 2.2e-07, Identities = 29/85 (34%), Positives = 41/85 (48%)
  Q:    14 KEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           ++ +  AY PYS + V +    DD     G NVEN+SY + LC E   +S     G   +T    +  +     PCG CRQ + EF
  S:    14 RDAMSRAYAPYSGYAVGAAALVDDGRTVTGCNVENASYGIGLCAECGLVSQLQVTGGGRLTHFVCVDGAGEVLVPCGRCRQLLYEF 99
>gi|86143914|ref|ZP_01062282.1| cytidine deaminase [Flavobacterium sp. MED217] >gi|85829621|gb|EAQ48084.1| cytidine deaminase [Leeuwenhoekiella blandensis MED217] (160 aa)
Score = 138, Expect = 2.4e-07, Identities = 40/116 (34%), Positives = 63/116 (54%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT------DSNTFATPCGMCRQFMSEF--MESDDCSIYIFNWEGKYIKY-TIGEILKGRFTKKDL 133
           ++AY PYS+F V A++  ++     G N EN++YP  LC ER AI  A +N      ++  ++       S T   PCG CRQ ++E+   +     IY     GK  K  ++  +L   FT++ L
  S:    35 DSAYAPYSEFHVGAALLLSNGEIVKGSNQENAAYPSGLCAERTAIYYAGANFPDEKLEVMAISATGKRKPSTTPIPPCGACRQAIAEYEVKQKQPVVIYFMGASGKVFKSDSLSNLLPFIFTQEYL 160
>gi|149278654|ref|ZP_01884790.1| cytidine deaminase [Pedobacter sp. BAL39] >gi|149230649|gb|EDM36032.1| cytidine deaminase [Pedobacter sp. BAL39] (162 aa)
Score = 137, Expect = 3.5e-07, Identities = 40/117 (34%), Positives = 59/117 (50%)
  Q:    11 IKLKEVIENAYVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAI-STAVSNGHKNITDIYLLTDSNTF-----ATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTI-GEILKGR 127
           +K +E +  +Y PYS FRV +  +   D    G N EN +YP  LC ER A+ +   +N    I  + +   ++ F      T CG C Q M+EF +     I +       + Y I GEI+K R
  S:    28 LKAEEALNTSYAPYSHFRVGTAIQLKGDQIVLGSNQENVAYPSGLCAERVALFAIGAANPSAVIERMAITAKADHFQVEQPVTSCGACLQVMAEFEKKQQQEIEV-------LFYCIGGEIMKVR 145
>gi|111023212|ref|YP_706184.1| cytidine deaminase [Rhodococcus sp. RHA1] >gi|110822742|gb|ABG98026.1| probable cytidine deaminase [Rhodococcus sp. RHA1] (134 aa)
Score = 136, Expect = 4.2e-07, Identities = 33/97 (34%), Positives = 43/97 (44%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M EI+   +    +EV+  AY PYS F V +    DD     G NVEN SY + LC E   +    + G   +        S     PCG CRQ + E
  S:     1 MVEIDWKLLRANAREVMGQAYAPYSGFAVGAAALVDDGRIVVGCNVENVSYGLGLCAECVLVGNLFAGGGGRLIAFTCCDASGDILMPCGRCRQILFE 98
>gi|119615337|gb|EAW94931.1| cytidine deaminase, isoform CRA_a [Homo sapiens] (97 aa)
Score = 135, Expect = 4.8e-07, Identities = 29/75 (38%), Positives = 45/75 (60%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPC 88
           +E  ++AY PYS F V A++   +   + G N+EN+ YP+ +C ER AI  AVS G+K+   I + + + T   PC
  S:    23 QEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASLAPT--GPC 96
>gi|119468658|ref|ZP_01611710.1| cytidine deaminase [Alteromonadales bacterium TW-7] >gi|119447714|gb|EAW28980.1| cytidine deaminase [Alteromonadales bacterium TW-7] (308 aa)
Score = 134, Expect = 7.2e-07, Identities = 41/116 (35%), Positives = 62/116 (53%)
  Q:    18 ENAYVPYSKFRVASICKADD-----SFYYGVNVENSSYPVTLC--GERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E +  P S F V +I KA D     +FY+G NVE     ++L    E++AI+ A  NG K I  I  ++D+     PCG CRQFM+E  ++ +  I + +       + + E+L   F   DL
  S:    69 EFSVAPVSHFHVGAIVKALDDQQQVNFYFGANVEFDHQALSLVVHAEQSAINNAWLNGAKKILKI-AISDA-----PCGYCRQFMNELADAKEFDILLPSQH-----FKLAELLPHSFGPTDL 180
>gi|46203981|ref|ZP_00050665.2| COG0295: Cytidine deaminase [Magnetospirillum magnetotacticum MS-1] (85 aa)
Score = 134, Expect = 7.5e-07, Identities = 30/81 (37%), Positives = 45/81 (55%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDS 81
           M+E  L+ +F     V   A+ PYS F V A++   D   + G NVEN++YPV  C E  AI+  ++ G + I  I +L +S
  S:     1 MTEPALDALFEAAAAVRGRAHAPYSGFAVGAALTDEDGRIHAGCNVENAAYPVGTCAEAGAIAAMIATGGRRIRAILVLAES 82
>gi|120402596|ref|YP_952425.1| cytidine deaminase [Mycobacterium vanbaalenii PYR-1] >gi|119955414|gb|ABM12419.1| cytidine deaminase [Mycobacterium vanbaalenii PYR-1] (140 aa)
Score = 134, Expect = 7.9e-07, Identities = 32/96 (33%), Positives = 46/96 (47%)
  Q:     2 SEINLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           +EI+   +  K  +   +AY PYS+FRV +    DD     G NVEN SY + LC E   +    S+G   +  +  +        PCG CRQ + E
  S:     3 TEIDWKMLRRKAIDASVHAYAPYSRFRVGAAALVDDHRMVAGCNVENVSYGLGLCAECAVVCALHSSGGGRLLALSCVGPDGEVLMPCGRCRQLLLE 99
>gi|29829908|ref|NP_824542.1| cytidine deaminase [Streptomyces avermitilis MA-4680] >gi|29607017|dbj|BAC71077.1| putative cytidine/deoxycytidine deaminase [Streptomyces avermitilis MA-4680] (138 aa)
Score = 133, Expect = 8.4e-07, Identities = 29/85 (34%), Positives = 40/85 (47%)
  Q:    14 KEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           ++ +  AY PYS + V      DD     G NVEN+SY + LC E   +S   + G   +T    +        PCG CRQ + EF
  S:    22 RDAMSRAYAPYSGYPVGVAALVDDGRTVSGCNVENASYGLGLCAECGLVSQLQNTGGGRLTHFTCVDGRGEILVPCGRCRQLLYEF 107
>gi|77362227|ref|YP_341801.1| cytidine deaminase [Pseudoalteromonas haloplanktis TAC125] >gi|85540969|sp|Q3IBX5|CDD_PSEHT Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|76877138|emb|CAI89355.1| putative cytidine/deoxycytidine deaminase [Pseudoalteromonas haloplanktis TAC125] (309 aa)
Score = 133, Expect = 9.1e-07, Identities = 40/116 (34%), Positives = 62/116 (53%)
  Q:    18 ENAYVPYSKFRVASICKADD-----SFYYGVNVENSSYPVTLC--GERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E A  P S F V +I KA D     +FY+G N E +   ++L    E++AI+ A  NG K I  I  ++D+     PCG CRQFM+E  ++ +  I +   +     + + ++L   F   DL
  S:    69 EFAVAPVSNFHVGAIVKALDESGEVNFYFGANAEFNRQALSLVVHAEQSAINNAWLNGAKKILKI-AISDA-----PCGYCRQFMNELADAREFDILLPEQQ-----FKLADLLPHSFGPTDL 180
>gi|62422760|ref|ZP_00377944.1| COG0295: Cytidine deaminase [Brevibacterium linens BL2] (164 aa)
Score = 133, Expect = 9.2e-07, Identities = 29/78 (37%), Positives = 40/78 (51%)
  Q:    20 AYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           AYVPYS + V +    DD     G N+EN+S+ VTLC E + +S    +G   I     +  +     PCG CRQ + E
  S:    44 AYVPYSSYPVGAAALVDDGRIVSGANIENASFGVTLCAECSLVSDLFMSGGGRIVAFDCVDGAGGTLAPCGRCRQLLFE 122
>gi|85709467|ref|ZP_01040532.1| cytidine deaminase [Erythrobacter sp. NAP1] >gi|85688177|gb|EAQ28181.1| cytidine deaminase [Erythrobacter sp. NAP1] (138 aa)
Score = 132, Expect = 1.2e-06, Identities = 32/81 (39%), Positives = 50/81 (61%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHK-NITDIYLL--TDSNTFA--TPCGMCRQFMSEFMESDD 103
           PYS++ V +    DD +   G NVEN+SY + LC E NA+S A+++G +  +  + ++   D    A  TPCG CRQ ++E  +  D
  S:    20 PYSEYEVGAALLFDDGAVITGSNVENASYGLALCAETNAVSKALNDGRRGGLVRVAVVGPLDKGDGAPITPCGRCRQVLNEIAQLGD 106
>gi|148272160|ref|YP_001221721.1| cytidine deaminase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830090|emb|CAN01019.1| cddA [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (140 aa)
Score = 132, Expect = 1.2e-06, Identities = 34/83 (40%), Positives = 45/83 (54%)
  Q:    15 EVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTA-VSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           E +  AYVPYS+F V     A D     G NVEN+SY +TLC E   +S   ++ G + +    +  D NT   PCG CRQ + E
  S:    20 EAMGRAYVPYSRFPVGVAAIATDGRVITGCNVENASYGLTLCAECALVSVLHLTGGGQLVAFTCVDGDGNTL-MPCGRCRQLLFE 103
>gi|149593337|ref|XP_001516594.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus] (94 aa)
Score = 132, Expect = 1.3e-06, Identities = 25/51 (49%), Positives = 34/51 (66%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK 70
           AY PYS F V A++   D   + G NVEN+S+P+ +C ER AI  A+S G+K
  S:    35 AYCPYSNFPVGAALLTTDGKIFSGCNVENASFPLGICAERTAIQKAISEGYK 86
>gi|118617051|ref|YP_905383.1| cytidine deaminase [Mycobacterium ulcerans Agy99] >gi|118569161|gb|ABL03912.1| cytidine deaminase Cdd [Mycobacterium ulcerans Agy99] (132 aa)
Score = 132, Expect = 1.3e-06, Identities = 31/97 (31%), Positives = 44/97 (45%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           M +I+   +  K  +V   AY PYS+F V +    DD     G NVEN SY + LC E   +    + G   +  +  +        PCG CRQ + E
  S:     1 MPDIDWKQLRDKATQVAAGAYAPYSRFPVGAAALVDDGRVVTGCNVENVSYGLALCAECGVVCALHATGGGRLVALACVDGRGAPLMPCGRCRQLLFE 98
>gi|85375017|ref|YP_459079.1| cytidine deaminase [Erythrobacter litoralis HTCC2594] >gi|84788100|gb|ABC64282.1| cytidine deaminase [Erythrobacter litoralis HTCC2594] (140 aa)
Score = 132, Expect = 1.3e-06, Identities = 30/81 (37%), Positives = 47/81 (58%)
  Q:    20 AYVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLL---TDSNTFA--TPCGMCRQFMSEFME 100
           +Y PYS + V +  + +D S   G N+EN+SY + LC E  A+S A+++G +   +   +    D    A  TPCG CRQ + E  +
  S:    19 SYSPYSNYAVGAALRFSDGSVVTGTNIENASYGLALCAETVAVSKAMADGMRGGLEAVAVVGPADKGNGAPITPCGRCRQVLKELAQ 105
>gi|94497505|ref|ZP_01304075.1| cytidine deaminase [Sphingomonas sp. SKA58] >gi|94423136|gb|EAT08167.1| cytidine deaminase [Sphingomonas sp. SKA58] (152 aa)
Score = 131, Expect = 1.5e-06, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGH-KNITDIYLL-----TDSNTFATPCGMCRQFMSE 97
           PYS+F V A++   D S   G N EN+SY ++LC E  A++T  + G   ++  I ++     ++     TPCG CRQ M+E
  S:    24 PYSRFAVGAAVRLTDGSIVTGCNFENASYGLSLCAETVALATVNAQGRFADVAAIAVVGGAMDSEQEALVTPCGRCRQVMNE 105
>gi|88713260|ref|ZP_01107344.1| cytidine deaminase [Flavobacteriales bacterium HTCC2170] >gi|88708641|gb|EAR00877.1| cytidine deaminase [Flavobacteriales bacterium HTCC2170] (160 aa)
Score = 131, Expect = 1.5e-06, Identities = 42/103 (40%), Positives = 56/103 (54%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK----NITDIYLLTDSNTF-----ATPCGMCRQFMS--EFMESDDCSIYIFNWEGKYIK 117
           E  ++AY PYS F V A++  A+     G N EN+SYP  LC ER A+  A   G K     I  I +   S T      A PCG CRQ +S  EF +     + +   +G+ IK
  S:    32 EARKDAYAPYSNFMVGAAVLLANGKTVIGSNQENASYPSGLCAERVAVFQA---GAKYPGVTIKSIAITAMSKTHLVEKPAAPCGNCRQAISEYEFKQKSPIELLLMAEKGEIIK 143
>gi|118472624|ref|YP_886049.1| cytidine deaminase [Mycobacterium smegmatis str. MC2 155] >gi|118173911|gb|ABK74807.1| cytidine deaminase [Mycobacterium smegmatis str. MC2 155] (128 aa)
Score = 131, Expect = 1.7e-06, Identities = 33/94 (35%), Positives = 43/94 (45%)
  Q:     4 INLNTIFIKLKEVIENAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           +N N +  K  EV  +AY PYS F V +    DD     G NVEN SY + LC E   +    S G   +  +  +        PCG CRQ + E
  S:     1 MNWNALRSKAIEVSRHAYAPYSGFPVGAAALVDDGRTVTGCNVENVSYGLGLCAECAVVCALHSGGGGRLVALSCVGPDGGVLMPCGRCRQVLLE 95
>gi|88802257|ref|ZP_01117784.1| cytidine deaminase [Polaribacter irgensii 23-P] >gi|88781115|gb|EAR12293.1| cytidine deaminase [Polaribacter irgensii 23-P] (160 aa)
Score = 131, Expect = 1.8e-06, Identities = 33/80 (41%), Positives = 45/80 (56%)
  Q:    19 NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT------PCGMCRQFMSEF 98
           NAY PYS F V A++  A+     G N E+++YP  +C ER AI  A +       D   ++ S+T         PCG CRQ +SEF
  S:    36 NAYAPYSNFHVGAALLLANGEIVLGNNQESAAYPSGMCAERVAIWNAGATFPGVHIDALAISASSTKTVVNRAVGPCGACRQTLSEF 122
>gi|126647118|ref|ZP_01719628.1| putative cytidine deaminase [Algoriphagus sp. PR1] >gi|126577166|gb|EAZ81414.1| putative cytidine deaminase [Algoriphagus sp. PR1] (160 aa)
Score = 130, Expect = 1.8e-06, Identities = 31/89 (34%), Positives = 51/89 (57%)
  Q:     9 IFIKLKEVIENAYVPYSKFRVASICKADDSFYY-GVNVENSSYPVTLCGERNAISTAVSNGHKN-ITDIYLLT-----DSNTFATPCGMCRQFMSE 97
           + ++ +E+ +NAY PYS F+V +  +          N EN S+PV +C ER  +  A +N   + +  I ++      DS    +PCGMCRQ ++E
  S:    26 LMVQAQEISKNAYAPYSDFQVGAAVRLKSGLILQSSNQENVSFPVGVCAERLVLGYAGANYPLDPVMKIAIVAKRKGEDSWASVSPCGMCRQAINE 121
>gi|86132117|ref|ZP_01050713.1| cytidine deaminase [Cellulophaga sp. MED134] >gi|85817451|gb|EAQ38631.1| cytidine deaminase [Dokdonia donghaensis MED134] (160 aa)
Score = 130, Expect = 2.3e-06, Identities = 44/116 (37%), Positives = 59/116 (50%)
  Q:    18 ENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT----------DSNTFATPCGMCRQFMSEFMESDDCSI--YIFNWEGKYIKY-TIGEILKGRFTKKDL 133
           E AY PYS F V +    D+     G N EN+ YP  LC ER AI  A S       D  +LT          ++     PCG+CRQ ++E+    +  I  Y    +GK +K  ++  IL   FT K L
  S:    35 ERAYAPYSNFLVGAALLLDNGEIVTGNNQENACYPAGLCAERTAIFYASS----QYPDAKMLTMAITARARDKETTDPIPPCGVCRQAIAEYEIKQEAPIELYFMGEKGKVVKSASLENILPLLFTSKYL 160
>gi|103486255|ref|YP_615816.1| cytidine deaminase, homotetrameric [Sphingopyxis alaskensis RB2256] >gi|98976332|gb|ABF52483.1| cytidine deaminase [Sphingopyxis alaskensis RB2256] (151 aa)
Score = 129, Expect = 2.5e-06, Identities = 40/113 (35%), Positives = 58/113 (51%)
  Q:    23 PYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGH-KNITDIYL---------LTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK---YIKYTIGEILKGRFTKKDLDL 135
           PYS F V A++   +     G NVEN+SY +TLC E  A++   + G    + ++ +         LT S+    PCG CRQ ++E  E     I +    G       Y + E+L   F  KDL L
  S:    24 PYSGFHVGAALLLKNGDVVTGANVENASYGLTLCAETAAVAKIANEGWIGELAEVAIVGGRPDGEALTGSDP-VHPCGRCRQILNEAAERSQTDILVHCASGDDSAVATYKLSELLPAAFGPKDLGL 149
>gi|152967888|ref|YP_001363672.1| cytidine deaminase [Kineococcus radiotolerans SRS30216] >gi|151362405|gb|ABS05408.1| cytidine deaminase [Kineococcus radiotolerans SRS30216] (136 aa)
Score = 129, Expect = 2.6e-06, Identities = 29/84 (34%), Positives = 38/84 (45%)
  Q:    19 NAYVPYSKFRVASICKADDS-FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESD 102
           ++Y PYS F V +    DD     G N+EN+SY VTLC E   +      G   +     +        PCG CRQ + EF   D
  S:    18 HSYSPYSNFPVGAAALVDDGRVVSGANIENASYGVTLCAECTLVGQLRMTGGGRLVAFACVDAVGNVLMPCGRCRQLLYEFGGPD 102
>gi|33866343|ref|NP_897902.1| putative cytidine/deoxycytidine deaminase [Synechococcus sp. WH 8102] >gi|33639318|emb|CAE08326.1| putative cytidine/deoxycytidine deaminase [Synechococcus sp. WH 8102] (130 aa)
Score = 129, Expect = 2.8e-06, Identities = 28/82 (34%), Positives = 46/82 (56%)
  Q:    21 YVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT-----PCGMCRQFMSEFMESD 102
           + PYS F V +  + +D +   G NVEN+SY +T+C ER ++   V+ G + +       D+    +     PCG CRQ M E + ++
  S:    19 HCPYSNFHVGAAVRCSDGTVVTGCNVENASYGLTICAERVSLFNCVAQGLQPLELAVSCVDAQNNTSLSSRMPCGACRQVMQELLPNN 106
>gi|77978844|ref|ZP_00834268.1| COG0295: Cytidine deaminase [Yersinia intermedia ATCC 29909] (297 aa)
Score = 129, Expect = 2.8e-06, Identities = 37/114 (32%), Positives = 55/114 (48%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F V +I +    + Y+G N+E S  P+  T+  E+ A++ A   G  ++  I          TPCG CRQFM+E     D  I++          T+G  L   F  KDLD++
  S:    67 PISHFMVGAIAQGSSGNLYFGANMEFSGVPLQQTIHAEQCAVTHAWLRGEASLVAI------TVNYTPCGHCRQFMNELNSGTDLHIHLPGRPAA----TLGHYLPDSFGPKDLDIT 173
>gi|154335124|ref|XP_001563802.1| cytidine deaminase-like protein [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134060831|emb|CAM37847.1| cytidine deaminase-like protein [Leishmania braziliensis] (182 aa)
Score = 129, Expect = 3.0e-06, Identities = 39/122 (31%), Positives = 66/122 (54%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK--NITDIYLLT----------DSNTFATPCGMCRQFMSEFMESD----DCSIYIFNWEGKYIKYT-IGEILKGRFTKKDLDLSVKQ 139
           +N+Y PYS F V A++   D S   G N EN +   + C ER AI  A   G +  N   +Y  +           ++T  TPCG+CRQ ++E  +      +  + +  ++ K  K   + ++L  +F   D+ ++V Q
  S:    37 KNSYSPYSNFSVGAALLHDDGSVTAGCNYENCTLQ-SFCAERCAIVRANVEGRRYANAVAVYGRSYGAATVAHPPPADTLCTPCGLCRQLLAEVADLSQNFGEFLVVLVAYDAKQAKVVRLADLLPAKFGPADMGMTVMQ 175
>gi|150008708|ref|YP_001303451.1| cytidine deaminase [Parabacteroides distasonis ATCC 8503] >gi|149937132|gb|ABR43829.1| cytidine deaminase [Parabacteroides distasonis ATCC 8503] (158 aa)
Score = 127, Expect = 4.2e-06, Identities = 40/119 (33%), Positives = 58/119 (48%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVS---NGHKNITDIYLLTDSN--TFATPCGMCRQFMSEFME--SDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E  + AY PYSKF V A++   +     G N EN++YP  LC ER  +  A +   +    I  I  + D       TPCG CRQ M E  +  +    + +   E  Y+  +   +L   F+K DL
  S:    31 EASKKAYAPYSKFHVGAAVLLENGEILSGNNQENAAYPSGLCAERTTLFYAGARYPDAAVQILAIAAMKDGERVDLITPCGACRQVMLETEQRYNKPMKVLLCGKEEAYLVPSATALLPFCFSKSDL 157
>gi|126173925|ref|YP_001050074.1| cytidine deaminase [Shewanella baltica OS155] >gi|149115567|ref|ZP_01842308.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella baltica OS223] >gi|153000206|ref|YP_001365887.1| cytidine deaminase [Shewanella baltica OS185] >gi|160874833|ref|YP_001554149.1| cytidine deaminase [Shewanella baltica OS195] >gi|167008660|sp|A3D392|CDD_SHEB5 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|167008661|sp|A6WLY5|CDD_SHEB8 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|189081902|sp|A9KXF0|CDD_SHEB9 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|125997130|gb|ABN61205.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella baltica OS155] >gi|146864546|gb|EDK49946.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella baltica OS223] >gi|151364824|gb|ABS07824.1| Cytidine deaminase [Shewanella baltica OS185] >gi|160860355|gb|ABX48889.1| Cytidine deaminase [Shewanella baltica OS195] (296 aa)
Score = 127, Expect = 4.2e-06, Identities = 39/114 (34%), Positives = 58/114 (50%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I DI +       A+PCG CRQFM+E +E    SI++   E   + Y     L   F  KDL+++
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELPGEALFHSVHAEQSAISHAWLSGESQIVDIIV------NASPCGHCRQFMNELVEGSKISIHLPAQESHPLAY----YLPYAFGPKDLNVT 172
>gi|114562813|ref|YP_750326.1| cytidine deaminase [Shewanella frigidimarina NCIMB 400] >gi|122300042|sp|Q083S7|CDD_SHEFN Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|114334106|gb|ABI71488.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella frigidimarina NCIMB 400] (298 aa)
Score = 127, Expect = 4.2e-06, Identities = 39/115 (33%), Positives = 59/115 (51%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLSV 137
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I DI +      F +PCG CRQFM+E +     +I++ N E +    T+   L   F   DLD++V
  S:    66 PISEFYVGAIAKGSSGDLYMGANLELPGEALFHSVHAEQSAISHAWLSGETEIVDIIV-----NF-SPCGHCRQFMNELVNGSKINIHLPNQETQ----TLAHYLPYAFGPSDLDVTV 173
>gi|88857489|ref|ZP_01132132.1| cytidine deaminase [Pseudoalteromonas tunicata D2] >gi|88820686|gb|EAR30498.1| cytidine deaminase [Pseudoalteromonas tunicata D2] (309 aa)
Score = 127, Expect = 4.4e-06, Identities = 39/111 (35%), Positives = 62/111 (55%)
  Q:    23 PYSKFRVASICKADD-----SFYYGVNVENSSYPVTLC--GERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           P S+F V +I   +      + Y+G N+E +   ++L    E+ A++TA  NG K I+ +  +TD+     PCG CRQF++E  +S D +I +    G+ I +T  E L   F   DL
  S:    65 PISEFYVGAIAVGEQINGFGALYFGANLEFNHQALSLVVHAEQAALNTAWLNGEKTIS-VLAITDA-----PCGYCRQFINELNQSSDITILL---GGELIAFT--EFLPRSFGPTDL 171
Score = 83, Expect = 6.1e-01, Identities = 23/60 (38%), Positives = 35/60 (58%)
  Q:    18 ENAYVPYSK-FRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGH----KNITDIYL 77
           E +YVPY+K +    I   D S YYG   EN++Y  +L   ++AIS  + +G     + I  +YL
  S:   202 EQSYVPYTKNYASCMIVCQDGSKYYGRYAENAAYSPSLSPLQSAISQLILSGQSFDSETIKAVYL 266
>gi|126662324|ref|ZP_01733323.1| cytidine deaminase [Flavobacteria bacterium BAL38] >gi|126625703|gb|EAZ96392.1| cytidine deaminase [Flavobacteria bacterium BAL38] (159 aa)
Score = 127, Expect = 4.6e-06, Identities = 42/109 (38%), Positives = 57/109 (52%)
  Q:     1 MSEINLNTIF------------IKLK----EVIENAYVPYSKFRVASICKADDSFYY-GVNVENSSYPVTLCGERNAISTAVSN-GHKNITDIYLLTDSNTFA-----TPCGMCRQFMSEFMESDDCSIYIF 109
           M +IN+N++             + LK    E    AY PYSKF V +    D+     G N EN++YP  LC ER AI  A S      I  +++              PCG CRQ ++E+    D  I IF
  S:     1 MKQININSVISILTVDELSQVELDLKNQAFEARSKAYAPYSKFTVGAAILLDNGIIVQGSNQENAAYPSGLCAERVAIFYAGSTYPDAKIVKMFITASPQDRELTEPIPPCGSCRQVIAEYEFKQDIPIEIF 132
>gi|32034191|ref|ZP_00134413.1| COG0295: Cytidine deaminase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208807|ref|YP_001054032.1| cytidine deaminase [Actinobacillus pleuropneumoniae L20] >gi|165976768|ref|YP_001652361.1| cytidine deaminase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150664|ref|YP_001969189.1| cytidine deaminase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|171855095|sp|A3N1Z1|CDD_ACTP2 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|126097599|gb|ABN74427.1| cytidine deaminase [Actinobacillus pleuropneumoniae L20] >gi|165876869|gb|ABY69917.1| cytidine deaminase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915795|gb|ACE62047.1| cytidine deaminase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (297 aa)
Score = 127, Expect = 5.1e-06, Identities = 37/116 (31%), Positives = 60/116 (51%)
  Q:    20 AYVPYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           A VP S F V ++   +   FY+G N E ++  +  T+  E++AIS A   G   ITD+ +        TPCG CRQFM+E   +    I++ + +   ++    + L   F  KDL++
  S:    70 ALVPISNFYVGAVAIGESGRFYFGANQEFNAQAIQQTVHAEQSAISHAWLAGETAITDMVV------NYTPCGHCRQFMNELNSAKTLKIHLPHSQNNLLR----QYLPDSFGPKDLNI 178
>gi|15233630|ref|NP_194692.1| cytidine deaminase, putative / cytidine aminohydrolase, putative [Arabidopsis thaliana] >gi|4836448|gb|AAD30446.1|AF121877_6 DesF [Arabidopsis thaliana] >gi|5123557|emb|CAB45323.1| cytidine deaminase 3 (CDA3) [Arabidopsis thaliana] >gi|7269862|emb|CAB79721.1| cytidine deaminase 3 (CDA3) [Arabidopsis thaliana] >gi|67633770|gb|AAY78809.1| putative cytidine deaminase/cytidine aminohydrolase [Arabidopsis thaliana] (223 aa)
Score = 127, Expect = 5.3e-06, Identities = 35/114 (30%), Positives = 61/114 (53%)
  Q:    20 AYVPYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI---FNWEGKYIKYTIGEILKGRFTKKDL 133
           A  P SK++V ++ +A     Y GVNVE    P+  ++  E+  ++    N  K  ++  + + TD N F  PCG CRQF+ E  ++ +  I +   +  EG +    +  +L  RF+  D+
  S:    37 ALAPISKYKVGAVGRARSGRIYLGVNVELPGLPLHHSIHAEQFLVTNLALNSEKGLHLLAVTISTDGNDFGAPCGNCRQFLMEISKALNIKILLKSKYEAEGSFKSLRL--LLPDRFSPDDV 156
>gi|86157048|ref|YP_463833.1| cytidine deaminase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85773559|gb|ABC80396.1| cytidine deaminase [Anaeromyxobacter dehalogenans 2CP-C] (134 aa)
Score = 126, Expect = 6.4e-06, Identities = 36/111 (32%), Positives = 64/111 (57%)
  Q:    23 PYSKFRVASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           PYS+FRV +  +A  + + G NVEN+SY +T+C ER A++ AV+ G + +  + + + ++    PCG C Q ++EF    D  + +    G  ++ T+G +L   F ++ L
  S:    25 PYSRFRVGAAVRAGGAIHAGCNVENASYGLTVCAERAAVAAAVAAGARRLDAVVVASGTSPPTPPCGACLQTLAEF-GGPDLPVVLAGARGARVETTLGALLPSAFGRRFL 134
>gi|149190024|ref|ZP_01868302.1| cytidine deaminase [Vibrio shilonii AK1] >gi|148836190|gb|EDL53149.1| cytidine deaminase [Vibrio shilonii AK1] (295 aa)
Score = 126, Expect = 6.9e-06, Identities = 38/117 (32%), Positives = 58/117 (49%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           +Y P S+F V +I +      Y+G N+E   +    T+  E++AIS A   G   + DI +      F +PCG CRQFM+E   +D   I +   +      T+ E L   F  KDL ++
  S:    64 SYAPISEFFVGAIARGTSGKLYFGANMEIIGAQLGQTVHAEQSAISHAWMKGETGLKDITI-----NF-SPCGHCRQFMNELTTADKLVIQLPQRDA----MTLQEYLPESFGPKDLGIT 173
>gi|170019540|ref|YP_001724494.1| cytidine deaminase [Escherichia coli ATCC 8739] >gi|189081898|sp|B1IYC6|CDD_ECOLC Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|169754468|gb|ACA77167.1| cytidine deaminase [Escherichia coli ATCC 8739] (294 aa)
Score = 125, Expect = 7.0e-06, Identities = 37/113 (32%), Positives = 58/113 (51%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E   S D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSSLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|144369235|dbj|BAF56218.1| EGFP-Bsr [Cloning vector piMARK] (383 aa)
Score = 125, Expect = 7.7e-06, Identities = 33/89 (37%), Positives = 52/89 (58%)
  Q:    42 GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD--------SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
            V++E     VT+C E  AI +AVSNG K+   I  +          S    +PCGMCR+ +S++  + DC + I    GK +K TI E++  ++T+
  S:   289 AVHIEAYIGRVTVCAEAIAIGSAVSNGQKDFDTIVAVRHPYSDEVDRSIRVVSPCGMCRELISDY--APDCFVLI-EMNGKLVKTTIEELIPLKYTR 382
>gi|71006840|ref|XP_758066.1| hypothetical protein UM01919.1 [Ustilago maydis 521] >gi|46097567|gb|EAK82800.1| hypothetical protein UM01919.1 [Ustilago maydis 521] (185 aa)
Score = 125, Expect = 8.2e-06, Identities = 31/84 (36%), Positives = 49/84 (58%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHK---------------NITDIYLLTDSNTFATPCGMCRQFMSE 97
           +E  + +Y PYSKFRV A++         G N EN+SY  T+C ER A++ A+    +               +I  + + +D     +PCG+CRQ + E
  S:    21 QEARKLSYSPYSKFRVGAALLTKWGEIILGANYENASYGGTVCAERTALAKALIRSDQLDVTEQNSARRIQRGDIIAVAVASDLEGSCSPCGICRQVIRE 120
>gi|7649700|dbj|BAA94845.1| bsr [Retroviral vector pCXbsr] >gi|26449189|dbj|BAC41722.1| blasticidin deaminase [Retroviral vector pCX4bsr] (142 aa)
Score = 125, Expect = 8.6e-06, Identities = 33/89 (37%), Positives = 52/89 (58%)
  Q:    42 GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD--------SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
            V++E     VT+C E  AI +AVSNG K+   I  +          S    +PCGMCR+ +S++  + DC + I    GK +K TI E++  ++T+
  S:    48 AVHIEAYIGRVTVCAEAIAIGSAVSNGQKDFDTIVAVRHPYSDEVDRSIRVVSPCGMCRELISDY--APDCFVLI-EMNGKLVKTTIEELIPLKYTR 141
>gi|126433859|ref|YP_001069550.1| cytidine deaminase [Mycobacterium sp. JLS] >gi|126233659|gb|ABN97059.1| cytidine deaminase [Mycobacterium sp. JLS] (138 aa)
Score = 125, Expect = 8.9e-06, Identities = 33/95 (34%), Positives = 43/95 (45%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           EI    +  K  E    AY PYS F V A+    DD    G NVEN SY + LC E + +    S G   +  +  +   +    PCG CRQ + E
  S:     4 EIKWEVLRRKAIEASSLAYAPYSGFPVGAAALVDDDRIVTGCNVENVSYGLGLCAECSVVCALHSGGGGRLVALSCVGPDSEVLMPCGRCRQVLLE 99
>gi|54308878|ref|YP_129898.1| cytidine deaminase [Photobacterium profundum SS9] >gi|81615240|sp|Q6LRI0|CDD_PHOPR Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|46913308|emb|CAG20096.1| putative cytidine deaminase [Photobacterium profundum SS9] (295 aa)
Score = 125, Expect = 8.9e-06, Identities = 40/120 (33%), Positives = 61/120 (50%)
  Q:    17 IENAY--VPYSKFRVASICKADDS-FYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           I  AY   P SKF V +I + +    Y+G N+E   +S   T+  E++AIS A   G   ITDI +        +PCG CRQFM+E   +    + +   E    + T+ + L   F   DL+++
  S:    59 IAAAYSVAPISKFFVGAIVRGESGRLYFGANMEFVGASLSQTIHAEQSAISHAWIKGETGITDITI------NYSPCGHCRQFMNELTTAKTLIVQLPERE----EQTLQQYLPESFGPADLNIT 173
>gi|461652|sp|P33967|BSR_BACCE Blasticidin-S deaminase >gi|15294079|gb|AAK95216.1|AF403737_1 blasticidin-S deaminase [Expression and selection vector pKS336] >gi|245237|gb|AAC60404.1| blasticidin S deaminase [Escherichia coli] >gi|1661208|gb|AAB18408.1| blasticidin S deaminase [Cloning vector pBACe4] >gi|1661211|gb|AAB18410.1| blasticidin S deaminase [Cloning vector pPAC4] >gi|48995603|gb|AAT48418.1| blasticidin S deaminase [Cloning vector pSRalphablast] >gi|48995610|gb|AAT48423.1| blasticidin S deaminase [Cloning vector pSRalphablastC] (140 aa)
Score = 125, Expect = 8.9e-06, Identities = 33/89 (37%), Positives = 52/89 (58%)
  Q:    42 GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD--------SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
            V++E     VT+C E  AI +AVSNG K+   I  +          S    +PCGMCR+ +S++  + DC + I    GK +K TI E++  ++T+
  S:    46 AVHIEAYIGRVTVCAEAIAIGSAVSNGQKDFDTIVAVRHPYSDEVDRSIRVVSPCGMCRELISDY--APDCFVLI-EMNGKLVKTTIEELIPLKYTR 139
>gi|87198171|ref|YP_495428.1| cytidine deaminase [Novosphingobium aromaticivorans DSM 12444] >gi|87133852|gb|ABD24594.1| cytidine deaminase [Novosphingobium aromaticivorans DSM 12444] (145 aa)
Score = 125, Expect = 9.0e-06, Identities = 30/79 (37%), Positives = 42/79 (53%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKN-----ITDIYLLTDSNTFATPCGMCRQFMSEF 98
           AY PYS F V A++   D +   G NVEN+SY ++LC E  A S A   G +               ++   +PCG CRQ ++E 
  S:    24 AYAPYSGFHVGAALLFEDGAIVTGANVENASYGLSLCAETVACSIAAHAGRRGGLLAVAVSGGAGGRADAAISPCGRCRQVLNEL 108
>gi|123443007|ref|YP_001006982.1| cytidine deaminase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122089968|emb|CAL12825.1| cytidine deaminase [Yersinia enterocolitica subsp. enterocolitica 8081] (294 aa)
Score = 124, Expect = 9.5e-06, Identities = 35/114 (30%), Positives = 56/114 (49%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F+V +I +    + Y+G N+E S  P+  T+  E+ A++ A      ++  I          TPCG CRQFM+E        I++ N        T+G+ L   F  KDL+++
  S:    67 PVSNFKVGAIARGVSGNLYFGANMEFSGAPLQQTIHAEQCAVTHAWLRNEASLVSI------TVNYTPCGHCRQFMNELNSGTGLHIHLPNRPAS----TLGQYLPDSFGPKDLNIT 173
>gi|148826823|ref|YP_001291576.1| cytidine deaminase [Haemophilus influenzae PittGG] >gi|167006537|sp|A5UEI7|CDD_HAEIG Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|148718065|gb|ABQ99192.1| cytidine deaminase [Haemophilus influenzae PittGG] (292 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/117 (31%), Positives = 60/117 (51%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           ++   S F V +I   +   FY+G N E  NS+   T+  E++AIS A     + I+D+ +        TPCG CRQFM+E   ++  SI++ + +       +   L   F  KDLD++
  S:    63 SHTAISHFNVGAIAIGEQGDFYFGANQEFANSAIQQTIHAEQSAISHAWLRNERRISDMVV------NYTPCGHCRQFMNELHGAEKISIHLPHSQNN----PLHSYLPDAFGPKDLDIA 172
>gi|145634342|ref|ZP_01790052.1| cytidine deaminase [Haemophilus influenzae PittAA] >gi|148825890|ref|YP_001290643.1| cytidine deaminase [Haemophilus influenzae PittEE] >gi|167006536|sp|A5UBV9|CDD_HAEIE Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|145268322|gb|EDK08316.1| cytidine deaminase [Haemophilus influenzae PittAA] >gi|148716050|gb|ABQ98260.1| cytidine deaminase [Haemophilus influenzae PittEE] (292 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/117 (31%), Positives = 60/117 (51%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           ++   S F V +I   +   FY+G N E  NS+   T+  E++AIS A     + I+D+ +        TPCG CRQFM+E   ++  SI++ + +       +   L   F  KDLD++
  S:    63 SHTAISHFNVGAIAIGEQGDFYFGANQEFANSAIQQTIHAEQSAISHAWLRNERRISDMVV------NYTPCGHCRQFMNELHGAEKISIHLPHSQNN----PLHSYLPDAFGPKDLDIA 172
>gi|145632907|ref|ZP_01788640.1| cytidine deaminase [Haemophilus influenzae 3655] >gi|144986563|gb|EDJ93129.1| cytidine deaminase [Haemophilus influenzae 3655] (292 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/117 (31%), Positives = 60/117 (51%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           ++   S F V +I   +   FY+G N E  NS+   T+  E++AIS A     + I+D+ +        TPCG CRQFM+E   ++  SI++ + +       +   L   F  KDLD++
  S:    63 SHTAISHFNVGAIAIGEQGDFYFGANQEFANSAIQQTIHAEQSAISHAWLRNERRISDMVV------NYTPCGHCRQFMNELHGAEKISIHLPHSQNN----PLHSYLPDAFGPKDLDIA 172
>gi|16273260|ref|NP_439501.1| cytidine deaminase [Haemophilus influenzae Rd KW20] >gi|1168859|sp|P44325|CDD_HAEIN Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|1574812|gb|AAC22997.1| cytidine deaminase (cdd) [Haemophilus influenzae Rd KW20] (292 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/117 (31%), Positives = 60/117 (51%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           ++   S F V +I   +   FY+G N E  NS+   T+  E++AIS A     + I+D+ +        TPCG CRQFM+E   ++  SI++ + +       +   L   F  KDLD++
  S:    63 SHTAISHFNVGAIAIGEQGDFYFGANQEFANSAIQQTIHAEQSAISHAWLRNERRISDMVV------NYTPCGHCRQFMNELHGAEKISIHLPHSQNN----PLHSYLPDAFGPKDLDIA 172
>gi|42631648|ref|ZP_00157186.1| COG0295: Cytidine deaminase [Haemophilus influenzae R2866] >gi|53732683|ref|ZP_00154906.2| COG0295: Cytidine deaminase [Haemophilus influenzae R2846] >gi|68250135|ref|YP_249247.1| cytidine deaminase [Haemophilus influenzae 86-028NP] >gi|145629576|ref|ZP_01785374.1| cytidine deaminase [Haemophilus influenzae 22.1-21] >gi|145636055|ref|ZP_01791725.1| cytidine deaminase [Haemophilus influenzae PittHH] >gi|145639057|ref|ZP_01794665.1| cytidine deaminase [Haemophilus influenzae PittII] >gi|81335441|sp|Q4QK60|CDD_HAEI8 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|68058334|gb|AAX88587.1| cytidine deaminase [Haemophilus influenzae 86-028NP] >gi|144978419|gb|EDJ88183.1| cytidine deaminase [Haemophilus influenzae 22.1-21] >gi|145270577|gb|EDK10510.1| cytidine deaminase [Haemophilus influenzae PittHH] >gi|145272029|gb|EDK11938.1| cytidine deaminase [Haemophilus influenzae PittII] (292 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/117 (31%), Positives = 60/117 (51%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           ++   S F V +I   +   FY+G N E  NS+   T+  E++AIS A     + I+D+ +        TPCG CRQFM+E   ++  SI++ + +       +   L   F  KDLD++
  S:    63 SHTAISHFNVGAIAIGEQGDFYFGANQEFANSAIQQTIHAEQSAISHAWLRNERRISDMVV------NYTPCGHCRQFMNELHGAEKISIHLPHSQNN----PLHSYLPDAFGPKDLDIA 172
>gi|16121785|ref|NP_405098.1| cytidine deaminase [Yersinia pestis CO92] >gi|22126535|ref|NP_669958.1| cytidine deaminase [Yersinia pestis KIM] >gi|45441227|ref|NP_992766.1| cytidine deaminase [Yersinia pestis biovar Microtus str. 91001] >gi|108806804|ref|YP_650720.1| cytidine deaminase [Yersinia pestis Antiqua] >gi|108812628|ref|YP_648395.1| cytidine deaminase [Yersinia pestis Nepal516] >gi|145598746|ref|YP_001162822.1| cytidine deaminase [Yersinia pestis Pestoides F] >gi|149366433|ref|ZP_01888467.1| cytidine deaminase [Yersinia pestis CA88-4125] >gi|153947021|ref|YP_001401431.1| cytidine deaminase [Yersinia pseudotuberculosis IP 31758] >gi|162418189|ref|YP_001607390.1| cytidine deaminase [Yersinia pestis Angola] >gi|165924607|ref|ZP_02220439.1| cytidine deaminase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939620|ref|ZP_02228164.1| cytidine deaminase [Yersinia pestis biovar Orientalis str. IP275] >gi|166009352|ref|ZP_02230250.1| cytidine deaminase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211692|ref|ZP_02237727.1| cytidine deaminase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400363|ref|ZP_02305876.1| cytidine deaminase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421843|ref|ZP_02313596.1| cytidine deaminase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167424271|ref|ZP_02316024.1| cytidine deaminase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469199|ref|ZP_02333903.1| cytidine deaminase [Yersinia pestis FV-1] >gi|170024786|ref|YP_001721291.1| cytidine deaminase [Yersinia pseudotuberculosis YPIII] >gi|123073300|sp|Q1CGT5|CDD_YERPN Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|123245922|sp|Q1C9U7|CDD_YERPA Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|167008667|sp|A7FJK3|CDD_YERP3 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|167008668|sp|A4TKN7|CDD_YERPP Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|81594333|sp|Q8ZG08|CDD_YERPE Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|21959536|gb|AAM86209.1|AE013868_3 cytidine/deoxycytidine deaminase [Yersinia pestis KIM] >gi|45436087|gb|AAS61643.1| cytidine deaminase [Yersinia pestis biovar Microtus str. 91001] >gi|108776276|gb|ABG18795.1| cytidine deaminase [Yersinia pestis Nepal516] >gi|108778717|gb|ABG12775.1| cytidine deaminase [Yersinia pestis Antiqua] >gi|115347264|emb|CAL20158.1| cytidine deaminase [Yersinia pestis CO92] >gi|145210442|gb|ABP39849.1| cytidine deaminase [Yersinia pestis Pestoides F] >gi|149290807|gb|EDM40882.1| cytidine deaminase [Yersinia pestis CA88-4125] >gi|152958516|gb|ABS45977.1| cytidine deaminase [Yersinia pseudotuberculosis IP 31758] >gi|162351004|gb|ABX84952.1| cytidine deaminase [Yersinia pestis Angola] >gi|165912417|gb|EDR31050.1| cytidine deaminase [Yersinia pestis biovar Orientalis str. IP275] >gi|165923667|gb|EDR40799.1| cytidine deaminase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991907|gb|EDR44208.1| cytidine deaminase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166207463|gb|EDR51943.1| cytidine deaminase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960328|gb|EDR56349.1| cytidine deaminase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050312|gb|EDR61720.1| cytidine deaminase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057120|gb|EDR66883.1| cytidine deaminase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169751320|gb|ACA68838.1| cytidine deaminase [Yersinia pseudotuberculosis YPIII] (294 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/117 (31%), Positives = 57/117 (48%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           A  P S F V +I +    +FY+G N+E    P+  T+  E+ A++ A   G  N+  I          TPCG CRQFM+E     +  I++    G+    T+G+ L   F   DL ++
  S:    64 ALTPISHFNVGAIARGKSGNFYFGANMEFRGVPLQQTIHAEQCAVTHAWLRGETNLVAI------TVNYTPCGHCRQFMNELNSGSELHIHL---PGR-PPSTLGQYLPDSFGPTDLAIT 173
>gi|157369811|ref|YP_001477800.1| cytidine deaminase [Serratia proteamaculans 568] >gi|166989834|sp|A8GC32|CDD_SERP5 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|157321575|gb|ABV40672.1| cytidine deaminase [Serratia proteamaculans 568] (294 aa)
Score = 124, Expect = 1.0e-05, Identities = 37/114 (32%), Positives = 55/114 (48%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S+F V +I +    + Y+G N+E S  P+  T+  E+ A++ A   G   +  I          TPCG CRQFM+E        I +   E      T+G+ L   F  KDLD++
  S:    67 PISQFYVGAIARGQSGNLYFGANMEFSGAPMQQTIHAEQCAVTHAWLRGEPALASI------TVNYTPCGHCRQFMNELNSGVSLKIRLPGRE----PATLGDYLPDSFGPKDLDIT 173
>gi|119867298|ref|YP_937250.1| cytidine deaminase [Mycobacterium sp. KMS] >gi|119693387|gb|ABL90460.1| cytidine deaminase [Mycobacterium sp. KMS] (138 aa)
Score = 124, Expect = 1.1e-05, Identities = 33/95 (34%), Positives = 43/95 (45%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           EI    +  K  E    AY PYS F V A+    DD    G NVEN SY + LC E + +    S G   +  +  +   +    PCG CRQ + E
  S:     4 EIKWEVLRRKAIEASTLAYAPYSGFPVGAAALVDDDRIVTGCNVENVSYGLGLCAECSVVCALHSGGGGRLVALSCVGPDSEVLMPCGRCRQVLLE 99
>gi|108798202|ref|YP_638399.1| cytidine deaminase [Mycobacterium sp. MCS] >gi|108768621|gb|ABG07343.1| cytidine deaminase [Mycobacterium sp. MCS] (158 aa)
Score = 124, Expect = 1.1e-05, Identities = 33/95 (34%), Positives = 43/95 (45%)
  Q:     3 EINLNTIFIKLKEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           EI    +  K  E    AY PYS F V A+    DD    G NVEN SY + LC E + +    S G   +  +  +   +    PCG CRQ + E
  S:    24 EIKWEVLRRKAIEASTLAYAPYSGFPVGAAALVDDDRIVTGCNVENVSYGLGLCAECSVVCALHSGGGGRLVALSCVGPDSEVLMPCGRCRQVLLE 119
>gi|34539906|ref|NP_904385.1| cytidine deaminase [Porphyromonas gingivalis W83] >gi|188993890|ref|YP_001928142.1| putative cytidine deaminase [Porphyromonas gingivalis ATCC 33277] >gi|34396217|gb|AAQ65284.1| cytidine deaminase [Porphyromonas gingivalis W83] >gi|188593570|dbj|BAG32545.1| putative cytidine deaminase [Porphyromonas gingivalis ATCC 33277] (158 aa)
Score = 123, Expect = 1.2e-05, Identities = 31/83 (37%), Positives = 44/83 (53%)
  Q:    15 EVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSN-GHKNITDIYLLTDSNT----FATPCGMCRQFMSE 97
           E   +AY PYS+F V +    D+     G N EN++YP  LC ER  +  A +      + ++ L+  S +      TPCG CRQ M E
  S:    31 EAARSAYAPYSRFSVGAAVLLDNGEILSGSNQENAAYPSGLCAERTVLFYAGARYPEAAVREMVLVAFSASGRVPLITPCGACRQVMLE 119
>gi|77959260|ref|ZP_00823281.1| COG0295: Cytidine deaminase [Yersinia bercovieri ATCC 43970] (294 aa)
Score = 123, Expect = 1.3e-05, Identities = 36/114 (31%), Positives = 54/114 (47%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F V +I +    + Y+G N+E S  P+  T+  E+ A++ A   G   +  I          TPCG CRQFM+E     D  I++          T+G+ L   F  KDL ++
  S:    67 PISHFMVGAIARGKSGNLYFGANMEFSGAPLQQTIHAEQCAVTHAWLRGETGLVSI------TVNYTPCGHCRQFMNELNSGTDLHIHLPGRPAS----TLGQYLPDAFGPKDLAIT 173
>gi|145346868|ref|XP_001417904.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578132|gb|ABO96197.1| predicted protein [Ostreococcus lucimarinus CCE9901] (243 aa)
Score = 123, Expect = 1.5e-05, Identities = 35/111 (31%), Positives = 55/111 (49%)
  Q:    23 PYSKFRVASICK-ADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           P S+F V +  + A  + Y GVNVE S+ P+  ++  E+ A+ TA++N  + +  I       T   PCG CRQFM+E  ++         W     +  + E+L   F   DL
  S:     4 PTSRFHVGAAARGASGNVYLGVNVEISAVPLNHSIHAEQFALVTAMANEERKVEAI------ATTEAPCGHCRQFMNELRDAGGLRCVTRKW-----RSPLAELLPHAFGPMDL 106
>gi|194540634|ref|YP_002075672.1| cytidine deaminase [Vibrio sp. Ex25] >gi|151939189|gb|EDN58020.1| cytidine deaminase [Vibrio sp. Ex25] (295 aa)
Score = 123, Expect = 1.5e-05, Identities = 38/116 (32%), Positives = 59/116 (50%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y+G N+E     +  T+  E++AIS A   G + I DI +      F +PCG CRQFM+E   +++  I +   E K    ++ E L   F   DL +
  S:    64 SYAPLSEFYVGAIVRGLSGRLYFGANMEFFGVQLGQTVHAEQSAISHAWMKGERGIKDITI-----NF-SPCGHCRQFMNELSTANELKIQLPEREEK----SLHEYLPEAFGPNDLGI 172
>gi|90578667|ref|ZP_01234477.1| cytidine deaminase [Vibrio angustum S14] >gi|90439500|gb|EAS64681.1| cytidine deaminase [Vibrio angustum S14] (295 aa)
Score = 123, Expect = 1.5e-05, Identities = 37/108 (34%), Positives = 58/108 (53%)
  Q:     1 MSEINLNTIFIKLKEV-IENAY--VPYSKFRVASICKADDS-FYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           +S+ NL+   ++L  + +  AY  VP S F V +I +      Y+G N+E   +S   T+  E++AIS A   G   I D+ +        +PCG CRQFM+E   + D  I +
  S:    42 VSQTNLSDTDLRLALLPVAAAYAVVPISNFYVGAIVRGTSGRLYFGANMEFVGASMACTIHAEQSAISHAWIKGETGIKDVTI------NYSPCGHCRQFMNELNTAQDLVIQL 149
>gi|89074286|ref|ZP_01160776.1| cytidine deaminase [Photobacterium sp. SKA34] >gi|89049990|gb|EAR55524.1| cytidine deaminase [Photobacterium sp. SKA34] (295 aa)
Score = 123, Expect = 1.5e-05, Identities = 37/108 (34%), Positives = 58/108 (53%)
  Q:     1 MSEINLNTIFIKLKEV-IENAY--VPYSKFRVASICKADDS-FYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           +S+ NL+   ++L  + +  AY  VP S F V +I +      Y+G N+E   +S   T+  E++AIS A   G   I D+ +        +PCG CRQFM+E   + D  I +
  S:    42 VSQTNLSDTDLRLALLPVAAAYAVVPISNFYVGAIVRGTSGRLYFGANMEFEGASMACTIHAEQSAISHAWIKGETGIKDVTI------NYSPCGHCRQFMNELNTAQDLVIQL 149
>gi|169848785|ref|XP_001831097.1| hypothetical protein CC1G_03988 [Coprinopsis cinerea okayama7#130] >gi|116507824|gb|EAU90719.1| hypothetical protein CC1G_03988 [Coprinopsis cinerea okayama7#130] (145 aa)
Score = 122, Expect = 1.6e-05, Identities = 29/66 (43%), Positives = 42/66 (63%)
  Q:    14 KEVIENA-------YVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT 79
           K++IE A       Y PYS+F V A++  A+     G N+EN+SY  T+C ER AI  AVS G +    + ++T
  S:     8 KKLIEGAFAAKKGSYSPYSRFPVGAALLTAEGEIVKGANIENASYGGTICAERTAIVKAVSEGSRRFVGLAVVT 81
>gi|89096247|ref|ZP_01169140.1| cytidine deaminase [Bacillus sp. NRRL B-14911] >gi|89089101|gb|EAR68209.1| cytidine deaminase [Bacillus sp. NRRL B-14911] (140 aa)
Score = 122, Expect = 1.7e-05, Identities = 32/115 (27%), Positives = 60/115 (52%)
  Q:    14 KEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT--------FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +EVI+  Y  Y +  + S  ++     +  V+VE +   +T+CGE  A+  A+S G   +  I  +   +            PCGMCR+ +S++ +  D    I ++ GK +K  + E+L  ++
  S:    19 EEVIKKNY-RYGRHHIGSAVRSSSGKIFAAVHVEANVGRITVCGEAMAMGKAISEGEHEMKTIVAVAHPHPHEDMEDCWVVAPCGMCRELISDYGKETDV---ILSYHGKLVKCNVMELLPEKY 138
>gi|148975892|ref|ZP_01812681.1| cytidine deaminase [Vibrionales bacterium SWAT-3] >gi|145964637|gb|EDK29890.1| cytidine deaminase [Vibrionales bacterium SWAT-3] (295 aa)
Score = 122, Expect = 1.7e-05, Identities = 35/117 (29%), Positives = 61/117 (52%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           +Y P S F V +I +    + Y+G N+E +   +  T+  E++AIS A   G + I+DI +      F +PCG CRQFM+E   + +  + +   +    + ++ E L   F   DL ++
  S:    64 SYAPLSDFYVGAIVRGLSGTLYFGANLEIAGAQLGQTVHAEQSAISHAWMKGERGISDITI-----NF-SPCGHCRQFMNELTTAKELKVQLPQRD----EMSLQEYLPDSFGPSDLGVT 173
>gi|3818577|gb|AAC69568.1| cytidine deaminase 3 [Arabidopsis thaliana] (322 aa)
Score = 122, Expect = 1.8e-05, Identities = 35/114 (30%), Positives = 60/114 (52%)
  Q:    20 AYVPYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHK--NITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI---FNWEGKYIKYTIGEILKGRFTKKDL 133
           A  P SK++V ++ +A     Y GVNVE    P+  ++  E+  ++    N  K  ++  + + TD N F  PCG CRQF+ E  ++ +  I +      EG +    +  +L  RF+  D+
  S:    37 ALAPISKYKVGAVGRARSGRIYLGVNVELPGLPLHHSIHAEQFLVTNLALNSEKGLHLLAVTISTDGNDFGAPCGNCRQFLMEISKALNIKILLKSKHEAEGSFKSLRL--LLPDRFSPDDV 156
>gi|160891805|ref|ZP_02072808.1| hypothetical protein BACUNI_04262 [Bacteroides uniformis ATCC 8492] >gi|156858283|gb|EDO51714.1| hypothetical protein BACUNI_04262 [Bacteroides uniformis ATCC 8492] (160 aa)
Score = 122, Expect = 1.9e-05, Identities = 37/115 (32%), Positives = 58/115 (50%)
  Q:    14 KEVIENAYVPYSKFRVASICK-ADDSFYYGVNVENSSYPVTLCGERNAISTAVS-NGHKNITDIYLL--TDSNTFAT----PCGMCRQFMSEFME--SDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           +E    +Y PYS F V +  + A+     G N EN++YP  LC ER  +  A S +  + +T + +    + N F      PCG CRQ M E  +       + ++  +G Y    +GE+L   F
  S:    30 REATNRSYAPYSHFSVGAAARLANGIVVTGTNQENAAYPSGLCAERTTLFYANSQHPDQAVTTLAIAARNEHNEFLESPIPPCGACRQVMLETEKRFKHPMRVLLYGKKGIYELKNVGELLPLSF 154
>gi|120599335|ref|YP_963909.1| cytidine deaminase [Shewanella sp. W3-18-1] >gi|124548291|ref|ZP_01707009.1| Cytidine and deoxycytidylate deaminase, zinc-binding region [Shewanella putrefaciens 200] >gi|146292668|ref|YP_001183092.1| cytidine deaminase [Shewanella putrefaciens CN-32] >gi|167008663|sp|A4Y5R0|CDD_SHEPC Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|167008665|sp|A1RL10|CDD_SHESW Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|120559428|gb|ABM25355.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella sp. W3-18-1] >gi|124508601|gb|EAY52694.1| Cytidine and deoxycytidylate deaminase, zinc-binding region [Shewanella putrefaciens 200] >gi|145564358|gb|ABP75293.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella putrefaciens CN-32] (296 aa)
Score = 121, Expect = 2.1e-05, Identities = 37/113 (32%), Positives = 58/113 (51%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I DI +       A+PCG CRQFM+E ++  + +I++   E   + Y     L   F  KDL++
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELPGEALFHSVHAEQSAISHAWLSGESQIVDIIV------NASPCGHCRQFMNELVDGANITIHLPAQESHSLAY----YLPYAFGPKDLNV 171
>gi|157267365|ref|NP_288726.2| cytidine deaminase [Escherichia coli O157:H7 EDL933] >gi|169822941|gb|AAG57281.2|AE005446_9 cytidine/deoxycytidine deaminase [Escherichia coli O157:H7 EDL933] (294 aa)
Score = 121, Expect = 2.2e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLADAFGPKDLEI 172
>gi|15832289|ref|NP_311062.1| cytidine deaminase [Escherichia coli O157:H7 str. Sakai] >gi|168709852|ref|ZP_02742129.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4045] >gi|168717645|ref|ZP_02749922.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4206] >gi|168733481|ref|ZP_02765758.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4115] >gi|168750523|ref|ZP_02775545.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4113] >gi|168757725|ref|ZP_02782732.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4401] >gi|168763799|ref|ZP_02788806.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4501] >gi|168767756|ref|ZP_02792763.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4486] >gi|168773146|ref|ZP_02798153.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4196] >gi|168779986|ref|ZP_02804993.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4076] >gi|168788953|ref|ZP_02813960.1| cytidine deaminase [Escherichia coli O157:H7 str. EC869] >gi|168792756|ref|ZP_02817763.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4042] >gi|168801168|ref|ZP_02826175.1| cytidine deaminase [Escherichia coli O157:H7 str. EC508] >gi|195935519|ref|ZP_03080901.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4024] >gi|85681029|sp|Q8X648|CDD_ECO57 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|13362504|dbj|BAB36458.1| cytidine/deoxycytidine deaminase [Escherichia coli O157:H7 str. Sakai] >gi|187771285|gb|EDU35129.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4196] >gi|188015351|gb|EDU53473.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4113] >gi|189001890|gb|EDU70876.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4076] >gi|189355346|gb|EDU73765.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4401] >gi|189362904|gb|EDU81323.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4486] >gi|189366054|gb|EDU84470.1| cytidine deaminase [Escherichia coli O157:H7 str. EC4501] >gi|189371363|gb|EDU89779.1| cytidine deaminase [Escherichia coli O157:H7 str. EC869] >gi|189376625|gb|EDU95041.1| cytidine deaminase [Escherichia coli O157:H7 str. EC508] (294 aa)
Score = 121, Expect = 2.2e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLADAFGPKDLEI 172
>gi|157375753|ref|YP_001474353.1| cytidine deaminase [Shewanella sediminis HAW-EB3] >gi|189081905|sp|A8FWK2|CDD_SHESH Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|157318127|gb|ABV37225.1| Cytidine deaminase [Shewanella sediminis HAW-EB3] (296 aa)
Score = 121, Expect = 2.2e-05, Identities = 39/115 (33%), Positives = 63/115 (54%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK----YIKYTIG----EILKGRFTKKDLDLSV 137
           P S+F V +I K      Y G N+E S   +  ++  E++AIS A  +G + I D+ +      F +PCG CRQFM+E +E     I++   + +    Y+ Y  G     I +   TK+  +LS+
  S:    66 PISEFYVGAIAKGKSGDIYMGANMELSGEALFHSVHAEQSAISHAWLSGERQIEDVIV-----NF-SPCGHCRQFMNELVEGQKVKIHLPEQQTQPLSHYLPYAFGPSDLNITEPLLTKQQHELSL 185
>gi|82777374|ref|YP_403723.1| cytidine deaminase [Shigella dysenteriae Sd197] >gi|85540971|sp|Q32EM3|CDD_SHIDS Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|81241522|gb|ABB62232.1| cytidine/deoxycytidine deaminase [Shigella dysenteriae Sd197] (294 aa)
Score = 121, Expect = 2.4e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|41090|emb|CAA44849.1| cytidine deaminase [Escherichia coli] (330 aa)
Score = 121, Expect = 2.4e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|194431485|ref|ZP_03063777.1| cytidine deaminase [Shigella dysenteriae 1012] >gi|194420310|gb|EDX36387.1| cytidine deaminase [Shigella dysenteriae 1012] (294 aa)
Score = 121, Expect = 2.4e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|157156119|ref|YP_001463494.1| cytidine deaminase [Escherichia coli E24377A] >gi|191165451|ref|ZP_03027293.1| cytidine deaminase [Escherichia coli B7A] >gi|167006531|sp|A7ZNW5|CDD_ECO24 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|157078149|gb|ABV17857.1| cytidine deaminase [Escherichia coli E24377A] >gi|190904614|gb|EDV64321.1| cytidine deaminase [Escherichia coli B7A] (294 aa)
Score = 121, Expect = 2.4e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|16130081|ref|NP_416648.1| cytidine/deoxycytidine deaminase [Escherichia coli str. K-12 substr. MG1655] >gi|24113533|ref|NP_708043.1| cytidine deaminase [Shigella flexneri 2a str. 301] >gi|30063587|ref|NP_837758.1| cytidine deaminase [Shigella flexneri 2a str. 2457T] >gi|74312666|ref|YP_311085.1| cytidine deaminase [Shigella sonnei Ss046] >gi|82543536|ref|YP_407483.1| cytidine deaminase [Shigella boydii Sb227] >gi|89108960|ref|AP_002740.1| cytidine/deoxycytidine deaminase [Escherichia coli W3110] >gi|110806120|ref|YP_689640.1| cytidine deaminase [Shigella flexneri 5 str. 8401] >gi|157161623|ref|YP_001458941.1| cytidine deaminase [Escherichia coli HS] >gi|170081766|ref|YP_001731086.1| cytidine/deoxycytidine deaminase [Escherichia coli str. K12 substr. DH10B] >gi|170680352|ref|YP_001744337.1| cytidine deaminase [Escherichia coli SMS-3-5] >gi|187732217|ref|YP_001879528.1| cytidine deaminase [Shigella boydii CDC 3083-94] >gi|188493466|ref|ZP_03000736.1| cytidine deaminase [Escherichia coli 53638] >gi|193071075|ref|ZP_03052001.1| cytidine deaminase [Escherichia coli E110019] >gi|194435985|ref|ZP_03068087.1| cytidine deaminase [Escherichia coli 101-1] >gi|78099946|sp|P0ABF6|CDD_ECOLI Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|123146896|sp|Q0T2Y0|CDD_SHIF8 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|167006532|sp|A8A204|CDD_ECOHS Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|78099947|sp|P0ABF7|CDD_SHIFL Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|85540970|sp|Q322V3|CDD_SHIBS Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|85540972|sp|Q3Z062|CDD_SHISS Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|2392080|pdb|1AF2|A Chain A, Crystal Structure Of Cytidine Deaminase Complexed With Uridine >gi|157829950|pdb|1ALN|A Chain A, Crystal Structure Of Cytidine Deaminase Complexed With 3- Deazacytidine >gi|157830721|pdb|1CTT|A Chain A, Transition-State Selectivity For A Single Oh Group During Catalysis By Cytidine Deaminase >gi|157830722|pdb|1CTU|A Chain A, Transition-State Selectivity For A Single Oh Group During Catalysis By Cytidine Deaminase >gi|145470|gb|AAA23542.1| cytidine deaminase >gi|453291|gb|AAA60533.1| cytidine deaminase [Escherichia coli] >gi|1788465|gb|AAC75204.1| cytidine/deoxycytidine deaminase [Escherichia coli str. K-12 substr. MG1655] >gi|24052577|gb|AAN43750.1| cytidine/deoxycytidine deaminase [Shigella flexneri 2a str. 301] >gi|30041840|gb|AAP17567.1| cytidine/deoxycytidine deaminase [Shigella flexneri 2a str. 2457T] >gi|73856143|gb|AAZ88850.1| cytidine/deoxycytidine deaminase [Shigella sonnei Ss046] >gi|81244947|gb|ABB65655.1| cytidine/deoxycytidine deaminase [Shigella boydii Sb227] >gi|85675257|dbj|BAE76620.1| cytidine/deoxycytidine deaminase [Escherichia coli W3110] >gi|110615668|gb|ABF04335.1| cytidine/deoxycytidine deaminase [Shigella flexneri 5 str. 8401] >gi|157067303|gb|ABV06558.1| cytidine deaminase [Escherichia coli HS] >gi|169889601|gb|ACB03308.1| cytidine/deoxycytidine deaminase [Escherichia coli str. K12 substr. DH10B] >gi|170518070|gb|ACB16248.1| cytidine deaminase [Escherichia coli SMS-3-5] >gi|187429209|gb|ACD08483.1| cytidine deaminase [Shigella boydii CDC 3083-94] >gi|188488665|gb|EDU63768.1| cytidine deaminase [Escherichia coli 53638] >gi|192955598|gb|EDV86075.1| cytidine deaminase [Escherichia coli E110019] >gi|194424713|gb|EDX40698.1| cytidine deaminase [Escherichia coli 101-1] >gi|744207|prf||2014253BU cytidine deaminase (294 aa)
Score = 121, Expect = 2.4e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|26248523|ref|NP_754563.1| cytidine deaminase [Escherichia coli CFT073] >gi|91211429|ref|YP_541415.1| cytidine deaminase [Escherichia coli UTI89] >gi|110642352|ref|YP_670082.1| cytidine deaminase [Escherichia coli 536] >gi|117624345|ref|YP_853258.1| cytidine deaminase [Escherichia coli APEC O1] >gi|191170069|ref|ZP_03031623.1| cytidine deaminase [Escherichia coli F11] >gi|122423223|sp|Q1R9T0|CDD_ECOUT Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|123049057|sp|Q0TFU8|CDD_ECOL5 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|167006533|sp|A1AD04|CDD_ECOK1 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|78099197|sp|Q8FFV3|CDD_ECOL6 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|26108928|gb|AAN81131.1|AE016763_90 Cytidine deaminase [Escherichia coli CFT073] >gi|91073003|gb|ABE07884.1| cytidine deaminase [Escherichia coli UTI89] >gi|110343944|gb|ABG70181.1| cytidine deaminase [Escherichia coli 536] >gi|115513469|gb|ABJ01544.1| cytidine deaminase [Escherichia coli APEC O1] >gi|190909585|gb|EDV69170.1| cytidine deaminase [Escherichia coli F11] (294 aa)
Score = 121, Expect = 2.4e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G K +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|153814077|ref|ZP_01966745.1| hypothetical protein RUMTOR_00285 [Ruminococcus torques ATCC 27756] >gi|145848473|gb|EDK25391.1| hypothetical protein RUMTOR_00285 [Ruminococcus torques ATCC 27756] (299 aa)
Score = 121, Expect = 2.4e-05, Identities = 30/94 (31%), Positives = 50/94 (53%)
  Q:    30 ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI-FNWEGKYIKYTIGEI 123
           A+I     + Y GV ++ +   + +C ERNAI+  ++NG   I  +  +  +     PCG CR+FM + M     SI I  ++E K +  T+G+I
  S:   201 AAILTEKGNIYVGVCIDTAC-SLGMCAERNAIANMITNGENGICRLIAVDRNGKAIPPCGACREFMVQLMPDHYHSIQIMMDYENKKM-VTLGDI 293
>gi|161486621|ref|NP_934755.2| cytidine deaminase [Vibrio vulnificus YJ016] >gi|85540974|sp|Q7MK48|CDD_VIBVY Cytidine deaminase (Cytidine aminohydrolase) (CDA) (295 aa)
Score = 121, Expect = 2.4e-05, Identities = 32/95 (33%), Positives = 52/95 (54%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK 114
           +Y P S+F V +I +    + Y+G N+E     +  T+  E++AIS A   G + ++DI +      F +PCG CRQFM+E   + +  I +   E K
  S:    64 SYAPISEFYVGAIVRGLSGTLYFGANMEFDGVQLGQTVHAEQSAISHAWMKGEQGLSDITI-----NF-SPCGHCRQFMNELSSAKELKIQLPEREEK 155
>gi|37198892|dbj|BAC94726.1| cytidine deaminase [Vibrio vulnificus YJ016] (302 aa)
Score = 121, Expect = 2.4e-05, Identities = 32/95 (33%), Positives = 52/95 (54%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK 114
           +Y P S+F V +I +    + Y+G N+E     +  T+  E++AIS A   G + ++DI +      F +PCG CRQFM+E   + +  I +   E K
  S:    71 SYAPISEFYVGAIVRGLSGTLYFGANMEFDGVQLGQTVHAEQSAISHAWMKGEQGLSDITI-----NF-SPCGHCRQFMNELSSAKELKIQLPEREEK 162
>gi|86146816|ref|ZP_01065136.1| cytidine deaminase [Vibrio sp. MED222] >gi|85835466|gb|EAQ53604.1| cytidine deaminase [Vibrio sp. MED222] (295 aa)
Score = 121, Expect = 2.5e-05, Identities = 30/89 (33%), Positives = 50/89 (56%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           +Y P S F V +I +    + Y+G N+E +   +  T+  E++AIS A   G + I+DI +      F +PCG CRQFM+E   + +  + +
  S:    64 SYAPLSDFYVGAIVRGLSGTLYFGANLEIAGAQLGQTVHAEQSAISHAWMKGEQGISDITI-----NF-SPCGHCRQFMNELTTAKELKVQL 149
>gi|84394528|ref|ZP_00993237.1| cytidine deaminase [Vibrio splendidus 12B01] >gi|84374853|gb|EAP91791.1| cytidine deaminase [Vibrio splendidus 12B01] (295 aa)
Score = 121, Expect = 2.5e-05, Identities = 30/89 (33%), Positives = 50/89 (56%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           +Y P S F V +I +    + Y+G N+E +   +  T+  E++AIS A   G + I+DI +      F +PCG CRQFM+E   + +  + +
  S:    64 SYAPLSDFYVGAIVRGLSGTLYFGANLEIAGAQLGQTVHAEQSAISHAWMKGEQGISDITI-----NF-SPCGHCRQFMNELTTAKELKVQL 149
>gi|27361847|gb|AAO10753.1|AE016805_10 Cytidine deaminase [Vibrio vulnificus CMCP6] (302 aa)
Score = 121, Expect = 2.6e-05, Identities = 32/95 (33%), Positives = 52/95 (54%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK 114
           +Y P S+F V +I +    + Y+G N+E     +  T+  E++AIS A   G + ++DI +      F +PCG CRQFM+E   + +  I +   E K
  S:    71 SYAPISEFYVGAIVRGLSGALYFGANMEFDGVQLGQTVHAEQSAISHAWMKGEQGLSDITI-----NF-SPCGHCRQFMNELSSAKELKIQLPEREEK 162
>gi|161501809|ref|NP_761226.2| cytidine deaminase [Vibrio vulnificus CMCP6] >gi|85540973|sp|Q8DA31|CDD_VIBVU Cytidine deaminase (Cytidine aminohydrolase) (CDA) (295 aa)
Score = 121, Expect = 2.6e-05, Identities = 32/95 (33%), Positives = 52/95 (54%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK 114
           +Y P S+F V +I +    + Y+G N+E     +  T+  E++AIS A   G + ++DI +      F +PCG CRQFM+E   + +  I +   E K
  S:    64 SYAPISEFYVGAIVRGLSGALYFGANMEFDGVQLGQTVHAEQSAISHAWMKGEQGLSDITI-----NF-SPCGHCRQFMNELSSAKELKIQLPEREEK 155
>gi|15602124|ref|NP_245196.1| cytidine deaminase [Pasteurella multocida subsp. multocida str. Pm70] >gi|81637270|sp|Q9CP11|CDD_PASMU Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|12720488|gb|AAK02343.1| Cdd [Pasteurella multocida subsp. multocida str. Pm70] (294 aa)
Score = 121, Expect = 2.6e-05, Identities = 34/92 (36%), Positives = 51/92 (55%)
  Q:    17 IENAY--VPYSKFRVASICKAD-DSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           I  AY   P S+F V +I      ++Y+G N+E +S  +  T+  E++AIS A  N    ITD+ +        TPCG CRQFM+E   +    I++
  S:    60 IAAAYSLAPISQFHVGAIAIGQRGAYYFGANLEFASTHIQQTVHAEQSAISHAWMNHESAITDVVV------NYTPCGHCRQFMNELKTAPQLKIHL 150
>gi|51595864|ref|YP_070055.1| cytidine deaminase [Yersinia pseudotuberculosis IP 32953] >gi|186894951|ref|YP_001872063.1| cytidine deaminase [Yersinia pseudotuberculosis PB1/+] >gi|81639819|sp|Q66C79|CDD_YERPS Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|51589146|emb|CAH20766.1| cytidine deaminase [Yersinia pseudotuberculosis IP 32953] >gi|186697977|gb|ACC88606.1| cytidine deaminase [Yersinia pseudotuberculosis PB1/+] (294 aa)
Score = 120, Expect = 2.9e-05, Identities = 37/117 (31%), Positives = 57/117 (48%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           A  P S F V +I +    +FY+G N+E    P+  T+  E+ A++ A   G  N+  I          TPCG CRQFM+E     +  I++    G+    T+G+ L   F   DL ++
  S:    64 ALTPISHFNVGAIARGKSGNFYFGANMEFRGVPLQQTIHAEQCAVTHAWLRGETNLVAI------TVNYTPCGHCRQFMNELNCGSELHIHL---PGR-PPSTLGQYLPDSFGPTDLAIT 173
>gi|52142659|ref|YP_084171.1| hypothetical protein BCZK2582 [Bacillus cereus E33L] >gi|51976128|gb|AAU17678.1| cytidine deaminase family enzyme; blasticidin S deaminase [Bacillus cereus E33L] (143 aa)
Score = 120, Expect = 2.9e-05, Identities = 33/118 (27%), Positives = 62/118 (52%)
  Q:    14 KEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT--------FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           ++VIE  Y  Y +  + S  +    + Y  V+VE +   +T+CGE  AI  ++S G      I  +   +            PCGMCR+ +S++ ++ +    I ++ G+ +K  + E+L  ++T K
  S:    19 EKVIEKNY-KYGRHHIGSAVRTKTGNIYAAVHVEANVGRITVCGEAMAIGKSISEGDHEFDTIVAVAHPHPHEDIEKCWVVAPCGMCRELISDYGKNTNV---ILSYNGELVKCNVMELLPEKYTSK 141
>gi|152978108|ref|YP_001343737.1| cytidine deaminase [Actinobacillus succinogenes 130Z] >gi|171472955|sp|A6VLF5|CDD_ACTSZ Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|150839831|gb|ABR73802.1| Cytidine deaminase [Actinobacillus succinogenes 130Z] (296 aa)
Score = 120, Expect = 3.0e-05, Identities = 38/117 (32%), Positives = 57/117 (48%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           A  P S F V ++      +FY+G N E S   V  T+  E++A+S A   G   +TD+ +        TPCG CRQFM+E   +D   I++ +     +       L   F  KDL++S
  S:    68 ASAPVSHFNVGAVAVGQSGAFYFGANQEFSGDAVQQTVHAEQSAVSHAWLAGEVALTDMVV------NYTPCGHCRQFMNELNSADRLQIHLPHSRNNRLH----SYLPDAFGPKDLNIS 177
>gi|116057592|emb|CAL53795.1| putative cytidine deaminase (ISS) [Ostreococcus tauri] (287 aa)
Score = 120, Expect = 3.4e-05, Identities = 39/116 (33%), Positives = 54/116 (46%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           E A  P SKF V A    A    Y GVNVE    P+  ++  E+ A+  A++ G + I  I       T   PCG CRQFM+E  +  D  +   +W     +  + E+L   F   DL
  S:    26 ELARPPTSKFHVGACALGASGRAYLGVNVEIPGVPLNHSVHAEQFALVIAMACGERRIEAI------ATTEAPCGHCRQFMNELRDGQDLKVVTKDW-----RLPLRELLPHAFGPMDL 133
>gi|90415073|ref|ZP_01223031.1| cytidine deaminase [Photobacterium profundum 3TCK] >gi|90323808|gb|EAS40421.1| cytidine deaminase [Photobacterium profundum 3TCK] (295 aa)
Score = 120, Expect = 3.4e-05, Identities = 39/120 (32%), Positives = 60/120 (50%)
  Q:    17 IENAY--VPYSKFRVASICKADDS-FYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           I  AY   P S F V +I + +    Y+G N+E   +S   T+  E++AIS A   G   ITDI +        +PCG CRQFM+E   +    + +   E    + T+ + L   F   DL+++
  S:    59 IAAAYSVAPISNFFVGAIVRGESGRLYFGANMEFVGASLSQTIHAEQSAISHAWIKGETGITDITI------NYSPCGHCRQFMNELTTAKTLIVQLPERE----EQTLQQYLPESFGPADLNIT 173
>gi|91223951|ref|ZP_01259215.1| cytidine deaminase [Vibrio alginolyticus 12G01] >gi|91191443|gb|EAS77708.1| cytidine deaminase [Vibrio alginolyticus 12G01] (295 aa)
Score = 119, Expect = 3.5e-05, Identities = 37/116 (31%), Positives = 58/116 (50%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S F V +I +      Y+G N+E     +  T+  E++AIS A   G + + DI +      F +PCG CRQFM+E   +++  I +   E K    ++ E L   F   DL +
  S:    64 SYAPLSDFYVGAIVRGLSGRLYFGANMEFFGVQLGQTVHAEQSAISHAWMKGERGVKDITI-----NF-SPCGHCRQFMNELSTANELKIQLPEREEK----SLHEYLPEAFGPNDLGI 172
>gi|77962482|ref|ZP_00826302.1| COG0295: Cytidine deaminase [Yersinia mollaretii ATCC 43969] (294 aa)
Score = 119, Expect = 3.8e-05, Identities = 35/114 (30%), Positives = 54/114 (47%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F V +I +    + Y+G N+E S  P+  T+  E+ A++ +   G  ++  I          TPCG CRQFM+E     D  I++          T+G  L   F  KDL ++
  S:    67 PISHFMVGAIARGKSGNLYFGANMEFSGTPLQQTIHAEQCAVTHSWLRGEASLVSI------TVNYTPCGHCRQFMNELNSGTDLHIHLPGRPAS----TLGHYLPDAFGPKDLAIT 173
>gi|134103008|ref|YP_001108669.1| cytidine deaminase [Saccharopolyspora erythraea NRRL 2338] >gi|133915631|emb|CAM05744.1| cytidine deaminase [Saccharopolyspora erythraea NRRL 2338] (132 aa)
Score = 119, Expect = 3.9e-05, Identities = 31/97 (31%), Positives = 43/97 (44%)
  Q:     2 SEINLNTIFIKLKEVIENAYVPYSKFRV--ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           S ++ + +     EV   AY PYS  +V  A+IC  D     G NVEN+SY + LC E          G      +   + +     PCG CRQ + E 
  S:     9 SSVDWDALRAAAVEVAGKAYCPYSNLQVGAAAICD-DGRTVVGCNVENASYGLALCAECTMAGQLRLTGGGRFVAVACRSGTGELLMPCGRCRQVLFEL 106
>gi|115449949|ref|XP_001218738.1| cytidine deaminase [Aspergillus terreus NIH2624] >gi|114187687|gb|EAU29387.1| cytidine deaminase [Aspergillus terreus NIH2624] (123 aa)
Score = 119, Expect = 4.1e-05, Identities = 25/46 (54%), Positives = 28/46 (60%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAV 65
           AY PYS FRV A I      +  G NVEN++YPV  C ER A  TAV
  S:    27 AYCPYSNFRVGACILTQSGEYIQGANVENAAYPVGTCAERVAFGTAV 73
>gi|113970746|ref|YP_734539.1| cytidine deaminase [Shewanella sp. MR-4] >gi|122943733|sp|Q0HHI5|CDD_SHESM Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|113885430|gb|ABI39482.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella sp. MR-4] (296 aa)
Score = 119, Expect = 4.1e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I D+ +       A+PCG CRQFM+E +E     I++ + +   + Y     L   F  KDL++
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELPGEALFHSVHAEQSAISHAWLSGESQIVDMIV------NASPCGHCRQFMNELVEGGQIKIHLPSQDSHLLSY----YLPYAFGPKDLNV 171
>gi|114047973|ref|YP_738523.1| cytidine deaminase [Shewanella sp. MR-7] >gi|123326413|sp|Q0HTT9|CDD_SHESR Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|113889415|gb|ABI43466.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella sp. MR-7] (296 aa)
Score = 119, Expect = 4.1e-05, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I D+ +       A+PCG CRQFM+E +E     I++ + +   + Y     L   F  KDL++
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELPGEALFHSVHAEQSAISHAWLSGESQIVDMIV------NASPCGHCRQFMNELVEGGQIKIHLPSQDSHLLSY----YLPYAFGPKDLNV 171
>gi|146083266|ref|XP_001464694.1| cytidine deaminase-like protein [Leishmania infantum JPCM5] >gi|134068788|emb|CAM59722.1| cytidine deaminase-like protein [Leishmania infantum] (182 aa)
Score = 119, Expect = 4.2e-05, Identities = 33/80 (41%), Positives = 43/80 (53%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT------------PCGMCRQFMSE 97
           +NAY PYS F V A++   D S   G N EN +   + C ER AI  A   GH+    + +   S   AT            PCG+CRQ + E
  S:    37 KNAYSPYSNFSVGAALLHDDGSVTAGCNYENCTLQ-SCCAERCAIVRANMEGHRRANAVAVYGRSYGAATPTNPPPADALCPPCGLCRQLLVE 128
>gi|145955651|ref|ZP_01804652.1| hypothetical protein CdifQ_04000854 [Clostridium difficile QCD-32g58] >gi|168697151|ref|ZP_02729428.1| Cytidine deaminase [Clostridium difficile QCD-37x79] >gi|168725530|ref|ZP_02757807.1| Cytidine deaminase [Clostridium difficile QCD-76w55] >gi|168732112|ref|ZP_02764389.1| Cytidine deaminase [Clostridium difficile QCD-97b34] >gi|196161922|ref|ZP_03122483.1| cytidine/deoxycytidylate deaminase family protein [Clostridium difficile CIP 107932] (132 aa)
Score = 119, Expect = 4.3e-05, Identities = 23/83 (27%), Positives = 44/83 (53%)
  Q:    30 ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWE 112
           A+I     + Y GV ++ +   + +C ERNAI+  ++NG   IT +  +  + +  +PCG CR+++ +  +   C   + N E
  S:    30 AAILTDSGNVYTGVCIDTAC-TLGMCAERNAIANMITNGESKITKLVCVMSNGSVGSPCGACREYLMQLDKDSACIEILVNVE 111
>gi|157867472|ref|XP_001682290.1| cytidine deaminase-like protein [Leishmania major] >gi|68125743|emb|CAJ03496.1| cytidine deaminase-like protein [Leishmania major] (182 aa)
Score = 119, Expect = 4.4e-05, Identities = 33/80 (41%), Positives = 43/80 (53%)
  Q:    18 ENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT------------PCGMCRQFMSE 97
           +NAY PYS F V A++   D S   G N EN +   + C ER AI  A   GH+    + +   S   AT            PCG+CRQ + E
  S:    37 KNAYSPYSNFSVGAALLHDDGSVTAGCNYENCTLQ-SCCAERCAIVRANVEGHRRANAVAVYGRSYGAATPTNPPPVDALCPPCGLCRQLLVE 128
>gi|117921014|ref|YP_870206.1| cytidine deaminase [Shewanella sp. ANA-3] >gi|167008664|sp|A0KYD1|CDD_SHESA Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|117613346|gb|ABK48800.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella sp. ANA-3] (296 aa)
Score = 118, Expect = 4.5e-05, Identities = 40/117 (34%), Positives = 60/117 (51%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD----LSVKQ 139
           P S+F V +I K      Y G N+E    +   ++  E++AIS A  +G   I D+ +       A+PCG CRQFM+E +E     I++ + +   + Y     L   F  KDL+    L VKQ
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELLGEALFHSVHAEQSAISHAWLSGESQIVDMIV------NASPCGHCRQFMNELVEGGQIKIHLPSQDSHLLSY----YLPYAFGPKDLNVQSPLLVKQ 179
>gi|125525159|gb|EAY73273.1| hypothetical protein OsI_001120 [Oryza sativa (indica cultivar-group)] (470 aa)
Score = 118, Expect = 4.7e-05, Identities = 36/114 (31%), Positives = 56/114 (49%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F V +I +    + Y+G N+E S  P+  ++  E++A++ A   G K +  I          TPCG CRQFM+E        I +    G+    T+ + L   F  KDLD++
  S:   243 PISHFHVGAIARGQSGNLYFGANMEFSGAPLQQSVHAEQSAVTHAWLRGEKALASI------TVNYTPCGHCRQFMNELNSGGALQIRL---PGR-APATLADYLPDAFGPKDLDVA 349
>gi|52425890|ref|YP_089027.1| cytidine deaminase [Mannheimia succiniciproducens MBEL55E] >gi|81609425|sp|Q65RG8|CDD_MANSM Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|52307942|gb|AAU38442.1| Cdd protein [Mannheimia succiniciproducens MBEL55E] (296 aa)
Score = 118, Expect = 4.7e-05, Identities = 38/116 (32%), Positives = 57/116 (49%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           A  P S+F V +I      SFY+G N E   +S   T+  E++AIS A   G K I  + +        TPCG CRQFM+E   ++   I++ + +   +       L   F  KDL++
  S:    68 ALTPISQFNVGAIAIGQSGSFYFGANQEFVAASMQQTVHAEQSAISHAWLAGEKAIAHMVV------NYTPCGHCRQFMNELNSAERLKIHLPHSQNNLLH----NYLPDAFGPKDLNI 176
>gi|149912252|ref|ZP_01900828.1| cytidine deaminase [Moritella sp. PE36] >gi|149804673|gb|EDM64727.1| cytidine deaminase [Moritella sp. PE36] (297 aa)
Score = 117, Expect = 6.3e-05, Identities = 39/114 (34%), Positives = 60/114 (52%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F V +I +A   + Y+G N E +   +  ++  E+ AI+ A S+    I DI  +TDS     PCG CRQFM+E   + + S+   N +   +K T+  +L   F   DL +S
  S:    67 PISDFNVGAIARAGSGNLYFGANYEFTHQALFNSVHAEQAAINNAFSHHESAILDI-TVTDS-----PCGHCRQFMNELHCAPELSV---NLKATGVK-TLATLLPDSFGPIDLGIS 173
>gi|86134148|ref|ZP_01052730.1| cytidine deaminase [Tenacibaculum sp. MED152] >gi|85821011|gb|EAQ42158.1| cytidine deaminase [Polaribacter dokdonensis MED152] (160 aa)
Score = 117, Expect = 6.3e-05, Identities = 40/114 (35%), Positives = 57/114 (50%)
  Q:    12 KLKEVIENAYVPYSKFRVASICKADDSFY-YGVNVENSSYPVTLCGERNAISTAVSNGHK------NITDIYLLTDSNTFATPCGMCRQFMSEF-MESDDCSIYIFNWEGKYIKYTIGEILK 125
           K  E  + AY PYSKF V +    D+     G N EN++YP  +C ER AI  A S   +       I+    ++  +    PCG CRQ +SE+ M+       +F  E       IGE++K
  S:    29 KAIEARKKAYAPYSKFSVGAALLLDNGVVVLGNNQENAAYPSGMCAERVAIWRAGSEYPEMKVLKLAISASSAISKVDKPVGPCGACRQSLSEYEMKQKQSFSILFMGE-------IGEVIK 143
>gi|127512539|ref|YP_001093736.1| cytidine deaminase [Shewanella loihica PV-4] >gi|167008662|sp|A3QDC9|CDD_SHELP Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|126637834|gb|ABO23477.1| Cytidine and deoxycytidylate deaminase, zinc-binding domain protein [Shewanella loihica PV-4] (296 aa)
Score = 117, Expect = 6.4e-05, Identities = 32/86 (37%), Positives = 47/86 (54%)
  Q:    23 PYSKFRVASICK-ADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           P S+F V +I K A    Y G N+E     +  ++  E++AIS A  +G   I DI +       A+PCG CRQFM+E +E     I++
  S:    66 PISEFYVGAIAKGASGDIYMGANLELDGEALFHSVHAEQSAISHAWLSGETGIEDIIV------NASPCGHCRQFMNELVEGQAIRIHL 148
>gi|113461400|ref|YP_719469.1| cytidine deaminase [Haemophilus somnus 129PT] >gi|122945394|sp|Q0I4X6|CDD_HAES1 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|112823443|gb|ABI25532.1| cytidine deaminase [Haemophilus somnus 129PT] (303 aa)
Score = 117, Expect = 6.6e-05, Identities = 35/108 (32%), Positives = 54/108 (50%)
  Q:     1 MSEINLNTIFIKLKEVIENAYVPYSKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           M++  L  I + +     N  +  S F V +I K +  SFY+G N E   ++   T+  E++AIS A       IT+I          TPCG CRQFM+E   ++   I++
  S:    56 MTDKELALILLPVSACYANPTI--SHFSVGAIAKGESGSFYFGANQEFCTTNIQQTVHAEQSAISHAWMRRESKITEI------TVNYTPCGHCRQFMNELNSAETLRIHL 158
>gi|150422367|gb|EDN14327.1| cytidine deaminase [Vibrio cholerae AM-19226] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|153826965|ref|ZP_01979632.1| cytidine deaminase [Vibrio cholerae MZO-2] >gi|149739213|gb|EDM53485.1| cytidine deaminase [Vibrio cholerae MZO-2] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|153801924|ref|ZP_01956510.1| cytidine deaminase [Vibrio cholerae MZO-3] >gi|124122569|gb|EAY41312.1| cytidine deaminase [Vibrio cholerae MZO-3] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|89890162|ref|ZP_01201673.1| cytidine deaminase [Flavobacteria bacterium BBFL7] >gi|89518435|gb|EAS21091.1| cytidine deaminase [Flavobacteria bacterium BBFL7] (160 aa)
Score = 117, Expect = 6.7e-05, Identities = 40/109 (36%), Positives = 57/109 (52%)
  Q:     1 MSEINLNTIFIKLKEVI---ENAYVPYSKFRVA-SICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLT-----DSNTFAT-PCGMCRQFMSEFMESDDCSIYIF 109
           MSE++ +T+   +++ I     AY PYS F V  +I   +     G N EN++YP  LC ER AI  A +        +  LT     DS T    PCG CRQ ++E+       I I+
  S:    16 MSELD-STVHSLMQQSIAARHKAYAPYSNFTVGCAILLENGEVVTGNNQENAAYPSGLCAERVAIYAAGAQYPGVAIKMMALTASPIDDSLTIPVPPCGACRQAIAEYENKQKSFIPIY 133
>gi|147675337|ref|YP_001216798.1| cytidine deaminase [Vibrio cholerae O395] >gi|172047384|sp|A5F1V7|CDD_VIBC3 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|146317220|gb|ABQ21759.1| cytidine deaminase [Vibrio cholerae O395] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|125621062|gb|EAZ49409.1| cytidine deaminase [Vibrio cholerae V51] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|121728807|ref|ZP_01681819.1| cytidine deaminase [Vibrio cholerae V52] >gi|121628895|gb|EAX61351.1| cytidine deaminase [Vibrio cholerae V52] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|15641244|ref|NP_230876.1| cytidine deaminase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591214|ref|ZP_01678516.1| cytidine deaminase [Vibrio cholerae 2740-80] >gi|153212307|ref|ZP_01948095.1| cytidine deaminase [Vibrio cholerae 1587] >gi|153222522|ref|ZP_01953244.1| cytidine deaminase [Vibrio cholerae MAK 757] >gi|153819196|ref|ZP_01971863.1| cytidine deaminase [Vibrio cholerae NCTC 8457] >gi|153823031|ref|ZP_01975698.1| cytidine deaminase [Vibrio cholerae B33] >gi|153829734|ref|ZP_01982401.1| cytidine deaminase [Vibrio cholerae 623-39] >gi|194531891|ref|YP_002067330.1| cytidine deaminase [Vibrio cholerae MO10] >gi|81623150|sp|Q9KSM5|CDD_VIBCH Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|9655712|gb|AAF94390.1| cytidine deaminase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121546939|gb|EAX57088.1| cytidine deaminase [Vibrio cholerae 2740-80] >gi|124116685|gb|EAY35505.1| cytidine deaminase [Vibrio cholerae 1587] >gi|124118859|gb|EAY37602.1| cytidine deaminase [Vibrio cholerae MAK 757] >gi|125617845|gb|EAZ46397.1| cytidine deaminase [Vibrio cholerae MO10] >gi|126510282|gb|EAZ72876.1| cytidine deaminase [Vibrio cholerae NCTC 8457] >gi|126519459|gb|EAZ76682.1| cytidine deaminase [Vibrio cholerae B33] >gi|148874768|gb|EDL72903.1| cytidine deaminase [Vibrio cholerae 623-39] (295 aa)
Score = 117, Expect = 6.7e-05, Identities = 38/116 (32%), Positives = 55/116 (47%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           +Y P S+F V +I +      Y G N+E +   +  T+  E+ AIS A   G K + DI +      F +PCG CRQFM+E   +    I +     K    T+ E L   F   DL +
  S:    64 SYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQTVHAEQCAISHAWMKGEKGVADITI-----NF-SPCGHCRQFMNELTTASSLKIQLPKRAAK----TLQEYLPESFGPADLGI 172
>gi|193062366|ref|ZP_03043461.1| cytidine deaminase [Escherichia coli E22] >gi|194427193|ref|ZP_03059744.1| cytidine deaminase [Escherichia coli B171] >gi|192932032|gb|EDV84631.1| cytidine deaminase [Escherichia coli E22] >gi|194414814|gb|EDX31085.1| cytidine deaminase [Escherichia coli B171] (294 aa)
Score = 117, Expect = 7.0e-05, Identities = 35/113 (30%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    ++Y+G N+E   ++   T+  E++AIS A  +G + +  I          TPCG CRQFM+E     D  I++   E   ++    + L   F  KDL++
  S:    67 PLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEEALAAI------TVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALR----DYLPDAFGPKDLEI 172
>gi|42781941|ref|NP_979188.1| hypothetical protein BCE_2885 [Bacillus cereus ATCC 10987] >gi|42737865|gb|AAS41796.1| cytidine and deoxycytidylate deaminase family protein [Bacillus cereus ATCC 10987] (143 aa)
Score = 117, Expect = 7.1e-05, Identities = 32/118 (27%), Positives = 62/118 (52%)
  Q:    14 KEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT--------FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           ++VIE  Y  Y +  + S  +    + Y  V+VE +   +T+CGE  AI  ++S G      I  +   +            PCGMCR+ +S++ ++ +    I ++ G+ +K  + E+L  ++T +
  S:    19 EKVIEKNY-KYGRHHIGSAVRTKTGNIYAAVHVEANVGRITVCGEAMAIGKSISEGEHEFDTIVAVAHPHPHEDIEKCWVVAPCGMCRELISDYGKNTNV---ILSYNGELVKCNVMELLPEKYTSE 141
>gi|118478204|ref|YP_895355.1| hypothetical protein BALH_2561 [Bacillus thuringiensis str. Al Hakam] >gi|196043147|ref|ZP_03110385.1| cytidine and deoxycytidylate deaminase family protein [Bacillus cereus 03BB108] >gi|118417429|gb|ABK85848.1| cytidine and deoxycytidylate deaminase family protein [Bacillus thuringiensis str. Al Hakam] >gi|196025456|gb|EDX64125.1| cytidine and deoxycytidylate deaminase family protein [Bacillus cereus 03BB108] (143 aa)
Score = 116, Expect = 8.5e-05, Identities = 32/118 (27%), Positives = 62/118 (52%)
  Q:    14 KEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT--------FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           ++VIE  Y  Y +  + S  +    + Y  V+VE +   +T+CGE  AI  ++S G      I  +   +            PCGMCR+ +S++ ++ +    I ++ G+ +K  + E+L  ++T +
  S:    19 EKVIEKNY-KYGRHHIGSAVRTKTGNIYAAVHVEANVGRITVCGEAMAIGKSISEGDHEFDTIVAVAHPHPHEDIEKCWVVAPCGMCRELISDYGKNTNV---ILSYNGELVKCNVMELLPEKYTSE 141
>gi|15233626|ref|NP_194690.1| cytidine deaminase, putative / cytidine aminohydrolase, putative [Arabidopsis thaliana] >gi|5123555|emb|CAB45321.1| cytidine deaminase 6 (CDA6) [Arabidopsis thaliana] >gi|7269860|emb|CAB79719.1| cytidine deaminase 6 (CDA6) [Arabidopsis thaliana] (293 aa)
Score = 116, Expect = 8.7e-05, Identities = 28/89 (31%), Positives = 43/89 (48%)
  Q:    20 AYVPYSKFRVASI-CKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           A  P S F+V ++   +    + GVNVE  + P+  T+  E+  ++    N  K +T I +      F  PCG CRQF  E   + +  I I
  S:    32 ARAPVSTFKVGAVGLTSSGEVFLGVNVEFPNLPLHHTIHAEQFLVTNLALNSMKKLTHIAVSVTGTIFGAPCGHCRQFYQEMRNAPEIEILI 123
>gi|3818575|gb|AAC69566.1| cytidine deaminase 6 [Arabidopsis thaliana] (293 aa)
Score = 116, Expect = 8.7e-05, Identities = 28/89 (31%), Positives = 43/89 (48%)
  Q:    20 AYVPYSKFRVASI-CKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           A  P S F+V ++   +    + GVNVE  + P+  T+  E+  ++    N  K +T I +      F  PCG CRQF  E   + +  I I
  S:    32 ARAPVSTFKVGAVGLTSSGEVFLGVNVEFPNLPLHHTIHAEQFLVTNLALNSMKKLTHIAVSVTGTIFGAPCGHCRQFYQEMRNAPEIEILI 123
>gi|4836446|gb|AAD30444.1|AF121877_4 DesD [Arabidopsis thaliana] (293 aa)
Score = 116, Expect = 9.7e-05, Identities = 28/89 (31%), Positives = 43/89 (48%)
  Q:    20 AYVPYSKFRVASI-CKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           A  P S F+V ++   +    + GVNVE  + P+  T+  E+  ++    N  K +T I +      F  PCG CRQF  E   + +  I I
  S:    32 ARAPVSTFKVGAVGLTSSGEVFLGVNVEFPNLPLHHTIHAEQFLVTNLALNSMKKLTHIAVSVTGTIFGAPCGHCRQFYQEMRNAPEIEILI 123
>gi|24374326|ref|NP_718369.1| cytidine deaminase [Shewanella oneidensis MR-1] >gi|81461004|sp|Q8EDG1|CDD_SHEON Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|24348875|gb|AAN55813.1|AE015718_5 cytidine deaminase [Shewanella oneidensis MR-1] (296 aa)
Score = 116, Expect = 9.7e-05, Identities = 39/117 (33%), Positives = 60/117 (51%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLD----LSVKQ 139
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I D+ +       A+PCG CRQFM+E ++     I++ + +   + Y     L   F  KDL+    L VKQ
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELPGEALFHSVHAEQSAISHAWLSGESQIVDMIV------NASPCGHCRQFMNELVDGGQIKIHLPSQDSHLLSY----YLPYAFGPKDLNVQSPLLVKQ 179
>gi|154490833|ref|ZP_02030774.1| hypothetical protein PARMER_00750 [Parabacteroides merdae ATCC 43184] >gi|154088581|gb|EDN87625.1| hypothetical protein PARMER_00750 [Parabacteroides merdae ATCC 43184] (158 aa)
Score = 116, Expect = 9.8e-05, Identities = 33/78 (42%), Positives = 45/78 (57%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT---------PCGMCRQFMSE 97
           +Y PYSKF V A+    D +   G N EN++YP  LC ER A+  A   GH+   D+ ++  +   AT         PCG CRQ + E
  S:    36 SYAPYSKFHVGAAALLEDGTIITGSNQENAAYPSGLCAERVALFHA---GHQ-YPDMPVVALAIAAATNGRQVESISPCGACRQVLLE 119
>gi|153808630|ref|ZP_01961298.1| hypothetical protein BACCAC_02928 [Bacteroides caccae ATCC 43185] >gi|149128952|gb|EDM20169.1| hypothetical protein BACCAC_02928 [Bacteroides caccae ATCC 43185] (160 aa)
Score = 115, Expect = 1.0e-04, Identities = 40/115 (34%), Positives = 56/115 (48%)
  Q:    14 KEVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFAT-------PCGMCRQFM--SEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           KE    +YVPYS F V A+    D +   G N EN++YP  LC ER  +  A S  + +   I L   + T          PCG CRQ +  +E        I ++  E  Y   +IG++L   F
  S:    30 KEATARSYVPYSHFSVGAAALLGDGTVVSGTNQENAAYPSGLCAERTTLFYANSR-YPDQPVITLAIAARTEKDFIDNPIPPCGACRQVILETEKRYGQPIRILLYGKECIYEIKSIGDLLPLSF 153
>gi|85058946|ref|YP_454648.1| cytidine deaminase [Sodalis glossinidius str. 'morsitans'] >gi|123519680|sp|Q2NUD2|CDD_SODGM Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|84779466|dbj|BAE74243.1| cytidine deaminase [Sodalis glossinidius str. 'morsitans'] (309 aa)
Score = 114, Expect = 1.3e-04, Identities = 31/87 (35%), Positives = 44/87 (50%)
  Q:    20 AYVPYSKFRVASI-CKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSI 106
           A  P S F V +I C    + Y+G N+E  + P+  T+  E++AI+ A   G K +  +          TPCG CRQFM+E     D  I
  S:    64 AVTPLSHFNVGAIACGISGNLYFGANMEFLAAPLQQTVHAEQSAIAHAWLRGEKRLRAL------TVNYTPCGHCRQFMNELNSGTDLII 147
>gi|59712092|ref|YP_204868.1| cytidine deaminase [Vibrio fischeri ES114] >gi|75431626|sp|Q5E4R6|CDD_VIBF1 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|59480193|gb|AAW85980.1| cytidine/deoxycytidine deaminase [Vibrio fischeri ES114] (297 aa)
Score = 114, Expect = 1.4e-04, Identities = 36/113 (31%), Positives = 57/113 (50%)
  Q:    23 PYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           P S F V +I +    + Y+G N+E +   +  T+  E++AIS A   G   I++I +      F +PCG CRQFM+E   +D   + +     K    ++ E L   F  KDL +
  S:    69 PISNFYVGAIARGLTGNLYFGANMEYNDVQLGQTIHAEQSAISHAWIQGETGISNITI-----NF-SPCGHCRQFMNELTTADSLMVQLPERNEK----SLQEYLPESFGPKDLGI 174
>gi|88805107|ref|ZP_01120627.1| cytidine deaminase [Robiginitalea biformata HTCC2501] >gi|88785986|gb|EAR17155.1| cytidine deaminase [Robiginitalea biformata HTCC2501] (161 aa)
Score = 114, Expect = 1.4e-04, Identities = 34/90 (37%), Positives = 44/90 (48%)
  Q:    20 AYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTA---VSNGHKNITDIYLLTDSNTF---ATPCGMCRQFMSEFMESDDCSIYIF 109
           +Y PYSKF V A+I  A      G N EN+SYP  LC ER A+  A             +Y+     +    A PCG CRQ + E+    +  I I 
  S:    37 SYSPYSKFPVGAAIELATGEVVIGSNQENASYPSGLCAERVAVFQAGARFPGTPVRTLAVYVGNPGGSLHKPAAPCGNCRQSLLEYEHRQEGPIRIL 133
>gi|33152118|ref|NP_873471.1| cytidine deaminase [Haemophilus ducreyi 35000HP] >gi|78099198|sp|Q7VMJ6|CDD_HAEDU Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|33148340|gb|AAP95860.1| cytidine deaminase [Haemophilus ducreyi 35000HP] (299 aa)
Score = 114, Expect = 1.6e-04, Identities = 37/117 (31%), Positives = 59/117 (50%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           A  P S F V ++      SFY+G N E +   +  T+  E++AIS A   G   I+D+ +        TPCG CRQFM+E   +    I++ + +      T+ + L   F  KDL+++
  S:    72 ALTPVSHFCVGAVAIGLSGSFYFGANQEFAGIAMQQTVHAEQSAISHAWLAGEGAISDMVV------NCTPCGHCRQFMNELNTATTLQIHLPHRQHN----TLQQYLIDAFGPKDLNIA 181
>gi|170726401|ref|YP_001760427.1| cytidine deaminase [Shewanella woodyi ATCC 51908] >gi|169811748|gb|ACA86332.1| Cytidine deaminase [Shewanella woodyi ATCC 51908] (296 aa)
Score = 113, Expect = 1.7e-04, Identities = 34/99 (34%), Positives = 53/99 (53%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK----YIKYTIG 121
           P S+F V +I K      Y G N+E S   +  ++  E++AIS A  +G   I D+ +      F +PCG CRQFM+E +E     I++   + +    Y+ Y  G
  S:    66 PISEFYVGAIAKGKSGDIYMGANLELSGEALFHSVHAEQSAISHAWLSGETQILDVVV-----NF-SPCGHCRQFMNEMVEGQKVVIHLPEQKAQPLAHYLPYAFG 165
>gi|91793640|ref|YP_563291.1| cytidine deaminase [Shewanella denitrificans OS217] >gi|91715642|gb|ABE55568.1| Cytidine and deoxycytidylate deaminase, zinc-binding region [Shewanella denitrificans OS217] (297 aa)
Score = 113, Expect = 1.9e-04, Identities = 36/97 (37%), Positives = 52/97 (53%)
  Q:    25 SKFRVASICKADD-SFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGK----YIKYTIG 121
           S+F V +I K      Y G N+E  N +   ++  E++AIS A  +G   I DI +      F +PCG CRQFM+E +E     I++   E K    Y+ Y  G
  S:    68 SEFYVGAIAKGSSGDIYMGANLELPNEALFHSVHAEQSAISHAWLSGETKIVDIVV-----NF-SPCGHCRQFMNELVEGSLVRIHLPQQEIKPLSHYLPYAFG 165
>gi|145299361|ref|YP_001142202.1| cytidine deaminase [Aeromonas salmonicida subsp. salmonicida A449] >gi|167006529|sp|A4SNI2|CDD_AERS4 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|142852133|gb|ABO90454.1| cytidine deaminase [Aeromonas salmonicida subsp. salmonicida A449] (293 aa)
Score = 113, Expect = 2.2e-04, Identities = 29/76 (38%), Positives = 43/76 (56%)
  Q:    23 PYSKFRVASI-CKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           P SKF V +I C    ++Y+G N+E +   +  ++  E++AIS A   G   I++I          TPCG CRQFM+E 
  S:    66 PISKFFVGAIACGLSGTWYFGANMEFAGQGLFHSVHAEQSAISNAWLGGETGISEI------TVNYTPCGHCRQFMNEL 138
>gi|146312388|ref|YP_001177462.1| cytidine deaminase [Enterobacter sp. 638] >gi|167006534|sp|A4WCI1|CDD_ENT38 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|145319264|gb|ABP61411.1| cytidine deaminase [Enterobacter sp. 638] (294 aa)
Score = 112, Expect = 2.4e-04, Identities = 37/111 (33%), Positives = 56/111 (50%)
  Q:    25 SKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           S F V +I +    ++Y+G N+E   ++   T+  E++AIS A   G   +  I          TPCG CRQFM+E     +  I   N  G+   +T+G+ L   F  KDLD+
  S:    69 SHFNVGAIARGVSGTWYFGGNMEFLGATMQQTVHAEQSAISHAWLRGEHALNAI------TVNYTPCGHCRQFMNELNSGLELRI---NLPGRE-PHTLGDYLPDAFGPKDLDI 172
>gi|119775109|ref|YP_927849.1| cytidine deaminase [Shewanella amazonensis SB2B] >gi|167008659|sp|A1S723|CDD_SHEAM Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|119767609|gb|ABM00180.1| cytidine deaminase [Shewanella amazonensis SB2B] (296 aa)
Score = 112, Expect = 2.5e-04, Identities = 30/86 (34%), Positives = 47/86 (54%)
  Q:    23 PYSKFRVASIC-KADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           P S F V +I   +   FY G N+E     +  ++  E++AIS A  +G   I+DI +       A+PCG CRQFM+E ++     I++
  S:    66 PVSNFYVGAIAVGSGGDFYMGANLELQGEALFHSVHAEQSAISHAWLSGETQISDIIV------NASPCGHCRQFMNELVQGQAIRIHL 148
>gi|117618483|ref|YP_856425.1| cytidine deaminase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|167006528|sp|A0KJH4|CDD_AERHH Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|117559890|gb|ABK36838.1| cytidine deaminase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (293 aa)
Score = 112, Expect = 2.7e-04, Identities = 29/76 (38%), Positives = 43/76 (56%)
  Q:    23 PYSKFRVASI-CKADDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEF 98
           P SKF V +I C    ++Y+G N+E +   +  ++  E++AIS A   G   I++I          TPCG CRQFM+E 
  S:    66 PISKFFVGAIACGLSGNWYFGANMEFAGQGLFHSVHAEQSAISNAWLGGETGISEI------TVNYTPCGHCRQFMNEL 138
>gi|153833695|ref|ZP_01986362.1| cytidine deaminase [Vibrio harveyi HY01] >gi|148869974|gb|EDL68934.1| cytidine deaminase [Vibrio harveyi HY01] (295 aa)
Score = 112, Expect = 2.8e-04, Identities = 32/103 (31%), Positives = 51/103 (49%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGE 122
           +Y P S+F V +I +      Y+G N+E     +  T+  E+ AIS A   G   + DI +        +PCG CRQFM+E   + +  I +   E K + + + E
  S:    64 SYAPISEFYVGAIVRGLSGRLYFGANMEFFGVQLGQTVHAEQCAISHAWMKGEHGVKDITI------NYSPCGHCRQFMNELSTAKELKIQLPEREEKSLHHYLPE 163
>gi|29346949|ref|NP_810452.1| cytidine deaminase [Bacteroides thetaiotaomicron VPI-5482] >gi|29338847|gb|AAO76646.1| cytidine deaminase [Bacteroides thetaiotaomicron VPI-5482] (131 aa)
Score = 111, Expect = 3.1e-04, Identities = 38/114 (33%), Positives = 55/114 (48%)
  Q:    15 EVIENAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVS---NGHKNITDIYLLTDSNTFAT---PCGMCRQFM--SEFMESDDCSIYIFNWEGKYIKYTIGEILKGRF 128
           E    +Y PYS F V A+    + +   G N EN++YP  LC ER  +  A S   +   N   I   T+ +   T   PCG CRQ +  +E        I ++  E  Y   +IG++L   F
  S:     2 EATARSYAPYSHFSVGAAALLNNGTIVTGTNQENAAYPSGLCAERTTLFYANSQYPDQPVNTLAIAARTEKDFIETPIPPCGACRQVILETEKRYGQPIRILLYGRECIYEVKSIGDLLPLSF 124
>gi|62180770|ref|YP_217187.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|75482258|sp|Q57MF5|CDD_SALCH Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|62128403|gb|AAX66106.1| cytidine/deoxycytidine deaminase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (294 aa)
Score = 111, Expect = 3.1e-04, Identities = 35/111 (31%), Positives = 57/111 (51%)
  Q:    25 SKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           S F V +I +    ++Y+G N+E   ++   T+  E++AIS A   G K +  +          TPCG CRQFM+E     D  I++    G+   +T+ + L   F  KDL++
  S:    69 SHFNVGAIARGVSGNWYFGANMEFLGATMQQTVHAEQSAISHAWLRGEKGLAAV------TVNYTPCGHCRQFMNELNSGLDLRIHL---PGR-APHTLRDYLPDAFGPKDLEI 172
>gi|56412903|ref|YP_149978.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|81599359|sp|Q5PE68|CDD_SALPA Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|56127160|gb|AAV76666.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (294 aa)
Score = 111, Expect = 3.1e-04, Identities = 35/111 (31%), Positives = 57/111 (51%)
  Q:    25 SKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           S F V +I +    ++Y+G N+E   ++   T+  E++AIS A   G K +  +          TPCG CRQFM+E     D  I++    G+   +T+ + L   F  KDL++
  S:    69 SHFNVGAIARGVSGNWYFGANMEFLGATMQQTVHAEQSAISHAWLRGEKGLAAV------TVNYTPCGHCRQFMNELNSGLDLRIHL---PGR-APHTLRDYLPDAFGPKDLEI 172
>gi|16761125|ref|NP_456742.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29141179|ref|NP_804521.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|81593435|sp|Q8Z5A8|CDD_SALTI Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|25326138|pir||AE0780 cytidine deaminase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16503423|emb|CAD02563.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136805|gb|AAO68370.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (294 aa)
Score = 111, Expect = 3.1e-04, Identities = 35/111 (31%), Positives = 57/111 (51%)
  Q:    25 SKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           S F V +I +    ++Y+G N+E   ++   T+  E++AIS A   G K +  +          TPCG CRQFM+E     D  I++    G+   +T+ + L   F  KDL++
  S:    69 SHFNVGAIARGVSGNWYFGANMEFLGATMQQTVHAEQSAISHAWLRGEKGLAAV------TVNYTPCGHCRQFMNELNSGLDLRIHL---PGR-APHTLRDYLPDAFGPKDLEI 172
>gi|16765513|ref|NP_461128.1| cytidine deaminase [Salmonella typhimurium LT2] >gi|161613125|ref|YP_001587090.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167543567|ref|ZP_02339140.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167991110|ref|ZP_02572209.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168229538|ref|ZP_02654596.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168242269|ref|ZP_02667201.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168259476|ref|ZP_02681449.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168466137|ref|ZP_02700007.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168475595|ref|ZP_02704618.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818107|ref|ZP_02830107.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194451356|ref|YP_002046236.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472954|ref|ZP_03078938.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|189081901|sp|A9N6L3|CDD_SALPB Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|81594935|sp|Q8ZNM0|CDD_SALTY Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|16420720|gb|AAL21087.1| cytidine/deoxycytidine deaminase [Salmonella typhimurium LT2] >gi|161362489|gb|ABX66257.1| hypothetical protein SPAB_00833 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194409660|gb|ACF69879.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194459318|gb|EDX48157.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|195631358|gb|EDX49918.1| cytidine deaminase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (294 aa)
Score = 111, Expect = 3.1e-04, Identities = 35/111 (31%), Positives = 57/111 (51%)
  Q:    25 SKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           S F V +I +    ++Y+G N+E   ++   T+  E++AIS A   G K +  +          TPCG CRQFM+E     D  I++    G+   +T+ + L   F  KDL++
  S:    69 SHFNVGAIARGVSGNWYFGANMEFLGATMQQTVHAEQSAISHAWLRGEKGLAAV------TVNYTPCGHCRQFMNELNSGLDLRIHL---PGR-APHTLRDYLPDAFGPKDLEI 172
>gi|86739397|ref|YP_479797.1| cytidine deaminase [Frankia sp. CcI3] >gi|86566259|gb|ABD10068.1| cytidine deaminase [Frankia sp. CcI3] (159 aa)
Score = 111, Expect = 3.5e-04, Identities = 38/118 (32%), Positives = 53/118 (44%)
  Q:    16 VIENAYVPYSKFRV------------ASICKADDSF-YYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDL 133
           V ++AY PYS  RV            A     DD +   G NVEN+SY + LC E   +S   + G   +     +        PCG CRQ + E    D     +    G  ++ TI ++L   F   DL
  S:    31 VAQSAYAPYSGLRVGAAALVVDLPDAAGRTTGDDPWIVVGCNVENASYGLGLCAECGLVSALHARGGGRLLAFACVDSDGAPLAPCGRCRQLLYEHGGPD-----LLVAMGDGVR-TIADLLPAAFGPHDL 155
>gi|157144917|ref|YP_001452236.1| cytidine deaminase [Citrobacter koseri ATCC BAA-895] >gi|167006530|sp|A8AE87|CDD_CITK8 Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|157082122|gb|ABV11800.1| hypothetical protein CKO_00646 [Citrobacter koseri ATCC BAA-895] (294 aa)
Score = 110, Expect = 4.2e-04, Identities = 35/111 (31%), Positives = 57/111 (51%)
  Q:    25 SKFRVASICKA-DDSFYYGVNVE--NSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDL 135
           S F V +I +    ++Y+G N+E   ++   T+  E++AI  A   G K +  I          TPCG CRQFM+E     D  I++    G+ + +T+ + L   F  KDL++
  S:    69 SHFNVGAIARGISGTWYFGGNMEFLGATMQQTVHAEQSAIGHAWLRGEKGLAAI------TVNYTPCGHCRQFMNELNSGLDLRIHL---PGR-VPHTLRDYLPDAFGPKDLEI 172
>gi|37525494|ref|NP_928838.1| cytidine deaminase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81572594|sp|Q7N6K3|CDD_PHOLL Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|36784922|emb|CAE13840.1| Cytidine deaminase (Cytidine aminohydrolase) (CDA) [Photorhabdus luminescens subsp. laumondii TTO1] (294 aa)
Score = 110, Expect = 4.6e-04, Identities = 33/114 (28%), Positives = 53/114 (46%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKKDLDLS 136
           P S F V +I + +  + Y+G N+E +  P+  T+  E+ AI+ A   G K +  +          +PCG CRQFM+E        I++     K    T+   L   F   DL ++
  S:    67 PISHFNVGAIARGESGNLYFGANMEFAGVPLQQTIHAEQCAITHAWLLGEKRLASV------TVNYSPCGHCRQFMNELNSGTQLEIHL----PKQASSTLDHYLPDSFGPNDLGIT 173
>gi|28898072|ref|NP_797677.1| cytidine deaminase [Vibrio parahaemolyticus RIMD 2210633] >gi|153836567|ref|ZP_01989234.1| cytidine deaminase [Vibrio parahaemolyticus AQ3810] >gi|81727922|sp|Q87Q52|CDD_VIBPA Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|28806286|dbj|BAC59561.1| cytidine deaminase [Vibrio parahaemolyticus RIMD 2210633] >gi|149750165|gb|EDM60910.1| cytidine deaminase [Vibrio parahaemolyticus AQ3810] (295 aa)
Score = 110, Expect = 4.6e-04, Identities = 29/89 (32%), Positives = 47/89 (52%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           +Y P S+F V +I +      Y+G N+E     +  T+  E++AIS A   G   + DI +      F +PCG CRQFM+E   + +  + +
  S:    64 SYAPISEFYVGAIVRGLSGRLYFGANMEFFGVQLGQTVHAEQSAISHAWMKGEHGVKDITI-----NF-SPCGHCRQFMNELSTAKELKVQL 149
>gi|3818574|gb|AAC69565.1| cytidine deaminase 7 [Arabidopsis thaliana] (329 aa)
Score = 109, Expect = 5.6e-04, Identities = 38/123 (30%), Positives = 62/123 (50%)
  Q:    11 IKLKEVIENAYV----PYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNT--FATPCGMCRQFMSEFMESDDCSIYI---FNWEGKYIKYTIGEILKGRFTKKDL 133
           I+L ++I  A      P SK++V ++ +A     Y GVNVE    P+  ++  E+  ++    N  K +  + +   S+   F  PCG CRQF+ E     D  I +      EG +    +  +L  RFT  D+
  S:    47 IRLPKLIRKAMSLARGPISKYKVGAVGRASSGRVYLGVNVEFPGLPLHHSIHPEQFLVTNLALNSEKGLRQLAVAISSDCIEFGAPCGNCRQFLMETSNELDIKILLKSKHEAEGSFSSLKL--LLPYRFTPDDV 179
>gi|111220654|ref|YP_711448.1| cytidine deaminase [Frankia alni ACN14a] >gi|111148186|emb|CAJ59855.1| Cytidine deaminase [Frankia alni ACN14a] (198 aa)
Score = 109, Expect = 6.4e-04, Identities = 28/82 (34%), Positives = 38/82 (46%)
  Q:    16 VIENAYVPYSKFRVASICKADDS-------------FYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           V ++AY PYS  RV +     D                 G NVEN+SY + LC E   +S   + G   +     +        PCG CRQ + E
  S:    31 VAQSAYAPYSGLRVGAAALVVDRPDAEGRTTGDEPWMVVGCNVENASYGLALCAECGLVSALHARGGGRLVAFACVDADGRPLAPCGRCRQLLYE 125
>gi|30262820|ref|NP_845197.1| hypothetical protein BA2855 [Bacillus anthracis str. Ames] >gi|47528148|ref|YP_019497.1| hypothetical protein GBAA2855 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185668|ref|YP_028920.1| hypothetical protein BAS2661 [Bacillus anthracis str. Sterne] >gi|65320146|ref|ZP_00393105.1| COG0295: Cytidine deaminase [Bacillus anthracis str. A2012] >gi|166993473|ref|ZP_02259933.1| hypothetical protein BcerA_09320 [Bacillus cereus AH820] >gi|167632508|ref|ZP_02390835.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0442] >gi|167637626|ref|ZP_02395905.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0193] >gi|170685307|ref|ZP_02876531.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0465] >gi|170704809|ref|ZP_02895275.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0389] >gi|177649775|ref|ZP_02932777.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0174] >gi|190565697|ref|ZP_03018617.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis Tsiankovskii-I] >gi|196032283|ref|ZP_03099697.1| cytidine and deoxycytidylate deaminase family protein [Bacillus cereus W] >gi|30257453|gb|AAP26683.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. Ames] >gi|47503296|gb|AAT31972.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49179595|gb|AAT54971.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. Sterne] >gi|167514175|gb|EDR89542.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0193] >gi|167532806|gb|EDR95442.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0442] >gi|170130610|gb|EDS99471.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0389] >gi|170670667|gb|EDT21406.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0465] >gi|172084849|gb|EDT69907.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis str. A0174] >gi|190563724|gb|EDV17689.1| cytidine and deoxycytidylate deaminase family protein [Bacillus anthracis Tsiankovskii-I] >gi|195995034|gb|EDX58988.1| cytidine and deoxycytidylate deaminase family protein [Bacillus cereus W] (143 aa)
Score = 108, Expect = 6.5e-04, Identities = 31/118 (26%), Positives = 61/118 (51%)
  Q:    14 KEVIENAYVPYSKFRVASICKADD-SFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTDSNT--------FATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTKK 131
           ++VIE  Y  Y +  + S  +    + Y  V+VE +   +T+CGE  AI  ++S G      I  +   +            PCGMCR+ +S++ ++ +    I ++  + +K  + E+L  ++T +
  S:    19 EKVIEKNY-KYGRHHIGSAVRTKTGNIYAAVHVEANVGRITVCGEAMAIGKSISEGDHEFDTIVAVAHPHPHEDIEKCWVVAPCGMCRELISDYGKNTNV---ILSYNDELVKCNVMELLPEKYTSE 141
>gi|15233625|ref|NP_194689.1| cytidine deaminase, putative / cytidine aminohydrolase, putative [Arabidopsis thaliana] >gi|5123554|emb|CAB45320.1| cytidine deaminase 7 [Arabidopsis thaliana] >gi|7269859|emb|CAB79718.1| cytidine deaminase 7 [Arabidopsis thaliana] (307 aa)
Score = 108, Expect = 6.6e-04, Identities = 38/123 (30%), Positives = 62/123 (50%)
  Q:    11 IKLKEVIENAYV----PYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNT--FATPCGMCRQFMSEFMESDDCSIYI---FNWEGKYIKYTIGEILKGRFTKKDL 133
           I+L ++I  A      P SK++V ++ +A     Y GVNVE    P+  ++  E+  ++    N  K +  + +   S+   F  PCG CRQF+ E     D  I +      EG +    +  +L  RFT  D+
  S:    25 IRLPKLIRKAMSLARGPISKYKVGAVGRASSGRVYLGVNVEFPGLPLHHSIHPEQFLVTNLALNSEKGLRQLAVAISSDCIEFGAPCGNCRQFLMETSNELDIKILLKSKHEAEGSFSSLKL--LLPYRFTPDDV 157
>gi|156974401|ref|YP_001445308.1| cytidine deaminase [Vibrio harveyi ATCC BAA-1116] >gi|167008666|sp|A7MVH6|CDD_VIBHB Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|156525995|gb|ABU71081.1| hypothetical protein VIBHAR_02116 [Vibrio harveyi ATCC BAA-1116] (295 aa)
Score = 108, Expect = 6.9e-04, Identities = 31/103 (30%), Positives = 51/103 (49%)
  Q:    20 AYVPYSKFRVASICKA-DDSFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGE 122
           +Y P S+F V +I +      Y+G N+E     +  T+  E+ AIS A   G   + DI +        +PCG CRQFM+E   + +  I +   + K + + + E
  S:    64 SYAPISEFYVGAIVRGLSGRLYFGANMEFFGVQLGQTVHAEQCAISHAWMKGEHGVKDITI------NYSPCGHCRQFMNELSTAKELKIQLPERQEKSLHHYLPE 163
>gi|157962309|ref|YP_001502343.1| cytidine deaminase [Shewanella pealeana ATCC 700345] >gi|189081904|sp|A8H5H1|CDD_SHEPA Cytidine deaminase (Cytidine aminohydrolase) (CDA) >gi|157847309|gb|ABV87808.1| Cytidine deaminase [Shewanella pealeana ATCC 700345] (296 aa)
Score = 108, Expect = 6.9e-04, Identities = 29/86 (33%), Positives = 47/86 (54%)
  Q:    23 PYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           P S+F V +I K      Y G N+E     +  ++  E++AIS A  +G   I DI +       A+PCG CRQF++E ++    +I++
  S:    66 PISQFHVGAIAKGKSGDIYMGANIELPGEALFHSVHAEQSAISHAWLSGESIIEDIIV------NASPCGHCRQFINELVDGGKVNIHL 148
>gi|67633768|gb|AAY78808.1| putative cytidine deaminase/cytidine aminohydrolase [Arabidopsis thaliana] (307 aa)
Score = 108, Expect = 7.0e-04, Identities = 38/123 (30%), Positives = 62/123 (50%)
  Q:    11 IKLKEVIENAYV----PYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNT--FATPCGMCRQFMSEFMESDDCSIYI---FNWEGKYIKYTIGEILKGRFTKKDL 133
           I+L ++I  A      P SK++V ++ +A     Y GVNVE    P+  ++  E+  ++    N  K +  + +   S+   F  PCG CRQF+ E     D  I +      EG +    +  +L  RFT  D+
  S:    25 IRLPKLIRKAMSLARGPISKYKVGAVGRASSGRVYLGVNVEFPGLPLHHSIHPEQFLVTNLALNSEKGLRQLAVAISSDCIEFGAPCGNCRQFLMETSNELDIKILLKSKHEAEGSFSSLKL--LLPYRFTPDDV 157
>gi|4836445|gb|AAD30443.1|AF121877_3 DesC [Arabidopsis thaliana] (308 aa)
Score = 108, Expect = 7.0e-04, Identities = 38/123 (30%), Positives = 62/123 (50%)
  Q:    11 IKLKEVIENAYV----PYSKFRVASICKADDS-FYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNT--FATPCGMCRQFMSEFMESDDCSIYI---FNWEGKYIKYTIGEILKGRFTKKDL 133
           I+L ++I  A      P SK++V ++ +A     Y GVNVE    P+  ++  E+  ++    N  K +  + +   S+   F  PCG CRQF+ E     D  I +      EG +    +  +L  RFT  D+
  S:    25 IRLPKLIRKAMSLARGPISKYKVGAVGRASSGRVYLGVNVEFPGLPLHHSIHPEQFLVTNLALNSEKGLRQLAVAISSDCIEFGAPCGNCRQFLMETSNELDIKILLKSKHEAEGSFSSLKL--LLPYRFTPDDV 157
>gi|71414123|ref|XP_809175.1| cytidine deaminase-like protein, putative [Trypanosoma cruzi strain CL Brener] >gi|70873516|gb|EAN87324.1| cytidine deaminase-like protein, putative [Trypanosoma cruzi] (184 aa)
Score = 108, Expect = 7.4e-04, Identities = 32/79 (40%), Positives = 39/79 (49%)
  Q:    19 NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYPVTLCGERNAISTAVSNGHKNIT-----------DIYLLTDSNTFATPCGMCRQFMSE 97
           NAY PYSKF V A++   D     G N EN +     C E  AI    S G +  T           D+  L   +T   PCG CRQ + E
  S:    34 NAYCPYSKFAVGAALLHKDLKITAGCNYENCTLK-GCCAELCAIVKGNSEGRRTATAVAVYGCSKAPDVMNLPPPDTVTPPCGFCRQSLVE 123
>gi|71422219|ref|XP_812067.1| cytidine deaminase-like protein [Trypanosoma cruzi strain CL Brener] >gi|70876803|gb|EAN90216.1| cytidine deaminase-like protein [Trypanosoma cruzi] (184 aa)
Score = 107, Expect = 9.1e-04, Identities = 32/79 (40%), Positives = 41/79 (51%)
  Q:    19 NAYVPYSKFRV-ASICKADDSFYYGVNVENSSYP---VTLC--------GERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSE 97
           NAY PYSKF V A++   D     G N EN +       +C        G R A + AV  G   + D+  L   +T   PCG CRQ + E
  S:    34 NAYCPYSKFAVGAALLHKDLKITAGCNYENCTLKGCCAEVCAIVKGNSEGRRTATAVAVY-GCSKVPDVMNLPPPDTVTPPCGFCRQSLVE 123
>gi|153094100|gb|EDN75004.1| cytidine deaminase [Mannheimia haemolytica PHL213] (237 aa)
Score = 107, Expect = 1.0e-03, Identities = 30/89 (33%), Positives = 46/89 (51%)
  Q:    20 AYVPYSKFRVASICKADD-SFYYGVNVENSSYPV--TLCGERNAISTAVSNGHKNITDIYLLTDSNTFATPCGMCRQFMSEFMESDDCSIYI 108
           A  P S F V ++    +  FY+G N E S   +  ++  E++AIS A   G   ITD+ +        TPCG CRQFM+E   +    +++
  S:    69 AVTPVSDFNVGAVAIGKNGDFYFGANQEFSGECMQQSVHAEQSAISHAFLAGETLITDVVV------NYTPCGHCRQFMNELNSAASLKVHL 154
>gi|157692507|ref|YP_001486969.1| hypothetical protein BPUM_1737 [Bacillus pumilus SAFR-032] >gi|157681265|gb|ABV62409.1| cytidine deaminase [Bacillus pumilus SAFR-032] (140 aa)
Score = 107, Expect = 1.1e-03, Identities = 29/89 (32%), Positives = 52/89 (58%)
  Q:    42 GVNVENSSYPVTLCGERNAISTAVSNGHKNITDIYLLTD--------SNTFATPCGMCRQFMSEFMESDDCSIYIFNWEGKYIKYTIGEILKGRFTK 130
            V++E     VT+C E  AI +A+SNG+K+   I  +          S    +PCG+CR+ +S+F  +  C + I   +G+ +K  I E++  ++T+
  S:    46 AVHIEAYIGRVTVCAEAIAIGSALSNGYKDFDTIVAVRHPYSDEEDRSIRVVSPCGICRELISDFGPA--CFV-ILEIDGELVKVKIEELIPLKYTR 139