>gi|26553561|ref|NP_757495.1| phosphomannomutase [Mycoplasma penetrans HF-2] >gi|26453567|dbj|BAC43899.1| phosphomannomutase [Mycoplasma penetrans HF-2] (555 aa)
Score = 2866, Expect = 0.0e+00, Identities = 555/555 (100%), Positives = 555/555 (100%)
  Q:     1 MKIFQEKNPSSMHANVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           MKIFQEKNPSSMHANVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS
  S:     1 MKIFQEKNPSSMHANVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
>gi|31544786|ref|NP_853364.1| hypothetical protein MGA_0358 [Mycoplasma gallisepticum R] >gi|31541632|gb|AAP56932.1| CpsG [Mycoplasma gallisepticum R] (559 aa)
Score = 1208, Expect = 2.2e-130, Identities = 246/531 (46%), Positives = 343/531 (64%)
  Q:    16 VNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS-NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLD-EIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET----KEICDQILKALK 546
           +N   K WL   ++S   K  I  M+E+E+   F+   L FGTAGIR  MGPG   +N FTY QM+ G  R+L++K   +P  ++AHDNR N  ++A +I   LTS GI+V+L+  N+I +TPI+SY++     D  I  TASHN K   GFK YN  G Q+L+ +A +I+  MP+   I++  Y PN  L+ +  D I + YF   YR L  T+    K+F VI T  HG ASY LP +L+   Y N+I   +QC  D NFTY+ + NPE + S+DL+LKYA+ Y A+IML  DPD+DRLAV V+H N++ Y  GN+MGIIF +Y+L  K+  K P++VS++VSTN IDRI  KYN  V+R  TGFKW+GN+   H D+ DF++GFEEAIG+L + IG DKD FQ AALALE+Y     ++ T+VD+L+ EI+ +FG    +T++  I  L+WK++  + M++        I   +I  I+WN+    L+W LE+D W++FRLSGTEPKFK YY +YG +    KE  +QI K LK
  S:    17 MNNTVKYWLVHPKVSKDLKAQIKAMSEQELAYAFNEKPLGFGTAGIRQKMGPGYRYLNDFTYAQMAFGYGRFLIDKFGFSPRCVIAHDNRKNGVHFAKIITDVLTSMGIEVYLFDNNKISSTPILSYAIPRYNADGGINVTASHNRKTDNGFKTYNEKGAQLLNQDAQKIIDFMPKSCEILNLEYQPNDRLVKFIPDEIYDRYFADIYRDLYTTDHKEVKDFKVIFTGQHGAASYWLPEMLRRFNY-NVIPVKEQCKYDENFTYTKSPNPEARESWDLALKYAQHYGADIMLATDPDADRLAVAVKHNNEFRYFNGNEMGIIFAYYILKYKQLTKRPYIVSSYVSTNLIDRIIAKYNGVVYRVGTGFKWIGNKAIDHKDQEDFILGFEEAIGALPTTIGSDKDSFQTAALALEIYNECLKRKITMVDFLEREIYPQFGFIHNDTITTLINDLDWKKKANDWMERLKRYDQPYINDRKIVSIKWNQAGDCLDWILEDDSWIRFRLSGTEPKFKFYYNLYGNSLKQLKEEANQITKTLK 552
>gi|1352196|sp|P47723|MANB_MYCPI Phosphomannomutase (PMM) >gi|401786|gb|AAA25434.1| phosphomannomutase (544 aa)
Score = 1190, Expect = 2.2e-128, Identities = 239/537 (44%), Positives = 347/537 (64%)
  Q:    17 NPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDE-IFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           N + K WL S+ +    K++I KM  EE++  FS + LSFGTAGIRA M PGT  +N  TY QM+ G  ++L NK SN   +VIVAHDNR N   +++ +   LTS  ++    K   +    + SY++R+     A+I TASHNPK   GFK+YN TG Q+L  +  ++V  MP    +ID     +  LI+Y ++ I   Y+E   + LI TNI   K F ++ +  HGTA   LP  LK +GY+NIIL  +QC+ D NF+ +   NPE++A++DLS++YA+K  AN+++ VDPD+DR A+ VR+KN W +L+GNQMGII+T Y+L NK F K P++VS++VSTN IDRI ++Y+ +V+R  TGFKWVG+++NK  D  +FVVGFEEA+G+LNS I RDKD +QAAALALE+Y         ++D+L++ I+ ++G    +T+S+     NWKE +++ +DK      K I    I  I++NE     +W L+ D W++FR+SGTEPKFK+YY +YGE      Q  K + D+ + +L
  S:     3 NEIVKKWLSSDNVPQTDKDIISKMKNEELELAFSNAPLSFGTAGIRAKMAPGTQFLNKITYYQMATGYGKFLKNKFSNQNISVIVAHDNRNNGIDFSIDVTNILTSLELEFICLKIINLLLRQLFSYAIRKLNAQGAVIVTASHNPKEDNGFKIYNETGAQVLPDDGLKVVELMPNVFEMIDLKVANDDSLITYLNEDIFRQYYEDCKQALIKTNINESKEFSIVFSGQHGTACKRLPEFLKLLGYKNIILVEEQCIFDGNFSNTPTPNPENRAAWDLSIEYADKNNANVIIQVDPDADRFALGVRYKNSWRFLSGNQMGIIYTDYILKNKTFTKKPYIVSSYVSTNLIDRIIKEYHGEVYRVGTGFKWVGDKINKIKDSEEFVVGFEEAVGALNSTINRDKDAYQAAALALEIYNECLKNNINIIDHLEKNIYGKYGIIHNDTISFTFVENNWKELVKKSLDKILKYSEKTIGNRTITSIKYNEVGGCYDWILDGDSWLRFRMSGTEPKFKVYYNLYGENLNALSQEAKTINDQIKTLL 542
>gi|171920535|ref|ZP_02931812.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179085|ref|ZP_02964817.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024011|ref|ZP_02996771.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039194|ref|ZP_02998005.1| phosphomannomutase [Ureaplasma urealyticum serovar 8] >gi|188518361|ref|ZP_03003869.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524285|ref|ZP_03004327.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530645|ref|ZP_03004991.1| phosphomannomutase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568895|ref|ZP_03005608.1| phosphomannomutase [Ureaplasma urealyticum serovar 2] >gi|188592711|ref|ZP_03005999.1| phosphomannomutase [Ureaplasma urealyticum serovar 10] >gi|195867923|ref|ZP_03079921.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903231|gb|EDT49520.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208974|gb|EDU06017.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019038|gb|EDU57078.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997995|gb|EDU67092.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660027|gb|EDX53407.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660400|gb|EDX53659.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (552 aa)
Score = 975, Expect = 2.3e-103, Identities = 215/539 (39%), Positives = 317/539 (58%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYS-KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS-NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYL-DEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           N N L   WL S +IS   KE      +EEID  F  + +  FGT+G+R     G   +NV TY Q++ G  ++L  KKS N  +++  DNR  +     +IA+  +SF   V++ ++  + +TPI S+ V E    A I+ TASHNPKNY GFKVYN  G Q L  + N I S MP     ++  + P  D I +      ++YF+A    LI+TN+  +K F V+ + HHGT + D+   L+S+GY+ ++   +Q   DPNF+   + NPE++ SFDLS++YA+   A++M+  DPD DR+A+ VRH+N W +LTGNQ G++  HY+L +KKF K P+++STF+ST Y +  A+ +N  V     GFK  GN +       D VVGFEEAIGSL+SDI  DKD +QAA++ LE+    ++Q   L   L  EIF ++G W  +T  + I+  NWK++    ++   N + K I    I+ I ++E    LEW L+    +KFRLSGTEPKFK+Y ++Y  TK+      + LK + E +L
  S:     3 NTNKLFNCWLNSPKISQTIKEEYKNKTQEEIDHIFDENYRFKFGTSGVRCIYQEGARYLNVITYTQLALGFIKYLETKKSPNKIIVIGRDNRFGSRENLKLIAEIFSSFDYTVYVNEDYGMLSTPITSFLVNELQASAGIMITASHNPKNYNGFKVYNANGAQPLVDDTNTIESLMPSYIEALNFSFEPKQDSIKFLTQQHLQTYFDAVKAQLIHTNLNTKKPFKVVFSGHHGTTTNDMIPFLESLGYD-MVSVKEQNFEDPNFSDDPSSNPEEQRSFDLSIEYADNANADVMIASDPDGDRMAIAVRHQNYWKFLTGNQTGVLIAHYLLHHKKFTKPPYIISTFISTRYPELFAKDFNCDVLYVDVGFKNHGNLVANRKKTHDLVVGFEEAIGSLSSDINNDKDSYQAASILLEMVNYYHEQNLDLFTVLKKEIFAKYGNWYSKTAQFVIDGENWKQKALAILNNLKNFEFKTITQYTIQNIIFHEQGSYLEWKLDEYSTIKFRLSGTEPKFKVYIDLYDFTKDQNRDFYQELKVKVEDIL 543
>gi|13507805|ref|NP_109754.1| phosphomannomutase/phosphoglucomutase [Mycoplasma pneumoniae M129] >gi|2499513|sp|P75050|MANB_MYCPN Phosphomannomutase (PMM) >gi|1673743|gb|AAB95736.1| CpsG [Mycoplasma pneumoniae M129] (554 aa)
Score = 934, Expect = 1.1e-98, Identities = 200/541 (36%), Positives = 323/541 (59%)
  Q:    12 MHANVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL--LNKKSNP-TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTIT-ESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV--RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSD-IGRDKDGFQAAALALEVYTMLYDQEKTLVD-YLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYM 552
           M++N    ++ WL   R+    KE+I  M+ EEI+ +FS  K SFGTAG+R  M PG + +NVF+Y  +++G   ++  LN    P   +VA D R +   +  ++   +TS G  V+++  N+   TP++SY +++   D  +  TASHNPK   GFK+Y+  G Q+LD + +++++ +P   T++D     N +L+ + D+ +  ++YF+     L+  N    KN PV+ T  HGT+   LP  L  +GY NII    Q V D NF  + + NPE K +++L+ +YA   +A +M+ +DPD+DR A+         WHY +GN+ G++  +Y L +K+F + P++V+T VST+ +D+IA+KY A V RT  GFK++G  +N      + VV FEEAIG + SD + R+KD FQAAA+ LE+    +++  +L++ Y  EIF EFG +   TV + I  +NWKE+M++ + +      K+++G +I  I+       +E+ LEN  W+KFR+SGTEPK K+Y+        + +  L ALK E + M
  S:     1 MNSNAYLEAQRWLSHPRVKPNLKEVITAMSAEEIEHFFSLKKPSFGTAGVRGKMAPGYHGMNVFSYAYLTQGYVNYIQSLNPTKKPLRFLVARDTRKHGALFNGIVCDVITSMGHVVYMFDNNEPTPTPLVSYVIKKYHFDGGVNVTASHNPKTDNGFKIYDGHGAQLLDFQTDQLIAMLPPVVTMLDFEPRGNNELLHFLDNEVVYKNYFDDLKESLVVDN-DSFKNLPVVFTGLHGTSVKLLPRFLTYLGYSNIISVQPQNVFDANFANADHLNPESKDTWELARQYASNTKAKLMMAIDPDADRFAIAEWNPQTQDWHYFSGNESGVMVAYYKLKHKQFKRQPYIVTTVVSTDLVDKIAKKYGAFVKRTNVGFKFIGQAVNHFSKDNELVVAFEEAIGMMASDGLNREKDSFQAAAIMLEIARYCHNKGISLLEFYRGEIFGEFGDYYNWTVPHTIHGVNWKEKMEQVLHQLTTATIKEVVGHKITKIKNYVDINLVEYVLENGNWIKFRISGTEPKLKLYF-------NLSNGYLAALKHEAKKM 541
>gi|171920372|ref|ZP_02931702.1| phosphomannomutase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701874|ref|ZP_02971533.1| phosphomannomutase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|171902804|gb|EDT49093.1| phosphomannomutase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701179|gb|EDU19461.1| phosphomannomutase [Ureaplasma parvum serovar 6 str. ATCC 27818] (552 aa)
Score = 912, Expect = 4.0e-96, Identities = 205/539 (38%), Positives = 309/539 (57%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYS-KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS-NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYL-DEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           N N +   WL S +I    KE      ++EID  F  + +  FGT+G+R     GT  +N  TY Q++ G   +L  KK+ N  +++  DNR  +     ++A+  +SF   V++ ++  + +TPI S+ + +    A I+ TASHNPKNY GFKVYN  G Q L  + N I S MP     +D  +    D I +      +SYF+A    LINT+   +K F ++ + HHGT + D+   L+S+GY+ ++  ++Q   DPNF    + NPE++ SFDLS++YA+   A IM+  DPD DR+A+ VRH+N W +LTGNQ G++  HY+L +KKF K  +++STF+ST Y +  A+ ++  V     GFK  GN +       D VVGFEEAIGSL SDI  DKD +Q A++ LE+    Y+Q+  L   L  EIF ++G W  +T  + I+  NWK++    ++   N + K +    I  I ++E    LEW L+    +KFRLSGTEPKFK+Y ++Y  +K+      + LK + E +L
  S:     3 NTNKIFNCWLNSPKIPQVIKEEYKNKTQKEIDHIFDENYRFKFGTSGVRCIYEEGTRYLNAITYTQLTLGFIEYLETKKNFNKIIVIGRDNRFGSRENLKLVAEIFSSFDYTVYINEDYGMLSTPITSFLINQLQAGAGIMITASHNPKNYNGFKVYNANGAQPLVDDTNLIESLMPSYIEALDFNFEFKQDNIRFLTKEQIQSYFDAVKAQLINTDPNIKKPFKIVFSGHHGTTTKDMIPFLESLGYD-MVSVSEQNFEDPNFNDDPSSNPEEQCSFDLSVEYADNTNAEIMIASDPDGDRMAIAVRHENYWKFLTGNQTGVLIAHYLLEHKKFTKPTYIISTFISTRYPELFAKNFDCDVLYVDVGFKNHGNLIANRKKTHDLVVGFEEAIGSLPSDINNDKDSYQTASILLEMINYYYEQKLDLFTVLKKEIFAKYGNWYSKTTQFVIDGDNWKQKALIILNNLRNFEFKTVTQYTIHNIIFHEQGSYLEWKLDEYSTIKFRLSGTEPKFKVYIDLYDFSKDQKRDFYQELKIKAEDIL 543
>gi|183508450|ref|ZP_02957990.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182675861|gb|EDT87766.1| phosphoglucomutase/phosphomannomutase family protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (552 aa)
Score = 912, Expect = 4.2e-96, Identities = 205/539 (38%), Positives = 309/539 (57%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYS-KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS-NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYL-DEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           N N +   WL S +I    KE      ++EID  F  + +  FGT+G+R     GT  +N  TY Q++ G   +L  KK+ N  +++  DNR  +     ++A+  +SF   V++ ++  + +TPI S+ + +    A I+ TASHNPKNY GFKVYN  G Q L  + N I S MP     +D  +    D I +      +SYF+A    LINT+   +K F ++ + HHGT + D+   L+S+GY+ ++  ++Q   DPNF    + NPE++ SFDLS++YA+   A IM+  DPD DR+A+ VRH+N W +LTGNQ G++  HY+L +KKF K  +++STF+ST Y +  A+ ++  V     GFK  GN +       D VVGFEEAIGSL SDI  DKD +Q A++ LE+    Y+Q+  L   L  EIF ++G W  +T  + I+  NWK++    ++   N + K +    I  I ++E    LEW L+    +KFRLSGTEPKFK+Y ++Y  +K+      + LK + E +L
  S:     3 NTNKIFNCWLNSPKIPQVIKEEYKNKTQKEIDHIFDENYRFKFGTSGVRCIYEEGTRYLNAITYTQLTLGFIEYLETKKNFNKIIVIGRDNRFGSRENLKLVAEIFSSFDYTVYINEDYGMLSTPITSFLINQLQAGAGIMITASHNPKNYNGFKVYNANGAQPLVDDTNLIESLMPSYIEALDFNFEFKQDNIRFLTKEQIQSYFDAVKAQLINTDPNIKKPFKIVFSGHHGTTTKDMIPFLESLGYD-MVSVSEQNFEDPNFNDDPSSNPEEQCSFDLSVEYADNTNAEIMIASDPDGDRMAIAVRHENYWKFLTGNQTGVLIAHYLLEHKKFTKPTYIISTFISTRYPELFAKNFDCDVLYVDVGFKNHGNLIANRKKTHDLVVGFEEAIGSLPSDINNDKDSYQTASILLEMINYYYEQKLDLFTVLKKEIFAKYGNWYSKTAQFVIDGDNWKQKALIILNNLRNFEFKTVTQYTIHNIIFHEQGSYLEWKLDEYSTIKFRLSGTEPKFKVYIDLYDFSKDQKRDFYQELKIKAEDIL 543
>gi|13358094|ref|NP_078368.1| phosphomannomutase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761996|ref|YP_001752615.1| phosphomannomutase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11357004|pir||D82878 phosphomannomutase UU530 [imported] - Ureaplasma urealyticum >gi|6899534|gb|AAF30943.1|AE002152_2 phosphomannomutase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827573|gb|ACA32835.1| phosphomannomutase [Ureaplasma parvum serovar 3 str. ATCC 27815] (552 aa)
Score = 909, Expect = 9.7e-96, Identities = 204/539 (37%), Positives = 309/539 (57%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYS-KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS-NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYL-DEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           N N +   WL S +I    KE      ++EID  F  + +  FGT+G+R     GT  +N  TY Q++ G   +L  KK+ N  +++  DNR  +     ++A+  +SF   V++ ++  + +TPI S+ + +    A I+ TASHNPKNY GFKVYN  G Q L  + N I S MP     +D  +    D I +      +SYF+A    LINT+   +K F ++ + HHGT + D+   L+S+GY+ ++  ++Q   DPNF    + NPE++ SFDLS++YA+   A IM+  DPD DR+A+ VRH+N W +LTGNQ G++  HY+L +KKF K  +++STF+ST Y +  A+ ++  V     GFK  GN +       + VVGFEEAIGSL SDI  DKD +Q A++ LE+    Y+Q+  L   L  EIF ++G W  +T  + I+  NWK++    ++   N + K +    I  I ++E    LEW L+    +KFRLSGTEPKFK+Y ++Y  +K+      + LK + E +L
  S:     3 NTNKIFNCWLNSPKIPQVIKEEYKNKTQKEIDHIFDENYRFKFGTSGVRCIYEEGTRYLNAITYTQLTLGFIEYLETKKNFNKIIVIGRDNRFGSRENLKLVAEIFSSFDYTVYINEDYGMLSTPITSFLINQLQAGAGIMITASHNPKNYNGFKVYNANGAQPLVDDTNLIESLMPSYTEALDFNFEFKQDNIRFLTKEQIQSYFDAVKAQLINTDPNIKKPFKIVFSGHHGTTTKDMIPFLESLGYD-MVSVSEQNFEDPNFNDDPSSNPEEQCSFDLSVEYADNTNAEIMIASDPDGDRMAIAVRHENYWKFLTGNQTGVLIAHYLLEHKKFTKPTYIISTFISTRYPELFAKNFDCDVLYVDVGFKNHGNLIANRKKTHNLVVGFEEAIGSLPSDINNDKDSYQTASILLEMINYYYEQKLDLFTVLKKEIFAKYGNWYSKTTQFVIDGDNWKQKALIILNNLRNFEFKTVTQYTIHNIIFHEQGSYLEWKLDEYSTIKFRLSGTEPKFKVYIDLYDFSKDQKRDFYQELKIKAEDIL 543
>gi|12044903|ref|NP_072713.1| phosphoglucomutase/phosphomannomutase, putative [Mycoplasma genitalium G37] >gi|1352195|sp|P47299|MANB_MYCGE Phosphomannomutase (PMM) >gi|1045726|gb|AAC71269.1| phosphoglucomutase/phosphomannomutase, putative [Mycoplasma genitalium G37] >gi|166078996|gb|ABY79614.1| phosphoglucomutase/phosphomannomutase, putative [synthetic Mycoplasma genitalium JCVI-1.0] (550 aa)
Score = 889, Expect = 1.8e-93, Identities = 198/532 (37%), Positives = 321/532 (60%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL--LNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFD-DTITESYFEASYRCL-INTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSD-IGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           WL    ++ + K+ I ++NE EI + FS  K  FGTAG+R  M PG + +NVF+Y  +++G  +++  +N+ K     +VA D R N   +   +   +TS G   +++ +NQ  +TP++S+ + + G    I  TASHNPK+  GFKVY+HTG Q+LD++ N+++S +P   +++D    PN   +   D + + ++YF    + L IN N +  K+  V+ +  +GT+   +   LK +GY NII   +Q   D NF  + N NPE K ++ L+ KYA+K  A +++  DPD+DR A+   + N+WHY +GN+ G I  +Y L +K F K+P++VSTFVST  +++IA++Y A V RT  GFK++G  +N+     + VVGFEEAIG + SD + R+KD +QAAAL LE+     +Q  TL+D+   I  EFG +   T+S  +K  + +WKEE++   ++  N    ++ G ++  +  ++    LE+  EN  WVKFR SGTEPK K Y+++   T+E  ++  K +   F  +L+
  S:    11 WLNHPNVNWELKQQIKELNESEIQELFSLEKPLFGTAGVRNKMAPGYHGMNVFSYAYLTQGYVKYIESINEPKRQLRFLVARDTRKNGGLFLETVCDVITSMGHLAYVFDDNQPVSTPLVSHVIFKYGFSGGINITASHNPKDDNGFKVYDHTGAQLLDTQTNQLLSDLPCVTSMLDLELQPNPKFVHTLDNEKVYKNYFRELKKVLVINNNNF--KDIKVVFSGLNGTSVCLMQRFLKYLGYSNIISVEEQNWFDENFENAPNLNPEYKDTWILAQKYAKKNNAKLIIMADPDADRFAIAELNNNQWHYFSGNETGAITAYYKLNHKVF-KSPYIVSTFVSTYLVNKIAKRYGAFVHRTNVGFKYIGQAINELSQTNELVVGFEEAIGLITSDKLNREKDAYQAAALLLEIARHCKEQNITLLDFYKRILSEFGEYFNLTISHPFKATATDWKEEIKALFNQLINANLTEVAGFKVVKVHLDKQTNILEFGFENG-WVKFRFSGTEPKLKFYFDLTNGTREALEKQAKKIYKFFVNLLK 546
>gi|50364935|ref|YP_053360.1| phosphomannomutase/phosphoglucomutase-like protein [Mesoplasma florum L1] >gi|50363491|gb|AAT75476.1| phosphomannomutase/phosphoglucomutase homolog [Mesoplasma florum L1] (561 aa)
Score = 774, Expect = 4.8e-80, Identities = 189/530 (35%), Positives = 301/530 (56%)
  Q:    17 NPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR-----QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIA-EKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR------WNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET----KEICDQILKALK 546
           N +   W+ S ++ ++ K L++   ++E+   F   +L FGTAGIR  +G G  + NV+T ++++   A  L      + N  ++V HDNR N+  +A V+A+ L+SFGIK +L+KEN++  TP++SY+ +       I+ TASHNP  Y G+K+Y+  G Q+ D +   I   M E   I++  Y  N  LI    +T++E+  +     + N   Y+     +K+  +I +  +GT +   P +L+  GY N+I   +    D  F    N NPE   ++ + L+Y  K+ A+I++  DPD+DR  + ++H   +  L GNQ G I   + L+N K      K P + S+FV+++  DRIA EKY   + +T TGFKW+G E+ K  D  ++FV  +EE+ G +  D  RDKDG QA+ L  E       Q KTLVDYL+++F+E GA+   T++   +    K +++  M          I GL++  +       +N P Q  L++YLE+  W   R SGTEPK KIY+   GE+    K   D+I+K LK
  S:     7 NKVYSEWINSQKLDDELKSLLVNATDDELHAAFEGIELEFGTAGIRGILGAGPGRFNVYTVKKVTIAFAELLKQNYPNRLNDGIVVGHDNRHNSKQFAKVVAEVLSSFGIKAYLFKENEMMPTPVVSYATKFLNCIGGIVITASHNPSEYNGYKIYDPYGCQLQDEQTAIIAKRMDEITDILNWEYKINDSLI----ETVSENVIKEYVDMIKNLEFYKKEQEAKKDLKIIFSAVNGTGTKFTPKILRESGY-NVIEVEEHAFEDETFKNVVNPNPEFDPAWKIPLEYGIKHDADIIIMNDPDADRFGMAIKHDGHFVRLDGNQTGPILIDWKLSNLKRLNSIPKNPALYSSFVTSDLGDRIAHEKYGVNIVKTLTGFKWMGREIAKEEDNGLNFVFAYEESYGYVIDDSARDKDGIQASILIAEAAWFYKKQNKTLVDYLEDLFKEMGAYYTFTLNLNFKPEEKKLKIEPLMKSLRATPLTQIAGLKVVNVEDYIDGMYNMPGQDLLKFYLEDKSWFAVRPSGTEPKLKIYFIGVGESVQNAKVKVDEIIKELK 556
>gi|56421832|ref|YP_149150.1| phosphomannomutase [Geobacillus kaustophilus HTA426] >gi|56381674|dbj|BAD77582.1| phosphomannomutase [Geobacillus kaustophilus HTA426] (580 aa)
Score = 771, Expect = 9.7e-80, Identities = 187/527 (35%), Positives = 311/527 (59%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQI-----------LDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           + WL    +  + K+ ++ M  NE+ ++  F Y  L FGT G+R  +GPGTN++N++T ++ SEG+AR+++ +        V++A+D+R  +  +A+ +AKT+   GIK +L+KE  ++ TP +S++VR  G  A ++ TASHNP  Y GFKVY   GGQI           +++  NE+   +   Q +++N       L++Y  + I E+Y +      +N  I  +  K   ++ +  HGTA+  +   LK+ G+EN+ +  +Q +PDPNF+  A+ NPE+ A+F L+++Y EK  A+I++  DPD+DRL V V++   ++  LTGNQMG +   Y+L+ K+      K   VV T V++     IAE Y      T TGFK++G ++N  +   +  F  G+EE+ G L  D  RDKD  Q+A  A EV      Q KTL + L EIFE++G +     S  ++  +  E++   +  F     K+I G+E+  I                   + P +  L+++L N  W   R SGTEPK K Y+ + G + +  ++++ AL++
  S:     8 EKWLSYPELDAELKQQLISMQHNEKALEDSF-YKNLEFGTGGMRGEIGPGTNRMNIYTIRKASEGLARYIVEQGEEAKARGVVIAYDSRHKSPEFALEVAKTVGKHGIKAYLFKE--LRPTPELSFAVRYLGAFAGVVITASHNPPEYNGFKVYGEDGGQIPPAVADAIIQYVNAVENELTVEVASEQELLEN------GLLTYIGEEIDEAYLQQLKTIQLNPEIVAEVAKELKIVFSPLHGTANKLVRAGLKAFGFENVTVVKEQELPDPNFSTVASPNPEEHAAFALAIQYGEKIDADILMATDPDADRLGVAVKNLDGEYVVLTGNQMGALMLEYLLSQKQAKGILPKNGVVVKTIVTSEIGRAIAEHYGLPTIDTLTGFKFIGEKINEFEQTKEYTFQFGYEESYGYLIGDFVRDKDAVQSAIFAAEVAAYYKAQGKTLYEGLLEIFEKYGYYRESLRSLTLKGKDGAEQIANILAAFRKEPPKEIAGVEVVAIEDYLTSKRTIVTTGEEQTIDLPRSNVLKYHLANGAWFCLRPSGTEPKAKFYFGVRGTSLQESEELIAALEN 568
>gi|83319929|ref|YP_424707.1| phosphoglucomutase/phosphomannomutase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283815|gb|ABC01747.1| phosphoglucomutase/phosphomannomutase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (560 aa)
Score = 758, Expect = 3.1e-78, Identities = 186/532 (34%), Positives = 318/532 (59%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR-----QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIA-EKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQE----------KMDKFANVKNKDILGLE--IKGIRWNEPAQA-LEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+    +  + K+L+ K +++E++  F+  +L FGTAGIR  +G G  + NV+T ++++    + L +K   + +  V++ HDNR N+  +A ++A  LTSF IK +L+K+NQ++ TP++S++ ++      I+ TASHNP  Y G+K+Y+  G Q++ ++ + I S M +   I+D  +  N +L+   D+ + + YFE     + N   Y+     + N  +I +  +GT S   P +LK  GY+ II   +    D  F    N NPE   ++ + L+YA+KY A+I++  DPD+DR  + V+H N++  L GNQ G I   + L+N     K  K P + S+FV+++  DRIA E YN  + +T TGFKW+G E+ K +D  ++FV  +EE+ G +  D  RDKDG QA+ +A E      +Q  TLVDYL++++E++G +   T +Y   +LN+K E ++          + +    + N  ++  E  I G+ +N P++  L++YLE+  W   R SGTEPK KIY+ I   + +  +   + +  E + +L
  S:    12 SWVNHPNLDPELKDLLNKADDDELNAAFNL-ELKFGTAGIRGILGAGPGRFNVYTIKKVTIAYVKLLKSKYIDQLDKGVVIGHDNRHNSKKFAKLVADILTSFNIKAYLFKDNQLQPTPVVSFATKQLNCIGGIVITASHNPAEYNGYKIYDPYGCQLMPNDTDLIASEMNKISNILDWTFQANDNLLQEVDEIVIDKYFEM----IKNLEFYKDNKTSKSNLKIIYSAVNGTGSLYTPIVLKQSGYQ-IIEVKEHAFEDETFKNVINPNPEFDPAWKIPLEYAKKYDADIIILNDPDADRFGMAVKHNNEFIRLNGNQTGAILIDWKLSNLKRLNKLPKNPALYSSFVTSDLGDRIASETYNTTIIKTLTGFKWMGQEILKEVDNGLNFVFAYEESYGYVIDDSTRDKDGIQASIIAAEACWYYKNQNMTLVDYLNQLYEKYGYYF--TTTY---NLNFKPEEKDSKIAPIMKLLRSNGIKEINNLKVIKTEDYINGL-YNMPSEDFLKFYLEDKSWFAIRPSGTEPKLKIYFVIVDSSLQKAENKAEKIYKELKAIL 558
>gi|188159106|ref|ZP_02512151.2| phosphoglucomutase or phosphomannomutase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (558 aa)
Score = 757, Expect = 3.6e-78, Identities = 192/531 (36%), Positives = 309/531 (58%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN---PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR---QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIA-EKYNAKVFRTPTGFKWVGNEMNKH-IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA------------NVKNKDILGLE--IKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           W+    +  + KEL+ K ++ E++  F+  +L FGTAGIR  +G G  + NV+T ++++   A+ L  K SN     V++ HDNR N+  +A ++A  LTSF IK +L+K N ++ TP++S++ +       I+ TASHNP  Y G+K+Y+  G Q++  + + I + M E   I+D  +  N +L+   D T+ + YFE     + N   Y+   + N  +I +  +GT S   P +LK  GYE +I   +    D  F    N NPE   ++ + L+YA+KY A+I++  DPD+DR  + ++H N++  L GNQ G I   + L+N     K  K P + S+FV+++  DRIA E YNA V +T TGFKW+G EM K  ++ ++FV  +EE+ G +  D  RDKDG QA+ +A E      +Q  TLVDYL++++E++             +LN+K E  EK  K A             + N  ++ +E  I G+ +N P++  L+ YLE+  W+  R SGTEPK KIY+ I   + +  +   + +  E + +L
  S:    13 WINHPNLDQELKELLNKADDNELNAAFNL-ELKFGTAGIRGILGAGPGRFNVYTIKKVTIAYAKLLQTKYSNDLNKGVVIGHDNRHNSKKFAKLVADILTSFNIKAYLFKNNDLQPTPVVSFATKALNCIGGIVITASHNPAEYNGYKIYDPYGCQLMPHDTDVIANYMNEITNILDWTFISNNNLLEIVDQTVIDKYFEM----IKNLEFYKDQDKSNLKIIYSAVNGTGSLYTPIVLKQSGYE-VIEVKEHAFEDETFKNVINPNPEFDPAWKIPLEYAKKYDADIIILNDPDADRFGMAIKHNNEFIRLNGNQTGAILIDWKLSNLKRLNKLPKNPALYSSFVTSDLGDRIASETYNANVVKTLTGFKWMGQEMLKEPLNGLNFVFAYEESYGYVIDDSTRDKDGIQASIIAAEACWYYKNQNMTLVDYLNQLYEKY-----GYYYTTTYNLNFKPE--EKDSKIAPIMKLLRTTGIKQINNLKVVKIEDYINGL-YNMPSEDLLKIYLEDKSWIAIRPSGTEPKLKIYFVIVDSSLQKAENKAEKIYTELKTIL 556
>gi|42561351|ref|NP_975802.1| phosphoglucomutase or phosphomannomutase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492849|emb|CAE77444.1| phosphoglucomutase or phosphomannomutase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (558 aa)
Score = 747, Expect = 5.4e-77, Identities = 193/525 (36%), Positives = 308/525 (58%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN---PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK---NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIA-EKYNAKVFRTPTGFKWVGNEMNKH-IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA------------NVKNKDILGLE--IKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET----KEICDQILKALKD 547
           W+    +  + KEL+ K ++ E++  F+  +L FGTAGIR  +G G  + NV+T ++++   A+ L  K SN     V++ HDNR N+  +A ++A  LTSF IK +L+K N ++ TP++S++ +       I+ TASHNP  Y G+K+Y+  G Q++  + + I S M E   I+D  +  N +L+   D T+ + YFE     + N   Y+ +   N  +I +  +GT S   P +LK  GY+ +I   +    D  F    N NPE   ++ + L+YA+KY A+I++  DPD+DR  + ++H N++  L GNQ G I   + L+N K      K P + S+FV+++  DRIA E YNA V +T TGFKW+G EM K  ++ ++FV  +EE+ G +  D  RDKDG QA+ +A E      +Q  TLVDYL++++E++             +LN+K E  EK  K A             + N  ++ +E  I G+ +N P++  L+ YLE+  W+  R SGTE K KIY+ I   +    +   ++I K LK+
  S:    13 WINHPNLDQELKELLNKADDNELNAAFNL-ELKFGTAGIRGILGAGPGRFNVYTIKKVTIAYAKLLQTKYSNDLNKGVVIGHDNRHNSKKFAKLVADILTSFNIKAYLFKNNDLQPTPVVSFATKALNCIGGIVITASHNPAEYNGYKIYDPYGCQLMPHDTDVIASYMNEITNILDWTFISNNNLLEIVDQTVIDKYFEM----IKNLEFYKNQDKSNLKIIYSAVNGTGSLYTPIVLKQSGYQ-VIEVKEHAFEDETFKNVINPNPEFDPAWKIPLEYAKKYDADIIILNDPDADRFGMAIKHNNEFIRLNGNQTGAILIDWKLSNLKRLNELPKNPTLYSSFVTSDLGDRIASETYNANVVKTLTGFKWMGQEMLKEPLNGLNFVFAYEESYGYVIDDSTRDKDGIQASIIAAEACWYYKNQNMTLVDYLNQLYEKY-----GYYYTTTYNLNFKPE--EKDSKIAPIMKLLRTTGIKQINNLKVVQIEDYINGL-YNMPSEDLLKIYLEDKSWIAIRPSGTESKLKIYFVIVDSSLQKAENKAEKIYKELKE 554
>gi|169188234|ref|ZP_02848380.1| Phosphomannomutase [Paenibacillus sp. JDR-2] >gi|169004883|gb|EDS51738.1| Phosphomannomutase [Paenibacillus sp. JDR-2] (570 aa)
Score = 728, Expect = 9.4e-75, Identities = 174/526 (33%), Positives = 298/526 (56%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ---KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           +AWL    I    KE +  ++  E+EI   F Y  L FGT G+R  MG GTN++N +T  + ++G+A W+L++ +  P+ ++AHD+R N+  +A+  A  L + G+K +L+    ++ TP +SY+VR  G    I+ TASHNP  Y G+K Y   G Q++  +A ++++S+ +  T  D V   + +      L+ + D    E Y +      +N  + +    + F V+ T  HG+ +  +  +L+  G+ N+ + A+Q  PD  F+   + NPE++ +F L++K A++  A+I++G DPD+DR+  VV++ N ++  LTGNQ G +   YVL+  K+  + P    V+ T V++     IA  Y A V  T TGFK++G +M   +   +  F+ G+EE+ G L  D  RDKD   A+ L  E       Q KTL D L E++ + G +     S  ++ L+  +++   M+ + N    +I G++++       G+    P   L++ L +  W   R SGTEPK K+Y+ + GE+ E   ++L  L+
  S:    12 QAWLNDTLIDEATKEELRSIEGQEKEITDRF-YRDLEFGTGGLRGVMGAGTNRLNAYTVGKATQGLANWVLSRVEGQPSAVIAHDSRNNSPEFALDSALVLAANGVKTYLFP--SLRPTPQLSYAVRALGCSTGIVITASHNPPEYNGYKAYGADGCQLIPEDAEQVIASIGQV-TGFDQVKRMSREDAEAQGLLVWLDAEADEQYTDTVVAQSLNKELLQSGLGEKFKVVFTPLHGSGNLPVREVLRKAGFSNVHIVAEQEAPDGYFSTVKSPNPEEREAFTLAMKLAQEINADIIMGTDPDADRMGAVVKNNNGEYVVLTGNQSGALMIEYVLSQLKERGQLPANGVVIKTIVTSEMGADIARSYGAAVENTLTGFKYIGEKMTAYEQTGEHAFLFGYEESYGYLTGDYARDKDAVVASLLICEAAAYYSSQGKTLYDVLLELYAKHGFYLEGLESRTLKGLDGVQQIAGIMNDWRNNPPAEINGVKVEKVLDYLGGLDGLRPENVLKYMLADGSWFCLRPSGTEPKIKVYFAVRGESTEHAAELLGNLR 559
>gi|52079409|ref|YP_078200.1| Alpha phosphoglucomutase PgcA [Bacillus licheniformis ATCC 14580] >gi|52784769|ref|YP_090598.1| YhxB [Bacillus licheniformis ATCC 14580] >gi|52002620|gb|AAU22562.1| Alpha Phosphoglucomutase PgcA [Bacillus licheniformis ATCC 14580] >gi|52347271|gb|AAU39905.1| YhxB [Bacillus licheniformis DSM 13] (582 aa)
Score = 721, Expect = 5.9e-74, Identities = 176/526 (33%), Positives = 303/526 (57%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTII-----DNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA-----NVKNKDILGLE--IKG----IRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           W     + ++ K L+L+   NE+E++  F Y KL FGTAG+R  +GPG N++NV+T ++ S G+A ++     +     V++A+D+R  +  +AM  AKTL   G++ +++ E  ++ TP +S++VRE    A I+ TASHNP  Y G+KVY   G Q+  ++A+++   +   +  +     D        LI    + I ++Y +      +N ++ ++    VI T  HGTA+  +   LK++GYE++ +  +Q +PDP+F+  ++ NPE+ A+F+ +++  E+  A+I++G DPD+DRL V V+  + ++  LTGNQ G +  HY+L+ K+          V+ T V++     IA  +      T TGFK++G ++ +     +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q K+L D L E+++ FG +     S  ++     E++   +  F      ++  KD++  E  + G    ++ N+        +  L+++LE+  W   R SGTEPK K Y+ + G T E  + +L  L DE
  S:    10 WRNKENLDSELKALLLEAEGNEKELEDCF-YKKLEFGTAGMRGEIGPGPNRMNVYTVRKASAGLAAYIGANGGEAKKRGVVIAYDSRHKSPEFAMEAAKTLAENGVQTYVFDE--LRPTPELSFAVRELNAFAGIVITASHNPPEYNGYKVYGEDGAQLPPADADKLTGYVNAIENELEIEAGDEAALTEKGLIKIIGEEIDQAYLDKLTSISVNPDLAKETEVKVIFTPLHGTANKSVRRGLKALGYEHVTVVPEQELPDPDFSTVSSPNPEEHAAFEYAIRLGEENGADILIGTDPDADRLGVAVKDQEGRYVVLTGNQTGALLLHYLLSQKQQKGMLPDNGVVLKTIVTSEMGRDIAASFGLDTIDTLTGFKFIGEKIKQFEASGEYAFQFGYEESYGYLIGDFARDKDAVQAALLAVEVCAFYKKQGKSLYDGLLELYKSFGFYREGLKSLTLKGKEGAEQIAAILSTFREQPPLSIAGKDVVSAEDYLTGKRTLLKENKRETIDLPKSNVLKYFLEDGSWFCLRPSGTEPKVKFYFAVKGRTNEESEALLNQLTDE 567
>gi|192809044|ref|ZP_03037719.1| Phosphomannomutase [Geobacillus sp. Y412MC10] >gi|192801715|gb|EDV78220.1| Phosphomannomutase [Geobacillus sp. Y412MC10] (572 aa)
Score = 717, Expect = 1.8e-73, Identities = 170/526 (32%), Positives = 296/526 (56%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL----NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK---NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + K+ +  L+ + +E+++ F Y  L FGT G+R  +G G+N+IN +T  + ++G A+++L    + +  P+V++AHD+R  +  +A+  A  L   GI   LY    +++TP +S+SVR  G    I+ TASHNP  Y G+KVYN  GGQ++  EA  +++ + E  +      +         L+ +  +   +++ +      +N  +   K   +F ++ T  HGT    +  +L++IG+++I +  +Q  PD NF+   + NPE++ +F L++K  E+  A+I++G DPD+DR+  VV++ + ++  LTGNQ G I  HY+L   K+  K P    V+ T V++     IAE Y A V  T TGFK++G +M +  +     ++ G+EE+ G L  +  RDKD   A+ L  E       Q KTL D L E++E+FG +     S  ++  +   ++Q KM  + +   + + G  +K       G+        L++ LE+  W   R SGTEPK K+Y+ + GE+       +++L D+
  S:    15 WLNDPYVDEETKQELRSLEHDAKELEERF-YRDLEFGTGGLRGVIGAGSNRINKYTVGRATQGFAQYILEAHGDAEGKPSVVIAHDSRHFSPEFALEAALVLAGNGIVAKLYP--SLRSTPQLSFSVRHLGATGGIVITASHNPPEYNGYKVYNREGGQLVPDEAENVIARIQEVDSFSAVKRLSQADAEAQGLLVWLGEAEDQAFVDTVTDVSVNRELIASKLGEDFKIVFTPLHGTGQAPVERVLRNIGFKHIHVVPEQAQPDGNFSTVKSPNPEEREAFTLAMKLGEEVGADILIGTDPDADRMGAVVKNGQGEYVVLTGNQSGAIMIHYLLGQLKEAGKLPNNGAVIKTIVTSEMGAAIAEHYGAAVLNTLTGFKYIGEKMTQFEESGSHTYLFGYEESYGYLAGNYARDKDAVLASMLICEAAAYYKGQGKTLYDVLQELYEQFGYFLETLESRTLKGKDGVAQIQAKMSDWRDNPPQKVGGQSVKQVLDYAEGLDGLPKENVLKYLLEDGSWFCLRPSGTEPKIKVYFAVRGESLGDAKAKIQSLSDQ 565
>gi|34849454|gb|AAP58953.1| phosphoglucomutase/phosphomannomutase [Spiroplasma kunkelii] (558 aa)
Score = 715, Expect = 3.4e-73, Identities = 181/530 (34%), Positives = 303/530 (57%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS-----NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT----PNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYL-TGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-IKGIR--------WNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFE 550
           K W ++  +         +M+E ++   FS   L FGTAG+R  +GPGT ++N++T ++ +    ++L    S     +  +++ HDNR  +  +A  +A    S  IK  L+  N ++ TPI+SY++R+    A +I TASHN + Y G+K+Y+H G Q L    + I  +  +   I + V+T    P+  LI+Y    + ++Y           N  +++N  ++ +  HGT+    P +LK  GY+ + +  +Q   DPNFT++ N NPE    +DL+LKYA+K  A++++  DPD+DRL + V+ K+  +YL TGN+   +   Y+ ++    K   K   + +TFV+ N  D++AE Y  +V +T TGFKW+G++M+K  DK ++F+ GFEEA G +  DI RDKDG Q++ +  E     ++Q KTL D L E + +FG +  +TV+   + ++ K+ +   + K   ++ K I  LE IK I+        +  P Q  L++Y  +  W   R SGTEPK K Y+    +T E   + ++A+  E E
  S:     8 KLWKDAKNLDPTLATEFQQMSEADLIAAFS-DDLEFGTAGLRGLLGPGTGKMNLYTIRRATLAFMQYLRTIYSATDLKSKGIVIGHDNRHFSAEFAQEVANIFASNNIKAILFTNNDLRPTPIVSYTIRKIKALAGVIITASHNSREYNGYKIYDHNGSQFLPVATDIIGENYLK---IKEEVFTLTLNPDSTLITYVAKEVEDNYVSDVKAMHFYPN--QKRNIKIVFSNLHGTSKEWTPRILKECGYD-VTIVEEQFDNDPNFTFAPNPNPELTECYDLALKYAKKINADVIILNDPDADRLGIGVKIKDYEYYLMTGNETAPVLIEYLFSHYQRQKTLPKNGVMYNTFVTGNLSDKVAESYGVQVIKTLTGFKWIGDQMSKAADKGLEFLFGFEEAYGYVLKDITRDKDGIQSSLVLAEACWYYHNQGKTLYDVLVEQYNKFGFFYCKTVNLVRDGIDGKKIINNMLKK---LRQKTITSLEKIKCIKKEDYLYGLYEMPGQDLLKFYFADGSWFAVRASGTEPKIKFYFVCVDKTNEEAKRKMEAMYQELE 552
>gi|152977212|ref|YP_001376729.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025964|gb|ABS23734.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Bacillus cereus subsp. cytotoxis NVH 391-98] (574 aa)
Score = 713, Expect = 5.3e-73, Identities = 174/526 (33%), Positives = 304/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + K+ +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++  +     E    + NV     D L+      + E+Y E     +IN  +  +  K+  ++ T  HGT++  +   L+++G+ ++ +  +Q +PDPNF+   + NPE+ A+F+L+++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ K+      K   V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L EIFE++G +  + VS  ++  +  E++QE M  F     K++ GL +K +   +                   +  L++ L +  W   R SGTEPK K Y+ +  ++ +  +Q L  +K++
  S:    10 WLSYANLDAELKQQLEDMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLAHFIESLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTISGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELIRYVNQVEDELTVEVANVEQLKADGLLHIIGTEVDEAYVEQLKTVIINKEMVEKVGKDLKIVFTPLHGTSNIPVRQGLEAVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFELAIRDGEKVGADVLIATDPDADRLGVAVRNHNGEFQVLTGNQTGALMLEYLLSQKEQNGTLPKNGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEIFEKYGFFREDLVSLTLKGKDGAEKIQEMMTAFRENPPKEVAGLTVKTVEDYKASTITSLIDGSQEEIQLPKSNVLKYQLTDGSWFCLRPSGTEPKIKFYFGVKADSLQNSEQKLLTIKED 569
>gi|23100492|ref|NP_693959.1| phosphomannomutase [Oceanobacillus iheyensis HTE831] >gi|22778725|dbj|BAC14993.1| phosphomannomutase [Oceanobacillus iheyensis HTE831] (577 aa)
Score = 710, Expect = 1.1e-72, Identities = 178/513 (34%), Positives = 299/513 (58%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRC--LINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM--DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQE-----KMDKFANVKNKDILGLE-----IKGIRWNEPAQA--------LEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFE 550
           LK +   ++  F Y +LSFGTAG+R  +G GTN++N++T ++   G+A +LL   N   N  +++A+D+R  +  +A+  AK L  +GI  ++++   ++ TP++S++VR     A I+ TASHNP  Y GFKVYN  G QI+ +EA  IV S+ + +      I++       + +++ +D + ++Y E  Y    L   +   +K+  ++ T  HGTA   +   LK + +  I +  +Q  PDP F+   + NPE+  +F  ++   ++  A+I+LG DPD+DRL V V++ + ++  L+GNQ+G++   Y++  K  DK+    P ++ T V+T     IAE    +   T TGFK++G ++N H D     F+ GFEE+ G L SD  RDKD  QAA +A E+      Q KTL D LD ++E++G +     S  ++     ++M+E     +   FA +    ++ +E     ++ +   +  +         +++ LE+D WV FR SGTEPK K YY + G   E  +Q L  LK+  E
  S:    28 LKNDRSALEDAF-YQELSFGTAGMRGILGAGTNRMNIYTIRKAVNGLADYLLTNYNDAKNRGIVIAYDSRYMSKEFAIESAKVLGYYGIHTYVFE--SLRPTPLLSFAVRHLNTVAGIMITASHNPPEYNGFKVYNEHGAQIVPAEAKLIVESIQQTKDELTVPILEQSQVEEQEKLTWLNDEVDQAYLERLYEITQLSLEDKQSEKDIQIVFTPLHGTALDLVTKGLKQLQFSKIAVVEEQAQPDPEFSTVESPNPEEHQAFSKAINLGKQTNADILLGTDPDADRLGVAVKNSEGEYQVLSGNQLGVLLFDYIV--KHIDKSKSVKPRMIKTVVTTELGRAIAEANQVESIDTLTGFKYIGEKIN-HYDTTGETFLFGFEESYGYLISDFVRDKDAVQAAMMATEMAYYWKQQGKTLFDALDVLYEKYGYYLEGMTSLTLKGQEGSQQMEEILTSIREKPFAEIGGMKVIAIEDYSSSVRTLTLEDKQETIILPKENMIKYLLEDDGWVCFRPSGTEPKIKYYYGVRGTNAEDSEQRLLGLKESLE 569
>gi|149182155|ref|ZP_01860637.1| YhxB [Bacillus sp. SG-1] >gi|148850106|gb|EDL64274.1| YhxB [Bacillus sp. SG-1] (581 aa)
Score = 707, Expect = 2.4e-72, Identities = 179/535 (33%), Positives = 307/535 (57%)
  Q:    21 KAWLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID-NVYTPN----MDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK-FDKTPF---VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------------KGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG----ETKEICDQILKALKDEFEYMLRS 555
           + W     + ++ + L+ +M E+E  ++  F Y  L FGT G+R  +G G N++NV+T ++ SEG+A++++   ++     V +A+D+R  +  +AM  AKTL S G++ +++ E  +K TP +S++VR+    + I+ TASHNP  Y G+KVY   G Q+   EA+E++S + E +  +  NV +        LI    + I +SY E          I ++ +  ++ +  HGTA   +   L ++GY ++    +Q VPDP F+   + NPEDKA+F+L+++  ++  A+I++  DPD+DRL V V+ +N ++  LTGNQ G +   Y+L  KK  D  P    V  T V++    ++AE Y A V    TGFK++G ++  + D  +  F+ G+EE+ G L  D  RDKD  QA  +A E       Q KTL D L ++++ FG +     S  ++     E++Q  +  F     K+I GL +                G+        +  ++++LE+  W+  R SGTEPK K Y+ + G    E++E  + + +AL ++ + M+ S
  S:     8 EKWDSFEELDSEMRGLLTEMQEDEKSLEDAF-YKNLEFGTGGMRGEIGAGINRMNVYTVRKASEGLAQYIISHGDEAKKRGVAIAYDSRHKSPEFAMEAAKTLASNGVQTYVFDE--LKPTPELSFAVRQLKAFSGIVVTASHNPPEYNGYKVYGEDGAQLPPKEADEVISKVNEIENELQINVKSEEELKAAGLIKMIGEEIDQSYLEHLLSISEKPQIAKEVDLSIVFSPLHGTALKMVEKGLDALGYRDVHYVKEQSVPDPEFSTVKSPNPEDKAAFELAIRDGKEKDADILIATDPDADRLGVAVKDRNGEYILLTGNQTGALLIDYILGRKKEKDMIPANGRVFKTIVTSELGRKVAESYGASVEDVLTGFKFIGEKIKNYEDSGEYQFLFGYEESYGYLIGDFARDKDAVQAVLMATEAAAYFKQQGKTLYDALLDLYDRFGYYQEGLESLTLKGKEGAEQIQSILTSFREEPLKEIRGLAVTKCEDYKTSMSTMLENGLEETISLPKSNVIKYFLEDGSWICLRPSGTEPKIKFYFSVTGNSLSESQEKLEGLKQALMEKIDNMVNS 578
>gi|42784104|ref|NP_981351.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus ATCC 10987] >gi|42740035|gb|AAS43959.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus ATCC 10987] (574 aa)
Score = 706, Expect = 2.9e-72, Identities = 173/526 (32%), Positives = 304/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A++   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   LK +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAELDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATQGLAKFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNISVRRGLKEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEQIQEMMATFRENPPKEVAGLTVVAVEDYKASMITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDNSLQNSEQKLLTIKED 569
>gi|168161671|ref|ZP_02596904.1| Phosphoglucomutase [Bacillus cereus H3081.97] (574 aa)
Score = 706, Expect = 3.6e-72, Identities = 174/526 (33%), Positives = 303/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + NV     D L+      + ++Y       +IN  +  +  K+  ++ T  HGT++  +   LK +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVANVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVEKAGKDLKIVFTPLHGTSNISVRRGLKEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTIDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEKIQEMMATFRENPPKEVAGLTVVSVEDYKASIVTSLQDGHKEEIHLPKSNVLKYQLEDSSWFCLRPSGTEPKIKFYFGVKDSSLQNSEQKLLTIKED 569
>gi|148324403|gb|EDK89653.1| phosphoglucomutase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (562 aa)
Score = 705, Expect = 4.0e-72, Identities = 183/529 (34%), Positives = 301/529 (56%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAV-VVRHKNKWHYLTGNQMGIIFTHYVLTNKK-FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM----NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR------WNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           K WL+SN +S   KE +  +  NE+EI+  F Y+ LSFGTAG+R   G G N++N +  ++ ++G+A +++ +         V +A+D+R+++   A+  A TL   GIKV+L+  + +++TP +S++VRE    A I+ TASHNPK Y G+KVY   G QI+D +A  IVSS+          +++     +  L+ Y  + + + Y E   +  IN N+  +     + +  HG A+  +  +LK +GY N+    +Q  PD NF      NPED   F LS + A+K  A I +  DPD DR+ + V+ +  KW +  GNQ+GI+F  Y+L +KK   +   +++T VST  +D I +K   K  R  TGFK++G ++    NK +D   F+ GFEEAIG L     RDKD   A+ +  E+ T   +   ++ + + +I+E++G     TV    +  +  EE+Q+ M       + +I G+++K  R       N P A  ++  LE++ ++  R SGTEPK K Y  +    K++ ++ L  ++ EF
  S:     7 KKWLDSNMLSASEKEELKSIANNEKEIESRF-YTDLSFGTAGMRGVRGIGRNRMNKYNIRKATQGLANYIIKEAGEVGKKKGVAIAYDSRLDSVENAINTAMTLAGNGIKVYLF--DGVRSTPELSFAVRELKAQAGIMITASHNPKEYNGYKVYWEDGAQIVDPQATGIVSSVEAVDIFNGIKLMEEKEAIDKGLLVYVGEKLDDRYIEEVKKNAINPNVENKDKVKFVYSPLHGVAARPVERVLKEMGYTNVYPVKEQEKPDGNFPTCDYANPEDTNVFKLSTELADKVGAKICIANDPDGDRVGLAVLDNDGKWFFPNGNQIGILFAEYILNHKKNIPENGTMITTIVSTPLLDTIVKKNGKKALRVLTGFKYIGEKIRQFENKELDGT-FLFGFEEAIGYLVGTHVRDKDAVVASMIIAEMATTFENNGSSIYNEIIKIYEKYGWRLETTVPITKKGKDGLEEIQKIMKSMRAKTHTEIAGVKVKEYRDYQKGVDNLPKADVIQMVLEDETYLTVRPSGTEPKIKFYISVVDSDKKVAEEKLARIEKEF 555
>gi|166984320|ref|ZP_02255676.1| Phosphoglucomutase [Bacillus cereus AH187] (574 aa)
Score = 705, Expect = 4.0e-72, Identities = 174/526 (33%), Positives = 303/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + NV     D L+      + ++Y       +IN  +  +  K+  ++ T  HGT++  +   LK +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVANVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVEKAGKDLKIVFTPLHGTSNISVRRGLKEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTIDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEKIQEMMATFRENPPKEVAGLTVVSVEDYKASIVTSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVKDSSLQNSEQKLLTIKED 569
>gi|19703894|ref|NP_603456.1| phosphoglucomutase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714058|gb|AAL94755.1| Phosphoglucomutase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (580 aa)
Score = 704, Expect = 5.7e-72, Identities = 183/529 (34%), Positives = 300/529 (56%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVY------TPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAV-VVRHKNKWHYLTGNQMGIIFTHYVLTNKK-FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM----NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           K WL+SN +S   KE +  +  +E+EI+  F Y+ LSFGTAG+R   G G N++N +  ++ ++G+A +++           + +A+D+R+++   A+  A TL   GIKV+L+  + +++TP +S++VRE    A I+ TASHNPK Y G+KVY   G QI+D +A  IVSS+ E   I +++         +  L+ Y    + + Y E   +  IN N+  +     + +  HG A+  +  +LK +GY N+    +Q  PD NF      NPED   F LS++ A+K  A I +  DPD DR+ + V+ +  KW +  GNQ+GI+F  Y+L  KK   K   +++T VST  +D I +K   K  R  TGFK++G ++    NK +D   F+ GFEEAIG L     RDKD   A+ +  E+ T   +   ++ + + +I+E++G     TV    +  +  EE+Q+ M       + +I G+++       KG+     A  ++  LE++ ++  R SGTEPK K Y  +    K++ ++ L  +K EF
  S:    25 KKWLDSNMLSASEKEELKNIANDEKEIESRF-YTDLSFGTAGMRGVRGIGRNRMNKYNIRKATQGLANYIIKATGEVGKQKGIAIAYDSRLDSVENALNTAMTLAGNGIKVYLF--DGVRSTPELSFAVRELKAQAGIMITASHNPKEYNGYKVYWEDGAQIVDPQATGIVSSV-EAVNIFNDIKLMEEKEAIDKGLLVYVGKKLDDRYIEEVKKSAINPNVENKDKVKFVYSPLHGVAARPVERVLKEMGYTNVYPVKEQEKPDGNFPTCDYANPEDTTVFKLSIELADKVGAKICIANDPDGDRVGLAVLDNDGKWFFPNGNQIGILFAEYILNYKKDIPKNGTMITTVVSTPLLDTIVKKNGKKALRVLTGFKYIGEKIRQFENKELDGT-FLFGFEEAIGYLVGTHVRDKDAVVASMIIAEMATTFENNGSSIYNEIIKIYEKYGWRLETTVPITKKGKDGLEEIQKIMKSMRVKSHTEIAGVKVKEYRDYQKGVENLPKADVIQMVLEDETYLTVRPSGTEPKIKFYISVVDSDKKVAEEKLAKIKKEF 573
>gi|171326071|ref|ZP_02914563.1| Phosphomannomutase [Geobacillus sp. WCH70] >gi|171087958|gb|EDT34317.1| Phosphomannomutase [Geobacillus sp. WCH70] (582 aa)
Score = 703, Expect = 6.7e-72, Identities = 169/525 (32%), Positives = 297/525 (56%)
  Q:    23 WLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN---KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-------RWNEPA-----------QALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           WL    +  + K L+ +  ++   ++  F Y  L FGT G+R  +GPGTN++N++T ++ SEG+AR++ +   +     V++A+D+R  +  +AM  AKTL + GI+ +++ E  ++ TP +S++VR     + I+ TASHNP  Y G+KVY   GGQ+    A+ ++  + E +      + D        LI    + +  +Y +A     +   +  + +  ++ T  HGT++  +   LK +GY N+ +  +Q  PDPNF+  A+ NPE+ A+F L+++Y +K  A++++  DPD+DRL + V++ K  +  LTGNQ G +  HY+L+ KK      +   V+ T V++ +   IA+ +      T TGFK++G ++ ++    +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q  +L + L ++F+++G +     S  ++     E +Q  +  F N    ++ G ++  I       R N  A             L++ LE+D W   R SGTEPK K+Y+ + G++    +  L+ L +
  S:    10 WLAHKSLDKELKRLLTERQDDLKWLEDCF-YKNLEFGTGGMRGEIGPGTNRMNIYTIRKASEGLARYIESFGEEAKKRGVVIAYDSRHKSREFAMEAAKTLATHGIQTYVFDE--LRPTPELSFAVRYLHAFSGIVITASHNPPEYNGYKVYGEDGGQLPPDTADAVIRYVNEVENELDIHVEDEAILKEKGLIQIIGEEVDNAYIDAVKTVSLQPKLAEEVDIHIVFTPLHGTSNKPIRRALKELGYRNVFVVKEQEQPDPNFSTVASPNPEEHAAFALAIEYGKKVNADLLIATDPDADRLGIAVKNEKGDYVVLTGNQTGGLLLHYLLSQKKEKGILPQNGVVLKTIVTSEFGRAIAQSFGLDTVDTLTGFKFIGEKIKEYEQTGQYTFQFGYEESYGYLIGDFVRDKDAVQAAVLAVEVCAFYKKQGMSLYEGLLQLFDQYGYYREGQQSLTLKGREGAETIQAILTSFRNEPPVEVAGKKVTVIEDYKTKERVNTAAGEKTMITLPTSNVLKYLLEDDSWFCLRPSGTEPKIKVYFGVKGKSLADSEAKLQQLSN 566
>gi|196250716|ref|ZP_03149404.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Geobacillus sp. G11MC16] >gi|196209795|gb|EDY04566.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Geobacillus sp. G11MC16] (585 aa)
Score = 703, Expect = 8.4e-72, Identities = 168/525 (32%), Positives = 299/525 (56%)
  Q:    23 WLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-------RWNE-----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           WL   ++  + K+L+ +  ++E  ++  F Y  L FGT G+R  +GPGTN++N++T ++ SEG+AR++    N+     V++A+D+R  +  +AM  AKTL + GI+ +++ E  ++ TP +S++VR  G  + I+ TASHNP  Y G+KVY   GGQ+    A+E++  + E +      + D        LI      I E+Y  A     ++  + ++ N  ++ T  HGT++  +  +L  +GY+N+ +  +Q  PDPNF+  A+ NPE+ A+F L+++  ++  A++++  DPD+DRL + V++ + ++  LTGNQ G +  HY+L+ +K      +   V+ T V++ +   IA+ +  +   T TGFK++G ++ ++    +  F  G+EE+ G L  D  RDKD  QAA LA EV      Q  +L + L ++F+++G +     S  ++     E +   +  F      +  G ++  I       R N             +  L++ LE+  W   R SGTEPK K Y+ + G + +  ++ L  L D
  S:    10 WLREPQLDPELKQLLEQHRDDERWLEDCF-YKNLEFGTGGMRGEIGPGTNRMNIYTVRKASEGLARYIQSFGNEAKQRGVVIAYDSRHKSPEFAMEAAKTLATNGIQTYVFDE--LRPTPELSFAVRHLGAFSGIVITASHNPPEYNGYKVYGEDGGQLPPDTADEVIRYVNEVENELAIHVEDEETLKEKGLIRIIGQEIDEAYVNAVKTISLHPELAQETNIRIVFTPLHGTSNKPVRRVLAELGYQNVFVVQEQEQPDPNFSTVASPNPEEHAAFALAIELGKQVNADLLIATDPDADRLGIAVKNEQGEYVVLTGNQTGGLLLHYLLSQRKEKGLLPQNGVVLKTIVTSEFGRAIADSFGLETIDTLTGFKFIGEKIKEYEQTGQYTFQFGYEESYGYLIGDFARDKDAVQAAVLAAEVCAFYKQQGLSLYEALLQLFDKYGYYREGQQSLTLKGKEGAETIAAILSSFREQPPVEAAGKKVTVIEDYKTKERTNTLTGEKTAITLPTSNVLKYVLEDGSWFCLRPSGTEPKMKAYFGVKGTSLQDSEEKLANLTD 566
>gi|47566955|ref|ZP_00237672.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus G9241] >gi|47556273|gb|EAL14607.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus G9241] (574 aa)
Score = 702, Expect = 9.7e-72, Identities = 172/526 (32%), Positives = 304/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A++   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   L+ +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAELDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATQGLAKFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNISVRRGLEEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKIGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKTYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEQIQEMMATFRENPPKEVAGLTVVAVEDYKASIITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDNSLQNSEQKLLTIKED 569
>gi|30264962|ref|NP_847339.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. Ames] >gi|47530458|ref|YP_021807.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187780|ref|YP_031033.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. Sterne] >gi|49480344|ref|YP_038942.1| phosphomannomutase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65316911|ref|ZP_00389870.1| COG1109: Phosphomannomutase [Bacillus anthracis str. A2012] >gi|165870837|ref|ZP_02215489.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0488] >gi|166996877|ref|ZP_02263337.1| probable phosphomannomutase [Bacillus cereus AH820] >gi|167634923|ref|ZP_02393241.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0442] >gi|167639968|ref|ZP_02398236.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0193] >gi|170685911|ref|ZP_02877134.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0465] >gi|170706974|ref|ZP_02897431.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0389] >gi|177652277|ref|ZP_02934780.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0174] >gi|190567100|ref|ZP_03020015.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis Tsiankovskii-I] >gi|196033047|ref|ZP_03100460.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus W] >gi|196043853|ref|ZP_03111090.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus 03BB108] >gi|30259639|gb|AAP28825.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. Ames] >gi|47505606|gb|AAT34282.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181707|gb|AAT57083.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. Sterne] >gi|49331900|gb|AAT62546.1| probable phosphomannomutase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|164713346|gb|EDR18871.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0488] >gi|167512049|gb|EDR87427.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0193] >gi|167529673|gb|EDR92422.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0442] >gi|170128077|gb|EDS96947.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0389] >gi|170670375|gb|EDT21115.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0465] >gi|172082283|gb|EDT67349.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis str. A0174] >gi|190561604|gb|EDV15574.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus anthracis Tsiankovskii-I] >gi|195994476|gb|EDX58431.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus W] >gi|196025189|gb|EDX63859.1| phosphoglucomutase/phosphomannomutase family protein [Bacillus cereus 03BB108] (574 aa)
Score = 702, Expect = 1.1e-71, Identities = 172/526 (32%), Positives = 303/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A++   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   L  +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAELDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATQGLAKFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHMIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNLSVRRGLAEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEQIQEMMATFRENPPKEVAGLTVVAVEDYKASIITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDNSLQNSEQKLLTIKED 569
>gi|30022960|ref|NP_834591.1| phosphoglucomutase [Bacillus cereus ATCC 14579] >gi|29898519|gb|AAP11792.1| Phosphoglucomutase [Bacillus cereus ATCC 14579] (574 aa)
Score = 702, Expect = 1.1e-71, Identities = 173/526 (32%), Positives = 304/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   LK +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGARGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNISVRRGLKEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHNGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTIDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEKIQEMMATFRENPPKEVAGLTVVAVEDYKASIVTSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVKDSSLQNSEQKLLTIKED 569
>gi|167939460|ref|ZP_02526535.1| Phosphoglucomutase [Bacillus cereus AH1134] (574 aa)
Score = 701, Expect = 1.2e-71, Identities = 173/526 (32%), Positives = 304/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   LK +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGARGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKTDGLLHIIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNISVRRGLKEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHNGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEKIQEMMATFRENPPKEVAGLTVVAVEDYKASVVTSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVKDSSLQNSEQKLLTIKED 569
>gi|168137403|ref|ZP_02580632.1| Phosphoglucomutase [Bacillus cereus B4264] (574 aa)
Score = 701, Expect = 1.2e-71, Identities = 173/526 (32%), Positives = 304/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   LK +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGARGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNISVRRGLKEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHNGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEKIQEMMATFRENPPKEVAGLTVVAVEDYKASIVTSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVKDSSLQNSEQKLLTIKED 569
>gi|15895604|ref|NP_348953.1| phosphomannomutase [Clostridium acetobutylicum ATCC 824] >gi|15025346|gb|AAK80293.1|AE007734_7 Phosphomannomutase [Clostridium acetobutylicum ATCC 824] (575 aa)
Score = 700, Expect = 1.5e-71, Identities = 170/516 (32%), Positives = 302/516 (58%)
  Q:    21 KAWLESNRIS-NKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------KGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           KAWL+S  +     KEL    +E+EI+  F Y  L FGT G+R  +  G+N+IN++T  + ++G+A +L    +N ++ +AHD+R+ +  +A   A  L + GIK +L+  + ++ TP++S++VR     A I+ TASHNPK Y G+KVYN  G Q+ D+ A E++  + + +      +ID        ++    + + + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q  PD NF  +   NPE  + F+++L+ A+K   +++ G DPD DR+ V+V++K+ ++  LTGNQ G++ THY++++ K   K P    V+ T V++    +I E Y+ K+    TGFK++G ++   +  +   ++ GFEE+ G L     RDKD   AA L  E+     ++  +L D L+E++E++G +  + VS +++    +E++Q+ ++      + ++ G++I           K I  NE        +  L + LE+  W   R SGTEPK K+Y  + G  KE
  S:     8 KAWLDSEYVDVETKKELEAIKDEKEIEDRF-YKDLEFGTGGLRGVIAAGSNRINIYTVGKATQGLADYLNKNYNNASIAIAHDSRIMSREFAERAASVLCANGIKTYLF--DSLRPTPMLSFTVRHLNCKAGIVITASHNPKQYNGYKVYNEDGNQLTDNAAAEVLDFIEKTEDFSGVKLIDIKKAEKDGILDIIGEEVDKVYIDKVKDLTIRKDMVKESAKDLKIIYTPIHGSGNIPVRRVLKELGYENLTVVKEQEKPDGNFPTAPYPNPEQPSVFNIALELAKKVDPDVIFGTDPDCDRIGVLVKNKSGEYKVLTGNQTGVLLTHYIISSLKDTGKLPANGAVIKTIVTSEMTRKITEDYDMKLIDVLTGFKYIGEKIKEFEETNSNTYLFGFEESYGCLAGTFVRDKDAVVAATLVCEMALYYKNKGLSLDDALNELYEKYGFYKEKLVSIELQGKEGQEKIQKALNYLRENMSDNVAGVKIVKKFDYKSSVEKDIPKNEEKKIELPKSNVLRFILEDGSWFVVRPSGTEPKMKVYLAVAGTNKE 553
>gi|52140605|ref|YP_086224.1| phosphomannomutase [Bacillus cereus E33L] >gi|51974074|gb|AAU15624.1| probable phosphomannomutase [Bacillus cereus E33L] (574 aa)
Score = 700, Expect = 1.6e-71, Identities = 172/526 (32%), Positives = 303/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A++   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   L  +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAELDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATQGLAKFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNLSVRRGLAEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEKIQEMMATFRENPPKEVAGLTVVAVEDYKASIITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDNSLQNSEQKLLTIKED 569
>gi|75760262|ref|ZP_00740315.1| PHOSPHOGLUCOMUTASE / PHOSPHOMANNOMUTASE [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492257|gb|EAO55420.1| PHOSPHOGLUCOMUTASE / PHOSPHOMANNOMUTASE [Bacillus thuringiensis serovar israelensis ATCC 35646] (574 aa)
Score = 699, Expect = 1.9e-71, Identities = 172/526 (32%), Positives = 301/526 (57%)
  Q:    23 WLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP----ECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  MN++E  I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  +  +  K+  ++ T  HGT++  +   L+ +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK      +   V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMNQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGARGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVDAIEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVEKAGKDLKIVFTPLHGTSNISVRRGLEEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHNGEFQVLTGNQTGALMLDYLLSQKKENGILPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEQIQEMMATFRENPPKEVAGLTVVAVEDYKASIITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDSSLQNSEQKLLTIKED 569
>gi|118480012|ref|YP_897163.1| alpha-phosphoglucomutase [Bacillus thuringiensis str. Al Hakam] >gi|118419237|gb|ABK87656.1| alpha-phosphoglucomutase [Bacillus thuringiensis str. Al Hakam] (574 aa)
Score = 699, Expect = 2.0e-71, Identities = 172/526 (32%), Positives = 302/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM----PECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + KE +  +K +E++I+  F Y  L FGT G+R   G GTN++NV+T ++ ++G+A++   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   L  +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAELDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGEFGAGTNRLNVYTVRKATQGLAKFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVEDELTVEVADVEQLKADGLLHMIGQEVDDAYAAELNNVIINKEMVQKVGKDLKIVFTPLHGTSNLSVRRGLAEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEQIQEMMATFRENPPKEVAGLTVVAVEDYKASIITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDNSLQNSEQKLLTIKED 569
>gi|138894187|ref|YP_001124640.1| phosphoglucomutase [Geobacillus thermodenitrificans NG80-2] >gi|134265700|gb|ABO65895.1| Phosphoglucomutase [Geobacillus thermodenitrificans NG80-2] (585 aa)
Score = 698, Expect = 2.9e-71, Identities = 167/525 (31%), Positives = 299/525 (56%)
  Q:    23 WLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-------RWNE-----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           WL   ++  + K+L+ +  ++E  ++  F Y  L FGT G+R  +GPGTN++N++T ++ SEG+AR++    N+     V++A+D+R  +  +AM  AKTL + GI+ +++ E  ++ TP +S++VR  G  + I+ TASHNP  Y G+KVY   GGQ+    A+E++  + E +      + D        LI      I E+Y  A     ++  + ++ +  ++ T  HGT++  +  +L  +GY+N+ +  +Q  PDPNF+  A+ NPE+ A+F L+++  ++  A++++  DPD+DRL + V++ + ++  LTGNQ G +  HY+L+ +K      +   V+ T V++ +   IA+ +  +   T TGFK++G ++ ++    +  F  G+EE+ G L  D  RDKD  QAA LA EV      Q  +L + L ++F+++G +     S  ++     E +   +  F      +  G ++  I       R N             +  L++ LE+  W   R SGTEPK K Y+ + G + +  ++ L  L D
  S:    10 WLREPQLDPELKQLLEQHRDDERWLEDCF-YKNLEFGTGGMRGEIGPGTNRMNIYTVRKASEGLARYIQSFGNEAKQRGVVIAYDSRHKSPEFAMEAAKTLATNGIQTYVFDE--LRPTPELSFAVRHLGAFSGIVITASHNPPEYNGYKVYGEDGGQLPPDTADEVIRYVNEVENELAIHVEDEETLKEKGLIRIIGQEIDEAYVNAVKTISLHPELAQETDIRIVFTPLHGTSNKPVRRVLAELGYQNVFVVQEQEQPDPNFSTVASPNPEEHAAFALAIELGKQVNADLLIATDPDADRLGIAVKNEQGEYVVLTGNQTGGLLLHYLLSQRKEKGLLPQNGVVLKTIVTSEFGRAIADSFGLETIDTLTGFKFIGEKIKEYEQTGQYTFQFGYEESYGYLIGDFARDKDAVQAAVLAAEVCAFYKQQGLSLYEALLQLFDKYGYYREGQQSLTLKGKEGAETIAAILSSFREQPPVEAAGKKVTVIEDYKTKERTNTLTGEKTAITLPTSNVLKYVLEDGSWFCLRPSGTEPKMKAYFGVKGTSLQDSEEKLANLTD 566
>gi|168143658|ref|ZP_02586887.1| Phosphoglucomutase [Bacillus cereus G9842] (574 aa)
Score = 697, Expect = 4.1e-71, Identities = 171/526 (32%), Positives = 302/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP----ECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL   ++  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  +  +  K+  ++ T  HGT++  +   L+ +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK      +   V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE++G +  + VS  ++  +  E++QE M  F     K++ GL +  +   +                   +  L++ LE+  W   R SGTEPK K Y+ +   + +  +Q L  +K++
  S:    10 WLSYAQLDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLASFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGARGITTYVFE--SLRPTPVLSFAVRHLHTVSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVDAIEDELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVEKAGKDLKIVFTPLHGTSNISVRRGLEEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHNGEFQVLTGNQTGALMLDYLLSQKKENGILPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIRQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFEKYGFFREDLVSLTLKGKDGAEQIQEMMATFRENPPKEVAGLTVVAVEDYKASIITSLQDGHKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDSSLQNSEQKLLTIKED 569
>gi|157691667|ref|YP_001486129.1| phosphoglucomutase [Bacillus pumilus SAFR-032] >gi|157680425|gb|ABV61569.1| phosphoglucomutase [Bacillus pumilus SAFR-032] (581 aa)
Score = 696, Expect = 4.8e-71, Identities = 174/526 (33%), Positives = 292/526 (55%)
  Q:    23 WLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP----ECQTIIDNVYT-PNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ------------------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           W+    ++ + +E +    +++  ++  F Y  L FGT G+R  +G GTN++NV+T ++ S G+A ++     +     V +A+D+R  +  +AM  AKTL + GIK +++ E  ++ TP +S++VRE    A I+ TASHNP  Y G+KVY   GGQ+   +A++++  +     E    +D+  T     LI+     I  +Y E      ++  +  + +  V+ T  HGTA+  +   L+++GY+++ +  +Q  PDP F+   + NPE+ A+F+ ++K  EK  A+I++  DPD+DRL + VR H  ++  LTGNQ G +  HY+L+ K    +    P V+ T V++     +A  + A    T TGFK++G ++ +  +  +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q K+L D L +IF+EFG +     S  ++     E++   +  F       I G  I  I   + +Q                   L+++LE+  W   R SGTEPK K Y  + G +    ++ LK L +E
  S:    10 WINEKHLNTELREWLEAHQDDQQALEDCF-YKNLEFGTGGMRGEIGAGTNRMNVYTVRKASAGLAAYIAKHGEDAKRRGVAIAYDSRHKSPEFAMEAAKTLAAQGIKTYVFDE--LRPTPELSFAVRELNAFAGIVVTASHNPPEYNGYKVYGEDGGQLPPFQADQVIQEVDAIENELSISVDSEETLKQQGLINMIGAEIDLAYIEKLKTISVHPELADEVDVKVVFTPLHGTANQPVRKGLQALGYQHVTVVPEQERPDPQFSTVTSPNPEEHAAFEYAIKLGEKQNADILIATDPDADRLGIAVRDHDGEFTVLTGNQTGALLLHYLLSEKQKLGQLPPRPVVMKTIVTSELGRAVASAFGAHTIDTLTGFKFIGEKIKQFEESGEYTFQFGYEESYGYLIGDFARDKDAVQAALLAVEVTAFYKKQGKSLYDALVDIFKEFGFYREGLKSLTLKGKEGAEQISAILHTFRTNPPAAIAGQRITVIEDYQSSQRHLVAEKKEETIHLPASNVLKYFLEDGSWFCLRPSGTEPKVKFYMAVKGTSLTDSEEKLKHLSEE 567
>gi|189459653|ref|ZP_03008438.1| hypothetical protein BACCOP_00280 [Bacteroides coprocola DSM 17136] >gi|189433612|gb|EDV02597.1| hypothetical protein BACCOP_00280 [Bacteroides coprocola DSM 17136] (581 aa)
Score = 696, Expect = 4.8e-71, Identities = 169/500 (33%), Positives = 275/500 (55%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK----KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           K ++   ++ E+ + F Y  L FGT G+R  MG G+N++N++T    ++G++ +L NK    K + +V+V HD R N+  +A + A   ++ GIKV+L+++  ++ TP +S+++R  G  + II TASHNPK Y G+K Y   G Q+L      I+  + +  +  D  +  N +LI      I + Y    +   I+   I RQK+  ++ T  HGT    +P  LK  G+EN+    +Q V   +F    + NPE+  +  L++K A++  A+I++  DPD+DR+ +  +  K +W  + GNQ  +IF +Y++ N+    K     F+V T V+T  I  +A+K N K+    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A +L  E+     DQ KTL D L EI+ E+G     TV+      +  +E++  MD F     K++ G E+  ++                    EP+  L+++  +   +  R SGTEPK K Y EI GE
  S:    31 KRMLENPDKTELIEAF-YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYL-NKCFAGKKDISVVVGHDCRNNSRLFAEISANIFSANGIKVYLFED--MRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDKGIIDEVNKIASAADIKFEGNKELIQIIGKDIDDEYLRQVHTISIDPEVIKRQKDLKIVYTPIHGTGMMLIPQSLKLWGFENVHCVPEQMVKSGDFPTVVSPNPENAEALTLAIKLAKEIDADIVMASDPDADRVGMACKDDKGEWVLINGNQTCLIFLYYIIKNRIAMGKMKGNEFIVKTIVTTELIKSVADKNNIKMLDCYTGFKWIAREIRLREGKEQYIGGGEESYGFLAEDFVRDKDAVSACSLLAEICAWAKDQGKTLYDVLMEIYVEYGFSKEVTVNVVKPGKSGADEIKAMMDNFRACPPKELGGSEVVLVKDYKTLKATDANGNVTDLDMPEPSNVLQFFTADGTKISVRPSGTEPKIKFYMEIKGE 554
>gi|169347372|ref|ZP_02866310.1| hypothetical protein CLOSPI_00087 [Clostridium spiroforme DSM 1552] >gi|169293989|gb|EDS76122.1| hypothetical protein CLOSPI_00087 [Clostridium spiroforme DSM 1552] (564 aa)
Score = 695, Expect = 6.4e-71, Identities = 168/510 (32%), Positives = 299/510 (58%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD---KFANVKNKDILGLEIKGIRWNE-------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           W +   +    K  +L MNE+E +  F Y  L FGTAG+R  +G GTN++N++T ++ + G A+++L   +     V + +DNR  +  +A+  AK L ++GIK ++++   ++ TP +S++VR       I+ TASHNPK Y G+KVY+ TG Q++   A+++V+ + E +  +      + D    I++  + + E+Y++      IN  +  + +F ++ +  HGT++  +   L  +GY N+I    QC PDP+F+ +A+ NPE   S+DL++K A++  A++++  DPD DRL VV +H  ++  ++GNQ   ++  Y+L+  KK  K P    + +T V+++  + +++ Y  +V +T TGFK++G+++ K+    + +FV G+EE+ G +  D  RDKD  QA  +A E       Q K L+D L+E++E+ G +    ++         + ++E MD   K A  K  D   + I+  + +E              +  L++YLE+  W+  R SGTEPK K Y+ I G
  S:    10 WTDCKDLDPSLKAELLSMNEKEKEDAF-YMNLEFGTAGMRGILGAGTNRMNIYTIRKANVGFAKYVLGLPEGKERGVAIGYDNRHMSYKFAIESAKVLATYGIKSYIFE--SLRPTPELSFAVRYLKCAGGIMITASHNPKEYNGYKVYDDTGCQLIPEWADQVVTYVNEVEDELAIEVASDDDAYPYITWIGEEVDEAYYKEVMAIEINPGM-DKSDFKIVFSPQHGTSNLPVRTCLTRLGY-NVIPVLAQCAPDPDFSNTASPNPEIACSYDLAIKKAKEVDADVVVICDPDGDRLGVVAKHDGEYVLMSGNQSAAVYLEYILSELKKQGKLPSNAVMYNTIVTSDLGELVSKSYGVEVEKTLTGFKFIGDKIRKYEKTKEKEFVFGYEESYGCVVKDFVRDKDAVQAVVMAAEAGNFYKKQGKDLIDVLNELYEKHGTFKESQIALSKAGAEGAKRIKEIMDNLRKDAPAKIGDYKVVAIEDYQSSEKIENGATSTIDLPKSNVLKYYLEDGSWIAARPSGTEPKCKFYFSIKG 541
>gi|162447707|ref|YP_001620839.1| phosphoglucomutase / phosphomannomutase [Acholeplasma laidlawii PG-8A] >gi|161985814|gb|ABX81463.1| phosphoglucomutase / phosphomannomutase [Acholeplasma laidlawii PG-8A] (544 aa)
Score = 695, Expect = 6.5e-71, Identities = 183/526 (34%), Positives = 298/526 (56%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-KGIRWNE-----------PAQALEWYLENDM-WVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           K WL  N +S K K+ +L M+E+E ++ F Y +LSFGT GIR  +G G N+IN +T Q+++ G A +L ++     V +++DNR  +  +A   AK L   GIK ++YK   ++ TP++SY VR     A I+ TASHNPK Y GFK YN TG Q+   E+N+++  + +  +   ++ T + DLI +  D I + Y     +  +    + +K+  ++ +  HGT    +P LL   GY  +     Q   DP F+++ + NPED  +++ +++ A K  A+++   DPD+DRL V  +  + +H L GNQ   +  +Y+L+ KK   +  V +T VS++ +  IA KYN KV  T TGFK++G +  K+  K+ ++ G EE+ GSL SD  RDKD  QA  L  E+   L  +  T+ DYLDEI+  FG +  +T++  ++ +   + + +  D +  +    I G E+ K I +++           P+  L++  E+D  ++ FR SGTEPK KIY  +   +     Q +  LK
  S:     8 KIWLNGNALSEKEKQTLLSMDEKEKEESF-YQELSFGTGGIRGILGLGPNRINKYTIQRVTLGFANYLKSEHKLNGVAISYDNRYGSYEFAYEAAKVLAFNGIKSYIYK--ALRPTPMLSYLVRHFKTSAGIMLTASHNPKEYNGFKAYNDTGAQLSTDESNKVIEEISKIASPF-HIGTLDNDLIHWIGDEIDDIYLNEVEKIAVR---HDEKDLKIVYSPLHGTGGTVIPKLLDKTGY-TVYREPNQMKVDPEFSHTKSSNPEDHIAYEKTIELARKKDADVIFVTDPDADRLGVAYKLNDDYHILNGNQTASMMLYYILSEKK-QPSGIVYTTVVSSHLLKDIAHKYNQKVGETLTGFKFIGEQAEKNQGKLPYIFGCEESYGSLVSDFVRDKDAVQAVYLLAEILNTLKSRNLTVKDYLDEIYHIFGYYLEDTINLTLKGIEGSKRIIQITD-YVRLHGIKIDGFEVKKKIDFSKGMIHPHDIVLPPSNVLKF--ESDQGFIIFRPSGTEPKLKIYISVKTTSHAASKQKISDLK 534
>gi|196040480|ref|ZP_03107780.1| phosphoglucomutase (Alpha-phosphoglucomutase) (Glucosephosphomutase) (PGM) [Bacillus cereus NVH0597-99] >gi|196028612|gb|EDX67219.1| phosphoglucomutase (Alpha-phosphoglucomutase) (Glucosephosphomutase) (PGM) [Bacillus cereus NVH0597-99] (575 aa)
Score = 695, Expect = 6.7e-71, Identities = 169/511 (33%), Positives = 295/511 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP----ECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           +K + ++I+  F Y  L FGT G+R  +G GTN++NV+T ++ +EG+A+++  +        V+VA+D+R  +  +AM +A TL + GIK ++++   ++ TP +S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + NV     + L+      + ++Y E     +IN  +   +     ++ T  HGTA+  +   L+++G++N+ +  +Q  PDPNF+   + NPE+ A+F+L+++Y  + +A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK      +   V+ T V++     +A  Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+FE+ G +    VS  ++  +  E++Q  M  F      ++ GL++         +R               +  L++YLE+  W   R SGTEPK K Y+ + G T +   + L+++K++
  S:    27 MKQDVKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATEGLAQFIEKQGEEAKARGVVVAYDSRHKSPEFAMEVAATLGAHGIKTYVFE--SLRPTPELSFAVRYLHTYSGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVDGVSDELLVEVANVEQLKQNGLLQIIGQDVDDAYLEQLKTIIINKGLVESQGEELKIVFTPLHGTANIPVRRGLEAVGFKNVTIVKEQEQPDPNFSTVKSPNPEEHAAFELAIRYGTEIKADVLIATDPDADRLGVAVRNHDGEYQVLTGNQTGALMLDYMLSQKKEKGILPENGVVLKTIVTSELGRTVANSYGLDTIDTLTGFKFIGEKIKQYEESGQYNFQFGYEESYGYLIKPFCRDKDAVQSVLFACEVAAYYKAQGKTLYDGLLEVFEKHGYFREGLVSLTLKGKDGAEQIQNLMTTFRENCPVEVAGLKVTIAEDYKASLRTKIIGDGTEEIHLPQSNVLKYYLEDGSWFCLRPSGTEPKIKFYFGVQGSTLQHSKEKLESIKND 569
>gi|163942635|ref|YP_001647519.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Bacillus weihenstephanensis KBAB4] >gi|163864832|gb|ABY45891.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Bacillus weihenstephanensis KBAB4] (574 aa)
Score = 694, Expect = 8.3e-71, Identities = 171/526 (32%), Positives = 305/526 (57%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP----ECQTIIDNVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-WNEP-----------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           WL    +  + KE +  +K +E++I+  F Y  L FGT G+R  +G GTN++NV+T ++ ++G+A +   L  +     V+VA+D+R  +  +AM +A TL + GI  ++++   ++ TP++S++VR     + I+ TASHNP  Y G+KVY   GGQ+   EA+E++S +     E    + +V     D L+      + ++Y       +IN  + ++  K+  ++ T  HGT++  +   L+ +G+ ++ +  +Q +PDPNF+   + NPE+ A+F+ +++  EK  A++++  DPD+DRL V VR H  ++  LTGNQ G +   Y+L+ KK + T      V+ T V++     IA+ Y      T TGFK++G ++ ++ +  + +F  G+EE+ G L     RDKD  Q+   A EV      Q KTL D L E+F+++G +  + VS  ++  +  E++Q+ M  F     K++ GL +  +  + E                  +  L++ LE+  W   R SGTEPK K Y+ +  ++ +  +Q L  +K++
  S:    10 WLSYAELDAELKEQLENMKQDEKKIEDSF-YKNLEFGTGGMRGELGAGTNRLNVYTVRKATKGLAMFIEKLGEEAKKRGVVVAYDSRHKSPEFAMEVAATLGAHGITTYVFE--SLRPTPVLSFAVRHLHTASGIVLTASHNPPEYNGYKVYGEDGGQLPPKEADELISYVNAVENELTVEVADVEQLKADGLLHIIGQEVDDAYAAELNNVIINKEMVKEVGKDLKIVFTPLHGTSNISVRRGLEEVGFTDVTVVKEQELPDPNFSTVKSPNPEEHAAFEYAIRDGEKVGADVLIATDPDADRLGVAVRNHDGEFQVLTGNQTGALMLDYLLSQKKENGTLPENGVVLKTIVTSEIGRTIAKAYGLDTVDTLTGFKFIGEKIKQYEESGQYEFQFGYEESYGYLIRPFCRDKDAVQSVLFACEVAAYYKSQGKTLYDGLLEVFKKYGFFREDLVSLTLKGKDGAEQIQKMMATFREDPPKEVAGLTVVAVEDYKESIITTLQDGNKEEIHLPKSNVLKYQLEDGSWFCLRPSGTEPKIKFYFGVQDDSLQNSEQKLLTIKED 569
>gi|160916195|ref|ZP_02078402.1| hypothetical protein EUBDOL_02222 [Eubacterium dolichum DSM 3991] >gi|158431919|gb|EDP10208.1| hypothetical protein EUBDOL_02222 [Eubacterium dolichum DSM 3991] (564 aa)
Score = 694, Expect = 9.1e-71, Identities = 166/521 (31%), Positives = 290/521 (55%)
  Q:    16 VNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           VN + + WL    +   YKE++  M+E+E +  F Y+ + FGTAG+R  +GPGTN+IN+ T ++ + G A+++     +     + + +DNR  +  +AM  AK L +F I  ++++   ++ TP +S++VR       I+ TASHNPK Y G+K+Y+  G Q++   A +++  +   +  +     P  +   LI      + E+Y+E      +N  I +  +  +I T  HGTA+  +  +    GY + +   +QC PDP+F+ +   NPE+  +++L+L+YA++  A+I+L  DPD+DR+ V V+H  ++  LTGNQ G +   Y+ +  K        P + +T V+++  ++IA+KY     +T TGFK++G ++ K+   ++  +V G+EE+ GSL     RDKD  QA  +  E       Q KTLVD L +++ E G +     S  +      + +QE +      + +D+ G  +  +R+ +                    +  L++YL +  W+  R SGTEPK K YY I G + E
  S:     2 VNEVYEKWLHHPNLDPSYKEVLANMSEKEKNDAF-YTTIEFGTAGMRGLLGPGTNRINLHTIRKANAGFAQYICAHGEEAKKRGIAIGYDNRHMSYEFAMDSAKMLATFDITSYVFE--SLRPTPELSFAVRYFHCFGGIMVTASHNPKEYNGYKLYDEKGCQLVPHLAEQVIERVNAVEDELALCANPTAEQEQLIHVIGKEVDEAYYEKVLGIQLNPQIAKD-DVKIIFTPEHGTANIPVKEVYTRAGY-HFVAVEEQCTPDPDFSNTPTPNPEEAGAYELALEYAKREAADIILVCDPDADRMGVGVKHHGEYKLLTGNQSGAVLIEYIFSQLKAKNQMPPNPVMFNTVVTSDLGEKIADKYGVATEKTLTGFKFIGEKVAKYEATNEKQYVFGYEESYGSLIQPFVRDKDAPQACLMLAEAACYYKAQGKTLVDVLYDLYAELGYYEESQKSLTLAGQEGAQRIQEILATLRKTQLQDLGGSAV--VRFEDYKECRVVENGKEFELTGFTKSDVLKYYLADGSWIAIRPSGTEPKCKFYYCIKGSSLE 546
>gi|154685391|ref|YP_001420552.1| YhxB [Bacillus amyloliquefaciens FZB42] >gi|154351242|gb|ABS73321.1| YhxB [Bacillus amyloliquefaciens FZB42] (580 aa)
Score = 693, Expect = 1.1e-70, Identities = 172/525 (32%), Positives = 300/525 (57%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRW----------NEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           W ++ ++ ++ K+L+     NE+ ++ +F Y  L FGT G+R  +GPGTN++N++T ++ S G+A ++  +  +     V +A+D+R  +  +AM  AKTL S GI+ +++ E  ++ TP +S++VR+    A I+ TASHNP  Y G+KVY   G Q+   EA+ +++ +   +      + D        LI    + I + Y E      ++  +  + +  V+ T  HGTA+  +   L+++GY+N+ +  +Q +PDP+F+   + NPE+ A+F+ ++K  E+  A+I++  DPD+DRL + V++ + K+  LTGNQ G +  HY+L+ KK      +   V+ T V++     +A  +      T TGFK++G ++ ++    +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q  +L D L  IF+E+G +     S  ++     E++   +  F N   K + G +I        G R           + P +  L+++LE+  W   R SGTEPK K Y+ + G + +  +Q L AL +
  S:    10 WNQAEQLDSELKKLLADAEGNEQLLEDFF-YKNLEFGTGGMRGEIGPGTNRMNIYTVRKASAGLAAYIAKQGEDAKKRGVAIAYDSRHKSPEFAMEAAKTLASQGIQTYVFDE--LRPTPELSFAVRKLNAYAGIVVTASHNPPEYNGYKVYGDDGAQLPPKEADIVIAEVNAIENELTIQVEDEQSLKEKGLIKIIGEEIDKPYTEELTSISVHPELSAEVDVSVVFTPLHGTANKPVRRGLEALGYKNVTVVKEQELPDPDFSTVKSPNPEEHAAFEYAIKLGEEQNADILVATDPDADRLGIAVKNSEGKYTVLTGNQTGALLLHYLLSEKKKQGALPENGVVMKTIVTSELGRAVASSFGLDTVDTLTGFKFIGEKIKEYEKSGQYTFQFGYEESYGYLIGDFARDKDAIQAALLAVEVCAFYKKQGMSLYDALLSIFKEYGYYREGLKSLTLKGKQGAEQISAILTSFRNDPPKQMAGKQITQAEDYSTGKRTVFADHHEEDIDLPKSNVLKYFLEDGSWFCLRPSGTEPKVKFYFAVKGTSLQDSEQRLAALSE 566
>gi|188588947|ref|YP_001921610.1| phosphomannomutase [Clostridium botulinum E3 str. Alaska E43] >gi|188499228|gb|ACD52364.1| phosphomannomutase [Clostridium botulinum E3 str. Alaska E43] (575 aa)
Score = 693, Expect = 1.1e-70, Identities = 177/526 (33%), Positives = 300/526 (57%)
  Q:    22 AWLESNRISNKYK-ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------------KGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           +W+ S  I+ + K EL    +E+EI+  F Y  L FGT G+R  +G G+N++NV++  + ++G A +L    + P V +A+D+R  +  +A   A TL +  +KV+LY+   ++ TP++S++ RE      I+ TASHNPK Y G+KVY+  GGQ+ D +AN+I++ + + +       ID        L+ Y  + + + Y E      I T +  +K     VI T  HG+ +  +  +LK +GY N+ +  +Q  PD NF  ++  NPE+   F+L+LK A+    +I+ G DPD DR+ VVV+  K ++  LTGNQ G++ THY+L++ K+ +K P    V+ T V+T     IA+ +N ++    TGFK++G ++   K   +  ++ GFEE+ G L  D  RDKD   A+ L  E+     +  K+L D L E++E++G +    VS ++     +E++   +D   N    +I  +++                   +  N P +  L++ LE+D +   R SGTEPK K+Y  I G +    ++ +   K+
  S:     9 SWINSESINEETKNELKAISDEKEIEDRF-YKDLDFGTGGLRGVIGAGSNRMNVYSVSKATQGFANYLNENFNKPAVAIAYDSRNMSKEFAKAAALTLCANNVKVYLYE--SLRPTPVLSFATRELKCSGGIVVTASHNPKQYNGYKVYDEFGGQVTDDKANKIITCVNQIEDFSQIKTIDEKDALEKGLLEYVGEELDKIYMEKVKSLTIRTELVSEKANTLNVIYTPIHGSGNVPVRRVLKELGYTNVEVVKEQEAPDGNFPTASYPNPENPDVFELALKMAKNTNPDIIFGTDPDCDRIGVVVKDSKGEYKVLTGNQTGLLLTHYMLSSLKETNKLPANGVVIKTIVTTEGAKAIADDFNIEILDVLTGFKYIGEKIREFKESGEHTYLFGFEESYGYLAGDFVRDKDAVIASMLICEMCLYYKEHGKSLYDALIELYEKYGYFKETLVSLELAGKEGQEKIASCIDAMRNSNITEINNVKVVKKLDYKLSTDEDIINGTKVAINLPKSNVLKFILEDDSYFVVRPSGTEPKMKVYLSIKGNSVTDAERQISEFKE 564
>gi|187932543|ref|YP_001886650.1| phosphomannomutase [Clostridium botulinum B str. Eklund 17B] >gi|187720696|gb|ACD21917.1| phosphomannomutase [Clostridium botulinum B str. Eklund 17B] (575 aa)
Score = 692, Expect = 1.3e-70, Identities = 176/526 (33%), Positives = 299/526 (56%)
  Q:    22 AWLESNRISNKYK-ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------------KGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           +W+ S  I+ + K EL    +E+EI+  F Y  L FGT G+R  +G G+N++NV++  + ++G A +L    + P V +A+D+R  +  +A   A TL +  +KV+LY+   ++ TP++S++ RE      I+ TASHNPK Y G+KVY+  GGQ+ D +AN+I++ + + +      IID        L+ Y  + + ++Y E      I   +  +K     VI T  HG+ +  +  +LK +GY N+ +  +Q  PD NF  ++  NPE+   F L+L  A+    +I+ G DPD DR+ VVV+  K ++  LTGNQ G++ THY+L++ K+ +K P    V+ T V+T     IA+ +N ++    TGFK++G ++   K   +  ++ GFEE+ G L  D  RDKD   A+ L  E+     +  K+L D L E++E++G +    VS ++     +E++   +D   N    +I  +++                   +  N P +  L++ LE+D +   R SGTEPK K+Y  I G +    ++ +   K+
  S:     9 SWINSESINEETKNELKAICDEKEIEDRF-YKDLEFGTGGLRGVIGAGSNRMNVYSVSKATQGFANYLNENFNKPAVAIAYDSRNMSKEFAKAAALTLCANNVKVYLYE--SLRPTPVLSFATRELKCSGGIVVTASHNPKQYNGYKVYDEFGGQVTDDKANKIITCVNQIEDFSQIKIIDEKDALEKGLLEYVGEELDKTYMEKVKSLTIRKELVSEKANTLNVIYTPIHGSGNVPVRRVLKELGYTNVEVVKEQEAPDGNFPTASYPNPENPDVFKLALNMAQSTNPDIIFGTDPDCDRIGVVVKDSKGEYKVLTGNQTGLLLTHYILSSLKETNKLPENGVVIKTIVTTEGAKAIADDFNIEILDVLTGFKYIGEKIREFKESGEYTYLFGFEESYGYLAGDFVRDKDAVIASMLICEMCLYYKEHGKSLYDALIELYEKYGYFKETLVSLELAGKEGQEKIASCIDAMRNSNITEINNVKVVKKLDYKLSTDEDIINGTKVAINLPKSNVLKFILEDDSYFVVRPSGTEPKMKVYLSIKGNSVTDAEKQISEFKE 564
>gi|167755575|ref|ZP_02427702.1| hypothetical protein CLORAM_01089 [Clostridium ramosum DSM 1402] >gi|167704514|gb|EDS19093.1| hypothetical protein CLORAM_01089 [Clostridium ramosum DSM 1402] (564 aa)
Score = 692, Expect = 1.5e-70, Identities = 166/518 (32%), Positives = 296/518 (57%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPEC------QTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE----------------WYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           N N   + W+    +    K  +  MNE+E +  F Y  L FGTAG+R  +G GTN++N++T ++ + G A+++L   +     V + +DNR  +  +A+  AK L ++GIK ++++   ++ TP +SY+VR       I+ TASHNPK Y G+KVY+ TG Q++    +++V+ + E       + I D    P    I++  + + E+Y++      IN  +  +K+F ++ +  HGT++  +   L  +GY N+I    QC PDP+F+ + + NPE   S+DL++K A++  A++++  DPD DRL VV +H  ++  ++GNQ   ++  Y+L+  KK  K P    + +T V+++  + +++ Y  +V +T TGFK++G+++ K+    + +F+ G+EE+ G +  D  RDKD  QA  +A E       Q K L+D L+E++ + G +    ++         + ++E MD         I G ++  +   + +Q +E                +YLE+  W+  R SGTEPK K Y+ I G
  S:     2 NYNEEYQRWVNCENLDPSLKAELASMNEKEKEDAF-YMNLEFGTAGMRGILGAGTNRMNIYTIRKANVGFAKYVLGLPEGKERGVAIGYDNRHMSYKFAIESAKVLATYGIKSYIFE--SLRPTPELSYAVRYLKCAGGIMITASHNPKEYNGYKVYDDTGCQLIPEWGDQVVAYVNEVKDELAVEVISDEEAYP---YITWIGEEVDEAYYQEVMAIEINPGM-DKKDFKIVFSPQHGTSNLPVRNCLSRLGY-NVIPVLAQCAPDPDFSNTKSPNPEVDCSYDLAIKKAKEVDADVVVICDPDGDRLGVVAKHDGEYVLMSGNQSAAVYLEYILSELKKQGKLPANAVMYNTIVTSDLGELVSKSYGVEVEKTLTGFKFIGDKIRKYEKTKEKEFIFGYEESYGCVVKDFVRDKDAVQAVVMAAEAGNFYKHQGKDLIDVLNELYAKHGTFKESQIALSKAGAEGAKRIKEIMDNLRKDAPSVIGGYKVLAVEDYQSSQRIENETTTVIDLPKSNVLKYYLEDGSWIAARPSGTEPKCKFYFSIKG 541
>gi|168333995|ref|ZP_02692219.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Epulopiscium sp. 'N.t. morphotype B'] (575 aa)
Score = 689, Expect = 2.9e-70, Identities = 176/534 (32%), Positives = 302/534 (56%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL---DSEANEIVSSMPECQTIIDNVYTPNM--DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           N   L K WL      +  K  +  ++ NE+EI+  F Y++L FGTAG+R  +G GTN++N +  Q+ ++G+A +L  +   NP V++A+D+R  +D +AM  A  L + GIK +L++   ++A P +S+++R    DA ++ TASHNP  Y G+KVY + G Q++   D    + V+S+ +  TI     T      L+    + I + Y E     +IN ++  +    F ++ T  HGT +  +   LK +G++N+ + A+Q  PD NF    + NPED  +F L+++ A+K +A+I++G DPD+DR+ V++R  K ++  LTGN +G + T Y+L  +K          V+ T V+T  I  I E Y + V    TGFK++G ++   +  ++  +V GFEE+ G+L     RDKD    + LA E+         TL + L  ++++FG +  +  S+ ++ +    +++  M+   N +   I G +I   R  +  Q                  + + L N+ W+  R SGTEPK K Y  + G++ E  +  L+A+KD+
  S:     2 NYKDLYKKWLTDECFDDATKAELKSIENNEKEIEDRF-YTELEFGTAGLRGVIGAGTNRMNKYIVQKATQGLANFLKGQGLQNPKVVIAYDSRNKSDTFAMDTALVLAANGIKAYLFE--SLRAVPQLSFALRTLKADAGVVITASHNPPEYNGYKVYGNDGAQVIAPFDKMIIDQVNSITDFSTIKTTTETEAKADGLLEIIGENIDKLYIEQVKSQVINQDVINKVADEFKIVYTPLHGTGNLPVRRALKEVGFKNVYVVAEQEKPDGNFPTVKSPNPEDPNAFKLAIELAKKEQADIIIGTDPDADRVGVLIRDEKGEYIVLTGNMIGTMLTDYILRGRKENGSLPTNGVVIKTIVTTEMIRPICEFYGSDVIEVLTGFKFIGEQIKNFETTNQHSYVFGFEESYGALAGTYARDKDAVVTSLLACEMAAYYKLNGMTLYEALVALYQKFGYYREDVQSFTLKGIEGIGKIKNIMETLRNQQIDTIGGYQILAKRDYKTQQRVTKDGTTSKIELPVSDVIYFELSNNAWICVRPSGTEPKIKFYIGVKGQSLEDANNKLQAIKDD 566
>gi|110004297|emb|CAK98635.1| putative phosphomannomutase protein [Spiroplasma citri] (558 aa)
Score = 688, Expect = 3.8e-70, Identities = 173/512 (33%), Positives = 294/512 (57%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT----PNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL-EIKGIR--------WNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFE 550
           +M+E ++   FS   L FGTAG+R  +GPGT ++N++T ++ +    ++L    S        +++ HDNR  +  +A  +A    S  IK  L+  N ++ TP++SY++R+    A +I TASHN + Y G+K+Y+H G Q L    + I  +  +   I + V+T    PN  LI+Y    + ++Y           N  +++N  ++ +  HGT+    P + +  GY+ + +  +Q   DPNFT++ N NPE    +DL+LKYA+K  A++++  DPD+DRL + V+ K N+++ +TGN+   +   Y+ ++    K   K   + +TFV+ N  D++AE Y  +V +T TGFKW+G++M+K   K + F+ GFEEA G +  DI RDKDG Q++ +  E     ++Q KTL D L E + +FG +  +TV+   + ++ K+ +   + K   ++ + I  L +IK I+        +  P Q  L++Y  +  W   R SGTEPK K Y+    +T E     ++A+  E E
  S:    26 QMSEADLIAAFS-DDLEFGTAGLRGLLGPGTGKMNLYTIRRATLAFMQYLKTIYSETDLKTKGIVIGHDNRYFSAEFAQAVANIFASNNIKAILFANNDLRPTPMVSYTIRKIKAAAGVIITASHNSREYNGYKIYDHNGSQFLPVATDIIGENYLK---IKEEVFTLTLNPNSTLITYVPKEVEDNYVSDVKAMQFYPN--QKRNIKIVFSNLHGTSKEWTPRIFEECGYD-VTIVEEQFDNDPNFTFAPNPNPELTECYDLALKYAKKVNADVIILNDPDADRLGIGVKIKDNEYYLMTGNETAPVLIEYLFSHYQRQKTLPKNGVMYNTFVTGNLSDKVAEGYGVQVIKTLTGFKWIGDQMSKASAKGLQFLFGFEEAYGYVLKDITRDKDGIQSSLILAEACWYYHNQGKTLYDVLVEQYNKFGYFYCKTVNLVRDGIDGKKVINNMLKK---LRQETITSLNQIKCIKKEDYLNGLYEMPGQDLLKFYFADGSWFAVRASGTEPKIKFYFVCVDKTNEEAKIKMEAMYQELE 552
>gi|153955794|ref|YP_001396559.1| Pgm2 [Clostridium kluyveri DSM 555] >gi|146348652|gb|EDK35188.1| Pgm2 [Clostridium kluyveri DSM 555] (575 aa)
Score = 688, Expect = 4.0e-70, Identities = 175/524 (33%), Positives = 300/524 (57%)
  Q:    23 WLESNRISNKYK-ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI------------------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           WL S+ + ++ K EL    +E+EI+  F Y  L FGT G+R  +G GTN++N+ T  + +EG++R+L+    SN +V +A+D R+ ++ +A   A  L + GI V L+    +  TP++SY+VRE    A I+ TASHNPKNY G+KVY   GGQ+ D  AN+I+S +           +D     N  +++   + I + Y E   + +I  ++     KN  VI T  HGT +  +   LK +GYEN+ +  +Q  PD NF  +   NPED   F L+L+ A++ + +I+ G DPD DR+ ++V++  N +  LTGNQ+GI+ T Y+L++ K+ ++ P    ++ T V+T  +  IA+ YN  +    TGFK++G ++ +     D  F+ GFEE+ G L  D  RDKD   A+ L  E+      +   + + L  ++ ++G +    +S +++     EEM   ++   +   + + G++I                  + +     +  L++ +E+  W   R SGTEPK K+Y+ + G + +  ++ ++ LK
  S:     9 WLNSSYLDDEEKLELKNIKDEKEIEDRF-YKDLEFGTGGLRGIIGVGTNRLNIHTIGKTTEGLSRYLIEAYGSNISVAIAYDCRIMSEEFAKAAASNLCANGIIVNLF--GTLHPTPMLSYAVRELKCKAGIVITASHNPKNYNGYKVYGEDGGQVTDKIANKILSYINNVNDFSEIKRMDIKEAENRKILNIIGEDIDKPYIEKVKQMVIRKDMVSSCGKNLNVIYTPLHGTGNIPVRRALKELGYENVFIVKEQEYPDGNFPTAVCPNPEDPKVFQLALELAKELKPDIIFGTDPDCDRIGIIVKYDDNNYRTLTGNQVGILLTEYILSSLKELNRLPENGVIIKTIVTTEMVRDIAKDYNVGLIDVLTGFKYIGEKIKEFEQWQDKKFIFGFEESYGYLAGDFVRDKDAVIASTLICEMALYYKMKGINIYEALINLYNKYGFYKENIISIELKGKEGCEEMDTILEYLRHSMKRTLGGVKIVKKLDYKLSIEKDLVNITENVIQLPKSNVLKFVMEDKSWFVVRPSGTEPKIKLYFSVIGNSFKDSEEKMEILK 563
>gi|15613669|ref|NP_241972.1| phosphomannomutase [Bacillus halodurans C-125] >gi|10173721|dbj|BAB04825.1| phosphomannomutase [Bacillus halodurans C-125] (578 aa)
Score = 686, Expect = 7.0e-70, Identities = 172/515 (33%), Positives = 295/515 (57%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN---PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE--------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           +E++++  F Y  L FGT G+R  +GPG N++N +T ++ SEG AR+LL +  +     V++A+D+R  +  +A   A T+   GIK +L++E  ++ TP +S++VR+ G    I+ TASHNP  Y GFKVY   G Q+    AN +V  + E   I D +  P  D         +    + +  +Y EA    ++N  +     K+  ++ T  HGTA+  +  +L+++G+EN+ +  +Q +PDP F+     NPE+ A+F L+++Y +K  A++++  DPD+DR+ V V+++  ++  LTGNQ G +  HY+L+ KK           + T V++ +   IAE +   +  T TGFK++G ++ ++    +  F+ G+EE+ G L  D  RDKD  QA  LA E+      +  TL D L E+F+ +G +     S  ++     E++Q  + +F       V ++ ++ +E              ++ I     +  L++ LE+  W   R SGTEPK KIYY +  E  E  +  L A+K + E ++ S
  S:    30 DEQQLEDCF-YKNLEFGTGGMRGEIGPGPNRMNTYTIRKASEGFARYLLEQGEHVKAQGVVIAYDSRHKSPEFAREAALTIGKHGIKAYLFEE--LRPTPELSFAVRKLGAAGGIVITASHNPPEYNGFKVYGSDGCQLPPEPANRLVKFVNE---IEDELVIPVGDERELKENGTLEMIGEEVDVAYHEALKTIIVNPELLEASAKDVRIVFTPLHGTANLPVRRVLEAVGFENVTVVKEQELPDPQFSTVKAPNPEEHAAFALAIEYGKKTEADVLIATDPDADRVGVAVQNQAGEYIVLTGNQTGGLMLHYLLSQKKEKGQLPVNGIALKTIVTSEFGRAIAEDFGIPMVDTLTGFKFIGEKIKEYEQSGEHQFLFGYEESYGYLIGDFVRDKDAVQACLLAAEMTAYYKSRGMTLYDGLLELFDRYGYYREGLTSITLKGKVGVEKIQHVLSQFRQSPPKQVNDQQVVVIEDYQTKEKVSVKERTVEAITL-PTSNVLKYMLEDGSWFCLRPSGTEPKLKIYYGVKTEALEKSEAALDAVKRDVEEIVHS 576
>gi|150015869|ref|YP_001308123.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Clostridium beijerinckii NCIMB 8052] >gi|149902334|gb|ABR33167.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Clostridium beijerinckii NCIMB 8052] (575 aa)
Score = 686, Expect = 7.7e-70, Identities = 175/533 (32%), Positives = 310/533 (58%)
  Q:    23 WLESNRISNKYK-ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWNE-----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           W+ S+ I+ + K EL    +E+EI+  F Y  L FGT G+R  +G G+N++N++T  Q ++G A +L +   +P+V +A+D+R  +  +A   A  L +  IKV+LY+   ++ TP++S++VRE   +  I+ TASHNPK Y G+KVY+  GGQ+ D +A  I++S+           ID     +  L+ Y  + + + Y+E      I T++ ++K  N  VI T  HG+ +  +  +LK +GY N+ +  +Q  PD NF  ++  NPE+   F+L+LK A+    +I+ G DPD DR+ +VV+    ++  LTGNQ G++ T+Y+L++ K+ +K P    V+ T V+T     IAE ++ ++    TGFK++G ++ +  D  D  ++ GFEE+ G L  +  RDKD   AA L  E+     +Q K+L D L +++E++G +    VS +++    +E++   ++   N    ++ G++I         +  N             +  L++ LE+  +   R SGTEPK K+Y  +   + +  ++ +   K++   ++ S
  S:    10 WINSDFINEETKNELKSISDEKEIEDRF-YQDLDFGTGGLRGVIGAGSNRMNIYTVAQSTQGFANYLNDNFKDPSVAIAYDSRNMSKEFAKAAALNLCANNIKVYLYE--SLRPTPVLSFTVRELKCNGGIVITASHNPKIYNGYKVYDEFGGQVTDEKAKMIINSVKAVDDFSKIESIDENVALDKGLLKYIGEDVDKVYYEKVKGLTIRTDLVKEKASNLNVIYTPIHGSGNVPVRTVLKELGYSNVKVVKEQEAPDGNFPTASYPNPENPDVFELALKMAKTENPDIIFGTDPDCDRIGLVVKDSTGEYKVLTGNQTGLLLTNYILSSMKETNKLPQNGVVIKTIVTTEGARSIAEDFDIELMDVLTGFKYIGEKIREFEDAGDRNYIFGFEESYGYLAGNFVRDKDAVIAAMLVCEMCLYYKEQGKSLYDALIDLYEKYGYFKETLVSLELKGKEGQEKIANCIEALRNNPASEVNGVKIVTRLDYKLSVEENTVNNTKAPIDLPKSNVLKYILEDGSYFVVRPSGTEPKMKVYLAVKSNSLDNAEKDIATFKEKVMEIINS 572
>gi|160891818|ref|ZP_02072821.1| hypothetical protein BACUNI_04275 [Bacteroides uniformis ATCC 8492] >gi|156858296|gb|EDO51727.1| hypothetical protein BACUNI_04275 [Bacteroides uniformis ATCC 8492] (580 aa)
Score = 684, Expect = 1.1e-69, Identities = 171/491 (34%), Positives = 269/491 (54%)
  Q:    43 EEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK----KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILG-----------LEIKGIRWN-------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           E ID +  Y  L FGT G+R  MG GTN++N++T    ++G++ +L NK    K + +V+V HD R N+D +A + A   ++ GIKV+L+  + ++ TP +S+++R  G  + I  TASHNP+ Y G+K Y   G Q+L      I+  + +  T+ D  +  N DLI      + + Y +  +   I+   I RQK+  ++ T  HG     +P  LK  G+ENI    +Q V D NF    + NPE+  +  +++  A+K  A+I++  DPD+DR+ +  +  K +W  + GNQ  +IF +Y++ N+    K     F+V T V+T  I  +A+K   ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A +L  E+     DQ KTL D L EI+ E+G     TV+      +  EE++  MD F     K+I G           LE+   + N       E +  L+++  +   +  R SGTEPK K Y E+ GE
  S:    41 ELIDSF--YKDLEFGTGGLRGIMGAGTNRMNIYTVGAATQGLSNYL-NKCFAGKKDISVVVGHDCRNNSDKFAKISADIFSANGIKVYLF--DDLRPTPEVSFAIRHFGCQSGINITASHNPREYNGYKAYWDDGAQVLAPHDTAIIDEVNKV-TVADIKFNGNKDLIQIIGKEVDKVYLDMVHSISIDPEVIRRQKDLSIVYTPLHGAGRVLIPDSLKEWGFENINCVPEQMVKDGNFPTVVSPNPENAEALSMAIALAKKIDADIVMASDPDADRVGMACKDDKGEWVLINGNQTCLIFLYYIIKNRIAMGKMQPNDFIVKTIVTTELIKAVADKNKIEMRDCYTGFKWIAREIRLSEGKQQYIGGGEESYGFLAEDFVRDKDAVSACSLLAEICAWAKDQGKTLYDVLMEIYVEYGFSKETTVNVVKPGKSGAEEIKAMMDNFRANPPKEIGGSAVSLIKDYKTLELTDAQGNVSKLDMPETSNVLQYFTVDGTKISVRPSGTEPKIKFYIEVKGE 553
>gi|126645213|ref|ZP_01717757.1| phosphoglucomutase phosphomannomutase [Algoriphagus sp. PR1] >gi|126578624|gb|EAZ82788.1| phosphoglucomutase phosphomannomutase [Algoriphagus sp. PR1] (576 aa)
Score = 684, Expect = 1.2e-69, Identities = 177/512 (34%), Positives = 279/512 (54%)
  Q:    19 LSKA--WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFE-ASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILG------LEIKGIRWNEPA------------QALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           LSKA  WL+ N      N+ K+LI +   E +D +  Y  L FGT G+R  MG GTN++NV+T    ++G+A +LL      +  V + HD+R+N   +A   A  LT+ GIKV  +KE  ++ TP++S++VR  G  + ++ TASHNPK Y G+K Y   G Q++      I+  + +  +     +    +L SY ++     Y +      L    I +QK+ P++ +  HG +   +P  +K+ G++NI +  +Q  PD  F      NPE+  +  LS+K  ++  A ++L  DPD DR A  V +++ ++  L GNQ G + T+Y+L+      K D   F+V+T V+T  IDRI E +  K F   TGFK +   + +   K  FV G EE+ G L  D  RDKDG  A A+  EV      Q KT+ D L EI+E+FG +    +S   +  +  E++Q  M  F +   K++ G      +++K     E A              +++YL +   +  R SGTEPK K Y+ +
  S:     9 LSKAQSWLDGNIDEESKNEIKKLIDENPSELLDSF--YRDLEFGTGGLRGLMGVGTNRMNVYTVGMATQGLANYLLKCFPGEDIKVAITHDSRINNTLFATTTANVLTANGIKVLYFKE--MRPTPMLSFAVRHYGCKSGVMITASHNPKEYNGYKAYWEDGAQVVAPHDTNIIKEVQKITSFDMVNWNKKDELFSYIEEDFDAIYLDLVKGLSLAPEEIQKQKSMPIVFSPIHGASGKMVPAAIKAFGFDNIHVVKEQAEPDGTFPTVVYPNPEEAEALTLSVKLGKEVGAELILACDPDGDRYAAAVPNESGEFELLNGNQTGSLLTYYLLSRWKEAGKLDGKQFMVNTIVTTELIDRICEGFGVKCFSVLTGFKNIAAIILELEGKEKFVGGGEESYGYLVGDFVRDKDGVSACAMVAEVIAYYKSQGKTVFDVLAEIYEKFGFYKENLISVTKKGKDGAEQIQALMTNFRDNPPKEMNGQKVEKIVDVKASTITEVATGKVEKLDMDKSNVMQFYLADGSKISARPSGTEPKIKYYFSV 547
>gi|110802226|ref|YP_699155.1| phosphomannomutase [Clostridium perfringens SM101] >gi|110682727|gb|ABG86097.1| phosphomannomutase [Clostridium perfringens SM101] (575 aa)
Score = 682, Expect = 2.0e-69, Identities = 176/514 (34%), Positives = 301/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+            E+  +   E       +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGVIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPKNGVVIKTIVTTESVRKMTEEYGVTLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMNGVKVITSFDYKLSKEVNNLTGEEKEVKLPKSNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|169343596|ref|ZP_02864595.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens C str. JGS1495] >gi|169298156|gb|EDS80246.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens C str. JGS1495] (575 aa)
Score = 682, Expect = 2.0e-69, Identities = 176/514 (34%), Positives = 301/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+            E+  +   E       +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGVIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPKNGAVIKTIVTTESVRKMTEEYGVTLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMKGVKVVTSFDYKLSKEVNNLTGEEKEVKLPKSNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|168215501|ref|ZP_02641126.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens NCTC 8239] >gi|182382028|gb|EDT79507.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens NCTC 8239] (575 aa)
Score = 680, Expect = 3.2e-69, Identities = 176/514 (34%), Positives = 301/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+            E+  +   E       +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGVIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPKNGAVIKTIVTTESVRKMTEEYGVTLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMNGVKVITSFDYKLSKEVNNLTGEEKEIKLPKSNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|168206074|ref|ZP_02632079.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens E str. JGS1987] >gi|170662439|gb|EDT15122.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens E str. JGS1987] (575 aa)
Score = 680, Expect = 3.2e-69, Identities = 176/514 (34%), Positives = 301/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+            E+  +   E       +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGVIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPENGAVIKTIVTTESVRKMTEEYGVTLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMNGVKVITSFDYKLSKEVNNLTGEEKEIKLPKSNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|18310855|ref|NP_562789.1| phosphomannomutase [Clostridium perfringens str. 13] >gi|168214906|ref|ZP_02640531.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens CPE str. F4969] >gi|18145537|dbj|BAB81579.1| probable phosphomannomutase [Clostridium perfringens str. 13] >gi|170713659|gb|EDT25841.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens CPE str. F4969] (575 aa)
Score = 680, Expect = 3.8e-69, Identities = 176/514 (34%), Positives = 301/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+            E+  +   E       +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGVIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPENGAVIKTIVTTESVRKMTEEYGVTLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMNGVKVITSFDYKLSKELNNLTGEEKEIKLPKSNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|182417155|ref|ZP_02948526.1| phosphomannomutase [Clostridium butyricum 5521] >gi|182378997|gb|EDT76503.1| phosphomannomutase [Clostridium butyricum 5521] (575 aa)
Score = 679, Expect = 3.9e-69, Identities = 177/514 (34%), Positives = 299/514 (58%)
  Q:    23 WLESNRISNKYK-ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDI-LGLEIKGIRWNEP------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           W+ S+ I+ + K EL    +E+EI+  F Y  L FGT G+R  +G G+N++N++T  + ++G A +L     NP+V +A+D+R  +  +A   A  L +  IKV+LY+   ++ TP++S++VRE      I+ TASHNPK Y G+KVY+  GGQ+ D +AN I++ + +         ID        L+ Y  + +   Y+E      I T++  +K     VI T  HG+ +  +  +L  +GY N+ +  +Q +PD NF  ++  NPE+   F+L+LK A+    +I+ G DPD DR+ VVV+  + ++  LTGNQ G++ THYVL++ K+ +K P    V+ T V+T     IA+ ++ ++    TGFK++G ++ +  D  +  ++ GFEE+ G L  D  RDKD   AA L  E+     +  K+L + L E++E++G +  + VS +++    +E++   ++   N           VKN D  L +E   +   +       +  L++ L +D +   R SGTEPK K+Y  + G + E
  S:    10 WINSDIINEETKNELRNISDEKEIEDRF-YQDLDFGTGGLRGVIGAGSNRMNIYTVAKATQGFANYLNENFENPSVAIAYDSRNMSKEFAESAALNLCANNIKVYLYE--SLRPTPVLSFTVRELKCSGGIVVTASHNPKIYNGYKVYDEFGGQVTDEKANTIINCVNDVDDFSKIKTIDKNDAVEKGLLKYIGEDLDNIYYEKVKGLTIRTDLVDKKASELNVIYTPIHGSGNVPVRSVLNQLGYSNVKVVKEQELPDGNFPTASYPNPENPDVFELALKMAQSENPDIIFGTDPDCDRIGVVVKDSQGEYKVLTGNQTGLLLTHYVLSSLKETNKLPNNGVVIKTIVTTEGARAIAKDFDVELMDVLTGFKYIGEKIREFEDAGNKTYLFGFEESYGYLAGDFVRDKDAVIAAMLVCEMALYYKEHGKSLYEALIELYEKYGYFKEQLVSIELKGKEGQEKIASCIEALRNDPIAEVDGIKVVKNFDYKLSVETDAVNNVKSDIDLPKSNVLKYILSDDSYFVVRPSGTEPKMKVYLAVKGNSLE 553
>gi|168211679|ref|ZP_02637304.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens B str. ATCC 3626] >gi|170710369|gb|EDT22551.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens B str. ATCC 3626] (575 aa)
Score = 679, Expect = 4.4e-69, Identities = 176/514 (34%), Positives = 301/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+            E+  +   E       +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGVIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPKNGAVIKTIVTTESVRKMTEEYGITLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMNGVKVITSFDYKLSKEVNNLTGEEKEIKLPKSNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|110800100|ref|YP_696555.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens ATCC 13124] >gi|110674747|gb|ABG83734.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium perfringens ATCC 13124] (575 aa)
Score = 677, Expect = 6.9e-69, Identities = 176/514 (34%), Positives = 303/514 (58%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------------------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S+ IS + K  +  + E+ EI+  F Y +L FGT G+R  +G GTN++N++T  + ++G A +L  N     +V +A+D+R  +  +A   A TL + GIKV L++   ++ TP++S++VRE      I+ TASHNPK Y G+KVY   G Q+ D+ A  ++  + +  T   N+ T + +      L+ Y  + I + Y +      I  ++ ++  K+  +I T  HG+ +  +  +LK +GYEN+ +  +Q +PD NF  +   NPED   F L+L  A++ + +I+ G DPD DR+ VVV+  N ++  L+GNQ G++ T+Y+L++ K+ +K P    V+ T V+T  + ++ E+Y   +  T TGFK++G ++ +  +    +++ GFEE+ G L     RDKD   A+ L  E+     +Q KTL D L E++ ++G +    VS ++     +E++ + +D   N   K++ G+++                   K I+  + +  L++ LE+D W   R SGTEPK KIY  + G + E
  S:     9 WLNSDIISEEIKAELRDVKEDKEIEDRF-YKELDFGTGGLRGIIGAGTNRMNIYTVGKATQGFADYLNDNYAGEKSVAIAYDSRNMSKEFAKAAALTLCANGIKVNLFE--SLRPTPMLSFAVRELNCKGGIVITASHNPKQYNGYKVYGDDGCQLTDAPAKAVIGYVNKV-TDYANIKTMSEEKALEEGLLVYIGEEIDKKYIDDLKTLTIREDLVKKHAKDLKIIYTPIHGSGNVPVRRILKELGYENVFVVKEQEMPDGNFPTAPYPNPEDPKVFKLALDMAKEIQPDIIFGTDPDCDRIGVVVKDNNGEYQVLSGNQTGMLLTNYILSSLKEMNKLPENGAVIKTIVTTESVRKMTEEYGVTLIDTLTGFKYIGEKIREFEESGSNEYLFGFEESYGYLAGTFARDKDAVVASMLIAEMTLYYKEQGKTLYDGLIELYNKYGYFKESLVSIELAGKEGQEQIAKCIDGLRNDALKEMNGVKVITSFDYKLSKEVNNLTDEEKEIKLPK-SNVLKYVLEDDSWFVVRPSGTEPKMKIYLSVKGSSLE 553
>gi|189466990|ref|ZP_03015775.1| hypothetical protein BACINT_03372 [Bacteroides intestinalis DSM 17393] >gi|189435254|gb|EDV04239.1| hypothetical protein BACINT_03372 [Bacteroides intestinalis DSM 17393] (580 aa)
Score = 677, Expect = 7.7e-69, Identities = 162/483 (33%), Positives = 262/483 (54%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           Y  L FGT G+R  MG GTN++N++T    ++G++ +L      K   +V+V +D R N+D +A + A   ++ GIKV+L+  + ++ TP +S+++R  G  + I  TASHNP+ Y G+K Y   G Q+L      I+  + +  T+ D  +  N DLI      + + Y +  +   I+   I RQK+  ++ T  HG     +P  LK  G+EN+    +Q V D NF    + NPE+  +  +++  A+K  A+I++  DPD+DR+ +  +  K +W  + GNQ  +IF +Y++ N+    K     F+V T V+T  I  +A+K   ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A +L  E+     DQ KTL D L +I+ E+G     TV+      +  +E++  MD F     K+I G  +K I+                    E +  L+++ E+   +  R SGTEPK K Y E+ GE
  S:    47 YKDLEFGTGGLRGIMGAGTNRMNIYTVGAATQGLSNYLNKCFKDKEQISVVVGYDCRNNSDKFAQISADIFSANGIKVYLF--DDLRPTPEVSFAIRHFGCQSGINITASHNPREYNGYKAYWDDGAQVLAPHDTAIIDEVNKV-TVADIKFKGNKDLIQTIGADVDKIYLDMVHSISIDPEVIKRQKDLSIVYTPLHGAGRVLIPASLKEWGFENVNCVPEQMVKDGNFPTVVSPNPENAEALSMAIALAKKIDADIVMASDPDADRVGMACKDDKGEWVLINGNQTCLIFLYYIIKNRIAMGKMQPNDFIVKTIVTTELIKAVADKNKIEMRDCYTGFKWIAREIRLSEGKQQYIGGGEESYGFLAEDFVRDKDAVSACSLLAEICAWAKDQGKTLYDVLMDIYVEYGFSKETTVNVVKPGKSGADEIKAIMDNFRANPPKEIGGSPVKLIKDYKTLKITDAEGKVSELDMPEASNVLQYFTEDGTKISVRPSGTEPKIKFYIEVKGE 553
>gi|153939110|ref|YP_001392393.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum F str. Langeland] >gi|152935006|gb|ABS40504.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum F str. Langeland] (575 aa)
Score = 677, Expect = 8.0e-69, Identities = 182/532 (34%), Positives = 297/532 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQE-----KMDKFANVKNKDIL-------GLEIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+ S  +  + KE +  +++E+  K   Y  LSFGT GIR   G GTN+IN +T  + +EG++ +L++  K+   +V +A+D R ++  +A   ++ L S GI+V+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G QI D EA EI   + E     C   +D       +L  +    I   YF       +  +I +  +KNF ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F  SLK AE    ++++  DPD DR+ ++VR H  ++  L GN++G+I T+Y+L++    KK  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  R+KDG  ++AL  E+      Q K L D L E+++++G +  + +S + +    K +++      ++D    + N++IL       GL+I   +  E       +  L+++L N      R SGTEPK KIY      T E  +  +  L+   + M+
  S:     9 SWMNSCFLEEREKEQLKNIDDEQEIKDRFYKDLSFGTGGIRGVAGLGTNRINKYTIAKATEGLSNYLIHNFKEKGISVAIAYDCRNDSLDFAKKASEVLCSHGIRVYIFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQITDKEAQEIAEYIKEVEDLGCIKYMDINNAKGKNLYEFVPIEILNKYFYNVKNLTLRKDIVKNYEKNFKILYTPLHGTGNVPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDNKAFYASLKEAENINPDVIIATDPDCDRVGIMVRDHSTRYVALNGNELGVILTNYILSSLEEEKKIPENSVLLKTIVTTDMVKNICKDYGVKVEEVLTGFKYIGEKIEEFKKNGQNKFIFGFEESYGYLFGDFVREKDGIISSALICEMALYYKSQNKNLFDVLTELYDKYGYYREKLISMEFKGEEGKNKIENIINNLRIDDSKTIFNEEILLKEDYKTGLKINMNKKKEYINKLPKSNVLKFHLNNGTNFVIRPSGTEPKIKIYLSSVHTTAEGAEMKINKLEKNIKNMI 572
>gi|56419105|ref|YP_146423.1| phosphomannomutase [Geobacillus kaustophilus HTA426] >gi|56378947|dbj|BAD74855.1| phosphomannomutase [Geobacillus kaustophilus HTA426] (585 aa)
Score = 675, Expect = 1.3e-68, Identities = 167/525 (31%), Positives = 293/525 (55%)
  Q:    23 WLESNRISNKYKELI-LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-------RWNE-----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           WL   ++  + K L+  + N+E   +   Y  L FGT G+R  +GPGTN++N++T ++ SEG+AR++    ++     V++A+D+R  +  +AM  AKTL + GI+ +++ E  ++ TP +S++VR     A I+ TASHNP  Y G+KVY   GGQ+  + A++++  + E +      + D        LI      + ++Y  A     I+  + R+    ++ T  HGT++  +   L  +GY+N+ +  +Q +PDPNF+  A+ NPE+ A+F ++++  ++  A++++  DPD+DR+ V V + K  +  LTGNQ G +  HY+L+ +K   T      V+ T V++ +   IA+ +  +   T TGFK++G +M ++    +  F  G+EE+ G L  D  RDKD  QAA LA EV      Q  +L + L ++F+++G +     S  ++     E +   +  F      +  G ++  I       R N             +  L++ LE+  W   R SGTEPK K Y+ + G + E  ++ L  L +
  S:    10 WLREPQLDPELKRLLEQRRNDERWLEDCFYKNLEFGTGGMRGEIGPGTNRMNMYTVRKASEGLARYIQSFGDEAKQRGVVIAYDSRHKSPEFAMEAAKTLATNGIQTYVFDE--LRPTPELSFAVRYLRAFAGIVITASHNPPEYNGYKVYGEDGGQLPPAVADQVIRYVNEVENELAIHVEDEETLREKGLIRIIGSEVDDAYIHAVKTISIHPELAREAAINIVFTPLHGTSNKPVRRALAELGYQNVFVVKEQELPDPNFSTVASPNPEEHAAFAMAMELGKQVNADLLIATDPDADRMGVAVTNDKGNYVVLTGNQTGGLLLHYLLSQRKAQGTLPENGVVLKTIVTSEFGRAIAQSFGLETVDTLTGFKFIGEKMKEYEQTGQYAFQFGYEESYGYLIGDFVRDKDAVQAAVLAAEVCAFYKKQGLSLYEALLQLFDQYGYYREGQRSLTLKGKEGAEAIAAILASFRQQPPVEAAGKKVTVIEDYKTKERTNTLTGEKTAIDLPTSNVLKYILEDGSWFCLRPSGTEPKMKAYFGVKGTSLEDSEERLARLTE 566
>gi|167762305|ref|ZP_02434432.1| hypothetical protein BACSTE_00658 [Bacteroides stercoris ATCC 43183] >gi|167699948|gb|EDS16527.1| hypothetical protein BACSTE_00658 [Bacteroides stercoris ATCC 43183] (580 aa)
Score = 672, Expect = 3.1e-68, Identities = 159/483 (32%), Positives = 262/483 (54%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK------------------GIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           Y  L FGT G+R  MG G+N++N++T    ++G+A +L      K   +V+V HD R N+  +A + A   ++ GIKV+L+++  ++ TP +S+++R  G  + I  TASHNPK Y G+K Y   G Q+L      I+  + +  T+ D  +  N DLI    + + + Y +  +   I+   I RQK+  ++ T  HG     +P  LK  G+EN+    +Q V   +F    + NPE+  +  ++++ A+K  A+I++  DPD+DR+ +  +  K +W  + GNQ  ++F +Y++ N+    K   T F+V T V+T  I  +A+K   ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A +L  E+     DQ KTL D L +I+ E+G     TV+      +  +E++  MD F     K+I G  +                    +   E +  L+++ E+   +  R SGTEPK K Y E+ GE
  S:    47 YKDLEFGTGGLRGIMGAGSNRMNIYTVGAATQGLANYLNKCFKDKGQISVVVGHDCRNNSRKFAEISADIFSANGIKVYLFED--LRPTPEVSFAIRHLGCQSGINLTASHNPKEYNGYKAYWDDGAQVLAPHDTAIIDEVNKV-TVEDIKFKGNKDLIQIIGEDVDKVYLDKVHTLSIDPEVIKRQKDLSIVYTPLHGAGRTLIPASLKEWGFENVHCVPEQMVKSGDFPTVVSPNPENAEALSMAIELAKKIDADIVMASDPDADRVGMACKDDKGEWVLINGNQTCLLFLYYIIKNRIATGKMQPTDFIVKTIVTTELIKAVADKNKIEMLDCYTGFKWIAREIRLREGKQQYIGGGEESYGFLAEDFVRDKDAVSACSLLAEICAWAKDQGKTLYDILMDIYVEYGFSKETTVNVVKPGKSGADEIKAMMDNFRANPPKEIGGSAVSLTKDYKTLKATDAKGTVTALDMPETSNVLQYFTEDGTKISVRPSGTEPKIKFYIEVKGE 553
>gi|168187379|ref|ZP_02622014.1| phosphoglucomutase [Clostridium botulinum C str. Eklund] >gi|169294731|gb|EDS76864.1| phosphoglucomutase [Clostridium botulinum C str. Eklund] (579 aa)
Score = 672, Expect = 3.3e-68, Identities = 179/527 (33%), Positives = 304/527 (57%)
  Q:    23 WLESNRISNKYKE-LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN---EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKG------------IRWNEP------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           WL S  I  K KE L +  ++ EI+  F Y  L FGT G+R  +G GTN++N++T +++++G + +LL+  K  + +V +A+D+R+ +  +A   A TL   GIKV L++   ++ TP++SY+VR    +A I+ TASHNPK Y G+KVY   GGQ+ D +A +I++ +   + +  NV +          L++   + I + Y +      I   + R+  K+  +I T  HG+ +  +  +L+ +GYE + +  +Q +PD  F  +   NPE    FD++LK A+    +I+ G DPD DR+  +V+ +K+++  LTGN MG++ T Y+L++ K      K P V+ T V+T  +  IA+ +N +V    TGFK++G    E  K+ DK D+V GFEE+ G L     RDKD   A+ L  E+      +  +L D L  +++++G +  + VS  +     +++++  +DK  NV +  I G+ I              I  NE       +  L++ L++  +   R SGTEPK KIY  I  ++ E   +I+   ++  
  S:    10 WLNSGFIDEKTKEELRIIKDKAEIEDRF-YKDLDFGTGGLRGIIGAGTNRMNIYTVKKVTQGFSEYLLDAYKNKDISVSIAYDSRIMSKEFAKEAALTLCGNGIKVNLFE--SLRPTPMLSYTVRHLKSNAGIVITASHNPKEYNGYKVYGEDGGQVTDKKAKDIIAYVNNVKNL-KNVKSMILKEAKGKKLLNIIGEEIDKDYIDEVKNLTIRKELVRENAKDLKIIYTPIHGSGNIPVRRVLRELGYEKVFVVKEQELPDGTFPTAEYPNPEMPQVFDIALKMAKDINPDIIFGTDPDCDRIGAIVKNNKDEYKVLTGNMMGVLLTEYILSSLKERNMMPKNPVVIKTIVTTEMVRAIAKDFNVEVIDVLTGFKYIGEKIGEFEKNKDK-DYVFGFEESYGYLRGTFVRDKDAVIASMLICEMTLYYKKKGLSLYDALMNLYKKYGFYNEKLVSINLMGKEGQKQIEMIIDKLRNVNDLKIDGVNIVKKYDYKFRIQKDIITGNEKEINLPISNVLKFVLKDGSYFVIRPSGTEPKMKIYMGIKEKSLENSSRIMGKFEESL 568
>gi|29376919|ref|NP_816073.1| phosphoglucomutase/phosphomannomutase family protein [Enterococcus faecalis V583] >gi|29344384|gb|AAO82143.1| phosphoglucomutase/phosphomannomutase family protein [Enterococcus faecalis V583] (574 aa)
Score = 671, Expect = 4.0e-68, Identities = 168/507 (33%), Positives = 275/507 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNE--EEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIY 527
           + WL+   I    K  +  +N   E+ +  F Y+ L FGTAG+R  +G G N++N+FT +Q +EG+AR++  +        V +A+D+R  +  +AM  AKTL    I  F+++   ++ TP +S++VR     A I+ TASHNP  Y G+KVY   GGQ+  ++A+ +   +   +      ++ +    +  LI+   + +  +Y +      IN  +  +  K   ++ T  HGT        LK  G+E  +L  +Q V DP+FT   + NPE+ ++F+ +++  EK  A++++  DPD+DRL   VR  N  +  LTGNQ+G I  HY+L   +      +   V+ + VS+     IAEK N K+F   TGFK++  ++ ++ +     F+ GFEE+ G L     RDKD  QA  L  EV      Q KTL D L +IFEEFG +  +T+S  +  +    +++  M K       +  G+++                        P+  L+++LE+  W+  R SGTEPK K Y
  S:     8 QQWLDEENIPENLKNELKDLNTDPEKCEDAF-YAPLEFGTAGMRGILGAGINRMNIFTVRQATEGLARFMDTQDPETKRRGVAIAYDSRHMSPEFAMEAAKTLAKHDIPSFVFE--SLRPTPELSFAVRYFKAFAGIMITASHNPAAYNGYKVYGEDGGQMPPADADALTKYVRSIENPLKIDVLSDEEVAHSGLINIVGEEVDNAYLKEIKTVTINQELINEMGKELKLVYTPLHGTGKMLGEKALKQAGFEKFVLVPEQAVADPDFTTVKSPNPEEHSAFEYAIRLGEKEGADLLIATDPDADRLGAAVRMPNGDYQVLTGNQLGSIMIHYILEAHQQAGTLPQNAAVLKSIVSSELATAIAEKCNTKMFNVLTGFKFIAEKIQQYEEDHSQTFMFGFEESYGYLVKPFVRDKDAIQALVLLAEVAAFYKKQGKTLYDGLQDIFEEFGYFEEKTISVTMSGIEGSGKIKALMAKCREQAPTEFAGIQVAQTEDFKELTRTFADGQTEQLQTPPSDVLKYHLEDGSWIAIRPSGTEPKIKFY 547
>gi|187605992|ref|ZP_02992171.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Exiguobacterium sp. AT1b] >gi|187481956|gb|EDU19981.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Exiguobacterium sp. AT1b] (575 aa)
Score = 670, Expect = 4.9e-68, Identities = 164/499 (32%), Positives = 279/499 (55%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE--------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           L  +E  ++  F Y  L FGT G+R  +GPG N++NV+T ++ S+G A ++     +     V++AHD+R  +  +A+  A+TL S GIK +L+    ++ATP +S++VR       I+ TASHNP  Y GFKVY   GGQ+  +EA+E+V+ +   +      I D        L+   D ++ E+Y EA     I+ +I +     ++ +  HGT    +   LK+ G+E++ +  +Q  PD  F   +  NPE+KA+F L+++Y ++  A++++  DPD+DR+ + VR ++ +W  LTGNQ G +   Y+L+ K    T     FV  T V++     IA+ Y   +  T TGFK++G ++ ++ +  + +F+ G+EE+ G L  D  RDKD  QA  LA E+        +TL D L  I+E++G +     S  ++     E++   M+ F     K++ G E+  +R+ +                     +  L++   +  W   R SGTEPK K Y+ ++ +  E
  S:    27 LAKDETTLEDAF-YKTLEFGTGGMRGEIGPGANRMNVYTIRKASQGFADFISASGEEAKRHGVVIAHDSRHFSPEFALEAARTLASNGIKTYLFP--SLRATPELSFAVRHLNAFGGIVITASHNPPEYNGFKVYGADGGQLPPAEADELVTYVNAIEDELKIEIEDEAALRQTGLLLTVDSSVDEAYMEALQSIRIHRDI-QDSPLRIVYSPLHGTGRRPVMEGLKAYGFEHVTIVEEQAEPDGAFPTVSYPNPEEKAAFKLAMEYGDRVEADLLMATDPDADRVGLTVRGRDGEWFVLTGNQTGALLMEYILSQKSETGTLPSNGFVAKTIVTSELGAAIAKAYGVHLENTLTGFKFIGEKIKQYEESGEYEFLFGYEESYGYLIGDFCRDKDAVQACLLAAEMAAYHKQHGRTLYDALQSIYEKYGFYEESLQSMTLKGKAGLEQIGRMMEAFRANPPKEVGGYEV--VRFEDYKKQVATDLQSGKSETIELPSSNVLKFVFADGSWFCLRPSGTEPKIKFYFSVHADRAE 554
>gi|150020651|ref|YP_001306005.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Thermosipho melanesiensis BI429] >gi|149793172|gb|ABR30620.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Thermosipho melanesiensis BI429] (574 aa)
Score = 669, Expect = 5.8e-68, Identities = 177/534 (33%), Positives = 299/534 (55%)
  Q:    21 KAWLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWN--------------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K WLES  +  + K+  L +K  EEEI + F +  L FGTAG+R  +G GTN++N +   + ++G+A ++ +K   ++   V++A+D R  +  +A   A  L   GIKV+L+++  I+ TP +S++VR  G  A I+ TASHNP  Y G+KVY   G QILD  A  + +++   + + D      MD        LI      + E Y++      +N ++   K   ++ T  +GT +  + Y+LK  G++N+ +  +Q +PDP+F      NPED  +F+L+L  A +  A+I+L  DPD DRLAV+V+H +++  L GNQ G +   Y+L+ +K          ++ + V+ N    +A++Y    F T TGFK +    NK   +   F  G+EE+IG +  +  RDKDG  +A +  E       Q KTLVD L+E++E++G +     S   E +   E+++  M+ +     K I  L++        G  +N                +  L ++ E+  W   R SGTEPK K+Y   +  T++  ++ L  +++EF+ +++
  S:     8 KKWLESPYVDEETKKELLSIKDKEEEIKERF-FKDLEFGTAGLRGKIGAGTNRMNKYVVAKATQGLADFINSKGKERAKMGVVIAYDVRHFSKDFAKEAASVLAGNGIKVYLFED--IRPTPELSFAVRHLGATAGIVITASHNPPEYNGYKVYWDEGSQILDEVAIPVQNNI---KALTDFGMIKKMDFDEAIEKGLIEIIGKEVDEEYYKRVLSLALNEDL--DKEVKIVYTPLNGTGNIPVRYVLKERGFKNVFVVKEQELPDPDFKTVGYPNPEDIKAFELALSLAREKNADIILATDPDCDRLAVMVKHNDQYIALNGNQTGAVLIQYILSQRKKKNLLSDKSIIIKSIVTGNLGKLVAQEYGVNTFETLTGFKNICGLENKLEKEGYQFEFGYEESIGFVTGNFVRDKDGVISAMMLAEAAGYYKKQGKTLVDVLNELYEKYGYYLENNFSLIYEGIEGMEKIKGIMEFYRKSFPKQIGTLKLSKYIDYLDGNVYNVNREVIDKLNQNHIPSSNVLRFFFEDGSWYAVRPSGTEPKLKVYIYSFAMTRKESEEKLDIIEEEFKNLIK 572
>gi|160903288|ref|YP_001568869.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Petrotoga mobilis SJ95] >gi|160360932|gb|ABX32546.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Petrotoga mobilis SJ95] (559 aa)
Score = 669, Expect = 6.3e-68, Identities = 175/523 (33%), Positives = 294/523 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVY-----TPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQE---KMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILK 543
           + WLES  +++ +KE +L++  NEEEI   F Y  L FGT G+R  MG GTN++NV+T  + ++G A +L   K  P+V++A+D R+N+D +A V A+ L +  + V ++  +Q+  TP++S++VR+   D  II TASHNP  Y G+KVY   G Q +   ANEI S + +     D          N + I+   ++I   Y +     + + N    K   ++ T  +G A   +  +L  +G+E   L  +Q   DP+F+     NPE+K +F+L+LK A++  A+++L  DPD DR+ V  ++K  +   TGNQ+G++  HY+L+            ++V T V+T+ +  IA++++ KV  T TGFK++G ++ K++     F+ GFEE+ G L +D  RDKD   AAAL   + +    + KTL +YL ++ E +G +  + +S+  E     ++++    KM K   +K  D    E    + GI     +  +E    N + +  R SGTEPK K Y  +   ++    +++K
  S:    13 QQWLES--VTDDFKEELLRLKDNEEEIIDRF-YKDLEFGTGGLRGIMGVGTNRMNVYTVARATQGFANYLKKYKDFPSVVIAYDTRLNSDLFAKVAARVLAANNVNVHIF--DQVAPTPLLSFTVRKLKADGGIIITASHNPPQYNGYKVYTSDGTQAVPQYANEITSEIEKLDYFKDIKMMGFEEAVNSEKINILSESIFNDYLDEIEGYIRSLNPKMDKKPLIVYTPLYGAALKLVEGILNRLGFE-FSLVEEQSKIDPSFSTLKVPNPEEKEAFELALKKAKEIDADLILATDPDGDRIGVFEKYKGDYVSFTGNQIGVMLAHYLLSKFREFSSLKPDDYIVKTIVTTDMVKPIAQEFDVKVEETLTGFKYIGEKIEKYLGSGKKFIFGFEESYGYLANDHVRDKDAIIAAALISVMSSESLSKLKTLTEYLKDLKERYGYYDEKLLSFTFEGFEGTQKIKRIMSKMRKNPPIKVGDFTLKETLDYLNGIEGFPKSDVVELRYSN-VKIIARPSGTEPKIKFYIMVKSSSENESRKLIK 547
>gi|170761337|ref|YP_001788436.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169408326|gb|ACA56737.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A3 str. Loch Maree] (575 aa)
Score = 669, Expect = 7.3e-68, Identities = 181/532 (34%), Positives = 294/532 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+ S  + +K KE +  +++E+  K   Y  LSFGT GIR  +G GTN+IN +T  + +EG++ +L++  K+   +V +A+D R ++  +A   ++ L S GI+V+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G QI D EA EI   + E     C   +D       +L  +    I   YF       +  +I +  +K+F ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F +SLK AE    +I++  DPD DR+ V+VR H  ++  L GN++G+I T+Y+L++    KK  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  R+KDG  ++ L  E+      Q K L D L E+++++G +  + +S + +    K +++  ++      +K I   EI        G++ N             +  L+++L N      R SGTEPK KIY      T E  +  +  L+     M+
  S:     9 SWMNSCFLEDKEKEQLKNIDDEQEIKDRFYKDLSFGTGGIRGIVGLGTNRINKYTIAKATEGLSNYLIHNFKEEVISVAIAYDCRNDSLDFAKKASEVLCSHGIRVYIFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQITDKEAQEIAEYIREVGDLGCIKYMDINDAKGKNLYEFVPIEILNKYFYNVKNLTLRKDIVKNYEKDFKILYTPLHGTGNIPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDHKAFYISLKEAENIHPDIIIATDPDCDRVGVMVRDHNARYVALNGNELGVILTNYILSSLEEEKKIPENSVLLKTIVTTDMVKNICKDYGVKVEEVLTGFKYIGEKIEEFKKNGQNKFIFGFEESYGYLFGDFVREKDGIISSVLICEMSLYYKSQNKNLFDVLTELYDKYGYYKEKLISMEFKGEEGKNKIENIINNLRIHDSKTIFNEEILLKEDYKTGLKININKKKEYINKLPKSNVLKFHLNNGTNFVIRPSGTEPKIKIYLSSVHTTAEGAEMNINKLEKNIRNMI 572
>gi|118444174|ref|YP_877849.1| phosphomannomutase [Clostridium novyi NT] >gi|118134630|gb|ABK61674.1| phosphomannomutase [Clostridium novyi NT] (580 aa)
Score = 668, Expect = 8.5e-68, Identities = 176/514 (34%), Positives = 304/514 (59%)
  Q:    23 WLESNRISNKYKELILKM-NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN---EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGI--RWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL+S  I +K KE +  + +E++I+  F Y  L FGT G+R  +G G+N++N++T +++++G++ +LL   K  + +V +A+D+R+ +  +A   + TL + GI+V L++   ++ TP++SY+VR    +A I+ TASHNPK Y G+KVY   GGQ+ D +A +I++ +   + +   V +  ++      L++   + +   Y     +  I   + +   K+  +I T  HG+ +  +  +L  +GYEN+ +  +Q +PD  F  +   NPE    FD++L+ A+  + +I+ G DPD DR+  +V+ +K ++  LTGN MG++ T Y+L++ K   T    P V+ T V+T  I  IA+ +N ++    TGFK++G    E  K+ +K D+V GFEE+ G L     RDKD   A+ L  E+      +  +L D L +++E++G +  E VS  +     ++++   +DK  +V +  I GL                I GI  + N P +  L++ LEN  +   R SGTEPK KIY  + GE  E
  S:    10 WLDSPLIDDKTKEELRSIKDEKDIEDRF-YKDLEFGTGGLRGVIGAGSNRMNIYTVKKVTQGLSEYLLEAYKNRDISVSIAYDSRIMSKEFAKEASLTLCANGIRVNLFE--SLRPTPMLSYTVRYLKSNAGIVITASHNPKEYNGYKVYGEDGGQVTDKKAKDIITCVNNIKDL-KQVKSFTLEEAKERKLLNIIGEEVDRDYINDVKKLTIRNELVKNNAKDLKIIYTPIHGSGNIPVRRVLGELGYENLFVVKEQELPDGTFPTAEYPNPEMPQVFDIALEMAKDIKPDIIFGTDPDCDRIGAIVKNNKKEYKVLTGNMMGVLLTEYILSSLKEKNTMPENPVVIKTIVTTEMIRAIAKDFNVEIMDVLTGFKYIGEKIGEFEKNKNK-DYVFGFEESYGYLRGTFVRDKDAVIASMLICEMTLYYKKKGLSLYDALMKLYEKYGFYKEELVSINLMGKEGQKQIGMTIDKLRHVNDLKIEGLNISKKYDYKMGVEKDIINGIEKKINLPTSNVLKFVLENGDYFVIRPSGTEPKMKIYMGVKGENLE 555
>gi|110637408|ref|YP_677615.1| phosphomannomutase [Cytophaga hutchinsonii ATCC 33406] >gi|110280089|gb|ABG58275.1| phosphomannomutase [Cytophaga hutchinsonii ATCC 33406] (579 aa)
Score = 668, Expect = 8.6e-68, Identities = 164/510 (32%), Positives = 283/510 (55%)
  Q:    21 KAWLESNRISNKYKE---LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRW-------------NEPAQALEWYLENDM--------WVKFRLSGTEPKFKIYYEI 530
           + WL  +  ++  KE   L+    E+E+ + F Y  L FGT G+R  MG G+N++N +T    ++G+  +L  KK+ P       +AHD+R N+D++A   A+   + GI+V+ +K   +++TP +S+++R  G    ++ TASHNPK Y G+K Y + G Q++      I++ + +  +I D  +  +  LI+   + +  +Y     +  ++ + I RQK+  ++ T  HGT    +P +LK  G+EN+ +  +Q VPD NF      NPE+K +  L++K A ++ A++++  DPD+DR+ + +++ KN++  L GNQ G +   Y+L       K     F+V T V+T+ I++IA K+  K + T TGFK++  ++ +   K  F+ G EE+ G L  D  RDKD   + A   E+     DQ K+L D L +++ E+G +    +S   +  +  EE+Q  M +      K + G     + W             N   + +E   EN +         V  R SGTEPK K Y+ +
  S:    13 QTWLSGSYDADTKKEIQSLVDAGKEDELIECF-YKDLEFGTGGLRGLMGVGSNRMNKYTIGAATQGLCNYL--KKNFPGQPLKAAIAHDSRNNSDFFARTTAEVFAANGIQVYFFK--ALRSTPELSFAIRHFGCQTGVVLTASHNPKEYNGYKAYWNDGAQVIAPHDKNIITEVQKISSIDDVNFNADQSLITEIGEEVDNAYLNEIVKLTVSPDAIKRQKDMKIVYTPIHGTGIVLVPEILKRFGFENVRVVQEQAVPDGNFPTVVYPNPEEKDALSLAVKQATEWNADLVMATDPDADRVGIAIKNDKNEFQLLNGNQTGSLLILYMLQAWKNANKITGKEFIVKTIVTTDLIEKIANKFGVKYYNTLTGFKYIAAKIKELEGKEQFIAGGEESYGYLIGDSVRDKDAIASCAFIAEMVAYAKDQGKSLYDMLLDMYVEYGFYKEHLISLTKKGKSGAEEIQTMMKELRATPPKTLSG---SPVEWMFDYDSQLATNIINGTTKKIELPQENVLQFKTADGTLVSARPSGTEPKIKFYFSV 548
>gi|196164648|ref|ZP_03125179.1| putative phosphoglucomutase [Clostridium difficile QCD-23m63] (565 aa)
Score = 668, Expect = 9.3e-68, Identities = 166/516 (32%), Positives = 292/516 (56%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL----NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ--TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K NE+EI+  F Y  L FGTAG+R  +  GTN+IN +T ++ + G+A ++L     +++N  V++AHDNR  +  + +  A TL + GIK +++  + ++ TP +S++VR     A I+ TASHNP  Y G+KVY   G Q++   AN I   +      +II      N +L+   D++    + EA    +I  ++ +   K+F ++ T   GT +  +   LK +G+ENII+  ++  PDPNF      NPE+K + +  +  A++  A++++  DPD DR+ V V+    ++  LTGNQ+G + THY++     N K  + P ++ T V++ +   IA+  N  V    TGFK++G ++   +      +V G+EE+ G L     RDKDG  ++ L  E+    Y +  +L + L E++E++G +  +T+S  ++ +   E+++E +  F   +   I  +++        GI     +  L+++LE++ WV  R SGTEPK K Y  + G +    D+ ++ LK   + M+
  S:    27 IKNNEKEIEDRF-YKDLEFGTAGLRGIIEAGTNRINKYTVRRATFGLANYILENTTKEETNRGVVIAHDNRHKSRQFCIESANTLAACGIKAYIF--DSLRTTPELSFAVRSLNAIAGIVITASHNPPEYNGYKVYWEDGAQVMPEIANAITEKVNSIHDYSIIPTPSEANKNLVVLLDESQDTKFIEAVKSQIIRKDLVKNVGKSFKIVYTPLCGTGNIPIRRALKEVGFENIIVVPEEENPDPNFAGLDYPNPEEKKALNRGILLAKEKGADLVIATDPDCDRVGVAVKTTIGEYALLTGNQIGGMLTHYIIEGLKENNKLKENPTIIKTIVTSEFGADIAKANNVDVLNVLTGFKFIGEKIKLFEQNKNRSYVFGYEESYGYLVGTHARDKDGVVSSLLISEMAAFYYSKGMSLYEGLIELYEKYGFFKEQTISLTLKGIEGVEKIKEIISYFRENQIDYINSVKVIDKKDYKNGIDNLPKSDVLKYFLEDESWVAIRPSGTEPKLKFYIAVKGASDIEADKKIQGLKKYIDDMV 561
>gi|154249640|ref|YP_001410465.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Fervidobacterium nodosum Rt17-B1] >gi|154153576|gb|ABS60808.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Fervidobacterium nodosum Rt17-B1] (574 aa)
Score = 667, Expect = 9.8e-68, Identities = 183/527 (34%), Positives = 291/527 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK---SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-IKGIRWNE-------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           + WLES  +  + K  +  +  N+EEI + F + +L FGTAG+R  +G GTN++N++T  + ++G+A ++L++    +   V++A+D R  +  +A   A+ L + G++V+L+  + I+ TPI+SY+VR     + I+ TASHNP  Y G+KVY   G QI+D  A  I  ++   + I D      MD        LI      I E+YFE      +N  NI   KN  +I T  HGT    + Y+L   G+ N  +  +Q  P+  F      NPED  +FDL+LKYA++  A+++L  DPD+DR AV+V+H   +  L GNQ G +   Y+L+ +K      K   ++ + V+ +    IA++Y  + F T TGFK +    N   DK  F  G+EE+IG +  +  RDKDG   + L  E+      Q KTLVD L+ ++++FG +     S   E L   E+++  M+ F     K+I  LE ++ I + E                    +  L ++L +  W   R SGTEPK K+Y     + +    + L  +KD
  S:     9 RKWLESPHVDEETKNELRSIANNDEEIKERFLF-ELEFGTAGLRGKIGAGTNRMNIYTVGKATQGLAEYILSRGEEYAKRGVVIAYDVRRMSREFARTTAQILAANGVQVYLF--DDIRPTPILSYAVRHLKTASGIVITASHNPPEYNGYKVYWEQGSQIMDDIAEPIEENI---RKIDDFGKIKKMDFDEAISKGLIKIVGKEIDEAYFEKVLGLSLNDENI--DKNISIIYTPLHGTGGRFVRYILTKRGFTNFTIIPEQEEPNGEFPTVEYPNPEDLKAFDLALKYAKEKDADLILATDPDADRNAVMVKHNGDYVPLNGNQTGALLIEYLLSQRKEKGLLPKNGIIIKSIVTGDLGKLIAKQYGVETFETLTGFKNICGLENMLEDKYSFQFGYEESIGYVTGNFVRDKDGVMMSMLISEMAAYYKKQGKTLVDVLESLYKKFGYYFEGNFSMIYEGLKGMEKIRRIMEVFRKKFPKEIGPLELVEYIDYKERKVYDRNGNVIGEVEKHIPESNVLRFFLSDGSWYAIRPSGTEPKLKVYIYTVDKIETESKKKLSLIKD 565
>gi|194014369|ref|ZP_03052986.1| phosphoglucomutase (Alpha-phosphoglucomutase) (Glucosephosphomutase) (PGM) [Bacillus pumilus ATCC 7061] >gi|194013395|gb|EDW22960.1| phosphoglucomutase (Alpha-phosphoglucomutase) (Glucosephosphomutase) (PGM) [Bacillus pumilus ATCC 7061] (581 aa)
Score = 667, Expect = 1.0e-67, Identities = 175/526 (33%), Positives = 291/526 (55%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP----ECQTIIDNVYT-PNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ------------------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           W+    +  + +E +   + N++ ++  F Y  L FGT G+R  +G GTN++NV+T ++ S G+A ++     +     V +A+D+R  +  +AM  AKTL S GI+ +++ E  ++ TP +S++VRE    A I+ TASHNP  Y G+KVY   GGQ+   +A++++  +     E    +D+  T     LI+     I  +Y E      ++  +  + +  V+ T  HGTA+  +   L+ +GY+++ +  +Q  PDP F+   + NPE+ A+F+ ++K  EK  A+I++  DPD+DRL + VR H  ++  LTGNQ G +  HY+L+ K    +    P V+ T V++     +A  + A    T TGFK++G ++ +  +  +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q K+L D L +IF+EFG +     S  ++     E++   +  F       I G  I  I   + +Q                   L+++LE+  W   R SGTEPK K Y  + G +    ++ LK L +E
  S:    10 WINEKHLDTELREWLEAHQDNQQALEDCF-YKNLEFGTGGMRGEIGAGTNRMNVYTVRKASAGLAAYIAKHGEDAKRRGVAIAYDSRHKSPEFAMEAAKTLASQGIQTYVFDE--LRPTPELSFAVRELNAFAGIVVTASHNPPEYNGYKVYGEDGGQLPPLQADQVIQEVDAIENELSISVDSEETLKQQGLINMIGAEIDHAYIEKLKTISVHPELADEVDVKVVFTPLHGTANQPVRKGLQVLGYQHVTVVPEQERPDPQFSTVTSPNPEEHAAFEYAIKLGEKQNADILIATDPDADRLGIAVRDHDGEFTVLTGNQTGALLLHYLLSEKQKLGQLPPRPVVMKTIVTSELGRAVASAFGAHTIDTLTGFKFIGEKIKQFEESGEYTFQFGYEESYGYLIGDFARDKDAVQAALLAVEVAAFYKKQGKSLYDALVDIFKEFGFYREGLKSLTLKGKEGAEQISAILHTFRTNPPAAIAGQRITVIEDYQSSQRYLIAEKKEETIHLPASNVLKYFLEDGSWFCLRPSGTEPKVKFYIAVKGTSLTDSEEKLKHLSEE 567
>gi|170755958|ref|YP_001782750.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum B1 str. Okra] >gi|169121170|gb|ACA45006.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum B1 str. Okra] (575 aa)
Score = 666, Expect = 1.3e-67, Identities = 179/532 (33%), Positives = 293/532 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+ S  +  + KE +  +++E+  K   Y  LSFGT GIR   G GTN+IN +T  + +EG++ +L++  K+   +V +A+D R ++  +A   ++ L S+GI+V+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G QI D EA EI   + E     C   +D       +L  +    I   YF       +  +I +  +KNF ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F  SLK AE    ++++  DPD DR+ ++VR H  ++  L GN++G+I T+Y+L++    KK  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  R+KDG  ++ L  E+      Q K L D L E+++++G +  + +S + +    K +++  ++      +K I   EI        G++ N             +  L+++L N      R SGTEPK KIY      T E  +  +  L+   + M+
  S:     9 SWMNSCFLEKREKEQLKNIDDEQEIKDRFYKDLSFGTGGIRGVAGLGTNRINKYTIAKATEGLSNYLIHNFKEKGISVAIAYDCRNDSLDFAKKASEVLCSYGIRVYIFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQITDKEAQEIAEYIKEVEDLGCIKYMDINDAKEKNLYEFVPIEILNKYFYNVKNLTLRKDIVKNYEKNFKILYTPLHGTGNVPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDNKAFYASLKEAENINPDVIIATDPDCDRVGIMVRDHSTRYVALNGNELGVILTNYILSSLEEEKKIPENSVLLKTIVTTDMVKSICKDYGVKVEEVLTGFKYIGEKIEEFKKNGQNKFIFGFEESYGYLFGDFVREKDGIISSVLICEMALYYKIQNKNLFDVLTELYDKYGYYKEKLISMEFKGEEGKNKIENIINNLRIHDSKTIFNEEILIKEDYKTGLKINMNKKKEYINKLPKSNVLKFHLNNGTNFVIRPSGTEPKIKIYLSSVHTTAEGAEMKINKLEKNIKNMI 572
>gi|150388542|ref|YP_001318591.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Alkaliphilus metalliredigens QYMF] >gi|149948404|gb|ABR46932.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Alkaliphilus metalliredigens QYMF] (577 aa)
Score = 663, Expect = 2.9e-67, Identities = 177/516 (34%), Positives = 298/516 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM---PECQTIID------NVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ-KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----VKNKDILGLEIKGIRWNE-------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K N +EI+  F Y  L FGTAG+R  +G GTN++N++T +++++G+A  +  +  +     V++A+D R  +  +    A  L + GIK +++++  ++ TP +S++VR+    A I+ TASHNP +Y G+KVY   G QI    A +I+ ++   P+  TI          Y    +L    DD   E   E   +CL    I ++ K+F VI T  HGTA+  +  +LK +G+E +I+  +Q  PDPNF+   + NPE++ +F L+++ AEK  A++++G DPD DR+  VV++K  ++  LTGNQ G +  HY+L N K DK        ++ T V++    +IA  Y  ++  T TGFK++  ++   +   K  F+ G+EE+ G L     RDKD   AA L  E+     +++  L D L  ++EE+G +     S  ++     E++Q  ++K  +     V ++ +L LE   ++  +             P+  L+  LE + W+  R SGTEPK K+Y  +  +T E   +  K L++  EYML
  S:    29 IKGNAKEIEDRF-YKNLEFGTAGLRGIIGAGTNRMNIYTVRRVTQGLADHIKTQGKDAMAGGVVIAYDCRHFSKEFTQEAALVLAANGIKAYVFED--LRPTPELSFAVRQCKATAGIVITASHNPPDYNGYKVYWDDGAQINTFLATKIIDAIDQIPDFNTIKRIEQKEAEFYGLYHELGKEMDDLYIE---EVKAQCLRPDLIKKEGKDFKVIFTPLHGTANLHIRQVLKEVGFEQVIVVPEQECPDPNFSTVKSPNPEEREAFALAIELAEKEGADLIIGTDPDGDRVGAVVKNKTGQYIVLTGNQTGALLIHYILDNLK-DKNEIPVDGKIIKTIVTSEMGTKIAANYGVEMLNTLTGFKFIAEQIKGFESTGKGAFIFGYEESYGYLKGTYARDKDAVVAAMLICEMAASYREKDMNLYDGLLALYEEYGYFAEGLKSITLKGKEGLEKIQSIIEKLRSQPIKKVGDRKVLILEDYLLQQRKDMVTGKVETMMLPPSNVLKLKLEGNAWITLRPSGTEPKLKVYGAVQEKTLE---ESHKKLEEIIEYML 573
>gi|151549182|gb|ABS12709.1| Pgm [Brachyspira hyodysenteriae] (563 aa)
Score = 663, Expect = 3.2e-67, Identities = 174/537 (32%), Positives = 292/537 (54%)
  Q:    12 MHANVNPLSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIG-SLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           M   V     +WL  +       + K L+   NE+E+   F Y  L FGT G+R  MG GTN++N +T    ++G+A ++L +  SN  V + +D+R N+D ++   A+ L+S GI V+LY  + I    ++SY+VR  G  A I+ TASHNPK Y G+KVY   G Q++      I+  + + +   + V   +   ++     I + Y       L+N +I ++  +  ++ T  HG+    +P  L+  G+ N+        P+ NF    + NPE+  +  +++  A++  A +++G DPD DR+   +  K+  + YLTGNQ+G I  +Y++TNKK  K PF+V T V+T     IA+  N K++   TGFKW+ + + +  +   ++ GFEE+ G  +NS++ RDKDG  +  +  EV     D   TL DYL+ I+E++G +  ET+S   +  +  + + + M  + N   K+I G++++ I   E                   +  L++ LE+   +  R SGTEPK K Y+E+    KE  D+ L   KD+
  S:     1 MEQEVKARIDSWLNGSYDEETKKEIKALLDAGNEKELIDAF-YRDLEFGTGGLRGIMGVGTNRMNKYTVGVATQGLANYILKQGGSNYKVAIGYDSRNNSDVFSKAAAEILSSNGISVYLY--DDIHPISLLSYAVRSLGCIAGIVVTASHNPKEYNGYKVYWTDGAQVIPPHDKNIIDEVLKVKP--EEVKMGDSSKVTIIGKDIEDKYMNDLMGYLVNPDIIKKHHDIKIVYTPIHGSGYKMVPMALRKAGFTNLTTMEGAQPPNGNFPTVESPNPENPEALKIAVDKAKEIGAELVMGTDPDCDRMGCALLTKDGSYMYLTGNQIGSIMAYYLITNKKNVKNPFIVKTIVTTELARAIADANNVKIYDVLTGFKWIADVIERDKEGT-YLFGFEESFGYCINSNV-RDKDGVSSCLMLAEVLAYCKDNNMTLADYLESIYEKYGYFYEETISITKKGADGAKAIADLMTYYRNNLPKEISGVKVESISDYEKKEVYDNTGKKIKDITLPKSNVLQYILEDKTKITIRPSGTEPKIKFYFEVC--VKESKDKRLAVAKDK 553
>gi|126699180|ref|YP_001088077.1| putative phosphoglucomutase [Clostridium difficile 630] >gi|168714544|ref|ZP_02746821.1| putative phosphoglucomutase [Clostridium difficile QCD-63q42] >gi|115250617|emb|CAJ68441.1| putative phosphoglucomutase [Clostridium difficile 630] (565 aa)
Score = 663, Expect = 3.6e-67, Identities = 167/516 (32%), Positives = 296/516 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL----NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K NE+EI+  F Y  L FGTAG+R  +  GTN+IN +T ++ + G+A ++L     ++++  V++AHDNR  +  + +  A TL + GIK +++  + ++ TP +S++VR     A I+ TASHNP  Y G+KVY   G Q++   AN I   V+S+ +  TI   +   N +L+   D++    + EA    +I  ++ +   K+F ++ T   GT +  +   LK +G+ENII+  ++  PDPNF      NPE+K + +  +  A++  A++++  DPD DR+ V V+    ++  LTGNQ+G + THY++     N K  + P ++ T V++ +   IA+  N  V    TGFK++G ++   +      +V G+EE+ G L     RDKDG  ++ L  E+    Y +  +L D L E+++++G +  +T+S  ++ +   E+++E +  F   +   I  +++        GI     +  L+++LE++ WV  R SGTEPK K Y  + G +    D+ ++ LK   + M+
  S:    27 IKNNEKEIEDRF-YKDLEFGTAGLRGIIEAGTNRINKYTVRRATFGLANYILENTTKEETSRGVVIAHDNRHKSRQFCIESANTLAACGIKAYIF--DSLRTTPELSFAVRSLNAIAGIVITASHNPPEYNGYKVYWEDGAQVMPEIANAITEKVNSIHDYSTI-PTLTEANKNLVVLLDESQDTKFIEAVKSQIIRKDLVKNVGKSFKIVYTPLCGTGNVPIRRALKEVGFENIIVVPEEENPDPNFAGLDYPNPEEKKALNRGILLAKEKGADLVIATDPDCDRVGVAVKTTTGEYALLTGNQIGGMLTHYIIEGLKENNKLKENPTIIKTIVTSEFGADIAKANNVDVLNVLTGFKFIGEKIKLFEQNKNRSYVFGYEESYGYLVGTHARDKDGVVSSLLISEMAAFYYSKGMSLYDGLIELYKKYGFFKEQTISLTLKGIEGVEKIKEIISYFRENQIDYINSIKVVDKKDYKNGIDNLPKSDVLKYFLEDESWVAIRPSGTEPKLKFYIAVKGASDIEADKKIQGLKKYIDDMV 561
>gi|94990561|ref|YP_598661.1| phosphoglucomutase / phosphomannomutase [Streptococcus pyogenes MGAS10270] >gi|94544069|gb|ABF34117.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS10270] (572 aa)
Score = 662, Expect = 4.2e-67, Identities = 166/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSSGLIQVVGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVEADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|168179610|ref|ZP_02614274.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum NCTC 2916] >gi|182669811|gb|EDT81787.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum NCTC 2916] (575 aa)
Score = 662, Expect = 4.3e-67, Identities = 177/532 (33%), Positives = 294/532 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+ S  +  + KE +  +++E+  K   Y  LSFGT GIR  +G GTN+IN +T  + +EG++ +L++  K+   +V +A+D R ++  +A   ++ L S GI+V+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G Q+ D EA EI   + E     C   +D       +L  +    I   YF       +  +I +  +K+F ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F  SLK AE    ++++  DPD DR+ ++VR H  ++  L GN++G+I T+Y+L++    KK  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  R+KDG  ++AL  E+      Q K L D L E+++++G +  + +S + +    K +++  ++      +K I   EI        G++ N             +  ++++L N      R SGTEPK KIY      T E  +  +  L+   + M+
  S:     9 SWMNSCFLEEREKEQLKNIDDEQEIKDRFYKDLSFGTGGIRGVVGLGTNRINKYTIAKATEGLSNYLIHNFKQKVISVAIAYDCRNDSLDFAKKASEVLCSHGIRVYIFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQVTDKEAQEIAEYIKEVEDLGCIKYMDINDAKGKNLYEFVPIEILNKYFYNVKNLTLRKDIVKNYEKDFKILYTPLHGTGNVPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDNKAFYASLKEAENINPDVIIATDPDCDRVGIMVRDHSTRYVALNGNELGVILTNYILSSLEEEKKIPENSVLLKTIVTTDMVKSICKDYGVKVEEVLTGFKYIGEKIEEFKKNGQNKFIFGFEESYGYLFGDFVREKDGIISSALICEMALYYKSQNKNLFDVLTELYDKYGYYKEKLISMEFKGEEGKNKIENIINNLRIHDSKTIFNEEILLKEDYKTGLKININKKKEYINKLPKSNVIKFHLNNGTNFVIRPSGTEPKIKIYLSSVHTTAEGAEMNINKLEKNIKNMI 572
>gi|47096067|ref|ZP_00233668.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153180572|ref|ZP_01933615.1| hypothetical protein LMMG_01984 [Listeria monocytogenes F6900] >gi|153184948|ref|ZP_01935596.1| hypothetical protein LMOG_01515 [Listeria monocytogenes J0161] >gi|153192135|ref|ZP_01939180.1| hypothetical protein LMPG_01262 [Listeria monocytogenes J2818] >gi|47015528|gb|EAL06460.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126942460|gb|EBA20199.1| hypothetical protein LMOG_01515 [Listeria monocytogenes J0161] >gi|127764463|gb|EBA24995.1| hypothetical protein LMPG_01262 [Listeria monocytogenes J2818] >gi|133731965|gb|EBA33663.1| hypothetical protein LMMG_01984 [Listeria monocytogenes F6900] (576 aa)
Score = 662, Expect = 4.4e-67, Identities = 165/529 (31%), Positives = 298/529 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+ + ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +     +TL++ LD+I++EFG +  + VS  +            + N++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMETNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNADGEYKVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAVAEVALVSKVAGRTLLEDLDQIYDEFGYYNEDLVSLTLSGKDGSERIKEITSNFREQLPTSMGGFVVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESTAKLEKVKADL 570
>gi|171779474|ref|ZP_02920438.1| hypothetical protein STRINF_01319 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282091|gb|EDT47522.1| hypothetical protein STRINF_01319 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (584 aa)
Score = 662, Expect = 4.5e-67, Identities = 164/512 (32%), Positives = 283/512 (55%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDILGLEIKGIRWNE-----PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+   + +  +E +L ++E+  +  F Y+ L FGTAG+R  +G GTN+INV+  +Q +EG+A+ +  K  +     V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR  G  A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   +    LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q VPDP+F+   + NPE++ +F L+ +   K  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y AK+F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++   E+++ MDKF +           VK +D L          E     P+  L++ L +D W+  R SGTEPK K Y    G
  S:    21 QKWLDFAGLPDYLREELLALDEKTKEDAF-YTNLEFGTAGMRGVIGVGTNRINVYVVRQATEGLAKLIETKGEDVKKRGVAIAYDSRHFSPEFAFESAQVLAKHGIKAYVFE--SLRPTPELSFAVRHLGTFAGIMVTASHNPAPFNGYKVYGEDGGQMPPADADALTDFIRAIDDPFAIELADLEESKASGLIEVIGENVDAEYLKEVKDVNINQKLIDEYGKDMKIVYTPLHGTGEMLARRALAQAGFQSVQVVEAQAVPDPDFSTVKSPNPENQEAFALAEELGRKVDADVLVATDPDADRLGVEIRQADGSYRNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGAKMFNVLTGFKFIAEKIQEFEEKHNYTYMFGFEESFGYLIKPFVRDKDAVQAVLIVAEIAAYYRSRGLTLADGIEEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRDNAPAQFNSTDIVKTEDFLAQTATSANGVEKLTTPPSNVLKYVLADDSWIAVRPSGTEPKIKFYIATVG 562
>gi|139473703|ref|YP_001128419.1| putative phosphomannomutase [Streptococcus pyogenes str. Manfredo] >gi|134271950|emb|CAM30188.1| putative phosphomannomutase [Streptococcus pyogenes str. Manfredo] (572 aa)
Score = 661, Expect = 5.3e-67, Identities = 166/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSSGLIQVIGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|71903575|ref|YP_280378.1| phosphoglucomutase [Streptococcus pyogenes MGAS6180] >gi|71802670|gb|AAX72023.1| phosphoglucomutase [Streptococcus pyogenes MGAS6180] (572 aa)
Score = 661, Expect = 5.3e-67, Identities = 166/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKHGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSSGLIQVIGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|15675188|ref|NP_269362.1| putative phosphoglucomutase [Streptococcus pyogenes M1 GAS] >gi|71910751|ref|YP_282301.1| phosphoglucomutase/phosphomannomutase [Streptococcus pyogenes MGAS5005] >gi|13622353|gb|AAK34083.1| putative phosphoglucomutase [Streptococcus pyogenes M1 GAS] >gi|71853533|gb|AAZ51556.1| phosphoglucomutase/phosphomannomutase [Streptococcus pyogenes MGAS5005] (572 aa)
Score = 661, Expect = 5.3e-67, Identities = 166/528 (31%), Positives = 289/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D     +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDENKSSGLIQVIGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVEADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|168695314|ref|ZP_02727591.1| putative phosphoglucomutase [Clostridium difficile QCD-37x79] >gi|168726290|ref|ZP_02758567.1| putative phosphoglucomutase [Clostridium difficile QCD-76w55] >gi|168730219|ref|ZP_02762496.1| putative phosphoglucomutase [Clostridium difficile QCD-97b34] (565 aa)
Score = 661, Expect = 5.4e-67, Identities = 167/516 (32%), Positives = 296/516 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL----NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K NE+EI+  F Y  L FGTAG+R  +  GTN+IN +T ++ + G+A ++L     ++++  V++AHDNR  +  + +  A TL + GIK +++  + ++ TP +S++VR     A I+ TASHNP  Y G+KVY   G Q++   AN I   V+S+ +  TI   +   N +L+   D++    + EA    +I  ++ +   K+F ++ T   GT +  +   LK +G+ENII+  ++  PDPNF      NPE+K + +  +  A++  A++++  DPD DR+ V V+    ++  LTGNQ+G + THY++     N K  + P ++ T V++ +   IA+  N  V    TGFK++G ++   +      +V G+EE+ G L     RDKDG  ++ L  E+    Y +  +L D L E+++++G +  +T+S  ++ +   E+++E +  F   +   I  +++        GI     +  L+++LE++ WV  R SGTEPK K Y  + G +    D+ ++ LK   + M+
  S:    27 IKNNEKEIEDRF-YKDLEFGTAGLRGIIEAGTNRINKYTVRRATFGLANYILENTTKEETSRGVVIAHDNRHKSRQFCIESANTLAACGIKAYIF--DSLRTTPELSFAVRSLNAIAGIVITASHNPPEYNGYKVYWEDGAQVMPEIANAITEKVNSIHDYSTI-PTLTEANKNLVVLLDESQDTKFIEAVKSQIIRKDLVKNVGKSFKIVYTPLCGTGNVPIRRALKEVGFENIIVVPEEENPDPNFAGLDYPNPEEKKALNRGILLAKEKGADLVIATDPDCDRVGVAVKTTTGEYALLTGNQIGGMLTHYIIEGLKENNKLKENPTIIKTIVTSEFGADIAKANNVDVLNVLTGFKFIGEKIKLFEQNKNRSYVFGYEESYGYLVGTHARDKDGVVSSLLISEMAAFYYSKGISLYDGLIELYKKYGFFKEQTISLTLKGIEGVEKIKEIISYFRENQIDYINSIKVVDKKDYKNGIDNLPKSNVLKYFLEDESWVAIRPSGTEPKLKFYIAVKGASDIEADKKIQGLKKYIDDMV 561
>gi|148381065|ref|YP_001255606.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. ATCC 3502] >gi|153933484|ref|YP_001385438.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. ATCC 19397] >gi|153935099|ref|YP_001388845.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. Hall] >gi|148290549|emb|CAL84677.1| alpha-phosphoglucomutase [Clostridium botulinum A str. ATCC 3502] >gi|152929528|gb|ABS35028.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. ATCC 19397] >gi|152931013|gb|ABS36512.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. Hall] (575 aa)
Score = 660, Expect = 6.6e-67, Identities = 177/532 (33%), Positives = 294/532 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+ S  +  + KE +  +++E+  K   Y  LSFGT GIR  +G GTN+IN +T  + +EG++ +L++  K+   +V +A+D R ++  +A   ++ L S GI+V+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G QI D EA EI   + +     C   +D       +L  +    I   YF       +  +I +  +K+F ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F  SLK AE    ++++  DPD DR+ ++VR H  ++  L GN++G+I T+Y+L++    KK  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  R+KDG  ++AL  E+      Q K L D L E+++++G +  + +S + +    K +++  ++      +K I   EI        G++ N             +  ++++L N      R SGTEPK KIY      T E  +  +  L+   + M+
  S:     9 SWMNSCFLEEREKEQLKNIDDEQEIKDRFYKDLSFGTGGIRGIVGLGTNRINKYTIAKATEGLSNYLIHNFKEKAISVAIAYDCRNDSLDFAKKASEVLCSHGIRVYIFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQITDKEAQEIAEYIKQVEDLGCIKYMDINDAKGKNLYEFVPIEILNKYFYNVKNLTLRKDIVKNYEKDFKILYTPLHGTGNVPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDNKAFYASLKEAENINPDVIIATDPDCDRVGIMVRDHSTRYVALNGNELGVILTNYILSSLEEEKKIPENSVLLKTIVTTDMVKNICKDYGVKVEEVLTGFKYIGEKIEEFKKDGQNKFIFGFEESYGYLFGDFVREKDGIISSALICEMALYYKSQNKNLFDVLTELYDKYGYYKEKLISMEFKGEEGKNKIENIINNLRIHDSKTIFNEEILLKEDYKTGLKININKKKEYINKFPKSNVIKFHLNNGTNFVIRPSGTEPKIKIYLSSVHTTAEGAEMNINKLEKNIKNMI 572
>gi|145953260|ref|ZP_01802268.1| hypothetical protein CdifQ_04003242 [Clostridium difficile QCD-32g58] >gi|168697003|ref|ZP_02729280.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile QCD-37x79] >gi|168723137|ref|ZP_02755414.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile QCD-76w55] >gi|168732779|ref|ZP_02765056.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile QCD-97b34] >gi|196162436|ref|ZP_03122997.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile CIP 107932] (568 aa)
Score = 660, Expect = 6.9e-67, Identities = 163/514 (31%), Positives = 299/514 (58%)
  Q:    23 WLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL-----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S     + K   L +K +E+EI   F Y  L FGT G+R  +G GTN+IN++T ++ + GV  +++  +        +++AHD+R  +  + + +AKTL+++G+K ++++E  +K TP +S++VR       I+ TASHNPK Y G+KVY+  GGQI    AN+I   V+ + +  TI  ID     + +LI+  D+ + + + +A  + ++  NI  +  K   +I T  HGT +  +  +L   G+EN+++  +Q +PD NF+     NPE+K+ F+++++ A+    ++++G DPD DR+ +VV+  + ++  L GNQ+G +   Y+L      NK     P ++ T V++    +IA+ YN     T TGFK++G ++    +  D  F++G+EE+ G L     RDKDG  ++ +  E+      +   L + L + + +FG +  +  S  ++ ++  ++++E M  F +VK  ++  +++        G+     +  L++ LE+  W+  R SGTEPK K Y+    + +E
  S:    10 WLNSPYFDEQTKNELLSIKDDEKEIQDRF-YKNLEFGTGGLRGIIGAGTNRINIYTVRRATLGVLNYIMKTQGEEGKQKGIVIAHDSRYMSREFCIEVAKTLSAYGVKAYIFEE--LKPTPELSFAVRYLKCAMGIVITASHNPKEYNGYKVYDSDGGQICIDMANDIIAEVNKIDDYSTIKSIDFEEALSKNLITILDNEVDDEFIKAVKKQVLRQNIIDEYGKKLKIIYTPIHGTGNKPVRKVLNECGFENVMVVKEQELPDSNFSTVKYPNPEEKSVFNIAIEMAKNNDTDLIIGTDPDCDRVGIVVKDSSGEYVVLNGNQVGSLLVRYILESLVEENKLPKNNPTIIKTIVTSELGAKIAKAYNVDCLNTLTGFKFIGEKIKAFEESNDRSFIMGYEESYGYLIGTHARDKDGVVSSLMICEMAAYYSSKGMNLYEALIDTYNKFGYYKEDLKSVTLKGIDGIKKIKEMMLYFRSVKIDNVADVKVDKILDYKDGVDDLPKSDVLKFLLEDGSWIAIRPSGTEPKIKFYFGANSDNQE 548
>gi|126700396|ref|YP_001089293.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile 630] >gi|115251833|emb|CAJ69668.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile 630] (568 aa)
Score = 660, Expect = 7.9e-67, Identities = 163/514 (31%), Positives = 299/514 (58%)
  Q:    23 WLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL-----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S     + K   L +K +E+EI   F Y  L FGT G+R  +G GTN+IN++T ++ + GV  +++  +        +++AHD+R  +  + + +AKTL+++G+K ++++E  +K TP +S++VR       I+ TASHNPK Y G+KVY+  GGQI    AN+I   V+ + +  TI  ID     + +LI+  D+ + + + +A  + ++  NI  +  K   +I T  HGT +  +  +L   G+EN+++  +Q +PD NF+     NPE+K+ F+++++ A+    ++++G DPD DR+ +VV+  + ++  L GNQ+G +   Y+L      NK     P ++ T V++    +IA+ YN     T TGFK++G ++    +  D  F++G+EE+ G L     RDKDG  ++ +  E+      +   L + L + + +FG +  +  S  ++ ++  ++++E M  F +VK  ++  +++        G+     +  L++ LE+  W+  R SGTEPK K Y+    + +E
  S:    10 WLNSPYFDEQTKNELLSIKDDEKEIQDRF-YKNLEFGTGGLRGIIGAGTNRINIYTVRRATLGVLNYIMKTQGEEGKQKGIVIAHDSRYMSREFCIEVAKTLSAYGVKAYIFEE--LKPTPELSFAVRYLKCAMGIVITASHNPKEYNGYKVYDSDGGQICIDMANDIIAEVNKIDDYSTIKSIDFEEALSKNLITILDNEVDDEFIKAVKKQVLRQNIIDEYGKKLKIIYTPIHGTGNKPVRKVLNECGFENVMVVKEQELPDSNFSTVKYPNPEEKSVFNIAIEMAKNNGTDLIIGTDPDCDRVGIVVKDSSGEYVVLNGNQVGSLLVRYILESLVEENKLPKNNPTIIKTIVTSELGAKIAKAYNVDCLNTLTGFKFIGEKIKAFEESNDRSFIMGYEESYGYLIGTHARDKDGVVSSLMICEMAAYYSSKGMNLYEALIDTYNKFGYYKEDLKSVTLKGIDGIKKIKEMMLYFRSVKIDNVADVKVDKILDYKDGVDDLPKSDVLKFLLEDGSWIAIRPSGTEPKIKFYFGANSDNQE 548
>gi|19746157|ref|NP_607293.1| putative phosphoglucomutase [Streptococcus pyogenes MGAS8232] >gi|19748335|gb|AAL97792.1| putative phosphoglucomutase [Streptococcus pyogenes MGAS8232] (572 aa)
Score = 659, Expect = 9.1e-67, Identities = 165/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ M+KF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--TLRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFAEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMNKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|196161805|ref|ZP_03122366.1| putative phosphoglucomutase [Clostridium difficile CIP 107932] (573 aa)
Score = 658, Expect = 1.1e-66, Identities = 167/516 (32%), Positives = 296/516 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL----NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K NE+EI+  F Y  L FGTAG+R  +  GTN+IN +T ++ + G+A ++L     ++++  V++AHDNR  +  + +  A TL + GIK +++  + ++ TP +S++VR     A I+ TASHNP  Y G+KVY   G Q++   AN I   V+S+ +  TI   +   N +L+   D++    + EA    +I  ++ +   K+F ++ T   GT +  +   LK +G+ENII+  ++  PDPNF      NPE+K + +  +  A++  A++++  DPD DR+ V V+    ++  LTGNQ+G + THY++     N K  + P ++ T V++ +   IA+  N  V    TGFK++G ++   +      +V G+EE+ G L     RDKDG  ++ L  E+    Y +  +L D L E+++++G +  +T+S  ++ +   E+++E +  F   +   I  +++        GI     +  L+++LE++ WV  R SGTEPK K Y  + G +    D+ ++ LK   + M+
  S:    27 IKNNEKEIEDRF-YKDLEFGTAGLRGIIEAGTNRINKYTVRRATFGLANYILENTTKEETSRGVVIAHDNRHKSRQFCIESANTLAACGIKAYIF--DSLRTTPELSFAVRSLNAIAGIVITASHNPPEYNGYKVYWEDGAQVMPEIANAITEKVNSIHDYSTI-PTLTEANKNLVVLLDESQDTKFIEAVKSQIIRKDLVKNVGKSFKIVYTPLCGTGNVPIRRALKEVGFENIIVVPEEENPDPNFAGLDYPNPEEKKALNRGILLAKEKGADLVIATDPDCDRVGVAVKTTTGEYALLTGNQIGGMLTHYIIEGLKENNKLKENPTIIKTIVTSEFGADIAKANNVDVLNVLTGFKFIGEKIKLFEQNKNRSYVFGYEESYGYLVGTHARDKDGVVSSLLISEMAAFYYSKGISLYDGLIELYKKYGFFKEQTISLTLKGIEGVEKIKEIISYFRENQIDYINSIKVVDKKDYKNGIDNLPKSNVLKYFLEDESWVAIRPSGTEPKLKFYIAVKGASDIEADKKIQGLKKYIDDMV 561
>gi|160376170|sp|P18159|PGCA_BACSU Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|51490691|emb|CAH04980.1| alpha-phosphoglucomutase [Bacillus subtilis subsp. subtilis] (581 aa)
Score = 658, Expect = 1.1e-66, Identities = 170/526 (32%), Positives = 301/526 (57%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD---------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------TGETVSYKIESL--NWKEEMQEKMDKFANVKNKD------ILGLEIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           W ++  +  + KE ++++  +E+ ++  F Y  L FGT G+R  +G GTN++N++T ++ S G A ++  +        V++A+D+R  +  +AM  AKTL + GI+ +++ E  ++ TP +S++VR+      I+ TASHNP  Y G+KVY   GGQ+   EA+ ++  +      I+N  T  +D         LI    + I + Y E      ++  +  + +  V+ T  HGTA+  +   L+++GY+N+ +  +Q +PD NF+   + NPE+ A+F+ ++K  E+  A+I++  DPD+DRL + V++ + K+  LTGNQ G +  HY+L+ KK          V+ T V++     +A  +      T TGFK++G ++ ++    +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q  +L + L  +F E+G +          G+  + +IE++  ++++   +KM     V  +D       L  E K    + P +  L+++LE+  W   R SGTEPK K Y+ + G + E  ++ L  L ++
  S:    10 WKQTEHLDLELKERLIELEGDEQALEDCF-YKDLEFGTGGMRGEIGAGTNRMNIYTVRKASAGFAAYISKQGEEAKKRGVVIAYDSRHKSPEFAMEAAKTLATQGIQTYVFDE--LRPTPELSFAVRQLNAYGGIVVTASHNPPEYNGYKVYGDDGGQLPPKEADIVIEQV----NAIENELTITVDEENKLKEKGLIKIIGEDIDKVYTEKLTSISVHPELSEEVDVKVVFTPLHGTANKPVRRGLEALGYKNVTVVKEQELPDSNFSTVTSPNPEEHAAFEYAIKLGEEQNADILIATDPDADRLGIAVKNDQGKYTVLTGNQTGALLLHYLLSEKKKQGILPDNGVVLKTIVTSEIGRAVASSFGLDTIDTLTGFKFIGEKIKEYEASGQYTFQFGYEESYGYLIGDFARDKDAIQAALLAVEVCAFYKKQGMSLYEALINLFNEYGFYREGLKSLTLKGKQGAEQIEAILASFRQNPPQKMAGKQVVTAEDYAVSKRTLLTESKEEAIDLPKSNVLKYFLEDGSWFCLRPSGTEPKVKFYFAVKGSSLEDSEKRLAVLSED 567
>gi|196124672|ref|ZP_03116421.1| putative phosphoglucomutase [Clostridium difficile ATCC 43255] (565 aa)
Score = 658, Expect = 1.1e-66, Identities = 166/516 (32%), Positives = 296/516 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL----NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K NE+EI+  F Y  L FGTAG+R  +  GTN+IN +T ++ + G+A ++L     ++++  V++AHDNR  +  + +  A TL + GIK +++  + ++ TP +S++VR     A I+ TASHNP  Y G+KVY   G Q++   AN I   V+S+ +  TI   +   N +L+   +++    + EA    +I  ++ +   K+F ++ T   GT +  +   LK +G+ENII+  ++  PDPNF      NPE+K + +  +  A++  A++++  DPD DR+ V V+    ++  LTGNQ+G + THY++     N K  + P ++ T V++ +   IA+  N  V    TGFK++G ++   +      +V G+EE+ G L     RDKDG  ++ L  E+    Y +  +L D L E+++++G +  +T+S  ++ +   E+++E +  F   +   I  +++        GI     +  L+++LE++ WV  R SGTEPK K Y  + G +    D+ ++ LK   + M+
  S:    27 IKNNEKEIEDRF-YKDLEFGTAGLRGIIEAGTNRINKYTVRRATFGLANYILENTTKEETSRGVVIAHDNRHKSRQFCIESANTLAACGIKAYIF--DSLRTTPELSFAVRSLNAIAGIVITASHNPPEYNGYKVYWEDGAQVMPEIANAITEKVNSIHDYSTI-PTLTEANKNLVVLLEESQDTKFIEAVKSQIIRKDLVKNVGKSFKIVYTPLCGTGNVPIRRALKEVGFENIIVVPEEENPDPNFAGLDYPNPEEKKALNRGILLAKEKGADLVIATDPDCDRVGVAVKTTTGEYALLTGNQIGGMLTHYIIEGLKENNKLKENPTIIKTIVTSEFGADIAKANNVDVLNVLTGFKFIGEKIKLFEQNKNRSYVFGYEESYGYLVGTHARDKDGVVSSLLISEMAAFYYSKGMSLYDGLIELYKKYGFFKEQTISLTLKGIEGVEKIKEIISYFRENQIDYINSIKVVDKKDYKNGIDNLPKSDVLKYFLEDESWVAIRPSGTEPKLKFYIAVKGASDIEADKKIQGLKKYIDDMV 561
>gi|160931402|ref|ZP_02078800.1| hypothetical protein CLOLEP_00237 [Clostridium leptum DSM 753] >gi|156869649|gb|EDO63021.1| hypothetical protein CLOLEP_00237 [Clostridium leptum DSM 753] (574 aa)
Score = 658, Expect = 1.2e-66, Identities = 161/507 (31%), Positives = 278/507 (54%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL------ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQA------------------LEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           +E+EI   F Y +L FGTAG+R  +G GTN++N++T ++ ++G+A +L +KK   +V +A+D+R+ ++ +A   A+ L + GI   + KE  ++  P++S++VRE   DA I+ TASHNP  Y G+K Y   G Q+ D++A+ + + + +   + D V   + D       I Y +D+  + Y +      +N  +       ++ T  +G  +  +  +L  IG + I +  +Q +PD +F      NPE + +  L+LK A++ + +++L  DPDSDR+ + V+  + +  +TGN+ GI+  +Y+L+ +K + T    P  V T V++  I RI   Y  ++    TGFK++G +   + +  +   FV GFEE+ G L     RDKD    + L  E+      Q K+LV  ++E+++ +G +   T+SY  E     E M  KM        ++I G+++      + ++A                  L + LE    V  R SGTEPK K+Y    G+      QI K L D
  S:    33 DEKEIYDRF-YKELEFGTAGLRGVIGAGTNRMNIYTVRRTTQGLANYLNSKKEGASVAIAYDSRIKSELFARECARVLAANGITARIVKE--LQPVPVLSFAVRELRCDAGIMITASHNPAKYNGYKCYGPDGCQMTDTDADNVYAEILKVD-LFDGVEEISFDQGLETGKIVYIEDSFYDKYLDCLEAQSVNPGVCAGSGLKIVYTPLNGAGNKLVRKILARIGVKEIQVVPEQELPDGSFPTCPYPNPEFREALTLALKLAQESKPDLVLATDPDSDRVGIAVKDGDDYRLMTGNETGIMLMNYILSCRKRNGTLPERPVAVKTIVTSEMIPRICADYGCELRNVLTGFKYIGEQILGLERAGEADRFVFGFEESYGYLAGTYVRDKDAVVTSMLICEMAAYYRRQGKSLVQVINELYDRYGYYQNTTLSYSFEGAEGMEIMAGKMSFMREHPFREIAGMKVVKTADYQLSEAVDLATGQKTEIKLPKSNVLSYSLEGGAAVIVRPSGTEPKIKVYVTSVGKDLAHASQITKRLGD 566
>gi|94994483|ref|YP_602581.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS10750] >gi|94547991|gb|ABF38037.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS10750] (572 aa)
Score = 658, Expect = 1.3e-66, Identities = 165/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ M+KF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKSKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--TLRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMNKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|88806476|ref|ZP_01121993.1| phosphoglucomutase phosphomannomutase [Robiginitalea biformata HTCC2501] >gi|88783308|gb|EAR14480.1| phosphoglucomutase phosphomannomutase [Robiginitalea biformata HTCC2501] (572 aa)
Score = 658, Expect = 1.3e-66, Identities = 167/520 (32%), Positives = 282/520 (54%)
  Q:    20 SKAWLES---NRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL--LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNI--YRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK---FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE------------------WYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICD 539
           +K+WL       +  + ++L+    EE  D++  Y  L FGT G+R  MG GTN+IN +T  + ++G++ +L  +       V++A+D R N+   A ++A+  +S GI+V+L+ E  ++ TP +S++VR  G  A ++ TASHNP  Y G+KVY   GGQI+  +  EI+ ++   +   D  + P  DLI   D  + E++ EA   C+ N +I    + +F ++ T+ HGT+   +P +L+  GY+ + +  +Q  PD NF   A+ NPE+ A+  L+L+  E   A++++G DPDSDRL + VR+ + +   L GNQ  ++ T Y+L  +K   F    FV +T VST  +  +A+ Y  +   + TGFKW+   +    D+ +F+ G EE+ G +  D  RDKD   +  LA E+         +    L + + +FG +    VS   + ++  +E+++ M  F     K + G E+  I     A +L+                  +   +   V  R SGTEPK K Y  +      + D
  S:    10 AKSWLTDFFDPAVKKEIQDLVENDPEELKDRF--YKNLEFGTGGMRGIMGTGTNRINKYTLGKSTQGLSNYLKEIYGADGLQVVIAYDCRNNSQSLARLVAEVFSSNGIRVYLFSE--LRTTPELSFAVRHLGCHAGVVLTASHNPPEYNGYKVYWTDGGQIVPPQDGEIIRAINRLE-YEDIRFEPREDLIKTIDAEVDEAFIEA---CVANGSIGAAGKDDFSIVFTSLHGTSITAIPQVLEKAGYKKVTIIPEQAEPDGNFPTVASPNPEEPAALALALEKGEAIGADMVVGTDPDSDRLGIAVRNSEGRLELLNGNQTMVLMTRYLLDARKSEGFKGNEFVATTIVSTPMMPAMADAYGVECKTSLTGFKWIAKMIVDFPDQ-EFLGGGEESYGYMVGDFVRDKDAVTSTLLACEIAAQAKSDGSSFYRELLQCYADFGCYRERLVSLVKKGMDGAQEIRQMMKDFRENPLKQLDGSEVVRIDDYNDATSLDTRTGERTPIDLPTSNVLVYTTADGTRVAARPSGTEPKIKFYVSVNAPIDSVSD 549
>gi|164688019|ref|ZP_02212047.1| hypothetical protein CLOBAR_01664 [Clostridium bartlettii DSM 16795] >gi|164602432|gb|EDQ95897.1| hypothetical protein CLOBAR_01664 [Clostridium bartlettii DSM 16795] (562 aa)
Score = 657, Expect = 1.5e-66, Identities = 167/516 (32%), Positives = 289/516 (56%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM-----DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQE--------KMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEIC 538
           WLES+      K+ +  +K NE+EI+  F Y+ L FGTAG+R  +  GTN+IN++T ++ + G+A +++   +       V++AHDNR  +  + +  A TL + GIK +++  + ++ TP +S++VR+    A I+ TASHNP  Y G+KVY   G Q++   A+ I +   E   I D    P +     DL+   DD    ++ EA    +I T + ++  K F ++ T   GT +  +   L  +G+EN+I+  ++  PDPNF      NPE+  +    +  A+   A++++  DPD DR+ V V+     +  LTGNQ+G + T+Y++ +     K D    +V T V++ +   IA   N  V    TGFK++G ++    +  D  ++ G+EE+ G L     RDKDG  A+ L  E+    YD+  +L + L E+++++G +  +T+S  ++ +    +++E         + +F N K  D+   + KGI     +  L+++LE+  W+  R SGTEPK K Y  + G+ +  C
  S:     7 WLESDYFDADTKKELENIKGNEKEIEDRF-YTDLEFGTAGLRGIIAAGTNRINIYTVRRATFGLANYIIKNTTEEEKERGVVIAHDNRHMSREFCLEAANTLAACGIKAYIF--DSLRTTPELSFAVRKLHTIAGIVITASHNPPEYNGYKVYWEDGAQVMPEIASAITA---EVNAITDYSTIPTIKDEQKDLVVMLDDKQDTAFIEAVKTQVIKTELVKKVGKEFKIVYTPLCGTGNVPVTRALAEVGFENVIVVPEEQNPDPNFAGIEYPNPEEHKALTRGIALAKAEGADLVIATDPDCDRVGVAVKTTTGDYALLTGNQIGAMLTNYIIESSKEENKLDPKATLVKTIVTSEFGADIARANNLDVINVLTGFKFIGQKIKSFEESGDRTYLFGYEESYGYLVGTHARDKDGVVASLLISEMAAYYYDKGMSLYEGLQELYKKYGYFKEKTISLTLKGIEGLAKIKEIITYFRENDIKEFNNTKVVDLKDYQ-KGIDDLPKSNVLKYFLEDGSWIAVRPSGTEPKLKFYVAVKGQDESEC 543
>gi|153175727|ref|ZP_01931031.1| hypothetical protein LMIG_01548 [Listeria monocytogenes FSL N3-165] >gi|133729152|gb|EBA30850.1| hypothetical protein LMIG_01548 [Listeria monocytogenes FSL N3-165] (576 aa)
Score = 657, Expect = 1.6e-66, Identities = 164/529 (31%), Positives = 298/529 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ +I+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+ + ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +     +TL++ LD+I++EFG +  + VS  +            + N++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMETNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTSIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNADGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVAGRTLLEDLDQIYDEFGYYNEDLVSLTLSGKDGSRRIKEITSNFREQLPTSMGGFVVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESTAKLEKVKADL 570
>gi|50914273|ref|YP_060245.1| phosphoglucomutase [Streptococcus pyogenes MGAS10394] >gi|50903347|gb|AAT87062.1| phosphoglucomutase; phosphomannomutase [Streptococcus pyogenes MGAS10394] (572 aa)
Score = 657, Expect = 1.6e-66, Identities = 166/528 (31%), Positives = 289/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN  +     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSSGLIQVIGEDVDMEYLREVKDVNINQVLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFDNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|21910400|ref|NP_664668.1| putative phosphoglucomutase [Streptococcus pyogenes MGAS315] >gi|28895976|ref|NP_802326.1| putative phosphoglucomutase [Streptococcus pyogenes SSI-1] >gi|21904598|gb|AAM79471.1| putative phosphoglucomutase [Streptococcus pyogenes MGAS315] >gi|28811226|dbj|BAC64159.1| putative phosphoglucomutase [Streptococcus pyogenes SSI-1] (572 aa)
Score = 657, Expect = 1.6e-66, Identities = 165/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ M+KF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--TLRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDMEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMNKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|153808621|ref|ZP_01961289.1| hypothetical protein BACCAC_02919 [Bacteroides caccae ATCC 43185] >gi|149128943|gb|EDM20160.1| hypothetical protein BACCAC_02919 [Bacteroides caccae ATCC 43185] (581 aa)
Score = 657, Expect = 1.6e-66, Identities = 163/483 (33%), Positives = 261/483 (54%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI--------------KG----IRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           Y  L FGT G+R  MG G+N++N++T    ++G++ +L  N K  P  +V+V HD R N+  +A   A   ++ GIKV+L+  + ++ TP +S+++R  G  + II TASHNPK Y G+K Y   G Q+L      I+  +    +  D  +  N DLI    + I + Y +      I+   I R K+  ++ T  HGT    +P+ LK  G+EN+    +Q + D NF    + NPE+  +  +++  A++  A++++  DPD+DR+ +  +  K +W  + GNQ  +++ +Y+LT      K     F V T V+T  I +IA+K N ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A  L  EV     D  K+L   L +I+ E+G     TV+      +  EE++  M+ F     K++ G ++              KG    I   EP+  L+++ E+   V  R SGTEPK K Y E+ GE
  S:    47 YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYLKKNFKDLPQISVVVGHDCRNNSRLFAETSANIFSANGIKVYLF--DDMRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDKGIIDEVNAIASAADIKFQGNPDLIQIIGEDIDKVYLDMVKTVSIDPEAIARHKDMKIVYTPIHGTGMMLIPHALKMWGFENVFTVPEQMIKDGNFPTVISPNPENAEALSMAVNLAKEIDADLVMASDPDADRVGIACKDDKGEWVLINGNQTCMMYLYYILTQYKQLGKIKGNEFCVKTIVTTELIKKIADKNNIEMLDCYTGFKWIAREIRLREGKKKYIGGGEESYGFLAEDFVRDKDAVSACCLIAEVAAWAKDNGKSLYQLLLDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMENFRANPPKELGGSKVILSKDYKTLKQTDDKGNVTAIDMPEPSNVLQYFTEDGSKVSVRPSGTEPKIKFYMEVQGE 554
>gi|124009327|ref|ZP_01694006.1| phosphomannomutase, putative [Microscilla marina ATCC 23134] >gi|123985104|gb|EAY25048.1| phosphomannomutase, putative [Microscilla marina ATCC 23134] (577 aa)
Score = 657, Expect = 1.7e-66, Identities = 158/500 (31%), Positives = 273/500 (54%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT--VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNV-YTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--ETKEICDQILKALKDEFE 550
           Y  L FGT G+R  MG G+N+IN +T    ++G+A +LL    N T  V +AHD+R  +DY+A + A   ++ GI+V+ +  +Q++ TP +S+++R  G  + ++ TASHNPK Y G+K Y   G Q++      +++ + + Q  +D++ +T +   I      I E Y +      I+   I +Q +  ++ T  HGT    +P +L+ +G+ N+ +   Q  PD NF      NPE+  +  L+L  A++  A++++  DPD+DR+ + ++ H N+W  + GNQ G +  HY+L       + +   ++V T V+T  ID ++  Y    F T TGFK + + +     K  F+ G EE+ G +  D  RDKD   + A   E+  +  DQ KTL D L +I+ E G +  + VS K E     + +++ M++F     K + G E+  ++  +                   +  L+++  +   V  R SGTEPK K Y+ +    E++E  D++   LK + E
  S:    45 YKDLEFGTGGLRGIMGVGSNRINKYTIGMATQGLANYLLQCFPNETIKVAIAHDSRNQSDYFAQITAHVFSANGIEVYFF--DQLRPTPELSFAIRHLGCKSGVVLTASHNPKEYNGYKAYWTDGAQLVAPHDKNVIAEVQKIQ--VDDIKFTKDDRKIHVIGKDIDEVYLDKIKALSISPEAIKKQSDIKIVYTPIHGTGVVLVPQILEKMGFTNVHVLEAQATPDGNFPTVVYPNPEEAEALTLALAKAKELDADLVMATDPDTDRVGIALKNHHNEWQLINGNQTGALLVHYLLDALKNTHQLEDKHYIVKTIVTTELIDTMSASYGVDCFNTLTGFKHIASIIRALEGKRKFIGGGEESYGYMIGDFVRDKDAVASCAFLAEMTAVAKDQGKTLFDQLIDIYLEHGFYLEDLVSIKKEGKAGADAIKQMMEEFRLNPPKSLAGSEVITLKDYQSRTETNLQTGATRPIDLPVSNVLQFFTADGSKVSARPSGTEPKIKFYFGVKATLESREAFDEVHTQLKAKIE 569
>gi|16804513|ref|NP_465998.1| hypothetical protein lmo2475 [Listeria monocytogenes EGD-e] >gi|167213130|ref|ZP_02283437.1| hypothetical protein LmonL_22186 [Listeria monocytogenes LO28] >gi|16411963|emb|CAD00553.1| lmo2475 [Listeria monocytogenes] (576 aa)
Score = 657, Expect = 1.7e-66, Identities = 164/529 (31%), Positives = 298/529 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+ + ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +     +TL++ LD+I++EFG +  + VS  +            + +++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMETNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNADGEYEVLSGNQIGAIILHYLLKQKKAQSELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVAGRTLLEDLDQIYDEFGYYNEDLVSLTLSGKDGSERIKEITSSFREQLPTSMGGFVVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESTAKLEKVKADL 570
>gi|168708023|ref|ZP_02740300.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile QCD-63q42] >gi|196127849|ref|ZP_03119598.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile ATCC 43255] (568 aa)
Score = 656, Expect = 1.9e-66, Identities = 163/514 (31%), Positives = 299/514 (58%)
  Q:    23 WLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL-----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S     + K   L +K +E+EI   F Y  L FGT G+R  +G GTN+IN++T ++ + GV  +++  +        +++AHD+R  +  + + +AKTL+++G+K ++++E  +K TP +S++VR       I+ TASHNPK Y G+KVY+  GGQI    AN+I   V+ + +  TI  ID     + +LI+  D+ + + + +A  + ++  NI  +  K   +I T  HGT +  +  +L   G+EN+++  +Q +PD NF+     NPE+K+ F+++++ A+    ++++G DPD DR+ +VV+  + ++  L GNQ+G +   Y+L      NK     P ++ T V++    +IA+ YN     T TGFK++G ++    +  D  F++G+EE+ G L     RDKDG  ++ +  E+      +   L + L + + +FG +  +  S  ++ ++  ++++E M  F +VK  ++  +++  I   +        +  L++ LE+  W+  R SGTEPK K Y+    + +E
  S:    10 WLNSPYFDEQTKNELLSIKDDEKEIQDRF-YKNLEFGTGGLRGIIGAGTNRINIYTVRRATLGVLNYIMKTQGEEGKQKGIVIAHDSRYMSREFCIEVAKTLSAYGVKAYIFEE--LKPTPELSFAVRYLKCAMGIVITASHNPKEYNGYKVYDSDGGQICIDMANDIIAEVNKIDDYSTIKSIDFKEALSKNLITILDNEVDDEFIKAVKKQVLRQNIIDEYGKKLKIIYTPIHGTGNKPVRKVLNECGFENVMVVKEQELPDSNFSTVKYPNPEEKSVFNIAIEMAKNNGTDLIIGTDPDCDRVGIVVKDSSGEYVVLNGNQVGSLLVRYILESLVEENKLPKNNPTIIKTIVTSELGAKIAKAYNVDCLNTLTGFKFIGEKIKAFEESNDRSFIMGYEESYGYLIGTHARDKDGVVSSLMICEMAAYYSSKGMNLYEALIDTYNKFGYYKEDLKSVTLKGIDGIKKIKEMMLYFRSVKIDNVADVKVDKILDYKDSVDDLPKSDVLKFLLEDGSWIAIRPSGTEPKIKFYFGANSDNQE 548
>gi|151549196|gb|ABS12716.1| Pgm [Brachyspira pilosicoli] (563 aa)
Score = 656, Expect = 1.9e-66, Identities = 167/519 (32%), Positives = 284/519 (54%)
  Q:    12 MHANVNPLSKAWLE---SNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIG-SLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           M  NV     +WL          + K L+   NE+E+   F Y  L FGT G+R  MG GTN++N +T    ++G+A ++L +  S+  V + +D+R N+D ++   A+ L+S GI V+LY  + I    ++SY+VR  G  A ++ TASHNPK Y G+KVY   G Q++      I+  + + +   + V T +   ++     I + Y       L+N +I ++  +  ++ T  HG+    +P  L+  G+ N+        P+ NF    + NPE+  +  +++  A++  A +++G DPD DR+   +  K+  + YLTGNQ+G I ++Y++TNKK  K P++V T V+T     IA+  N K++   TGFKW+ + + +   +  ++ GFEE+ G  +NS++ RDKDG  +  +  EV     D   TL DYL+ I+E++G +  ET+S   +  +  + + + M  + N   K+I G+E+  I   E                   +  L++ L +   +  R SGTEPK K Y+E+
  S:     1 MEKNVQDRINSWLNGPYDEETKKEIKALLDSGNEKELTDAF-YRDLEFGTGGLRGIMGVGTNRMNKYTVGVATQGLANYILKQGGSDYKVAIGYDSRNNSDVFSKAAAEILSSNGISVYLY--DDIHPISLLSYAVRSLGCIAGVVVTASHNPKEYNGYKVYWTDGAQVIPPHDKNIIEEVLKVKP--EEVKTGDASRVTLIGKDIEDKYMNDLMGYLVNPDIIKKHHDIKIVYTPIHGSGYKMVPMALRKAGFTNLTTLEGAQPPNGNFPTVESPNPENPEALQIAVNKAKEIGAELVMGTDPDCDRMGCALLTKDGSYMYLTGNQIGSIISYYLITNKKNVKDPYIVKTIVTTELARSIADANNVKLYDVLTGFKWIADIIER-TKEGTYLFGFEESFGYCINSNV-RDKDGVSSCLMLAEVLAYCKDNNMTLADYLESIYEKYGYFYEETISITKKGADGAKAIADLMTYYRNNLPKEISGVEVVSISDYEKKEVYDNSGKKISDIALPKSNVLQYILADKTKITVRPSGTEPKIKFYFEV 537
>gi|170017596|ref|YP_001728515.1| phosphoglucomutase [Leuconostoc citreum KM20] >gi|169804453|gb|ACA83071.1| Phosphoglucomutase [Leuconostoc citreum KM20] (566 aa)
Score = 656, Expect = 2.2e-66, Identities = 161/502 (32%), Positives = 271/502 (53%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR----------------WNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           K+L     EE+ D +  Y  LSFGTAG+R  +G GTN++N++T +Q++E +AR++    N      V+++ D+R  +  +A   A+ L++ GIK +L+  + ++ TP +S++VRE G  A I+ TASHNPK Y G+KVY   GGQ++      +VS +   Q +       +   +   D  I + Y        +N  +  ++  +   + +  HGT  Y     L+  G+ N  +  +Q V D +F      NPED A+  +++ YA++  A+ ++  DPD+DR+   V+   + +  LTGNQ+  +  +Y+LT KK   T      +V++ VS+ +  +IA  +        TGFK++   ++++       F+ GFEE+ G L      DKD  QA  L  EV      Q KT  D L E+FE+FG +  +T+S     ++  +EM   + KF N + K I G+ +  ++                  +P A  L+++L +  WV  R SGTEPK K Y  +  +++
  S:    21 KDLAHYTPEEQEDAF--YQNLSFGTAGMRGVLGAGTNRMNIYTVRQVTEALARYIDAQGNAAKTSGVVISFDSRHFSPEFASDAAQVLSAHGIKAYLF--SSLRPTPELSFAVRELGTFAGIMITASHNPKEYNGYKVYGADGGQMVPEAVEAVVSELENIQDVFTIALDESNAHVQVIDSEIDDKYLANVATVTVNPELVAKEGASLKFVYSPLHGTGQYIGEKALQQAGFTNYTIVKEQAVIDGDFPTVKKPNPEDAAALVMAIDYAKREGADAVVATDPDADRMGAAVKLADDTFQVLTGNQIAAVLVNYLLTAKKETNTLPENGAIVTSIVSSRFASKIAASFGVTTADVLTGFKYIAATIDEYEATKSHQFLFGFEESFGYLVKPFAHDKDAIQALVLFAEVAAYYKSQGKTFADGLQELFEKFGYFEEKTISLDFPGIHGNDEMSAIISKFRNEQPKTIGGVAVNRVQDFSTATETSADGQQKTLPQPKANVLKYWLADGSWVAVRPSGTEPKLKFYIGVESDSQ 547
>gi|53712771|ref|YP_098763.1| phosphoglucomutase phosphomannomutase [Bacteroides fragilis YCH46] >gi|52215636|dbj|BAD48229.1| phosphoglucomutase phosphomannomutase [Bacteroides fragilis YCH46] (581 aa)
Score = 656, Expect = 2.3e-66, Identities = 167/500 (33%), Positives = 273/500 (54%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLT--NK--KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-AN----------VKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           K ++   ++ E+ + F Y  L FGT G+R  MG GTN++N++T    ++G++ +L          +V+V +D R N+  +A + A   ++ GIKV+L++E  ++ TP +S+++R  G  + II TASHNPK Y G+K Y   G Q+L      I+  + +  +  D  +  N DLI    + + + Y +      I+   I R K+  ++ T  HGT    +P  LK  G+EN+    +Q + D NF    + NPE+  +  ++L  A++  A++++  DPD+DR+ +  ++ K +W  + GNQ  +++ +Y++T  NK  K     F V T V+T  I +IA+K + ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A  L  EV     D  KTL   L +I+ E+G     TV+      +  EE++  M+ F AN          V +KD   L+       +  I   EP+  L+++ E+   V  R SGTEPK K Y E+ GE
  S:    31 KRMLENEDKTELIEAF-YKDLEFGTGGLRGIMGVGTNRMNIYTVGAATQGLSNYLNANFKDMKQISVVVGYDCRNNSSLFAKISADIFSANGIKVYLFEE--MRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDKGIIDEVNKIASAADIKFQGNPDLIQIIGEDVDKIYLDMVKTVSIDPEAIARHKDMKIVYTPIHGTGMMLIPRALKMWGFENVYTVPEQMIKDGNFPTVVSPNPENAEALTMALNLAKEIDADLVMASDPDADRVGIACKNDKGEWVLINGNQTCLMYLYYIITQYNKLGKMTGNEFCVKTIVTTELIKKIADKNHIEMLDCYTGFKWIAREIRLREGKKKYIGGGEESYGFLAEDFVRDKDAVSACCLIAEVAAWAKDNGKTLYQLLMDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMENFRANPPKELGGSKVVLSKDYKTLKQTDAAGHVTDIDMPEPSNVLQYFTEDGGKVSVRPSGTEPKIKFYIEVKGE 554
>gi|196165818|ref|ZP_03126349.1| putative phosphomannomutase/phosphoglycerate mutase [Clostridium difficile QCD-23m63] (568 aa)
Score = 654, Expect = 3.5e-66, Identities = 159/514 (30%), Positives = 297/514 (57%)
  Q:    23 WLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL-----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL S     + K   L +K +E+EI   F Y  L FGT G+R  +G GTN+IN++T ++ + GV  +++  +        +++AHD+R  +  + + +AKTL+++G+K ++++E  +K TP +S++VR       I+ TASHNPK Y G+KVY+  GGQI    AN+I++ + +         ID     + +LI+  D+ + + + +A  + ++  NI  +  K   +I T  HGT +  +  +L   G+EN+++  +Q +PD NF+     NPE+K+ F+++++ A+    ++++G DPD DR+ +VV+  + ++  L GNQ+G +   Y++      NK     P ++ T V++    +IA+ YN     T TGFK++G ++       D  F++G+EE+ G L     RDKDG  ++ +  E+      +   L + L + + +FG +  +  S  ++ ++  ++++E M  F +VK  ++  +++       +G+     +  L++ LE+  W+  R SGTEPK K Y+    + +E
  S:    10 WLNSPYFDEQTKNELLSIKDDEKEIQDRF-YKDLEFGTGGLRGIIGAGTNRINIYTVRRATLGVLNYIIKTQGEEGKQKGIVIAHDSRYMSREFCIEVAKTLSAYGVKAYIFEE--LKPTPELSFAVRYLKCAMGIVITASHNPKEYNGYKVYDSDGGQICIDVANDIIAEVNKIDDYSVIKSIDFEEALSKNLITILDNEVDDEFIKAVKKQVLRQNIIDEYGKKLKIIYTPIHGTGNKPVRRVLSECGFENVMVVKEQELPDSNFSTVKYPNPEEKSVFNIAIEMAKSNGTDLIIGTDPDCDRVGIVVKDSSGEYIVLNGNQVGSLLVRYIVESLVKENKLPKNNPTIIKTIVTSELGAKIAKAYNVDCLNTLTGFKFIGEKIKAFEKSNDRSFIMGYEESYGYLIGTHARDKDGVVSSLMICEMAAYYSSKGMNLYEALLDTYNKFGYYKEDLKSVTLKGIDGIKKIKEMMLYFRSVKIDNVADVKVDKILDYKEGVDDLPKSDVLKFLLEDGSWIAIRPSGTEPKIKFYFGANSDNQE 548
>gi|116617722|ref|YP_818093.1| alpha-phosphoglucomutase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096569|gb|ABJ61720.1| alpha-phosphoglucomutase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (566 aa)
Score = 654, Expect = 3.7e-66, Identities = 163/504 (32%), Positives = 280/504 (55%)
  Q:    33 YKELILKMNEEEIDKYFS---------------YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----------------RWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           YKE + K  E  +  Y +               Y  LSFGTAG+R  +G GTN++NVFT +Q++E +AR++  + S+     V ++ D+R  +  +A   A+ L++ GIK FL+  + ++ TP +S++VRE    A I+ TASHNPK Y G+KVY   GGQ++    + +V+ +     I +     +   +   DD I   Y +      +N ++  ++  +   + +  HGT  Y     L+  G+ N  +  +Q V D +F      NPED A+  L+++YA++  A+ ++  DPD+DR+   V+  +  +  LTGNQ+  +  +Y+LT KK   T      +V++ VS+ +  ++AE +  +     TGFK++   +++        F+ GFEE+ G L      DKD  QA  L  EV      Q KT  D L E+FE+FG +  +T+S     ++  +EM   +  F + +  +I G+++  +                + ++P A  L+++L++  WV  R SGTEPK K Y  +  E+++
  S:     3 YKEALKKWQEATLPDYLAADLEKYTPDQQEDAFYQNLSFGTAGMRGVLGAGTNRMNVFTVRQVTEALARYIDEQGSDAKKRGVAISFDSRHFSPEFASNAAQVLSAHGIKSFLF--SSLRPTPELSFTVRELHAFAGIMITASHNPKEYNGYKVYGEDGGQMVPEAVDAVVNELANITDIFNIALDEDNKNVQIIDDEIDNKYLKKMETVTVNADLVAKEGASLKFVYSPLHGTGQYIGEKALQQAGFTNYTIVKEQAVIDGDFPTVKKPNPEDAAALSLAIEYAKRDGADAVVATDPDADRMGAAVKLADGTFQILTGNQIAAVLVNYLLTAKKDTNTLPTNGSIVTSIVSSRFASKVAESFGVETADVLTGFKYIAATIDQFEETKSNTFLFGFEESFGYLVKPFSHDKDAIQALVLFAEVAAYYKSQGKTFADGLYELFEKFGYFEEKTISLDFPGIHGNDEMAAIIAGFRDNQPAEIGGVKVARVQDFSTSVETSKDGSTAKLSQPKANVLKYWLDDGSWVALRPSGTEPKLKFYIGVESESQQ 548
>gi|160886282|ref|ZP_02067285.1| hypothetical protein BACOVA_04289 [Bacteroides ovatus ATCC 8483] >gi|156108167|gb|EDO09912.1| hypothetical protein BACOVA_04289 [Bacteroides ovatus ATCC 8483] (581 aa)
Score = 654, Expect = 3.7e-66, Identities = 163/483 (33%), Positives = 260/483 (53%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI--------------KG----IRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           Y  L FGT G+R  MG G+N++N++T    ++G++ +L  N K  P  +V+V HD R N+  +A   A   ++ GIKV+L+  + ++ TP +S+++R  G  + II TASHNPK Y G+K Y   G Q+L      I+  +    +  D  +  N DLI    + I + Y +      I+   I R K+  ++ T  HGT    +P  LK  G+EN+    +Q + D NF    + NPE+  +  +++  A++  A++++  DPD+DR+ +  +  K +W  + GNQ  +++ +Y+LT      K     F V T V+T  I +IA+K N ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A  L  EV     D  K+L   L +I+ E+G     TV+      +  EE++  M+ F     K++ G ++              KG    I   EP+  L+++ E+   V  R SGTEPK K Y E+ GE
  S:    47 YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYLKKNFKDLPQISVVVGHDCRNNSRLFAETSANIFSANGIKVYLF--DDMRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDKGIIDEVNAIASAADIKFQGNPDLIQIIGEDIDKIYLDMVKTVSIDPAAIARHKDMKIVYTPIHGTGMMLIPRALKMWGFENVFTVPEQMIKDGNFPTVVSPNPENAEALSMAVNLAKEIDADLVMASDPDADRVGIACKDDKGEWVLINGNQTCMMYLYYILTQYKQLGKIKGGEFCVKTIVTTELIKKIADKNNIEMLDCYTGFKWIAREIRLREGKQKYIGGGEESYGFLAEDFVRDKDAVSACCLIAEVAAWAKDNGKSLYQLLLDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMENFRANPPKELGGSKVILSKDYKTLKQTDDKGNVTAIDMPEPSNVLQYFTEDGSKVSVRPSGTEPKIKFYMEVQGE 554
>gi|160947303|ref|ZP_02094470.1| hypothetical protein PEPMIC_01236 [Peptostreptococcus micros ATCC 33270] >gi|158446437|gb|EDP23432.1| hypothetical protein PEPMIC_01236 [Peptostreptococcus micros ATCC 33270] (565 aa)
Score = 654, Expect = 3.9e-66, Identities = 170/506 (33%), Positives = 285/506 (56%)
  Q:    31 NKYKELI-LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS-----YFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI------RWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           N  K+L+ +K NEEEI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         V +++D R  +  +A +    +   GIK ++YK   I+ TP+ SY++R+    A ++ TASHNP+ Y G+K Y   G QILD  AN+I + M + +   D    P  D I      Y DD++ E Y +      IN  NI   K+  V+ T  +G  +  +  +LK  G+ENI +  +Q +PDP FT     NPE   +F  S K  ++  A+I++  DPD DR+A+ V+ KN ++ +L GN++G + ++Y+ + +       + P +V + V+ +    IA+KY  +   T TGFK +  + N++    + ++V G+EE+IG       RDKD   A+ + +E+      Q K+LVD L++I+EEFG +    +S ++E +  ++ +   M+ F     K++  + +K I        + P Q  L++YL +  W   R SGTEPK K+Y    G+T++
  S:    20 NTRKDLLSIKDNEEEIKDRF-YKVLEFGTAGLRGKLGAGTNRMNKYMVSKAAQALANTIIDHGQGAIERGVALSYDVRYGSKEFAELTCSIMAGNGIKSYIYK--GIRPTPMCSYAIRKLNCIAGVMVTASHNPQAYNGYKAYWKEGSQILDDIANQISAHMDKIEKFEDVKLIPFEDAIKSGIAKYIDDSVDEDYKKEVLNLTINDENI--DKDIKVVYTPLNGVGNLPVREVLKRRGFENIFVVKEQELPDPEFTTVGYPNPEVPKAFLYSEKLGKEVGADILIATDPDCDRVALEVKDKNGEYVFLNGNRIGALLSYYIFSQRYALNNLPENPVLVKSIVTGDLSRVIAKKYGIETVETLTGFKNICGKTNEYDITKEKNYVFGYEESIGFCYGTFVRDKDAVGASMMVVEMAAYYKKQGKSLVDVLNDIYEEFGYYNERQISLELEGIEGQQRIGRMMEDFRENPIKEMGDISLKEIIDFKDGYLDFPKQNCLKYYLNDGSWYALRPSGTEPKIKLYIYTIGKTEQ 544
>gi|149280437|ref|ZP_01886557.1| phosphomannomutase [Pedobacter sp. BAL39] >gi|149228851|gb|EDM34250.1| phosphomannomutase [Pedobacter sp. BAL39] (577 aa)
Score = 654, Expect = 4.0e-66, Identities = 166/505 (32%), Positives = 273/505 (54%)
  Q:    23 WLESNRISNKYKELILKMNEE---EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT----NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIY 527
           WLE N      +E+   ++ E   E+   F Y  L FGT G+R  MG G+N+IN +T    ++G+A +LL K S     V +AHD+R N+DY+A V A   ++ GI V+ ++   ++ TP +S+++RE G  + ++ TASHNPK Y G+K Y   GGQ    +   ++  +   ++I +  +      +S     I +SY +      ++   I RQK+  ++ +  HGT    +P  L+  G+ N+ L  +Q  PD NF      NPE+K +  L+LK AE+  A+++L  DPD+DR+ + V++ + ++  L GNQ G +  +Y+L+      K +   ++V T V+TN I+ IA+  N   + T TGFK++G  +     K  F+ G EE+ G L  ++ RDKD   + A   E+     D+  +L D L  ++ E+G +  E VS   +     EE++  M+KF N     + G  +  ++  E                   +  L++  E+   V  R SGTEPK K Y
  S:    14 WLEGNYDDTTKQEIQKLLDAEAFTELTDSF-YRSLEFGTGGLRGIMGAGSNRINKYTIGTATQGLANYLLKKYSGEQVKVAIAHDSRNNSDYFAKVTADVFSANGIHVYFFE--ALRPTPELSFAIRELGCRSGVMLTASHNPKEYNGYKAYGADGGQFTAPDDVMVMDEVAAIKSIDEVKFDRIEGNVSLIGSDIDKSYLDKITALSVSPEAIQRQKDLKIVFSPIHGTGITLVPKALEQFGFTNVTLVEEQSTPDGNFPTVVYPNPEEKEALTLALKKAEEIDADLVLATDPDADRVGIAVKNNDGQFVLLNGNQTGALLINYLLSAWEEKGKLNGEQYIVKTIVTTNLIEEIAKAKNVTYYNTLTGFKFIGQLITSLQGKKTFIGGGEESYGYLIGELVRDKDAVISCAFIAEMTAFYKDKGSSLYDALLNMYTEYGLYKEELVSITKKGKTGAEEIKAMMEKFRNNPPATLGGSPVATLKDYELGVETDLKTGNKTELPFPKSDVLQFITEDGSIVSARPSGTEPKIKFY 544
>gi|167464939|ref|ZP_02330028.1| Phosphoglucomutase [Paenibacillus larvae subsp. larvae BRL-230010] (564 aa)
Score = 653, Expect = 4.1e-66, Identities = 164/512 (32%), Positives = 281/512 (54%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP-TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD--------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET 534
           WL +  +  + K  +  LK NE+EI+  F Y  L FGT G+R  +G GTN++N++T  + ++G+A++LL       + ++A+D+R  +  +A+  A      GIK F+++   ++ TP +S++VR+    A I+ TASHNP  Y G+K Y   GGQ++   A  +++ + +         +      +  L+ +  + I + + +A      +  + RQ   +F +I T  HGT +  +   LK+IG++ + + A+Q  PDP+F    + NPE++A+F L+LK A+++ A+I++G DPD+DR+  V+++ K  +  LTGNQ G I   Y+  + K   T      +++T V++     IA+ Y      T TGFK++G +M   +   +  +V G+EE+ G L     RDKD   A+ L  E       Q KTL D L+E++  +G +     S   +  +  E++   M+        K A+VK  D+     +GI        L++ LE+  W   R SGTEPK K Y  + G +
  S:    11 WLNAPSVDPETKRELEGLKGNEKEIEDRF-YKDLEFGTGGLRGVVGAGTNRMNIYTVGRTTQGLAQYLLETAGESISAVIAYDSRHCSPEFALETALVFAGNGIKAFVFE--SLRPTPELSFAVRKLKASAGIVITASHNPPEYNGYKAYGADGGQLVPKYAELVLAQVKKVDRFDKVKKLSREEAESRGLLEWIGEQIDQHFIQAVTSLCQHPEVIRQISPDFRIIYTPLHGTGNIPVRKALKTIGFDQVRVVAEQEKPDPDFLTVKSPNPEERAAFTLALKEAKEWDADIIIGTDPDADRMGAVIKNRKGDYIVLTGNQSGAILADYLFRSMKEKGTLPANGVLINTIVTSEMGAEIAKHYGLSTLNTLTGFKYIGEKMTEFERTKEYTYVFGYEESYGYLAGTYARDKDAVVASMLICEAAAFYKSQGKTLYDVLEELYASYGYFLERLESRTFKGKDGVEQINRLMEEWRTNPPLKAADVKVTDMEDYS-RGINGLPQENVLKFKLEDGSWFCLRPSGTEPKIKFYIAVKGTS 543
>gi|94988671|ref|YP_596772.1| phosphoglucomutase [Streptococcus pyogenes MGAS9429] >gi|94992494|ref|YP_600593.1| phosphoglucomutase / phosphomannomutase [Streptococcus pyogenes MGAS2096] >gi|94542179|gb|ABF32228.1| phosphoglucomutase [Streptococcus pyogenes MGAS9429] >gi|94546002|gb|ABF36049.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS2096] (572 aa)
Score = 653, Expect = 5.3e-66, Identities = 164/528 (31%), Positives = 289/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y   +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ M+KF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGTTMFNVLTGFKFIAEKIQEFEEKQNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMNKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|196252893|ref|ZP_03151540.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Clostridium thermocellum DSM 4150] >gi|196197686|gb|EDX92536.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Clostridium thermocellum DSM 4150] (578 aa)
Score = 652, Expect = 5.6e-66, Identities = 173/529 (32%), Positives = 298/529 (56%)
  Q:    19 LSKAWLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM---DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSY---------KIESL--NWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP-------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           L K W+E++    + K+  L +K N +EI++ F Y  L FGT G+R  +G GTN+IN++T ++ S+G+A ++ +    +  + +A+D+R  +  +A+  AK     GIK FL+ E  ++ TP +S++VR     A ++ TASHNPK Y G+KVY   GGQ+    +N+++S + + + I     ++        L+      I + Y        +N  +  +  K F ++ T  HGT +  +  +L  IG++N+++  +Q +PD  F+   + NPE++ +F+L+++ A+K   ++++G DPD DR+ +VVR+K  ++  LTGNQ G +   Y+L+ KK      +  FVV T V+T     I + YN ++    TGFK++G ++ K +D+     ++ GFEE+ G L     RDKD   A+ L  E+      +  TL + L E+ E++G       S+         KI+S   N +E    K  ++  V  +D L  E   +            +  L + L++  W   R SGTEPK KIYY +  ++ +   + LK L+D
  S:     6 LYKFWVENDYFDAETKKELLSIKDNPKEIEERF-YKDLEFGTGGLRGIIGAGTNRINIYTVRKASQGLADYIKSLGLQDRGIAIAYDSRYKSPEFALEAAKVFAGNGIKAFLFDE--LRPTPELSFTVRHLNAAAGVVITASHNPKEYNGYKVYGEDGGQLPVEASNKVISYINKIEDITQVKVMEKDEAIEKGLLRIIGKEIDDEYISKLKTLSVNPELAAEIGKTFKIVYTPLHGTGNKPVRRILDEIGFKNVLVVKEQELPDSEFSTVKSPNPEEREAFELAIELAKKENVDLIIGTDPDCDRVGIVVRNKEGEYVPLTGNQTGCLLLEYILSQKKQRGELPENGFVVKTIVTTELARAITDAYNVELVEVLTGFKFIGEKI-KQLDEFGDKKYLFGFEESYGYLAGTFARDKDAVVASMLIAEMAAYYKSRGLTLYEGLMELLEKYGYTLEGITSFTLKGKDGVEKIKSAMKNLRENRVVKFGEYEAVAVRDYLTSERYEVATGAKEKLTLVESDVLYYELKDKAWFCIRPSGTEPKIKIYYGVTEKSMDAAKEKLKHLQD 566
>gi|81096356|ref|ZP_00874702.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III [Streptococcus suis 89/1591] >gi|146318340|ref|YP_001198052.1| phosphomannomutase [Streptococcus suis 05ZYH33] >gi|146320534|ref|YP_001200245.1| phosphomannomutase [Streptococcus suis 98HAH33] >gi|80977574|gb|EAP41111.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III [Streptococcus suis 89/1591] >gi|145689146|gb|ABP89652.1| Phosphomannomutase [Streptococcus suis 05ZYH33] >gi|145691340|gb|ABP91845.1| Phosphomannomutase [Streptococcus suis 98HAH33] (572 aa)
Score = 651, Expect = 7.8e-66, Identities = 169/528 (32%), Positives = 287/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY-LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLEIKGIRWNE------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+   + +  +E ++ M+E+  +  F Y+ L FGTAG+R  +G GTN+INVF  +Q +EG+A+ + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR     A I+ TASHNPK + G+KVY   GGQ+  ++A+ + + +     P    + D   +    LI+   +     Y E      IN  +  +  K+  ++ T  HGT        L   G+E++ +   Q   DP+F+  A+ NPE +A+F L+ +   +  A+++L  DPD+DR+ V VR  +  ++ L+GNQ+G I   Y+L   K          +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  +  E+      +  TL D +DEIF+E+G +  +T+S  +   +  E+++  M KF     A     DI   E   ++               P+  L++ L +D W   R SGTEPK K Y    GET    ++ +  ++ E
  S:     8 QTWLDFADLPDYLREELVAMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINVFVVRQATEGLAKLVESKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHYNAIAGIMVTASHNPKEFNGYKVYGEDGGQMPPADADALTNFIRAIDNPFAVELADLEASKENGLITVLGEETDVKYLEELNDLNINPELIAEYGKDMKIVYTPLHGTGEMLARRALAQAGFESVQVVEAQATADPDFSTVASPNPESQAAFALAEELGREVGADVLLATDPDADRVGVEVRQADGSYWNLSGNQIGAIIAKYILEAHKQAGTLPANAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLMVAEIAAYYRSRGMTLADGIDEIFKEYGYFAEKTISVTLSGKDGAEQIKAIMAKFRDNSPAQFNATDIAVFEDFALQTKTDKDGNIEKLTTPPSDVLKYTLADDSWFAVRPSGTEPKIKFYIATVGETLAEAEEKISNIEKE 566
>gi|76798927|ref|ZP_00781131.1| phosphoglucomutase [Streptococcus agalactiae 18RS21] >gi|77410511|ref|ZP_00786872.1| phosphoglucomutase [Streptococcus agalactiae CJB111] >gi|76585718|gb|EAO62272.1| phosphoglucomutase [Streptococcus agalactiae 18RS21] >gi|77163459|gb|EAO74409.1| phosphoglucomutase [Streptococcus agalactiae CJB111] (572 aa)
Score = 651, Expect = 8.2e-66, Identities = 165/512 (32%), Positives = 282/512 (55%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLEI---------KGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE           GI  N    P+  L++ L +D W+  R SGTEPK K Y    G
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGIISNLTTPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVG 550
>gi|56807809|ref|ZP_00365657.1| COG1109: Phosphomannomutase [Streptococcus pyogenes M49 591] (572 aa)
Score = 650, Expect = 1.1e-65, Identities = 164/528 (31%), Positives = 289/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L      DKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ M+KF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G+T +I  + +  ++ E
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVHDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMNKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATIGDTLDIAQEKIANIETE 566
>gi|168181808|ref|ZP_02616472.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum Bf] >gi|182675043|gb|EDT87004.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum Bf] (575 aa)
Score = 650, Expect = 1.1e-65, Identities = 178/532 (33%), Positives = 293/532 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +W+ S  +  + KE +  +++E+  K   Y  LSFGT GIR  +G GTN+IN +T  + +EG++ +L++  K+   +V +A+D R ++  +A   ++ L S GI+V+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G QI D EA +I   + +     C   +D       DL  +    +   YF       +   I +  +K+F ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F +SLK AE    +I++  DPD DR+ V+VR +  ++  L GN++GII T+Y+L++    +K  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  RDKDG  ++ L  E+      Q K L D L E+++++G +  + +S + +    K +++  ++      +K I   EI        G++ N             +  L+++L N      R SGTEPK KIY      T E  +  +  L+   + M+
  S:     9 SWMNSCFLEEREKEQLKNIDDEQEIKERFYKDLSFGTGGIRGIVGLGTNRINKYTIAKATEGLSNYLIHNFKEKGISVAIAYDCRNDSLDFAKKASEVLCSHGIRVYIFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQITDKEAQKISEYIRKVEDLGCIKYMDINDAEEKDLYEFVPIEVLNKYFYNVKNLTLRKYIVKNYEKDFKILYTPLHGTGNIPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDNKAFYVSLKEAENIYPDIIIATDPDCDRVGVMVRDYSARYVALNGNELGIILTNYILSSLEEEEKIPENSVLLKTIVTTDMVKNICKDYGVKVEEVLTGFKYIGEKIEEFKKNGQNKFIFGFEESYGYLFGDFVRDKDGIISSVLICEMALYYKSQNKNLFDVLTELYDKYGYYKEKLISVEFKGEEGKNKIENIINNLRIHDSKTIFNEEILIKEDYKTGLKINMNKKKEYINKLPKSNVLKFHLNNGTNFVIRPSGTEPKIKIYLSSVHTTAEGAEMKINKLEKNIKNMI 572
>gi|16077996|ref|NP_388812.1| hypothetical protein BSU09310 [Bacillus subtilis subsp. subtilis str. 168] >gi|2226139|emb|CAA74431.1| hypothetical protein [Bacillus subtilis] >gi|2633254|emb|CAB12759.1| yhxB [Bacillus subtilis subsp. subtilis str. 168] (565 aa)
Score = 649, Expect = 1.3e-65, Identities = 167/526 (31%), Positives = 298/526 (56%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------TGETVSYKIESL--NWKEEMQEKMDKFANVKNKD------ILGLEIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           W ++  +  + KE ++++  +E+ ++  F Y  L FGT G+R  +G GTN++N++T ++ S G A ++  +        V++A+D+R  +  +AM  AKTL + GI+ +++ E  ++ TP +S++VR+      ++ TASHNP  Y G+KVY   GGQ+   EA+ ++  +      I+N  T     +  +D   TE     S    ++  +  + +  V+ T  HGTA+  +   L+++GY+N+ +  +Q +PD NF+   + NPE+ A+F+ ++K  E+  A+I++  DPD+DRL + V++ + K+  LTGNQ G +  HY+L+ KK          V+ T V++     +A  +      T TGFK++G ++ ++    +  F  G+EE+ G L  D  RDKD  QAA LA+EV      Q  +L + L  +F E+G +          G+  + +IE++  ++++   +KM     V  +D       L  E K    + P +  L+++LE+  W   R SGTEPK K Y+ + G + E  ++ L  L ++
  S:    10 WKQTEHLDLELKERLIELEGDEQALEDCF-YKDLEFGTGGMRGEIGAGTNRMNIYTVRKASAGFAAYISKQGEEAKKRGVVIAYDSRHKSPEFAMEAAKTLATQGIQTYVFDE--LRPTPELSFAVRQLNAYGGVVVTASHNPPEYNGYKVYGDDGGQLPPKEADIVIEQV----NAIENELTIT---VVRYDKVYTEKLTSIS----VHPELSEEVDVKVVFTPLHGTANKPVRRGLEALGYKNVTVVKEQELPDSNFSTVTSPNPEEHAAFEYAIKLGEEQNADILIATDPDADRLGIAVKNDQGKYTVLTGNQTGALLLHYLLSEKKKQGILPDNGVVLKTIVTSEIGRAVASSFGLDTIDTLTGFKFIGEKIKEYEASGQYTFQFGYEESYGYLIGDFARDKDAIQAALLAVEVCAFYKKQGMSLYEALINLFNEYGFYREGLKSLTLKGKQGAEQIEAILASFRQNPPQKMAGKQVVTAEDYAVSKRTLLTESKEEAIDLPKSNVLKYFLEDGSWFCLRPSGTEPKVKFYFAVKGSSLEDSEKRLAVLSED 551
>gi|192807943|ref|ZP_03036620.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Geobacillus sp. Y412MC10] >gi|192803363|gb|EDV79866.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Geobacillus sp. Y412MC10] (575 aa)
Score = 649, Expect = 1.3e-65, Identities = 161/528 (30%), Positives = 281/528 (53%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL S  I    K+ +  +  NE EI   F Y +L FGT G+R  +G G+N+IN++T  + ++G+A  L  +  +P+  +A+D+R  +   A+  A  L   G+K ++++   ++ TP +SY+VR    +A I+ TASHNP  Y G+KVY   GGQI    A  ++  +    +      +D        L+ +    I ++Y  A      N  I  +   N+ ++ T  HGT +  +  +LK +G++++ +  +Q  PD NF+   + NPE+ A+F++++  A+   A+++LG DPD+DR+  V++  + ++  L+GNQ G I  HY+L + K      +   ++ T V+++    IA+ Y   VF T TGFK++G +M +       +F+ G+EE+ G L     RDKD   AA L  E       Q KTL + L E++  +G +  +  +  ++ +   + +   M  +      +  G+E+        G+        L+++L +  W   R SGTEPK K+Y+ + G T E     + AL  +
  S:    14 KRWLNSRVIDEASKDELRAIAHNESEIADRF-YKELEFGTGGLRGVIGAGSNRINIYTVGKATQGLAAVLKQEYESPSAAIAYDSRQFSPELALEAALVLAGNGVKAYVFE--TLRPTPELSYAVRHLNAEAGIVITASHNPPEYNGYKVYGSDGGQITPDTAARVIKEIGHVASFEEIRKLDRAEAEGSGLLVWLGQEIDDAYTLAVAGVSQNHGIIPEASSNYRIVFTPLHGTGNVPVRAVLKHLGFQHVDVVPEQEQPDANFSTVQSPNPEEHAAFEIAISQAKASAADLILGTDPDADRMGAVIQDDQGQYFILSGNQSGAIMVHYLLESMKNKGTLPENGAIIKTIVTSDMGAAIADAYGMTVFNTLTGFKYIGEKMTQFEKTGAFEFIFGYEESYGYLAGSYARDKDAVVAAMLIAEAGAYYKTQGKTLYEVLQELYRTYGYFAEKLETRTLKGIQGVQLIAGIMSAWREAAPSEAAGIELSETEDFSLGLYGLPQENVLKFHLADGSWFCLRPSGTEPKIKLYFAVQGSTYEEAQAKIAALTQD 561
>gi|116494456|ref|YP_806190.1| phosphomannomutase [Lactobacillus casei ATCC 334] >gi|116104606|gb|ABJ69748.1| alpha-phosphoglucomutase [Lactobacillus casei ATCC 334] (575 aa)
Score = 649, Expect = 1.3e-65, Identities = 166/527 (31%), Positives = 287/527 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSK-LSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID----NVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----------------RWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET----KEICDQILKALKD 547
           + W++   +  + K  +  M ++E  K  +++  ++FGTAG+R  +G G  ++N++T +Q +EG+AR+   L ++     V +++D+R  +  +A   A  L + GIK +++  +Q++ TP +S++VR     A I+ TASHNPK Y G+K+Y   GGQ+   E+++I         +      N++      L+    + + E+Y+       IN ++  +  KN  ++ +  HGT       +L++ G+EN  L  +Q + DP F  +   NPE    FDL +   +K  A++++  DPD+DRL   V+  + +  LTGNQ+  +  HY+L  +K      K   VV + VST     IA+ Y   +    TGFK++G+++ KH     + +F+ GFEE+ G L     RDKD  Q+  L  EV      Q KTL D + E+++++G +  +TV    E ++ +++M   M KF   +  D  G++I  +                +   P +  L++ L +  W+  R SGTEPK K Y     +T    +E  D   KAL D
  S:     8 QQWVDEPTLDPELKADLKNMADDETTKEQAFAAPMAFGTAGMRGVLGAGIGRMNIYTVRQATEGLARFMDTLSDETKARGVAISYDSRYMSQEFAYESAGVLGAHGIKSYVF--DQLRPTPELSFAVRHLKTYAGIMITASHNPKQYNGYKIYGPDGGQMPPEESDKITKYARSAADLFAIKSLNIHVLRAKKLMQPIGEDVDEAYYAEVATVTINHDLINKVGKNMSLVYSPLHGTGRIPAQMVLRNAGFENFRLVPEQSIADPEFATTPFPNPEFAQVFDLPIALGKKIGADVLIATDPDADRLGTAVKVGDHYQLLTGNQIASVLLHYILEARKQAGTLPKNGAVVKSIVSTELATAIAKDYGVDMINVLTGFKFIGDQI-KHFQATGEHEFLFGFEESYGYLIKPFVRDKDAIQSTVLLAEVAAYYQSQGKTLWDGVQELYKKYGYYAEKTVGVDFEGVDGQKQMANLMTKFREEQPADFAGVKITKVEDFLSQEAKSADGTVEKLTMPSSNVLKYILADGTWIAIRPSGTEPKVKFYVGTKADTEAKAQEKLDAFEKALND 570
>gi|118444132|ref|YP_877313.1| phosphoglucomutase/phosphomannomutase [Clostridium novyi NT] >gi|118134588|gb|ABK61632.1| Phosphoglucomutase/phosphomannomutase [Clostridium novyi NT] (563 aa)
Score = 649, Expect = 1.4e-65, Identities = 176/527 (33%), Positives = 282/527 (53%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT----NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD--------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           + WL  + I  K KE +  +K N+EEI   F Y  L FGTAG+R  +G GTN++N++   ++++G+A ++  K  N     V +A+D R  +  ++   A  L   GIK +L+++  I+ TP +S+++R+    A II TASHNPK Y G+KVY   G Q+L S A+ +   + E +      I+D     N  L++     I + Y E      I  +I   K+  ++ +  +GT +  +  +L+  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I   Y++          K   +V + V+ +    IAEKY    F   TGFK +   + K     + +F+ G+EE+IG   S   RDKDG  ++ L  E         KTL+D L E+F+E G +  + +S  +E +  +E +   M         K  N+K K+ +   I G +    +  L++YL++  W   R SGTEPK KIY     +T    ++ LK ++D
  S:     8 EKWLNDDFIDPKTKEELKSIKDNKEEIQDRF-YKNLEFGTAGLRGKLGAGTNRMNIYNISKVTQGIADFIKEKGQNYMNRGVAIAYDVRHFSKEFSKTAALVLAGNGIKSYLFED--IRPTPELSFTIRKLNTAAGIIITASHNPKEYNGYKVYWEDGAQVLSSIADPMTEKINEIKDFKDVKIMDEKEAINKGLLNIIGKEIDDEYIEKVKSLSIRDDI--DKDIKIVYSPLNGTGNIPVRRVLRERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFKYAENLGKKVDAELLIATDPDCDRLAIEVKDKNGEYVAFNGNQTGAILIKYIVEGMHDKGTLPKNAAIVKSIVTGDLGKVIAEKYGVTTFEALTGFKNICGRIPKFEKTGEYEFIFGYEESIGYNASTFVRDKDGVSSSMLLCEAAAYYKSIGKTLIDVLKEVFKEHGYYKEKQISLVLEGIEGQERISRMMKEYRKSYPTKIGNMKLKECIDF-IDGYKDIGASNVLKFYLDDGSWYAVRPSGTEPKIKIYLYTKADTPAKSEENLKVMED 553
>gi|191637841|ref|YP_001987007.1| Phosphoglucomutase [Lactobacillus casei] >gi|190712143|emb|CAQ66149.1| Phosphoglucomutase [Lactobacillus casei BL23] (575 aa)
Score = 649, Expect = 1.4e-65, Identities = 167/527 (31%), Positives = 287/527 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSK-LSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID----NVYTPNMD-LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----------------RWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET----KEICDQILKALKD 547
           + W++   +  + K  +  M ++E  K  +++  ++FGTAG+R  +G G  ++N++T +Q +EG+AR+   L ++     V +++D+R  +  +A   A  L + GIK +++  +Q++ TP +S++VR     A I+ TASHNPK Y G+K+Y   GGQ+   E+++I         +      NV+      L+    + + E+Y+       IN ++  +  KN  ++ +  HGT       +L++ G+EN  L  +Q + DP F  +   NPE    FDL +   +K  A++++  DPD+DRL   V+  + +  LTGNQ+  +  HY+L  +K      K   VV + VST     IA+ Y   +    TGFK++G+++ KH     + +F+ GFEE+ G L     RDKD  Q+  L  EV      Q KTL D + E+++++G +  +TV    E ++ +++M   M KF   +  D  G++I  +                +   P +  L++ L +  W+  R SGTEPK K Y     +T    +E  D   KAL D
  S:     8 QQWVDEPTLDPELKVDLKNMADDETTKEEAFAAPMAFGTAGMRGVLGAGIGRMNIYTVRQATEGLARFMDTLSDETKARGVAISYDSRYMSQEFAYESAGVLGAHGIKSYVF--DQLRPTPELSFAVRHLKTYAGIMITASHNPKQYNGYKIYGPDGGQMPPEESDKITKYAHSAADLFAIKSLNVHVLRAKKLMQPIGEDVDEAYYAEVATVTINHDLINKVGKNMSLVYSPLHGTGRIPAQMVLRNAGFENFRLVPEQSIADPEFATTPFPNPEFAQVFDLPIALGKKIGADVLIATDPDADRLGTAVKVGDHYQLLTGNQIASVLLHYILEARKQAGTLPKNGAVVKSIVSTELATAIAKDYGVDMINVLTGFKFIGDQI-KHFQATGEHEFLFGFEESYGYLIKPFVRDKDAIQSTVLLAEVAAYYQSQGKTLWDGVQELYKKYGYYAEKTVGVDFEGVDGQKQMANLMTKFREEQPADFAGVKITKVEDFLGQEAKSADGTVEKLTMPSSNVLKYILADGTWIAIRPSGTEPKVKFYVGTKADTEAKAQEKLDAFEKALND 570
>gi|89210164|ref|ZP_01188556.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III [Halothermothrix orenii H 168] >gi|89160237|gb|EAR79893.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III [Halothermothrix orenii H 168] (581 aa)
Score = 649, Expect = 1.5e-65, Identities = 171/529 (32%), Positives = 302/529 (57%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP-----ECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL-------------------EIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           K WL S+    + K  +  +K +++EI+  F Y  L+FGT G+R  +G GTN++N +T Q+ ++G+A +++N   N     V++A+D+R  +  +A+  A  L   GIK +L+ E  ++ TP +S++VR+      I+ TASHNP  Y G+KVY   GGQ++  +A EI++ +      E    ID     +  L+    + I + Y E   + L N  +  +K  +F +I T  HGT +  +  +LK +G+ N+ +  +Q  PDP F+   + NPE+ ++F ++L  A +Y   +++G DPD DR+ +VV++ N+  Y  L GNQ+G++   Y+L+  K          ++ T V+T  + ++A  Y  +V    TGFK++G ++ +     D  F+ GFEE+ G L     RDKD   A+AL   +     +Q  ++ + L ++ E++G +  +  + K+E    +++++  +      +   I G+                   EI+ I   E +  L++ LE+D  +  R SGTEPK KIY+ + GE +E  ++ + ALK+ F
  S:     8 KEWLLSDYFDEETKAELESIKDDKKEIEDRF-YKDLNFGTGGLRGIIGAGTNRMNKYTVQKATQGLANYIINYSENGKDRGVVIAYDSRHKSPEFALEAALVLNGNGIKAYLFDE--LRPTPELSFAVRDLNAIGGIVITASHNPPEYNGYKVYWEDGGQVVPDQAREIIAEIEEIDDFELVKRIDEKEARSQGLLKTIGEEIDKRYIEEMLKVLPNKELASKKGKDFSIIYTPLHGTGNKPVRRVLKELGFNNVHVVEEQAKPDPEFSTVESPNPEEFSAFKMALDLAGEYEPELIIGTDPDCDRMGIVVKN-NEGEYVGLNGNQVGVLMADYLLSQMKEQGELPDNGVIIKTIVTTEMVRKVAADYGVEVMDVLTGFKFIGEKIKEFKKTGDHTFIFGFEESYGYLAGTYCRDKDAVIASALIATMALYYREQGFSIYEKLIDLMEKYGYYKEKLSAIKLEGKEGQDKIKNTLATIREDRPDSISGIKVEVFKDYKEKKSYNNKTGEIEDIDLPE-SNVLQFKLEDDSMLTIRPSGTEPKLKIYFAVRGENEEDAERKINALKENF 570
>gi|57790334|gb|AAW56093.1| phosphoglucomutase [Streptococcus iniae] (571 aa)
Score = 649, Expect = 1.5e-65, Identities = 165/528 (31%), Positives = 288/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY-LTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDILGLEIKGIRWNE-----PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL ++ + +  K+ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+INVF  +Q +EG+A+ + +K     +  V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR  G  A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + I   Y +      IN  +     ++  ++ T  HGT        L   G+E++ +   Q   DPNF+  A+ NPE + +F L+ +      A++++  DPD+DRL V +R  +  ++ L+GNQ+G +   Y+L   K   T      +  + VST  + +IAE Y A +F   TGFK++  ++ +  +  +  ++ GFEE+ G L     RDKD  QA  +  E+      +  TL D +D+I++E+G +  +T+S  +  ++   +++  MDKF             V ++D L    K           P+  L++ L +D W   R SGTEPK K Y    G+T    ++ +K ++ E
  S:     8 QKWLNASNLPDYLKDELLAMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINVFVVRQATEGLAKLVESKGQAAKDAGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLGAVAGIMVTASHNPAPFNGYKVYGADGGQMPPADADALTDYIRAIEDPFSIVLADLEDSKSNGLIEVIGEAIDTEYLKEVKDVTINQELIDTFGRDMKIVYTPLHGTGEMLTRRALAQAGFESVEVVESQAKADPNFSTVASPNPESQEAFALAEELGRTVNADVLVATDPDADRLGVEIRQADGSYWNLSGNQIGALIAKYILEAHKVAGTLPVNAALAKSIVSTELVTKIAESYGATMFNXLTGFKFIAEKIQEFEETHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLIVAEIAAYYRSKGLTLADGIDDIYKEYGYFAEKTISLTLSGVDGASQIKAIMDKFRQSAPTSFNQTEIVLSEDFLEQTAKSADGTSPLTTPPSNVLKYTLADDSWFAVRPSGTEPKIKFYVATVGQTLLEAEEKIKTIEAE 565
>gi|150006293|ref|YP_001301037.1| putative phosphoglucomutase [Bacteroides vulgatus ATCC 8482] >gi|149934717|gb|ABR41415.1| putative phosphoglucomutase [Bacteroides vulgatus ATCC 8482] (581 aa)
Score = 648, Expect = 1.7e-65, Identities = 157/483 (32%), Positives = 261/483 (54%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE------------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           Y  L FGT G+R  MG G+N++N++T    ++G++ +L NK        +V+V HD R N+  +A + A   ++ GIKV+L+++  ++ TP +S+++R  G  + I  TASHNP+ Y G+K Y   G Q+L      I+  + +  +  D  +  N DLI    + +   Y        I+   I RQK+  ++ T  HGT    +P  LK  G+EN+    +Q V   +F    + NPE+  +  +++  A+K  A+I++  DPD+DR+ +  ++ K +W  + GNQ  ++F +Y++ N+    K     F+V T V+T  I  +A+K + ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A  L  E+     DQ KTL + L +I+ E+G     TV+      +  EE++  M+ F +   ++I G +                  I  I   E +  L+++ E+   +  R SGTEPK K Y E+ GE
  S:    47 YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYL-NKNFKDLDQISVVVGHDCRNNSRLFAEISANIFSANGIKVYLFED--MRPTPEMSFAIRHFGCQSGINITASHNPREYNGYKAYWDDGAQVLAPHDKGIIDEVNKISSATDIKFEGNKDLIQIVGEEVDSVYLNKVKTISIDPEVIKRQKDLKIVYTPIHGTGMMLIPRALKQWGFENVHTVPEQMVKSGDFPTVVSPNPENAEALSMAIDLAKKIDADIVMASDPDADRVGMACKNDKGEWVLINGNQTCLLFLYYIIKNRIAMGKMKDDDFIVKTIVTTELIKSVADKNHIEMLDCYTGFKWIAREIRLREGKQQYIGGGEESYGFLAEDFVRDKDAVSACTLLAEICAWAKDQGKTLFEVLLDIYVEYGFSKETTVNVVKPGKSGAEEIKAMMENFRSNPPREIGGSKVVLVKDFKTLKVTDGNGNITEIDMPEASNVLQYFTEDGTKISVRPSGTEPKIKFYVEVKGE 554
>gi|47092761|ref|ZP_00230546.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b H7858] >gi|167015570|ref|ZP_02278103.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes FSL J1-194] >gi|47018849|gb|EAL09597.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b H7858] (576 aa)
Score = 648, Expect = 1.8e-65, Identities = 163/529 (30%), Positives = 298/529 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++    ++     +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+   ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   +  +L++ L++I+ EFG +  + VS  +            + N++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMEANEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGDEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNLDGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGGSLLEDLEQIYAEFGYYKEDLVSLTLSGKDGSRRIKEITSNFREQLPTSMGGFPVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESATKLEKVKADL 570
>gi|77408659|ref|ZP_00785392.1| phosphoglucomutase [Streptococcus agalactiae COH1] >gi|77172707|gb|EAO75843.1| phosphoglucomutase [Streptococcus agalactiae COH1] (572 aa)
Score = 647, Expect = 2.2e-65, Identities = 163/512 (31%), Positives = 281/512 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSSGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVNADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQIATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVG 550
>gi|46908647|ref|YP_015036.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b F2365] >gi|153204046|ref|ZP_01944912.1| hypothetical protein LMSG_01687 [Listeria monocytogenes HPB2262] >gi|46881919|gb|AAT05213.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b F2365] >gi|47559005|gb|AAT35573.1| phosphomannomutase [Listeria monocytogenes] >gi|133734458|gb|EBA36156.1| hypothetical protein LMSG_01687 [Listeria monocytogenes HPB2262] (576 aa)
Score = 647, Expect = 2.4e-65, Identities = 163/529 (30%), Positives = 296/529 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+   ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   +  +L++ L++I+ EFG +  + VS  +            + N++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMEANEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNLDGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGGSLLEDLEQIYAEFGYYKEDLVSLTLSGKDGSRRIKEITSNFREQLPTSMGGFPVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESATKLEKVKADL 570
>gi|60680921|ref|YP_211065.1| putative phosphoglucomutase [Bacteroides fragilis NCTC 9343] >gi|60492355|emb|CAH07121.1| putative phosphoglucomutase [Bacteroides fragilis NCTC 9343] (581 aa)
Score = 647, Expect = 2.5e-65, Identities = 166/500 (33%), Positives = 272/500 (54%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLT--NK--KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-AN----------VKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           K ++   ++ E+ + F Y  L FGT G+R  MG GTN++N++T    ++G++ +L          +V+V +D R N+  +A + A   ++ GIKV+L++E  ++ TP +S+++R  G  + II TASHNPK Y G+K Y   G Q+L      I+  + +  +  D  +  N DLI    + + + Y +      I+   I R K+  ++ T  HGT    +P  LK  G+EN+    +Q + D NF    + NPE+  +  ++L  A++  A++++  DPD+DR+ +  ++ K +W  + GNQ  +++ +Y++T  NK  K     F V T V+T  I +IA+K + ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A  L  EV     D  KTL   L +I+ E+G     TV+      +  EE++  M+ F AN          V +KD   L+       +  I   E +  L+++ E+   V  R SGTEPK K Y E+ GE
  S:    31 KRMLENEDKTELIEAF-YKDLEFGTGGLRGIMGVGTNRMNIYTVGAATQGLSNYLNANFKDMKQISVVVGYDCRNNSSLFAKISADIFSANGIKVYLFEE--MRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDKGIIDEVNKIASAADIKFQGNPDLIQIIGEDVDKIYLDMVKTVSIDPEAIARHKDMKIVYTPIHGTGMMLIPRALKMWGFENVYTVPEQMIKDGNFPTVVSPNPENAEALTMALNLAKEIDADLVMASDPDADRVGIACKNDKGEWVLINGNQTCLMYLYYIITQYNKLGKMTGNEFCVKTIVTTELIKKIADKNHIEMLDCYTGFKWIAREIRLREGKKKYIGGGEESYGFLAEDFVRDKDAVSACCLIAEVAAWAKDNGKTLYQLLMDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMENFRANPPKELGGSKVVLSKDYKTLKQTDAAGHVTDIDMPESSNVLQYFTEDGGKVSVRPSGTEPKIKFYIEVKGE 554
>gi|25011151|ref|NP_735546.1| hypothetical protein gbs1100 [Streptococcus agalactiae NEM316] >gi|76787313|ref|YP_329776.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae A909] >gi|23095550|emb|CAD46759.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562370|gb|ABA44954.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae A909] (572 aa)
Score = 647, Expect = 2.5e-65, Identities = 163/512 (31%), Positives = 281/512 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVG 550
>gi|77413292|ref|ZP_00789488.1| phosphoglucomutase [Streptococcus agalactiae 515] >gi|77160679|gb|EAO71794.1| phosphoglucomutase [Streptococcus agalactiae 515] (572 aa)
Score = 647, Expect = 2.6e-65, Identities = 163/512 (31%), Positives = 281/512 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVG 550
>gi|22537224|ref|NP_688075.1| phosphoglucomutase [Streptococcus agalactiae 2603V/R] >gi|22534090|gb|AAM99947.1|AE014240_18 phosphoglucomutase [Streptococcus agalactiae 2603V/R] (572 aa)
Score = 646, Expect = 2.7e-65, Identities = 163/512 (31%), Positives = 281/512 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G
  S:     8 QKWLDFEQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSSGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVG 550
>gi|77405513|ref|ZP_00782605.1| phosphoglucomutase [Streptococcus agalactiae H36B] >gi|77175910|gb|EAO78687.1| phosphoglucomutase [Streptococcus agalactiae H36B] (572 aa)
Score = 646, Expect = 2.9e-65, Identities = 163/512 (31%), Positives = 281/512 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           + WL+  ++ +  ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K        V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +     P    + D   + +  LI    + +   Y        IN ++     K+  ++ T  HGT        L   G+E++++   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K      +   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  L  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF         N DI+ LE             I  +    P+  L++ L +D W+  R SGTEPK K Y    G
  S:     8 QKWLDFXQLPDYLRQELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAQHGIKSYVFE--ALRPTPELSFAVRHLNAYAGIMVTASHNPAPFNGYKVYGQDGGQLPPADADALTDFIRAIENPFAVELADLDESKSAGLIQVIGEDVDIEYLREVKDVNINQDLINNFGKDMKIVYTPLHGTGEMLTRRALAQAGFESVVVVESQAKADPDFSTVKSPNPESQAAFALAEELGREVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPENAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRENGPKQFNNTDIVLLEDFQKQTATKNDGTISNLT-TPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVG 550
>gi|90962151|ref|YP_536067.1| phosphoglucomutase [Lactobacillus salivarius UCC118] >gi|90821345|gb|ABD99984.1| Phosphoglucomutase [Lactobacillus salivarius UCC118] (575 aa)
Score = 646, Expect = 3.1e-65, Identities = 168/526 (31%), Positives = 292/526 (55%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL--LNKKSNPT-VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS-----YFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD---FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF---ANVKNKDILGLEIKGIRWNEPAQA--------------LEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           W E+  +    +  +++M  N++E++  F Y+ L FGTAG+R  +G G N++N++T +Q +EG+A ++  L++++    V +++D+R ++  +A   A+ L   GI  F+++   ++ TP +S++VR     A I+ TASHNPK Y G+K+Y   G Q+   E++ I   + +   +         +LI         D + ++Y +   +  IN  +  +  K   +I T  HGT +      L+  G+EN  +  +Q  PDP+F+     NPED A+FDL++K  ++  A++++ VDPD+DRL   VR  + ++  LTGNQ+  I  +Y+LT +K   T       V + VS+ +  +IAE +N  +    TGFK++  ++ KH +  +   F+ GFEE+ G L     RDKD  Q+  +  EV      Q K L D L E+FE+ G +  +T S   + +    ++++ M KF   A  +  D   + ++    +E + A              L++ LE+  W+  R SGTEPK K Y    G+T E   +     ++E
  S:    10 WKENKELVEDLRADLVRMEGNQDELEDAF-YAPLEFGTAGMRGVLGAGINRMNIYTVRQATEGLALFMETLDEETRKRGVAISYDSRHHSQDFAFESARVLGQHGIPTFVFE--SLRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGAQMPPKESDLITKYIRKVDDLFAIKVADQEELIEDGVLKVIGDEVDKAYLDEVKQVTINQELVAEEGKTMKLIFTPLHGTGAMLGEKALRQAGFENFTMVPEQAKPDPDFSTVKKPNPEDTAAFDLAIKLGKEEGADLLVAVDPDADRLGAAVRQPDGEYQLLTGNQIAAIMLNYILTARKNAGTLPANAAAVKSIVSSEFATKIAESFNVDMINVLTGFKFIAEQI-KHFEDTNEHTFMFGFEESYGYLVRPFVRDKDAVQSLVMLAEVAAFYKKQGKNLYDGLQELFEKHGYFVEKTTSLTFDGVEGANKIKDLMAKFRAEAPKQFGDYKVVAMEDFDKSEKSYADGKVEAMTLPKSNVLKFLLEDGTWIAIRPSGTEPKIKFYIGTLGDTLEAATKKRSVFEEE 568
>gi|16799932|ref|NP_470200.1| hypothetical protein lin0858 [Listeria innocua Clip11262] >gi|16413309|emb|CAC96090.1| lin0858 [Listeria innocua] (557 aa)
Score = 645, Expect = 3.9e-65, Identities = 172/526 (32%), Positives = 296/526 (56%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAV-VVRHKNKWHYLTGNQMGIIFTHYVLTNKKF-DKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDK----------------FANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           AW  ++ +S++++   LK  E E +++  Y  L+FGT G+R  MG G+N+IN+FT ++++ G+  ++  N      V + +D+R N+D +A   AK L++ GI+V+L   + I+ TP +S+ VRET   A ++ TASHNP  Y GFKVY+  G QI    A EI S + +   I  I     PN+ L++     + ++Y +A  + +    +         +  T  HG     +   L   G+ N +L  +Q  PD +F    + NPE++ SF+L+   A+K +A+I+L  DPD+DRL V V+ ++N++  LTGNQ+G +   Y+L+ K+F  K   +++T V+ +   +IA ++     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  +E+ +   +M + +D                 F   +  ++L  EI  I   +    L++YL++  W   R SGTEPK KIY++   ET+E  ++ +  LK+
  S:     9 AWKNAD-LSDEWRSE-LKRVEHEQERFEGY--LTFGTGGMRGKMGLGSNRINLFTIRRVASGLGEYVAANGGKEKGVAIFYDSRNNSDVFAAETAKVLSALGIRVYL--SDTIRPTPALSFCVRETKSFAGVVITASHNPSIYNGFKVYDENGCQITLGAAQEITSYLNKITDIFRIPVRELPNL-LVTTIGKEMDDAYLQALTKVISRPELVADYGNELGICYTPLHGAGKELVMRGLAENGFSNTLLVQEQSEPDGDFPTVVSPNPEEENSFELAKLQAQKMQADIILATDPDADRLGVAVLTNQNEYQILTGNQLGALLLDYILSAKEFVTKEDTMINTIVTGDLGGKIASRFGILHVQTLTGFKFIGEKIAEMEGTQANFIFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLGKLTSLYEQFGYHKEYLHTITLENNDGAAKMNQMIDTLRKEPHFLPEIVAVEDFLTSERTNLLTKEITNIELPQ-ENVLKFYLKDKSWFAVRPSGTEPKCKIYFQTIAETEENAEKAMNDLKE 550
>gi|195978068|ref|YP_002123312.1| phosphomannomutase PgmA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974773|gb|ACG62299.1| phosphomannomutase PgmA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (582 aa)
Score = 645, Expect = 4.1e-65, Identities = 164/528 (31%), Positives = 290/528 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM---------DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDF--VVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLEIKGIR-----------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           + WL+   +    ++ +L M+E+  +  F Y+ L FGTAG+R  +G GTN+INVF  +Q +EG+A  + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR  G  A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +      IDN +   +          LI    + +  +Y E   +  IN ++     ++  ++ T  HGT        L   G++++ +   Q  PDP+F+   + NPE + +F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G +   Y+L   +          +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K ++  + GFEE+ G L     RDKD  QA  L  E+      +  TL D +D+I++E+G +  +T+S  +  ++   E+++ MDKF     A   + DI+  E   I+              P+  L++ L +D W   R SGTEPK K Y    G+T  + ++ +  ++ E
  S:    19 QKWLDIPDLPAYLRDELLSMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINVFVVRQATEGLAALVESKGEAAKKAGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLGAFAGIMVTASHNPAPFNGYKVYGSDGGQMPPADADALTDYI----RAIDNPFAIRLADLEKAKANGLIEVIGEAVDLAYLEEVKKVNINQDLINDYGRDMKIVYTPLHGTGEMLARRALAQAGFKSVQVVEVQAKPDPDFSTVKSPNPESQEAFALAEELGRQVDADVLVATDPDADRLGVEIRQADGSYRNLSGNQIGALIAKYILEAHQQAGTLPNNAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNYTYMFGFEESFGYLIKPFVRDKDAIQAVLLVAEIAAYYRSRGLTLADGIDDIYKEYGYFAEKTISVTLSGVDGAAEIKQIMDKFRKHAPAQFNHTDIVLTEDFLIQTATHKAGQTQLTTPPSNVLKYTLADDSWFAVRPSGTEPKIKFYIATVGDTLALAEEKIANIESE 576
>gi|168266718|ref|ZP_02688683.1| hypothetical protein LmonFSL_15485 [Listeria monocytogenes FSL J2-071] (568 aa)
Score = 645, Expect = 4.2e-65, Identities = 162/526 (30%), Positives = 296/526 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +      L+    + +   Y +     ++N  + ++  ++  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+   ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   + +TL++ LD+I++EFG +  + VS  +            +  ++E++   M  F   + +D L  E   +   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K
  S:     8 QKWVANDKLDSALRKQLTNMEANEKELEDSF-YRNMEFGTAGMRGVLGVGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIDYINAVEDIF-SVEVANQEVLIENGLLEVISEKVDRPYLKKLKEVIVNKELVQEHGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNLDGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGRTLLEDLDQIYDEFGYYNEDLVSLTLSGKDGSQRIKEITSGFREQLPTSMGGFLVERVEDYLRSETTWVATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESTAKLEKVK 567
>gi|125973780|ref|YP_001037690.1| alpha-phosphoglucomutase [Clostridium thermocellum ATCC 27405] >gi|125714005|gb|ABN52497.1| alpha-phosphoglucomutase [Clostridium thermocellum ATCC 27405] (578 aa)
Score = 644, Expect = 4.7e-65, Identities = 172/529 (32%), Positives = 296/529 (55%)
  Q:    19 LSKAWLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM---DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSY---------KIESL--NWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP-------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           L K W+E++    + K+  L +K N +EI++ F Y  L FGT G+R  +G GTN+IN++T ++ S+G+A ++ +    +  + +A+D+R  +  +A+  AK     GIK FL+ E  ++ TP +S++VR     A ++ TASHNPK Y G+KVY   GGQ+    +N+++S + + + I     ++        L+      I + Y         N  +  +  K F ++ T  HG  +  +  +L  IG++N+++  +Q +PD  F+   + NPE++ +F+L+++ A+K   ++++G DPD DR+ +VVR+K  ++  LTGNQ G +   Y+L+ KK      +  FVV T V+T     I + YN ++    TGFK++G ++ K +D+     ++ GFEE+ G L     RDKD   A+ L  E+      +  TL + L E+ E++G       S+         KI+S   N +E    K  ++  V  +D L  E   +            +  L + L++  W   R SGTEPK KIYY +  ++ +   + LK L+D
  S:     6 LYKFWVENDYFDAETKKELLSIKDNPKEIEERF-YKDLEFGTGGLRGIIGAGTNRINIYTVRKASQGLADYIKSLGLQDRGIAIAYDSRYKSPEFALEAAKVFAGNGIKAFLFDE--LRPTPELSFTVRHLNAAAGVVITASHNPKEYNGYKVYGEDGGQLPVEASNKVISYINKIEDITQVKVMEKDEAIEKGLLRIIGKEIDDEYISKLKTLSANPELAAEIGKTFKIVYTPLHGAGNKPVRRILDEIGFKNVLVVKEQELPDSEFSTVKSPNPEEREAFELAIELAKKENVDLIIGTDPDCDRVGIVVRNKEGEYVPLTGNQTGCLLLEYILSQKKQRGELPENGFVVKTIVTTELARAITDAYNVELVEVLTGFKFIGEKI-KQLDEFGDKKYLFGFEESYGYLAGTFARDKDAVVASMLIAEMAAYYKSRGLTLYEGLMELLEKYGYTLEGITSFTLKGKDGVEKIKSAMKNLRENRVVKFGEYEAVAVRDYLTSERYEVATGAKEKLTLVESDVLYYELKDKAWFCIRPSGTEPKIKIYYGVTEKSMDAAKEKLKHLQD 566
>gi|153168583|ref|ZP_01928406.1| hypothetical protein LMHG_01524 [Listeria monocytogenes FSL N1-017] >gi|133726146|gb|EBA27844.1| hypothetical protein LMHG_01524 [Listeria monocytogenes FSL N1-017] (576 aa)
Score = 644, Expect = 5.1e-65, Identities = 162/529 (30%), Positives = 297/529 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++    ++     +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+   ++  L+GNQ+G I  HY+L  KK          V+ + V++N    I + Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   +  +L++ L++I+ EFG +  + VS  +            + N++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMETNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGDEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNLDGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEITKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGGSLLEDLEQIYAEFGYYKEDLVSLTLSGKDGSRRIKEITSNFREQLPTSMGGFPVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESATKLEKVKADL 570
>gi|24379514|ref|NP_721469.1| putative phosphoglucomutase [Streptococcus mutans UA159] >gi|24377454|gb|AAN58775.1|AE014945_12 putative phosphoglucomutase [Streptococcus mutans UA159] (571 aa)
Score = 642, Expect = 7.8e-65, Identities = 163/516 (31%), Positives = 280/516 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNK-----DILGLE---------IKGIR--WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + WL   ++ +   + +L M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ +  K  +     V +A+D+R  +  +A   A+ L   GIK ++++   ++ TP +S++VR  G  A I+ TASHNP  + G+KVY   GGQ+   +A+ +   +     P    + D   +    LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q VPDP+F+   + NPE++ +F L+ +   +  A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K          +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+ G L     RDKD  QA  +  E+      +  TL D +DEI++E+G +  +T+S  +  ++   E+++ MDKF     K     D++ LE           GI      P+  L++ L +  W+  R SGTEPK K Y    G   E
  S:     8 QKWLAYAKLPDYLHQELLAMDEKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAQLIETKGDDVKKRGVAIAYDSRHFSQEFAFESAQVLAKHGIKAYVFE--SLRPTPELSFTVRHLGTFAGIMVTASHNPAPFNGYKVYGEDGGQMPPFDADALTDFIRAINDPFSIELADLEESKASGLIEVIGEAVDTDYLKEVKDVNINQKLIDEYGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQAVPDPDFSTVKSPNPENQEAFRLAEELGRQVDADVLVATDPDADRLGVEIRQADGSYKNLSGNQIGAIIAKYILEAHKTAGSLPTNAALCKSIVSTELVSKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEESFGYLIKPFVRDKDAIQAVLIVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGATEIKKIMDKFRGDAPKQFNATDVVKLEDFQAQTATTADGIEKLTTPPSNVLKYILSDASWIAVRPSGTEPKIKFYIATVGNNSE 553
>gi|16801680|ref|NP_471948.1| hypothetical protein lin2618 [Listeria innocua Clip11262] >gi|16415155|emb|CAC97845.1| lin2618 [Listeria innocua] (576 aa)
Score = 642, Expect = 7.9e-65, Identities = 165/532 (31%), Positives = 296/532 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIY--RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN-----------WKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK-DEFEYM 552
           + W+ +  +    K+ ++ +  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   + D      L+    + +   Y E     ++N  +   R K+  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE+K +F L+++Y +K+  +I++G DPD+DRL V VR+ + ++  L+GNQ+G I  HY+L  KK      +   V+ + V++N    IA+ +  ++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   + +TL++ L++I+ EFG +  + VS  +   +           ++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE +    Q L+ +K D  +Y+
  S:     8 QKWITNKELDESLKKQLVDIEKNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRFLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIDYISAVEDIF-SVEVADQDELIEKGLLEIISEKVDRPYLEKLKEVIVNNELVQERGKDLKIVFTPLHGTGGILGVPALESVGFTNIVKVEEQFVNDPDFGTVKSPNPENKEAFSLAIEYGKKHDGDILVGTDPDADRLGVAVRNNDGEYEILSGNQIGAIILHYLLKQKKAQNELPENAAVLKSIVTSNLGTEIAKHFGVQMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKSFTRDKDAIQAVLAISEVALVSKTEGRTLLEELEQIYAEFGYYKEDLVSLTLSGKDGSERIKEITSGFREQLPTSMGGFRIERAEDYLRSETTWIETGKTEEIQLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGENEAESTQKLEKVKADLMQYI 574
>gi|187776972|ref|ZP_02993445.1| hypothetical protein CLOSPO_00516 [Clostridium sporogenes ATCC 15579] >gi|187775631|gb|EDU39433.1| hypothetical protein CLOSPO_00516 [Clostridium sporogenes ATCC 15579] (575 aa)
Score = 641, Expect = 1.1e-64, Identities = 177/513 (34%), Positives = 290/513 (56%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNP-TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDK-----FANVKNKDIL-------GLEIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +E+EI   F    LSFGT GIR  +  GTN+IN +T  + ++G+A +L+ N +  P +V +A+D R ++  +A + ++ L S  IKV+++ +  I  TPI+SY+VRE    A I+ TASHN K Y G+KVYNH G QI D EA +I   + + + +     +D       DL  +    +   YF      ++  +I +  + +F ++ T  HGT +  +   L  IGY N+ +   Q  P+ NF      NPED  +F  SLK AE    +I++  DPD DR+ V+VR H  K+  LTGN++GII T+Y+L++    KK  +   ++ T V+T+ +  I + Y  KV    TGFK++G ++   K   +  F+ GFEE+ G L  D  R+KDG  ++ L  E+     +Q + L D L ++++++G +  + +S + +    K +++  ++      F  + +++IL       GL+I   +  E       +  L++YL ND     R SGTEPK KIY      T E  +  +  L+   + M+
  S:    29 DEQEIKDRFC-KDLSFGTGGIRGIVSLGTNRINKYTIAKATQGLANYLMHNFEEKPLSVAIAYDCRNDSLDFAKIASEVLCSQDIKVYMFSD--IMCTPILSYAVRELKCKAGIVITASHNSKEYNGYKVYNHNGNQITDREAQKIAECIGKVEDLSRIKHMDISDAKEKDLYKFVPIEVLNKYFYNVKNLILRKDIIKNYESDFKILYTPLHGTGNVPVRRALCEIGYNNVFVVKDQEKPNGNFPTVKYPNPEDHKAFYASLKEAENINPDIIIATDPDCDRVGVMVRDHSEKYVALTGNELGIILTNYILSSLEEEKKIPENSVLLKTIVTTDMVKNICKDYGVKVEEVLTGFKYIGEKIEEFKKNGQNKFIFGFEESYGYLFGDFVREKDGIISSVLICEMALYYKNQNENLCDVLRDLYDKYGYYKEKLISMEFKGEEGKNKIENIINNLRIYDFKTIFDEEILIKEDYKTGLKINMNKKEEYINKLPKSNVLKFYLNNDTNFVVRPSGTEPKIKIYLASVDTTVEGAEMKINNLEKNIKNMI 572
>gi|118726615|ref|ZP_01575237.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Clostridium cellulolyticum H10] >gi|118663972|gb|EAV70612.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Clostridium cellulolyticum H10] (576 aa)
Score = 641, Expect = 1.1e-64, Identities = 168/524 (32%), Positives = 287/524 (54%)
  Q:    23 WLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKKFD-KTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ------------------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           WL++       K   L +K N +E++  F Y  L FGT G+R  +G GTN+IN++T +  S+G+A ++    K +  +++A+D R  +  +++  AK   + GIK +L+ E  ++ TP +S++VR     A ++ TASHNPK Y G+KVY   GGQ+    +N ++S + +        II      +  L+      I ++Y E   +  IN +   +    F ++ T  HG  +  +  +L   G++ +++  +Q +PD  F+   + NPE++++F+L++K A     ++++G DPDSDR+ VVVR KN   Y  LTGNQ G +   Y+LT  K + K P   FVV T V+T     IA+ YN ++    TGFK++G ++    +     ++ GFEE+ G L     RDKD   A+ L  E+      +  +L D L  ++E++G +     S+ +E  +   +++E +      K +   G+++K IR  + ++                   L + +E+  W   R SGTEPK KIYY +   T  +    L+  K
  S:    10 WLDNEYFDQDTKNELLSIKNNAKEVEDRF-YKSLEFGTGGLRGIIGAGTNRINIYTVRVASQGLANYINQMGKQDKGIVIAYDPRFMSPEFSLEAAKVFCANGIKAYLFDE--LRPTPQLSFAVRYLKAAAGVVVTASHNPKQYNGYKVYGEDGGQLSIDGSNAVISEINKITDITKVNIISKEDAASKGLLQIIGSEIDDAYIEMLKKLRINKDAVSKVADTFKIVYTPLHGAGNKPVRRILAESGFKEVLVVKEQELPDSQFSTVKSPNPEERSAFELAIKLASDNNVDLIIGTDPDSDRVGVVVR-KNDGEYAVLTGNQTGCLLLEYILTAMKEEGKLPANGFVVKTIVTTELARIIADFYNVELVEVLTGFKFIGEQIKLRDENGNQKYLFGFEESYGYLAGTDVRDKDAVVASMLVAEMAAYYKVKGISLYDALTNLYEKYGYFVEGISSFTLEGKDGVMKIKEALTTMRKTKYESFGGIKVKAIRDYQKSERHVIASGATEKITLPESDVLYFEMEDGSWFCVRPSGTEPKIKIYYGVSDRTLNLSQDKLEKFK 565
>gi|29346958|ref|NP_810461.1| phosphoglucomutase phosphomannomutase [Bacteroides thetaiotaomicron VPI-5482] >gi|29338856|gb|AAO76655.1| phosphoglucomutase phosphomannomutase [Bacteroides thetaiotaomicron VPI-5482] (581 aa)
Score = 641, Expect = 1.2e-64, Identities = 166/500 (33%), Positives = 269/500 (53%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTN-IYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-ANVK-----NKDILGLEIKGIRWN------------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           K ++   ++ E+ + F Y  L FGT G+R  MG G+N++N++T    ++G++ +L  N K  P  +V+V HD R N+  +A   A   ++ GIKV+L+  + ++ TP +S+++R  G  + II TASHNPK Y G+K Y   G Q+L      I+  +    +  D  +  N DLI    + I + Y +      I+   I R K+  ++ T  HGT    +P  LK  G+EN+    +Q + D NF    + NPE+  +  +++  A++  A++++  DPD+DR+ +  +  K +W  + GNQ  +++ +Y+LT      K     F V T V+T  I +IA+K N ++    TGFKW+  E+     K  ++ G EE+ G L  D  RDKD   A  L  EV     D  K+L   L +I+ E+G     TV+      +  EE++  M+ F AN       +K IL  + K ++              E +  L+++ E+   V  R SGTEPK K Y E+ GE
  S:    31 KRMLENEDKTELIEAF-YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYLKKNFKDLPQISVVVGHDCRNNSRLFAETSANIFSANGIKVYLF--DDMRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDAGIIDEVNNIASAADIKFKGNPDLIQIIGEDIDKIYLDMVKTVSIDPEAIARHKDMKIVYTPIHGTGMMLIPRALKMWGFENVFTVPEQMIKDGNFPTVISPNPENAEALSMAVNLAKEIDADLVMASDPDADRVGIACKDDKGEWVLINGNQTCMMYLYYILTQYKQLGKIKGNEFCVKTIVTTELIKKIADKNNIEMLDCYTGFKWIAREIRLREGKKKYIGGGEESYGFLAEDFVRDKDAVSACCLIAEVAAWAKDNGKSLYQLLLDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMENFRANPPKELGGSKVILSKDYKTLKQTDAEGKVTDLDMPETSNVLQYFTEDGSKVSVRPSGTEPKIKFYMEVQGE 554
>gi|172056711|ref|YP_001813171.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Exiguobacterium sibiricum 255-15] >gi|171989232|gb|ACB60154.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Exiguobacterium sibiricum 255-15] (578 aa)
Score = 640, Expect = 1.4e-64, Identities = 166/509 (32%), Positives = 286/509 (56%)
  Q:    22 AWLESNRISNKY--------KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTII------DNVYTPNMDLISYFDDTITESYFE--ASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------KGIRWNEP-------AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +W E+ +  N++        +EL    N+++  +   Y +L FGT G+R  +G GTN++NV+T ++ S+G A ++  +        +++AHD+R  +  +A+  AKTL S GIK +L+  + ++ TP +S++VRE      I+ TASHNP  Y G+KVY + GGQ+   EA+++VS + +    +      + V   N  LI    + + ++Y E   + R L            ++ T  HGT    +   LKS G+E++ +  +Q  PD  F   ++ NPE+ A+F L+++Y ++  A+++L  DPD+DR+ V  R  + +W  LTGNQ G +   Y+L+ K       K  FV  T V++     IA  Y+  V  T TGFK++G ++ ++ +  + +++ G+EE+ G L  D  RDKD  QA  LA E+      + +TL + L  I+E+FG +     S  ++  +   ++   MD F     K + G ++             +  ++P       +  L++ LE+  W   R SGTEPK K Y+ +
  S:     2 SWKETYQKWNQFAGLETELKEELTALANDDKAAEEAFYKELEFGTGGMRGEIGVGTNRMNVYTVRKASQGFADFIKAEGDEAVAQGIVIAHDSRHYSPEFALEAAKTLASNGIKAYLF--DGLRPTPELSFAVRELRAAGGIVITASHNPPEYNGYKVYGNDGGQLPPKEADDLVSYVDQVADELSIELEAEEVLRAN-GLIVRVGEQLDDAYQEQLKTIRVLPTIQDELADPLKIVFTPLHGTGLVPVTVGLKSYGFEHVTVVEEQAKPDGAFPTVSSPNPEEHAAFKLAIEYGDRVDADVLLATDPDADRVGVATRDADGEWVVLTGNQTGALLLDYILSQKAAQGTLPKNGFVAKTIVTSELGALIARHYDLHVENTLTGFKFIGEKIKQYNESGEYEYLFGYEESYGYLIGDFCRDKDAVQACLLAAEMTAYHKKEGRTLYEALQAIYEQFGYFEESLRSLTLKGKDGVAQIGRIMDTFREHPPKQVAGEKVILFEDYDASISHDLVKHQPSPINLPKSNVLKFTLEDGSWFCLRPSGTEPKIKFYFSV 551
>gi|116873839|ref|YP_850620.1| phosphoglucomutase/phosphomannomutase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742717|emb|CAK21841.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (576 aa)
Score = 640, Expect = 1.6e-64, Identities = 164/512 (32%), Positives = 288/512 (56%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM---DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN-----------WKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK-DEFEYM 552
           +E+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +     I  +V   N D      L+    + +   Y E     ++N  +  Q  ++  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE+K +F L+++Y +K+  +I++G DPD+DRL V VR+K+ ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ +  ++    TGFK++  ++ KH ++     F  G+EE+ G +     RDKD  QA     EV  +   + +TL++ L++I+ EFG +  + VS  +   +           ++E++   M  F   + +D L  E   I+  +        A  ++ YLE+  W   R SGTEPK K Y+ I GE +E   Q L+ +K D  +Y+
  S:    30 DEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASYGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRFLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPNGASAVIDYINAVDDIF-SVEVANQDELIKNGLLEVISEKVDRPYLEKLKEVIVNNELVEQHGQDLKIVFTPLHGTGGILGVPALQSVGFTNIVKVEEQFVNDPDFGTVKSPNPENKEAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNKDGEYEILSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHFGVEMIEVLTGFKFIAEQI-KHFEETGTHTFEFGYEESNGYMVKPFTRDKDAIQAVLAISEVALVSKTEGRTLLEDLEKIYAEFGYYKEDLVSLTLSGKDGSERIKEITSGFREQLPTSMGGFRIERAEDYLRSETTWIKTGKTEVIHLPTADVIKCYLEDGSWFCLRPSGTEPKIKFYFSILGENEEESTQKLEKIKADLMQYI 574
>gi|167771393|ref|ZP_02443446.1| hypothetical protein ANACOL_02759 [Anaerotruncus colihominis DSM 17241] >gi|167666033|gb|EDS10163.1| hypothetical protein ANACOL_02759 [Anaerotruncus colihominis DSM 17241] (569 aa)
Score = 639, Expect = 1.8e-64, Identities = 154/499 (30%), Positives = 266/499 (53%)
  Q:    35 ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL------ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-----EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP----------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           E I   ++E  D++  Y  LSFGTAG+R  +G GTN++N++T ++ ++G+A +L  +  +PTV +++D+R+ +D ++   A  L + GI V++Y+E  +   P +S++ R    DA I+ TASHNP  Y G+KVY   G Q+ ++ A+ +++ +     + D++ T + +       I Y   TI + + E      +N  I  +    ++ +  +G  +  +  +L+ IG  ++ + A+Q  PD NF      NPE K +    L  A +  A++ML  DPD DR+ + V+  + +  LTGN +G +   Y+  N+       K P  V+T VST   + I + Y  +V    TGFK++G      E   H ++  F+ GFEE+ G L+    RDKD    + L +E+ +    +  TLVD L+++++ FG +     +++ E     ++M   MD       K + G ++      E                 +  LE+ L N      R SGTEPK K+Y    G+
  S:    25 EAIKGKDDEIFDRF--YRDLSFGTAGLRGVLGAGTNRMNIYTVRRATQGLANYLNAQAKHPTVAISYDSRIKSDRFSKEAAGVLAANGIHVYIYRE--LMPVPALSFATRALKCDAGIMVTASHNPAKYNGYKVYGCDGCQMTENAADAVLAQINSLD-LFDDIRTLDFEQGIHDGKIEYIAQTIIDQFIENVLSQQVNPGICAKAGLKLVYSPLNGAGNQPVRRVLREIGASDVTVVAEQEHPDGNFPTCPFPNPEIKEALAKGLALARETGADLMLATDPDCDRVGIAVKDGDDYRLLTGNHVGALLFDYICRNRIENGTMPKDPIAVTTIVSTKLTNAIGKAYGVEVINVLTGFKYIGEQIAIVEAQGHPER--FIFGFEESYGYLSGTYVRDKDAVVGSMLIVEMASWYKQKGMTLVDALNDLYKRFGLYCESVANFQFEGAEGMKKMAAIMDGLRAHPPKQLGGSDVVSTSDYEASTVVSAEETRPISLPKSNVLEYALANGCTAIVRPSGTEPKIKLYLSAVGK 547
>gi|153197219|ref|ZP_01941489.1| hypothetical protein LMRG_01773 [Listeria monocytogenes 10403S] >gi|127633270|gb|EBA22687.1| hypothetical protein LMRG_01773 [Listeria monocytogenes 10403S] (576 aa)
Score = 639, Expect = 1.9e-64, Identities = 161/529 (30%), Positives = 296/529 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+ + ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   +  +L++ L++I+ +FG +  + VS  +            + +++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMETNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNADGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGGSLLEDLEQIYADFGYYKEDLVSLTLSGKDGSRRIKEITSSFREQLPTSMGGFPVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGENKEESTAKLEKVKADL 570
>gi|163789800|ref|ZP_02184237.1| phosphoglucomutase/phosphomannomutase family protein [Carnobacterium sp. AT7] >gi|159875022|gb|EDP69089.1| phosphoglucomutase/phosphomannomutase family protein [Carnobacterium sp. AT7] (575 aa)
Score = 639, Expect = 2.0e-64, Identities = 163/506 (32%), Positives = 285/506 (56%)
  Q:    22 AWLESNRISNKYKELILKMNEE---------EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS-----YFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI--------RWNE---------PAQALEWYLENDMWVKFRLSGTEPKFKIY 527
           +W E+ ++   + +L +++  E          ++  F Y+ L FGTAG+R  +G G N++N +T +Q +EG+AR+   L ++     V +A+D+R  +  +AM  AKTL + GI  F+++   ++ TP +S++VR     A I+ TASHNP  Y G+KVY   GGQ+   EA+ +   +   + +++       DL+S        + +   Y E      +N  + ++  K   ++ T  HGT        LK+ G+E+I L  +Q   DP+F+   + NPE+  +F+ ++K  ++  A++++  DPD+DRL + V+  ++ HY  LTGNQ+  +  HY+LT ++          V+ + VS+    +IAE +N ++    TGFK++  ++ ++       F+ GFEE+ G L S   RDKD  QA  L  EV      +  TL D L +IF  +G +  +T+S  ++ +   E+++  M KF     ++  G+E+  +        R  +         PA  L++ L ++ W+  R SGTEPK K Y
  S:     2 SWRETYQLWENFNDLEMELKNELKSLKDDSDTLEDAF-YAPLEFGTAGMRGIIGAGVNRMNAYTVRQATEGLARFMDSLGDETKKRGVAIAYDSRHKSPEFAMEAAKTLGAHGIPAFVFE--SLRPTPELSFAVRHLNAFAGIMITASHNPAAYNGYKVYGEDGGQMPPKEADALTEYVRSVENMLEIEVLSKEDLLSKGLLTMIGEDVDSEYLENVKSVTVNPALVKEMSKEMKLVYTPLHGTGKMIGEKALKNAGFESIYLVPEQAEADPDFSTVKSPNPEEPGAFEYAIKLGKEIDADVLVATDPDADRLGIAVK-TSEGHYEVLTGNQIASLMLHYLLTAQQEAGTLPANGVVLKSIVSSELPTQIAESFNVQMVDVLTGFKFIAEKIKQYETDGSKTFLFGFEESYGYLVSPFVRDKDAIQALVLIAEVAAYYKQKGDTLYDGLKQIFHNYGHYKEKTISISMQGITGAEKIKALMVKFREESPEEFAGIEVAYVEDFSISKRRLADGTVEEIDLPPADVLKYTLVDNSWIAIRPSGTEPKIKFY 547
>gi|89097697|ref|ZP_01170585.1| phosphomannomutase [Bacillus sp. NRRL B-14911] >gi|89087556|gb|EAR66669.1| phosphomannomutase [Bacillus sp. NRRL B-14911] (623 aa)
Score = 637, Expect = 3.5e-64, Identities = 167/544 (30%), Positives = 293/544 (53%)
  Q:     6 EKNPSSMHANVNPLSKAWL-ESNRISNKYKELI-LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN-----MDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHI--DKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDIL-GLEIKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           E+ P     +    ++ WL  +N  S+  +EL  L++++  ++  F Y  L FGT G+R  +GPGTN++N++T ++ + G+A ++    +        +A+D+R  +  +AM  AKTL + GI+ +++  N ++ TP +S++VR     A ++ TASHNP  Y G+KVY   G Q+    A+ ++  + E +  +              LI+   + + ++Y E       N  +  + +  V+ T  HGTA   +  +L ++ Y ++    +Q VPDP F+   + NPE+ A+F+L++K   +  A++++  DPD+DRL + V+  + ++  LTGNQ G I  HY+L  KK   T      ++ T V++    +IAE ++ +V    TGFK++  ++N     +   F+ G+EE+ G L  D  RDKD  QAA LA E       +  +L D L  I++E+G +     S  ++     E +QE +  F             ++ +D L GL        EP     +  +++  E+  W+  R SGTEPK K Y+ +     E   + L  L++EF
  S:    32 ERQPGGKEMDWKQKAEKWLGYANMDSSLQQELAELRLDDSRMEDAF-YKDLEFGTGGMRGEIGPGTNRMNIYTVRKAAAGLASYIETYGAEAKKRGAAIAYDSRYMSKEFAMETAKTLATRGIRAYVF--NGLRPTPELSFAVRYLQAFAGVVITASHNPPEYNGYKVYGEDGAQLPPESADIVIEKVNEIENELLIEAAEEETLLEQGLITMIGEEVDQAYQEKLKTISENPALGSETDIKVVFTPLHGTAGKPVQDILAAMDYRHVYTVEEQAVPDPGFSTVKSPNPEEHAAFELAIKLGNEVGADLLIATDPDADRLGIAVKDDRGEYTVLTGNQTGAILLHYILNEKKAKGTLPSNGAMLKTIVTSELGAKIAESHDVEVMDVLTGFKFIAEKINAFYKENSYKFLFGYEESYGYLIGDFARDKDAVQAALLATEACAFYKKKGMSLYDALMAIYKEYGYYLEGLRSLTLKGKQGAELIQETLASFRRDPIESLGEWKVLRMEDYLTGLAKPATGEEEPIGLPKSNVIKYLFEDGSWICLRPSGTEPKIKFYFGVNSTGLEESREKLAKLENEF 606
>gi|91217901|ref|ZP_01254855.1| putative phosphoglucomutase [Psychroflexus torquis ATCC 700755] >gi|91183994|gb|EAS70383.1| putative phosphoglucomutase [Psychroflexus torquis ATCC 700755] (571 aa)
Score = 635, Expect = 5.6e-64, Identities = 171/533 (32%), Positives = 291/533 (54%)
  Q:    20 SKAWLES--NRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCL-INTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------KGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--ETKEICDQILKALKDEFEYM 552
           +K WL    ++ +NK  + ++    E +++ F +  L FGT G+R  MG GT++IN +T  + ++G++ ++ +        V++A D R N+  +A  +A   ++ GI+ +++ E  ++ TP++SYSVR  G    I+ TASHNP  Y G+KVY   GGQ++  +  +I+S +       D  +    DLI   DD++ ++Y + +   +  N     +KN  +  T+ HGT+   +P LL++ GY N+ L + Q  PDP F    + NPE+  +  L+LK A + ++++ +G DPD DRL + VR+ K +   L GNQ  ++ T Y+L   K      ++ F+ ST VST  +  + E Y  K   + TGFKW+  ++ K    +D++ G EE+ G +  D  RDKD   A  L  E+   L  +  ++ + L +I+ E G +    VS     +   +E++ KM +  N   K+I G E+           K ++ +E        +  L +Y EN   V  R SGTEPK K Y  +    +TK   ++I   L  + E++
  S:     8 AKEWLTETFDKTTNKEVQDLMDSKSELLEESF-FQDLGFGTGGMRGIMGVGTSRINKYTLGKNTQGISNYMKSVFPDEKLKVVIAFDCRHNSMEFAHQVAGVFSANGIQAYIFPE--LRPTPLLSYSVRHLGCQCGIMLTASHNPPEYNGYKVYWEDGGQLVPPQDLDIISEI-NALNFSDINFESQSDLIEVLDDSVEKAYLKKAVENVNFNLPAESKKNLNITFTSLHGTSITTVPQLLENAGYPNLNLVSSQSEPDPEFPTVKSPNPEEPDALKLALKLANEKKSDLAIGTDPDGDRLGIAVRNRKGELTLLNGNQTMVLMTWYLLEKVKESNSLKESHFIASTIVSTPLMRVLTEAYGVKYMESLTGFKWIA-KLIKDNPTLDYIGGGEESFGYMVGDFVRDKDANTAILLVCEMAAELKSKGSSIYEQLIDIYIEHGFFKEHLVSLVKSGIEGAKEIKAKMIELRNNPPKEINGEEVVLIEDYQTSIAKNMQSHETHNINLPKSNVLIYYTENGTKVAARPSGTEPKIKFYISVNSTLKTKNDFEEIDSELSSKIEHI 565
>gi|154490834|ref|ZP_02030775.1| hypothetical protein PARMER_00751 [Parabacteroides merdae ATCC 43184] >gi|154088582|gb|EDN87626.1| hypothetical protein PARMER_00751 [Parabacteroides merdae ATCC 43184] (582 aa)
Score = 633, Expect = 8.6e-64, Identities = 155/487 (31%), Positives = 268/487 (55%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN---PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYF-EASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-------------------ANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEI 537
           Y  L FGT G+R  MG G+N++N++T    ++G++ +L  + ++     V++ HD R N+  +A + A   ++ GIKV+L+++  ++ TP +SY++R+ G  + II TASHNPK Y G+K Y   G Q++       ++ + + +   +  +  N +LI      I E Y  + +   L   +I R  +  ++ T  HGT    +P  LK+ G+ NII   +Q V   +F    + NPE+ A+  L+++ A++  A ++L  DPD+DR+   V++ + +W  L GNQ  ++F +Y++T      K +   ++V T V+T  I  IAEK   +V+   TGFKW+ + M K+  K +++ G EE+ G L  D  RDKD   A A+  E+     DQ  T+   L  I+ ++G    + +S   +  +  EE++  M  F                   A++K KD +  E   +     +  L+++ E+   V  R SGTEPK K Y E++ + K +
  S:    47 YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYLKKEFADLDQIKVVIGHDCRNNSRKFAEISADIFSANGIKVYLFED--LRPTPEMSYTIRKLGCQSGIILTASHNPKEYNGYKAYWDDGAQMIAPHDKNTIAEVNKIRNASEIKFKGNKELIEIIGKEIDEQYINDLTKISLSPESIARHHDMKIVYTPIHGTGVTVIPPTLKAFGFTNIIHVPEQDVVSGDFPTVVSPNPEEPAALALAVEKAKETDAELVLASDPDADRVGAAVKNNEGEWVLLNGNQTALMFVYYLITRWKELGKINGKEYIVKTIVTTELIRTIAEKNGVEVYDVYTGFKWIADVMKKNEGKKNYIGGGEESYGFLCEDFVRDKDAVSACAILAEIAAWAKDQGITMYQLLQNIYVQYGFSKEKGISVVKKGKSGAEEIEAMMKHFRENPLQEIAGSKVTLFYDYASLKGKDYVENETLTLDMPTTSNVLQYFTEDGTKVSIRPSGTEPKIKFYCEVHSKVKSL 559
>gi|167405315|ref|ZP_02310073.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes FSL J2-003] (576 aa)
Score = 633, Expect = 1.1e-63, Identities = 159/529 (30%), Positives = 297/529 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + W+ ++++ +  ++ +  M  NE+E++  F Y  + FGTAG+R  +G GTN++N++T ++ S G+A+++           +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ +I+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+ + ++  L+GNQ+G I  HY+L  KK          V+ + V++N    IA+ Y A++    TGFK++  ++ KH +   +  F  G+EE+ G +     RDKD  QA     EV  +   +  +L++ L++I+ +FG +  + VS  +            + +++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     8 QKWVANDKLDSTLRKQLTNMETNEKELEDSF-YRNMEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTSIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNADGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQI-KHFEETGRHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGGSLLEDLEQIYADFGYYKEDLVSLTLSGKDGSRRIKEITSSFREQLPTSMGGFPVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESTAKLEKVKADL 570
>gi|125718025|ref|YP_001035158.1| phosphoglucomutase [Streptococcus sanguinis SK36] >gi|125497942|gb|ABN44608.1| Phosphoglucomutase [Streptococcus sanguinis SK36] (572 aa)
Score = 632, Expect = 1.2e-63, Identities = 165/534 (30%), Positives = 287/534 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K WL+   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR L+ +K +      V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR  G  A I+ TASHNP  + G+KVY   GGQ+   +A+ +   +     P    + D        LI    D I   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q V DP+F+   + NPE +A+F L+ +   K  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K   T      +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF +   K+     I                        P+  L++ L +  W+  R SGTEPK K Y  + G++ E     + A++ E    ++
  S:     8 KKWLDYAELPDYLRQDLNSMDEKTKEDAF-YTNLEFGTAGMRGLIGAGTNRINIYVVRQATEGLAR-LIEEKGDEFKKRGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLGTFAGIMITASHNPAPFNGYKVYGEDGGQMPPHDADALTDYIRAIENPFAIEVADVEAEKASGLIEVIGDAIDAEYLKEVKDVNINEKLIDEYGKDMKIVYTPLHGTGEMLARRALAQAGFDSVEVVEAQAVADPDFSTVKSPNPESQAAFALAEELGRKVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKSAGTLPANAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYFAEKTISVTLSGVDGAEQIKAIMAKFRDNAPKEFNATAISVTEDFKAQTSTAADGTVTALTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGDSNEDAQAKIAAIEAEINDFIK 572
>gi|187777397|ref|ZP_02993870.1| hypothetical protein CLOSPO_00953 [Clostridium sporogenes ATCC 15579] >gi|187774325|gb|EDU38127.1| hypothetical protein CLOSPO_00953 [Clostridium sporogenes ATCC 15579] (573 aa)
Score = 632, Expect = 1.2e-63, Identities = 175/528 (33%), Positives = 295/528 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK---SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL+++ I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++N++   ++++G+A ++  K    +N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I      +    + +TI +     +  L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +LK  G+ NII+  +Q  PDP+FT     NPED  +F  +    ++  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K   +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K+ +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    GE+ +  ++ +KA++ E
  S:     8 KEWLDNDYIDEDTKKELKEIINNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNIYNISKVTQGLANYIKEKGEEYTNRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLSQIANGITEKIKSIGKFSDIKTISEEEALKS-GLLNILGEDIDFEYIEKVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLKERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFKYAENLGKEVGAELLIATDPDCDRLAIEVKDKNGEYLAFNGNQTGAILINYIVSNMKEMGKLPKGAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYKTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKKRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCRIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGESIKAAEEKIKAIEKE 564
>gi|168183697|ref|ZP_02618361.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum Bf] >gi|182673169|gb|EDT85130.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum Bf] (573 aa)
Score = 632, Expect = 1.4e-63, Identities = 175/528 (33%), Positives = 294/528 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL+++ I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++N++   ++++G+A ++  K     N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I      +    + +TI +     +  L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +LK  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K   +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K+ +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    G++ +  ++ +KA++ E
  S:     8 KEWLDNDYIDEDIKKELKEIINNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNIYNISKVTQGLADYITEKGGEYINRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLSQIANGITEKIKSIGKFSDVKTISEEKALKS-GLLNILGEDIDFEYIERVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLKERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFRYAENLGKKVDAELLIATDPDCDRLAIEVKDKNGEYLAFNGNQTGAILINYIVSNMKEMGKLPKGAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYKTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKKRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCKIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGKSIKAAEEKIKAIEKE 564
>gi|168181086|ref|ZP_02615750.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum NCTC 2916] >gi|182668072|gb|EDT80051.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum NCTC 2916] (573 aa)
Score = 631, Expect = 1.5e-63, Identities = 175/528 (33%), Positives = 294/528 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL+++ I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++N++   ++++G+A ++  K     N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I      +    + +TI +     +  L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +LK  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K   +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K+ +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    G++ +  ++ +KA++ E
  S:     8 KEWLDNDYIDEDIKKELKEIINNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNIYNISKVTQGLADYITEKGEEYINRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLSKIANGITEKIKSIGKFSDIKTISEEKALKS-GLLNILGEDIDFEYIERVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLKERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFRYAENLGKKVDAELLIATDPDCDRLAIEVKDKNGEYLAFNGNQTGAILINYIVSNMKEMGKLPKGAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYRTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKKRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCKIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGKSIKAAEEKIKAIEKE 564
>gi|148381556|ref|YP_001256097.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. ATCC 3502] >gi|153932578|ref|YP_001385933.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. ATCC 19397] >gi|153936275|ref|YP_001389340.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. Hall] >gi|148291040|emb|CAL85177.1| putative phosphoglucomutase/phosphomannomutase [Clostridium botulinum A str. ATCC 3502] >gi|152928622|gb|ABS34122.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. ATCC 19397] >gi|152932189|gb|ABS37688.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A str. Hall] (573 aa)
Score = 631, Expect = 1.5e-63, Identities = 175/528 (33%), Positives = 294/528 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL+++ I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++N++   ++++G+A ++  K     N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I      +    + +TI +     +  L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +LK  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K   +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K+ +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    G++ +  ++ +KA++ E
  S:     8 KEWLDNDYIDEDIKKELKEIINNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNIYNISKVTQGLADYITEKGEEYINRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLSKIANGITEKIKSIGKFSDIKTISEEKALKS-GLLNILGEDIDFEYIERVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLKERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFRYAENLGKKVDAELLIATDPDCDRLAIEVKDKNGEYLAFNGNQTGAILINYIVSNMKEMGKLPKGAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYKTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKKRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCKIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGKSIKAAEEKIKAIEKE 564
>gi|153939481|ref|YP_001392975.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum F str. Langeland] >gi|152935377|gb|ABS40875.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum F str. Langeland] (573 aa)
Score = 631, Expect = 1.8e-63, Identities = 175/528 (33%), Positives = 294/528 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL+++ I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++N++   ++++G+A ++  K     N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I      +    + +TI +     +  L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +LK  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K   +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K+ +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    G++ +  ++ +KA++ E
  S:     8 KEWLDNDYIDEDIKKELKEIINNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNIYNISKVTQGLADYITEKGEEYINRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLTQIANGITEKIKSIGKFSDIKTISEEKALKS-GLLNILGEDIDFEYIERVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLKERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFRYAENLGKKVDAELLIATDPDCDRLAIEVKDKNGEYLAFNGNQTGAILINYIVSNMKEMGKLPKGAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYKTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKKRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCRIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGKSIKAAEEKIKAIEKE 564
>gi|184154826|ref|YP_001843166.1| phosphoglucomutase [Lactobacillus fermentum IFO 3956] >gi|183226170|dbj|BAG26686.1| phosphoglucomutase [Lactobacillus fermentum IFO 3956] (574 aa)
Score = 630, Expect = 2.1e-63, Identities = 161/522 (30%), Positives = 277/522 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTII-----DNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL-TNKKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----------------RWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQIL 542
           + WL  +++    KE ++ M++++  +   Y  LSFGTAG+R  MGPG N++NV+T +Q + G+A+ + +         V +++D+R N+  +A   A+ L + GIK ++Y  + ++ TP +S++VR     A I+ TASHNPK Y G+K+Y   GGQ+   E++ +   + + + +      D        L     + + ++Y        +N+++  +  K+   + T   GT        LK  G+ N  L  ++  P+ +F    N NPE   +F  +    +K  A+I++  DPD+DRL   VR  N ++  LTGNQ+  +  HY+L  NK+    P     V + VSTN+  +IA+ Y   +    TGFKW+ ++++++  K +  F+ GFEE+ G L     RDKD  Q   L  EV      +E TL D + E+F ++G +  +T+S     +    ++   M KF     +D  G++I+                  +   P +  L + L ++ W+  R SGTEPK K Y    G + +  +Q L
  S:     8 QEWLNQDQLEPALKEQLVAMDDDQEKEDAFYGPLSFGTAGMRGLMGPGINRMNVYTVRQATAGLAKLMTSLGEETMARGVAISYDSRNNSRLFAHEAARVLGAQGIKTYIY--DDLRPTPELSFAVRHLHTYAGIMITASHNPKEYNGYKIYGEDGGQMPPKESDMMTGYIRQIEDLFNIELADEEELKAQGLEVVIGEEVDQAYLANVKTVTVNSDLATEFGKDMKFVYTPLCGTGRMLGERALKQAGFTNYELVEEEAAPNGDFPGLKNPNPEFPEAFVRATALGKKVDADILIATDPDADRLGCAVRQPNGEYQLLTGNQIAAVLLHYILEANKQAGTLPDNAAAVKSIVSTNFATKIAQSYGVTMVNVLTGFKWIADQIHQYETKHNHTFMFGFEESYGYLIKPFVRDKDAIQTLVLLAEVAAYYRSREMTLFDGVQELFTKYGYFKEKTISTTYAGVQGPAKIAALMKKFREEAPQDFAGVKIEETEDFAKDTKTLADGTVEKLGMPNSNVLRYVLADETWIAIRPSGTEPKLKFYIGTAGSSNQEANQKL 561
>gi|86142824|ref|ZP_01061263.1| phosphoglucomutase phosphomannomutase [Flavobacterium sp. MED217] >gi|85830856|gb|EAQ49314.1| phosphoglucomutase phosphomannomutase [Leeuwenhoekiella blandensis MED217] (572 aa)
Score = 630, Expect = 2.2e-63, Identities = 164/528 (31%), Positives = 286/528 (54%)
  Q:    12 MHANVNPLSKAWLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK--KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKN-FPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE------------------WYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICD 539
           M++ +   +KAWL S   S    E+  ++  N +E+++ F Y  L FGT G+R  MG GTN+IN +T  + ++G++ +L        P V +A+D R N+   A V+A   ++  IKVFL+ +  ++ TP +S++V+       I+ TASHNP  Y G+KVY   GGQ++  + +EIV+ +        N ++   + I+Y D  + +++ EAS +      + + ++   ++ T  HGT+   +P +L+  GY+N+ +  +Q  P+ NF    + NPE+  +  ++L+ AE+  A+I++G DPD DRL + VR +K K   L GNQ  ++ T ++L    +N K     F+ ST VST  +D +AE Y  +     TGFKW+   +  H ++ +F+ G EE+ G +  D  RDKD   A  LA E+ T    +  +    L +++ + G +  +  S   + ++  EE+++ M          I G ++  I     +++L+                  ++ +    +  R SGTEPK K Y  +  E K + D
  S:     1 MNSEIIEKAKAWLSSTFDSATQNEVQKLIDANADELNESF-YKNLEFGTGGMRGIMGVGTNRINKYTLGKNTQGLSNYLKEAFPGETPKVAIAYDCRNNSKELAQVVADVFSANDIKVFLFSD--LRPTPELSFAVKHLDCHCGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDSEIVAEIESLDYDAVN-FSAKKEHITYIDKDVDQAFIEASLKNGSFAELDKHRDDVTIVFTPLHGTSVTIIPEVLEGAGYKNVHIVEEQRTPNGNFPTVKSPNPEEPEALKMALELAEEKNADIVIGTDPDCDRLGIAVRNNKGKLQLLNGNQTMVVMTDFLLDLYFSNNKPKGNEFIGSTIVSTPMMDVLAESYGVECKLGLTGFKWIAKMIKDHPNQ-NFIGGGEESFGYMVGDFVRDKDAVTATLLACEIVTKAKSEGASFFKKLQDLYVKHGFYKEDLTSLVKKGISGAEEIKQTMIDLRENPLTTINGEQVVQIDDYASSKSLKTTTGTSVDIDIPKSNVLIYHTDQGSRIAARPSGTEPKIKFYISVNDEAKSLED 551
>gi|88711983|ref|ZP_01106070.1| phosphoglucomutase phosphomannomutase [Flavobacteriales bacterium HTCC2170] >gi|88709389|gb|EAR01622.1| phosphoglucomutase phosphomannomutase [Flavobacteriales bacterium HTCC2170] (569 aa)
Score = 630, Expect = 2.3e-63, Identities = 174/534 (32%), Positives = 292/534 (54%)
  Q:    20 SKAWLES---NRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK---FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQA------------------LEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +K+WL     + +  + + L+    EE  D++  Y  + FGT G+R  MG GTN+IN +T  + ++G++ ++  KK+ P     V++A+D R N++  A  +A+ L++  IKVFL+ E  ++ TP +S++VR  G  A I+ TASHNP  Y G+KVY   GGQI+  +  +I+S +       +  +  N +LI   D  + E++  AS   +IN N     + +F ++ T+ HGT+   +P +LK  GY N+ +  +Q  PD NF    + NPE+  +  +++K A+   A++++G DPDSDRL + VR+ + +   L GNQ  ++ T ++L  +K        F+ ST VST  +  +A+ Y  +     TGFKW+  +M K   +  FV G EE+ G +  D  RDKD   A  LA E+      +  +    L + + ++G +  + VS   + ++  EE+++ M  F     K+I G +++ I   + + A                  L +  E+   +  R SGTEPK K Y+ + G   E    I K  + E E  L
  S:     8 AKSWLTDFFDDEVQVEIQNLMANDPEELKDRF--YKNMEFGTGGMRGLMGVGTNRINKYTLGKSTQGLSNYI--KKACPGEEHKVVIAYDCRHNSNTLARTVAEVLSANDIKVFLFSE--LRTTPELSFAVRHLGCHAGIVLTASHNPPEYNGYKVYWTDGGQIVPPQDGDIISEI-NGLAYEEIKFDANEELIEIIDTEVDEAFMNAS---VINGNFNAAGKDDFKIVFTSLHGTSITAIPEVLKRAGYNNVSIVEEQAKPDGNFPTVESPNPEEPEALSMAIKQAKDIGADMVVGTDPDSDRLGIAVRNLEGEMEILNGNQTMMLMTKFLLDQRKAKGMQGNEFIASTIVSTPMMLSLAKAYKVECKVALTGFKWIA-KMIKDFPEQFFVGGGEESFGFMVGDFVRDKDAVTATLLACEIAAAAKAKGSSFYKELIQCYVDYGFYMEKLVSMTKKGISGAEEIKQMMVDFRENPIKEIDGSKVEWIHDYDTSVATNLLNGKTETISVPKSNVLIYTTEDGTRMAARPSGTEPKIKFYFSVNGNLNETGSFIAK--RSELENKL 559
>gi|167749133|ref|ZP_02421260.1| hypothetical protein EUBSIR_00077 [Eubacterium siraeum DSM 15702] >gi|167657906|gb|EDS02036.1| hypothetical protein EUBSIR_00077 [Eubacterium siraeum DSM 15702] (572 aa)
Score = 629, Expect = 2.7e-63, Identities = 167/523 (31%), Positives = 276/523 (52%)
  Q:    14 ANVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL------ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKG-------IRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           AN   L   WLE        K  +  +K  +EEI+  F Y  L FGT G+R  +G GTN++NV+T  + ++G+A +L N  KS+  V VA+D+R+ +D +A   A    + GI   +Y E  +  TP++S++VR  G DA II TASHNP  Y G+KVY   G Q+    A +I+  + E   I  +V + + +       I Y    + + Y     +  I+  +  +    V+ T  +G  +  +  +LK IG  N+++  +Q +PD NFT     NPE K +  L L+  +  + +++L  DPDSDR+ + V   +K+   TGN++G +   Y+   +    T    P  V T V+T+ +  IA KY  ++    TGFK++G +   +    ++  ++ GFEE+ G L     RDKD   A+ L  E+      Q  +LV    +++ ++G +  +  ++  E     ++M   MD   N K   + GL++ G       ++ +             +  + +YLE++  V  R SGTEPK K+YY   G + E
  S:     2 ANTTELYNEWLEKAVKDPDLKTELESVKGKDEEINDRF-YRDLEFGTGGLRGVIGAGTNRMNVYTVGKATQGLANYLKNTGKSDLKVAVAYDSRIKSDVFAKHAASIFAANGITANIYTE--LMPTPMLSWAVRALGCDAGIIVTASHNPAKYNGYKVYGSDGCQVTLEAAEKILGEI-EKLNIFADVKSGDFEQFVNEGKIKYIGQDVIDEYIANVKKQSIHPELCAKSGLKVVYTPLNGAGNKPVRRILKEIGINNVVVVKEQEMPDGNFTTCPYPNPEIKEALHLGLELCKTEKPDLLLATDPDSDRVGIAVPDGDKYVLFTGNEVGAMLLEYICKERTAAGTMPANPVAVKTIVTTDLVKAIAAKYGVELREVLTGFKFIGEQIGFLEAKGEENRYIFGFEESYGYLAGSYVRDKDAVVASMLICEMAAFYRSQGISLVQARAKMYSDYGFYCNKLDTFTFEGETGMKKMNAIMDTLRNEKLDSVAGLKVIGKADYKLSVKTDYESGKTEELTLPKSNVITFYLEDNASVVIRPSGTEPKIKLYYTTVGTSVE 554
>gi|157150644|ref|YP_001450502.1| phosphomannomutase [Streptococcus gordonii str. Challis substr. CH1] >gi|78100276|gb|ABB20929.1| alpha-phosphoglucomutase [Streptococcus gordonii] >gi|157075438|gb|ABV10121.1| phosphomannomutase [Streptococcus gordonii str. Challis substr. CH1] (572 aa)
Score = 629, Expect = 2.9e-63, Identities = 159/516 (30%), Positives = 281/516 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q  PDP+F+   + NPE++A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K   T      +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N   K+     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GE+ E
  S:     8 QKWVDFADLPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLIGAGTNRINIYVVRQATEGLARLIESKGRNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMITASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVEAEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATPDPDFSTVKSPNPENQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPDNAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPKEWNATAISVVEDFKAQTSTAADGTVTTLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGESNE 554
>gi|28210496|ref|NP_781440.1| phosphoglucomutase [Clostridium tetani E88] >gi|28202933|gb|AAO35377.1| phosphoglucomutase [Clostridium tetani E88] (573 aa)
Score = 628, Expect = 3.4e-63, Identities = 175/533 (32%), Positives = 284/533 (53%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDI-LGLEIKGIRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           WL ++   +  KE +  +K N +EI+  F Y  L FGTAG+R  +  GTN++N +   ++++G+A ++  +     N  V +A+D R  +D +A   A  L + GIK +L+++  ++ TP +SY+VR     + I+ TASHNPK+Y G+KVY   G QILD  A  +   +   +       I         L+      I + Y E      I  +I   K+  ++ T  +GT +  +  +L+   + N+I+  +Q  PDP+FT     NPED  +F+ + +  EK RA+++L  DPD DRLAV+ R ++ ++  L GNQ G +   Y++ +K       + P +V + V+ +    + EKY    F + TGFK + G EM  +    +F+ G+EE+IG    D  +DKDG  +A    E       Q KTL+D L++++ EFG +    +S  +E +  +  +   M+ + N           +K  DI  G EI  I   E       +  L++ LE+  W   R SGTEPK KIY    G T +  +  LK ++      L S
  S:    10 WLNNDYFDDVTKEELKSIKDNPKEIEDRF-YKNLEFGTAGLRGKIAAGTNRMNKYIIAKVTQGLANFIAKQGKEVMNRGVAIAYDCRHYSDVFAKTAALVLAANGIKAYLFED--LRPTPELSYTVRRLNTISGIVVTASHNPKDYNGYKVYWEDGAQILDKIAKPVTEEINNIKNFKEIKSISEEEALEKGLLEILGKEIDDEYIEKVKALSIRNDI--DKDIKIVYTPLNGTGNIPVRRVLRERRFTNVIVVPEQENPDPDFTTVGYPNPEDIKAFEYAKRLGEKERADLLLATDPDCDRLAVMARNNRGEFVALNGNQTGAVLIKYLVESKVEKGTLPEKPMIVKSVVTGDMGKVVGEKYGVTTFESLTGFKNICGKEMEMNKKGYNFIFGYEESIGYTAGDFVKDKDGVISAMFLCEAAAYYKTQGKTLIDVLNDMYNEFGYYRENLISLILEGVEGQRRIGRMMEAYRNEFPKIIGDNKLIKYIDIDKGKEIDFITREEKSVEFPKSNVLKFILEDGSWYAIRPSGTEPKIKIYLYSKGHTLKDSEDKLKIMEKTIMEKLNS 571
>gi|170761753|ref|YP_001788961.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169408742|gb|ACA57153.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum A3 str. Loch Maree] (573 aa)
Score = 628, Expect = 3.8e-63, Identities = 175/528 (33%), Positives = 296/528 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK---SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL++  I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++NV+   ++++G+A ++ +K    +N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I      ++   + +TI +     +  L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +L+  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K+  +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K  +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    G++ +  ++ +KA++ E
  S:     8 KQWLDNEYIDEDTKKELKEIMNNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNVYNISKVTQGLADYIKDKGEEYTNRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLSKIANGITEKIKSINDFSDIKTISEEEALKS-KLLNILGEDIDFEYIEKVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLEERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFKYAENLGKKIGAELLIATDPDCDRLAIEVKDKNDEYLAFNGNQTGAILINYIVSNMKEMGKLPKSAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYKTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKNRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCKIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGKSIKAAEEKIKAIEKE 564
>gi|170756131|ref|YP_001783254.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum B1 str. Okra] >gi|169121343|gb|ACA45179.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium botulinum B1 str. Okra] (573 aa)
Score = 627, Expect = 5.1e-63, Identities = 174/528 (32%), Positives = 293/528 (55%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV-GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE---------------IKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           K WL+++ I    K+ + ++  NE+EI+  F Y +L FGTAG+R  +G GTN++N++   ++++G+A ++  K     N  V +A D R  +  +A   A  L   GIK +L+++  ++ TP +S++VR+    A I+ TASHNPK+Y G+KVY   G Q+L   AN I   +       D + T + +      L++   + I   Y E      I  +I   K+  VI T  +GT +  +  +L+  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A +++  DPD DRLA+ V+ KN ++    GNQ G I  +Y+++N     K  K   +V + V+ +    I E+Y  + +   TGFK + G   N   +  +F+ G+EE+IG +     RDKDG  ++ L  E       + KTL+D L+EI+E+ G +  + +S  +E +  K+ +   M+ +     K+I G +               IK  R  +P     +  L ++L++  W   R SGTEPK K+Y    G++ +  ++ +KA++ E
  S:     8 KEWLDNDYIDEDIKKELKEIINNEKEIEDRF-YKELEFGTAGLRGKIGAGTNRMNIYNISKVTQGLADYITEKGEEYINRGVAIAFDCRHYSKEFAKTAALVLAGNGIKSYLFED--LRPTPELSFAVRKLNTAAGIVITASHNPKDYNGYKVYWEDGAQVLTQIANGITEKIKSIGKFSD-IKTMSEEKALKSGLLNILGEDIDFEYIERVKSLSIREDI--DKDIKVIYTPLNGTGNIPVRRVLRERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFRYAENLGKKVDAELLIATDPDCDRLAIEVKDKNGEYLAFNGNQTGAILINYIVSNMKEMGKLPKGAAIVKSIVTGDLGKVIGEEYGVETYEALTGFKNICGKIPNLKEEGKEFIFGYEESIGYVTGTFVRDKDGVSSSMLLCEAAAYYKTKGKTLIDVLNEIYEKHGYYREKQISLILEGIEGKKRIDRMMESYRKSFPKEIAGAKLLTYIDYQDRIEYDIIKNDR--KPCRIPRSNVLRFFLDDGSWYAVRPSGTEPKIKLYVYTKGKSIKAAEEKIKAIEKE 564
>gi|150008707|ref|YP_001303450.1| phosphoglucomutase phosphomannomutase [Parabacteroides distasonis ATCC 8503] >gi|149937131|gb|ABR43828.1| phosphoglucomutase phosphomannomutase [Parabacteroides distasonis ATCC 8503] (582 aa)
Score = 626, Expect = 5.7e-63, Identities = 155/496 (31%), Positives = 274/496 (55%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN---PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYF-EASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-------------------ANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           Y  L FGT G+R  MG G+N++N++T    ++G++ +L  + ++     V++ HD R N+  +A + A   ++ GIKV+L+++  ++ TP +S+++R+ G  + II TASHNPK Y G+K Y   G Q++       ++ + + +   +  +  N +LI      I + Y  E +   L    I R K+  ++ T  HGT    +P  LK+ G+ NII   +Q V   +F    + NPE+ A+  ++++ A++  A +++  DPD+DR+   V++ + +W  L GNQ  ++F +Y++T      K +   ++V T V+T  I  IAE+   +++   TGFKW+ N M ++  K +++ G EE+ G L  D  RDKD   A  +  E+     DQ  +L   L +I+ E+G    + +S   +  +  EE++  M KF                   + +K KD    E   +     +  L+++ E++  V  R SGTEPK K Y E++ + K I D++ +A K
  S:    47 YKDLEFGTGGLRGIMGVGSNRMNIYTVGAATQGLSNYLKKEFADLEQIKVVIGHDCRNNSRKFAEISADIFSANGIKVYLFED--LRPTPEMSFAIRKLGCQSGIILTASHNPKEYNGYKAYWDDGAQMIAPHDKNTIAEVNKIRNASEIKFKGNKELIEIIGQAIDDEYIKELTTISLSPEAISRHKDMKIVYTPIHGTGVKLVPAALKAYGFTNIIHVPEQDVVSGDFPTVISPNPEEPAALAMAVEKAKETDAELVMASDPDADRVGAAVKNNEGEWVLLNGNQTALMFVYYLITRWKELGKINGKEYIVKTIVTTETIKTIAERNGVEMYDVYTGFKWIANVMRENESKKNYIGGGEESYGFLCEDFVRDKDAVSACVILAEIAAWAKDQGLSLYQLLQKIYVEYGFSKEKGISVVKKGKSGAEEIEAMMKKFRENPLTEIAGSKVTYFYDYSTLKGKDYAENETVTLDMPTTSNVLQYFTEDNTKVSIRPSGTEPKIKFYCEVHSKVKSI-DELPEAEK 567
>gi|5929887|gb|AAD56627.1|AF165218_2 Pgm [Streptococcus pneumoniae] (572 aa)
Score = 625, Expect = 8.2e-63, Identities = 160/516 (31%), Positives = 280/516 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE---------------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N   K+          WNE                           P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPKE----------WNETAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADSSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|119953613|ref|YP_945823.1| phosphoglucomutase [Borrelia turicatae 91E135] >gi|119862384|gb|AAX18152.1| phosphoglucomutase [Borrelia turicatae 91E135] (569 aa)
Score = 625, Expect = 8.6e-63, Identities = 170/527 (32%), Positives = 274/527 (51%)
  Q:    24 LESNR-ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP---NMDLISYFDDTITESYFEASYRCLINTNI-YRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------------------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--ETKEICDQILKALKDEFE 550
           LE N+   ++   L+ + NE E+   F Y  L FGTAG+R  +G GT  IN +   + S+G+A ++L    NP V++++D+R  +  +A   A+   S G+KV++YK   ++ TP +SY+VR+   D  I+ TASHN K Y G+KVY   G QI+      I+S + +   + + +      N   I   +D I  +Y E       + N   +  N  +  T  HGT    +  L K    E +++   Q +PDP F      NPE+  +    ++ A++   +I    DPD+DR+ +      KW  L GNQ+  I  +Y+L+ +K  K  FV+++F +T  +++IA+KYN+ ++RT TGFKW+G   +E+        F  G EE+ G L     RDKD F A     ++   L   + T+  YL E+++EFG +    ++   +  N     +E M  F N   K+  G+ I                   K  ++     A+++ LEN++ +  R SGTE K K Y  IY   E K     I+ ++K E E
  S:    16 LEKNKYFKDEAIRLLNENNERELYNRF-YKDLEFGTAGMRGIIGAGTYYINTYNITKASQGIANYILEITQNPKVVISYDSRYFSKNFAYDAAEIFASNGLKVYIYK--NLRPTPQLSYTVRKLDCDLGIMITASHNTKEYNGYKVYWKGGAQIIPPHDTRIISEIKKVSNVKNTLTKEEGINKQAIIELNDEIDIAYIEKINEEFPDFNKKSKNTNLKIAYTPLHGTGGTIIKELFKGSKVE-LLIEQSQIIPDPEFPSVNYPNPEEHTTLSKVIELAKRENCDIAFATDPDADRMGIAFNEDKKWKTLNGNQIACILMNYLLSREKNPKNVFVIASFTTTPMLNKIAKKYNSTLYRTYTGFKWIGHLIDEIKTKEPNKKFTFGCEESYGYLIGTGTRDKDAFSAIKGFCDLMLTLKKNQITIGKYLQEMYKEFGYYEDFIINKSFQGSNGDFLREELMSNFRNEIKKNFAGINIIKKLDYKKLTETDMNGNVYKITKYKHTTNAIKFLLENEIEITIRPSGTESKIKFYVSIYSRYEQKNNIFDIINSIKMEIE 567
>gi|148984841|ref|ZP_01818094.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP3-BS71] >gi|149008121|ref|ZP_01831652.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP18-BS74] >gi|149021765|ref|ZP_01835772.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP23-BS72] >gi|168575954|ref|ZP_02721869.1| phosphomannomutase [Streptococcus pneumoniae MLV-016] >gi|194397272|ref|YP_002038128.1| Phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae G54] >gi|147760427|gb|EDK67405.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP18-BS74] >gi|147922863|gb|EDK73979.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP3-BS71] >gi|147930001|gb|EDK80988.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP23-BS72] >gi|183578280|gb|EDT98808.1| phosphomannomutase [Streptococcus pneumoniae MLV-016] >gi|194356939|gb|ACF55387.1| Phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae G54] (572 aa)
Score = 625, Expect = 8.6e-63, Identities = 158/516 (30%), Positives = 279/516 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N   K+     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPKEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|168487568|ref|ZP_02712076.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Streptococcus pneumoniae CDC1087-00] >gi|183569634|gb|EDT90162.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Streptococcus pneumoniae CDC1087-00] (572 aa)
Score = 625, Expect = 8.8e-63, Identities = 160/516 (31%), Positives = 280/516 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE---------------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N   K+          WNE                           P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPKE----------WNETAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|169833362|ref|YP_001694905.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Streptococcus pneumoniae Hungary19A-6] >gi|168995864|gb|ACA36476.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Streptococcus pneumoniae Hungary19A-6] (572 aa)
Score = 623, Expect = 1.2e-62, Identities = 160/516 (31%), Positives = 280/516 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE---------------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N   K+          WNE                           P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDIEYLKEVKDININPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPKE----------WNETAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|167215166|ref|ZP_02285473.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes FSL R2-503] (535 aa)
Score = 623, Expect = 1.4e-62, Identities = 155/496 (31%), Positives = 277/496 (55%)
  Q:    54 LSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI------SYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE-----------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           + FGTAG+R  +G GTN++N++T ++ S G+A+++    ++     +++A+D R  +  +A   A  L   G+K +++  + ++ TP +S++VR       I+ TASHNP  Y G+K+Y   GGQ+  + A+ ++  +   + I  +V   N +L+          + +   Y E     ++N  + +++  +  ++ T  HGT        L+S+G+ NI+   +Q V DP+F    + NPE++ +F L+++Y +K+  +I++G DPD+DRL V VR+   ++  L+GNQ+G I  HY+L  KK          V+ + V++N    I + Y A++    TGFK++  ++ KH +   K  F  G+EE+ G +     RDKD  QA     EV  +   +  +L++ L++I+ EFG +  + VS  +            + N++E++   M  F   + +D L  E   I   +        A  ++ Y E+  W   R SGTEPK K Y+ I GE+KE     L+ +K + 
  S:     1 MEFGTAGMRGVLGAGTNRMNIYTIRKASLGLAQFVAENGDEAKKRGIVIAYDPRHMSREFAFESAAVLGHHGVKSYVF--DALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGGQMPPTGASAVIEYINAVEDIF-SVEVANQELLIENGLLEVISEKVDRPYLEKLKEVIVNKELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPENREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNLDGEYEVLSGNQIGAIILHYLLKQKKAQNELPANAAVLKSIVTSNLGTEITKHYGAEMIEVLTGFKFIAEQI-KHFEETGKHTFEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGGSLLEDLEQIYAEFGYYKEDLVSLTLSGKDGSRRIKEITSNFREQLPTSMGGFPVERAEDYLRSETTWIATGKTEAIHLPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESATKLEKVKADL 529
>gi|49484700|ref|YP_041924.1| putative phosphomannomutase [Staphylococcus aureus subsp. aureus MRSA252] >gi|81650409|sp|Q6GDU9|PGCA_STAAR Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|49242829|emb|CAG41556.1| putative phosphomannomutase [Staphylococcus aureus subsp. aureus MRSA252] (552 aa)
Score = 623, Expect = 1.6e-62, Identities = 156/479 (32%), Positives = 260/479 (54%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + +NPT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY+  G Q L ++A+E+VS   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LLKS+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E L  K++++  M  F +   ++I GL++K I                 + + P   +   L ++ ++  R SGTEPK K+Y  +
  S:    40 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNNPTIVIHYDIRHLSTEFAQIIANVLANHQIIVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYSSDGAQ-LSTDASELVSRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLKSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVYQLDKDTTSQIDSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 534
>gi|163814510|ref|ZP_02205899.1| hypothetical protein COPEUT_00661 [Coprococcus eutactus ATCC 27759] >gi|158450145|gb|EDP27140.1| hypothetical protein COPEUT_00661 [Coprococcus eutactus ATCC 27759] (578 aa)
Score = 622, Expect = 1.7e-62, Identities = 165/506 (32%), Positives = 277/506 (54%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYL--TGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-----------------PAQALEWY-LENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           ++ EI+  F Y  L FGT G+R  +G GTN++N +T ++ ++G+A +++ + +    V +A+D+R  +  +A   A  L + GIK +L++   ++ TP +SY+VR+ G  A I+ TASHNP  Y G+KVY   G QI   +  EI++   E + + D      MD        L++     I ++Y E   + +I+  I +++  N  ++ T  HGT    +  +L  +G++N+ +  +Q +PDP FT     NPED  +F+L+LK A++  A+I+L  DPD+DRL +         Y+  TGN  G+I   Y    +       K P +V T V+TN  D +A  YN  +    TGFK++G ++   +  +  +FV+G EE+ G L     RDKD   A     E       Q  TL D++ +++E++G +     +  ++ +   E+++  M    +     I  L++  +R  E                 P   + +Y LE+  W   R SGTEPK K+YY I G + E  D  L++L+
  S:    30 DDAEIEDRF-YRDLVFGTGGLRGVIGAGTNRMNFYTVRKATQGLANFIVKQNAQEKGVAIAYDSRKYSPEFAAEAALCLCANGIKAYLFE--SLRPTPELSYAVRKLGCTAGIVITASHNPPEYNGYKVYWEDGAQITAPKDREIIA---EVKAVTDFHAVKTMDRREALDKGLLTIIGAEIDDAYMEELKKQIIHPEIIKEQSENIKIVYTPFHGTGLVPVKRVLSELGFKNVYIVPEQELPDPEFTTLEYPNPEDPKAFELALKLAKEKNADIVLATDPDADRLGIYALDTKTGRYMPFTGNMSGLIIAEYQFRERAKCGLMPKNPAMVKTIVTTNMADPLAADYNVNLIEVLTGFKFIGEQIKFFEQNNSYNFVMGMEESYGCLVGTYARDKDAPVAVMCLCEAAAYCKSQGITLWDHMLDLYEKYGYYKEGLYTITLKGVTGAEKIRRIMSSLRSESITQIDTLKVLKVRDYEKNTITDLATGVVTESGLPQSNVLYYDLEDGAWACVRPSGTEPKIKLYYGIKGTSLEDADAKLESLQ 566
>gi|160903193|ref|YP_001568774.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Petrotoga mobilis SJ95] >gi|160360837|gb|ABX32451.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Petrotoga mobilis SJ95] (577 aa)
Score = 622, Expect = 2.0e-62, Identities = 174/514 (33%), Positives = 283/514 (55%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN---KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ------TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWV---GNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL-------------------EIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL +  I  + KE +  ++ N EEI + F Y  L FGTAG+R  +G G+N +N++T  + S+ +A ++ +   ++    V++A+D R  +  +A   A  L + GIK +L+  + I+ TP++S++VR     A I+ TASHNPK+Y G+KVY   G QILD  AN I+  + +          I      N +L+ Y    + E Y +     L   +    KN  ++ T  +GT++  +  +LK  G++N+ +  +Q +PDP+F   AN NPE + +F+ + K   +  A ++L  DPD DR A+ +   N +  L GNQ+G +  +Y+L +K      ++   ++ + V+ +   RIA+KY   V  T TGFK +    NE+ K   K  F+ GFEE+IG +     RDKDG  A+ L  E+      + K L++ L++I++E+G       S  +E +  +E ++  M+KF N   K++  L                   EI  I     +  L ++  +  W   R SGTEPK KIY  IY   KE
  S:    11 WLNNPYIDERAKEELKSIENNPEEIKERF-YKDLEFGTAGLRGKLGIGSNMMNIYTVGRASQALADYITDFGEERMKMGVVIAYDVRHFSKEFAKESALILAANGIKTYLF--DDIRPTPVLSFAVRYLKTTAGIVVTASHNPKDYNGYKVYWDQGSQILDDVANGIIEKIEKIGYDFSKIKKISEEEALNKNLLQYISKEVDEEYIQ-RVEGLALRDEDLDKNIKIVYTPLNGTSNNFVRRVLKDRGFKNVFIVKEQELPDPDFKSVANPNPEYEVAFEEAKKLGYEKNAQLLLANDPDGDRTALEILDGNNYKMLNGNQVGALLVNYILESKSKKGSLEENSVIIKSIVTGDLTKRIAKKYGVSVLETLTGFKNICGKENELEKE-GKSKFLFGFEESIGYIYGTFVRDKDGTIASMLISEMVGYYSKKNKNLIEVLEDIYQEYGYELENNYSLVLEGVEGQERIKRIMEKFRNNFPKEMGDLKLEQYADYLKRKIYNLTTGEINDITDIPSSDVLRFWFSDGSWYAIRPSGTEPKLKIY--IYSNDKE 554
>gi|153812528|ref|ZP_01965196.1| hypothetical protein RUMOBE_02927 [Ruminococcus obeum ATCC 29174] >gi|149831453|gb|EDM86541.1| hypothetical protein RUMOBE_02927 [Ruminococcus obeum ATCC 29174] (577 aa)
Score = 622, Expect = 2.0e-62, Identities = 172/513 (33%), Positives = 287/513 (55%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL--LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL---DSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK-----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD--------KFAN---VKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQ----ILKALKDEFEYML 553
           +E EI + F Y  L FGTAG+R  +G GTN++N++  ++ ++G+A ++  ++KKS   V +A+D+R  +  +A   A  L + GIK ++++   ++ TP +S++VR  G  A I  TASHNP  Y G+KVY   G QI    DS     V ++ +  T+  +D        L       + ++Y     + +I+ +  +   KN  ++ T  HGT +     +LK +G+EN+ +  +Q +PD +F   +  NPE   +F+L LK A++  A+++L  DPD+DRL V V+ KN ++H LTGN  G +  +Y ++ +K       +   ++ T V+TN  D IA+ Y  K+    TGFK++G ++   +   K  ++ GFEE+ G L     RDKD   A     E       Q KTL D + E++E+FG +  +  +  ++ +   +++Q+ M+        +FA    V  +D     IK +   E        +  L + L ND WV  R SGTEPK K YY + G +    D+    + KA+ D  + M+
  S:    30 DENEIKERF-YMDLEFGTAGLRGIIGAGTNRMNIYVVRRATQGLANYIAKVDKKSQ-GVAIAYDSRHMSPEFAQEAALCLAANGIKAYIFE--TLRPTPELSFAVRHLGCVAGINVTASHNPPEYNGYKVYWEDGAQITPPHDSGIMGEVKAISDWNTVKTMDKAEAEKAGLFEVIGKEVDDAYMAELKKQVIHMDAIQAEGKNLKIVYTPLHGTGNIPARRILKELGFENVYVVKEQELPDGDFPTVSYPNPEAAEAFELGLKLAKEVDADLVLATDPDADRLGVRVKDKNGEYHDLTGNMSGCLLANYEISQRKAVNGSLPEDGALIKTIVTTNLADAIAKGYGVKLIEVLTGFKFIGQQILGFEKSGKGSYLFGFEESYGCLIGTYARDKDAIVATMALCEAAAYYKTQGKTLWDAMIEMYEQFGYYKDDIKAVTMKGIEGLQKIQDIMNSLRQNPPAEFAGHKVVAVRDYKADTIKNLETGEVTPTGLPNSNVLYYELTNDAWVCVRPSGTEPKVKFYYGVKGTSLADADEKSAVMGKAVLDMVDSMM 577
>gi|194468164|ref|ZP_03074150.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Lactobacillus reuteri 100-23] >gi|194453017|gb|EDX41915.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Lactobacillus reuteri 100-23] (574 aa)
Score = 621, Expect = 2.3e-62, Identities = 171/534 (32%), Positives = 283/534 (52%)
  Q:    21 KAWLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRC-----LINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH-IDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQ----------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K W E   +    K+ +  M+++ EI+  F Y  LSFGTAG+R  MGPG N++NV+T +Q +EG+A     L N      V + +D+R N+  +A   A+ L + GIKV++Y  + ++ TP +S++VR  G  A I+ TASHNPK Y G+K+Y   GGQ+   E++ +   + +   I D       +++    +TI     +A+Y        +N  + ++  K+   + T   GT        L+  G+ N  +   +  P+ +F    + NPE   +F  S+   +K  A++++  DPD+DRL   VR  + ++  LTGNQ+  I   Y+L   K      K    V + VSTN+  +IAE Y  ++    TGFKW+ ++++++   K D  F+ GFEE+ G L     RDKD  Q+  L  EV      +  TL D L E+F+++G +  +T++     ++   +++  M KF         G ++        G +     +           L + L++D W+  R SGTEPK K Y    G + +  D+  + L D FE  L+
  S:     8 KVWQERTDLEPDLKQELAAMSDDKEIEDAF-YGPLSFGTAGMRGLMGPGINRMNVYTVRQATEGLATLMDSLGNDIKKRGVAIGYDSRHNSRKFAHDAARVLGAHGIKVYIY--DNLRPTPELSFAVRHMGTYAGIMITASHNPKEYNGYKIYGEDGGQMPPKESDMMTGYIRKIDDIFDIALADEQEMLDNGLETIMGEDVDAAYLANAKGVTVNPELAKEYGKDMKFVFTPLCGTGRMLGERALRQAGFTNYEMEPTEAQPNGDFPGLEHPNPEFPEAFVRSIALGKKVGADVLIATDPDADRLGCAVRQPDGEYQLLTGNQIASIMLAYILEAHKQAGTLPKNAAAVKSIVSTNFAAKIAESYGVEMINVLTGFKWIADQIHQYETGKADHTFMFGFEESYGYLIKPFVRDKDAIQSLTLLAEVAAYYRSRNMTLYDGLQELFKKYGYFREKTIANTYAGVDGPAKIKALMKKFREEAPTHFAGHQVVVTEDLANGTKTTADGEVSELGIPESNVLRYILDDDTWIAIRPSGTEPKLKFY---IGTSADTLDKANEKLAD-FEKALQ 570
>gi|55820839|ref|YP_139281.1| phosphoglucomutase [Streptococcus thermophilus LMG 18311] >gi|55822754|ref|YP_141195.1| phosphoglucomutase [Streptococcus thermophilus CNRZ1066] >gi|8920345|emb|CAB96418.1| phosphoglucomutase [Streptococcus thermophilus] >gi|55736824|gb|AAV60466.1| phosphoglucomutase [Streptococcus thermophilus LMG 18311] >gi|55738739|gb|AAV62380.1| phosphoglucomutase [Streptococcus thermophilus CNRZ1066] (572 aa)
Score = 621, Expect = 2.3e-62, Identities = 160/515 (31%), Positives = 284/515 (55%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM---------DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDF--VVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE---------IKGIR--WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           + WL+   +    ++ ++ M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +      IDN +T  +          LI    + +   Y +      IN ++  +  ++  ++ T+ HGT    +   L   G++ + +   Q VP  +F    + NPE++ +F L+ +      A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K   T      +  + VST  + +IAE Y A +F   TGFK++G ++++   + ++  + GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++++G ++ +T+S  +  ++   E+++ MDKF         N DI   E           G+      P+  L++ L +D W   R SGTEPK K Y    GET+
  S:     8 QKWLDFAELPAYLRDELVSMDEKTKEDAF-YTNLEFGTAGMRGLIGAGTNRINIYVVRQATEGLAQLIDSKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLHTFAGIMITASHNPAPFNGYKVYGEDGGQMPPADADALTDYI----RAIDNPFTVKLADLEDSKASGLIEIIGENVDAEYLKEVKDVNINQDLINEYGRDMKIVYTSLHGTGEMLVRRALAQAGFDAVQVVEAQAVPHADFLTVKSPNPENQDAFALAEELGRNVDADVLVATDPDADRLGVEIRQPDGSYLNLSGNQIGAIIAKYILEAHKTAGTLPANAALCKSIVSTELVTKIAESYGATMFNVLTGFKFIGEKIHEFETQHNYTYMFGFEESFGYLIKPFVRDKDAIQAVLIVAEIAAYYRSRGMTLADGIEEIYKQYGYFSEKTISVTLSGVDGAAEIKKIMDKFRRNAPKQFNNTDIAKTEDFLEQTATTADGVEKLTTPPSNVLKYILADDSWFAVRPSGTEPKIKFYIATVGETE 552
>gi|82752080|ref|YP_417821.1| phosphoglucomutase [Staphylococcus aureus RF122] >gi|82657611|emb|CAI82059.1| phosphoglucomutase [Staphylococcus aureus RF122] (587 aa)
Score = 620, Expect = 3.3e-62, Identities = 155/479 (32%), Positives = 256/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVV-VRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + +NPT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +          Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E L  K+++   M KF +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    75 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNNPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTAAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAECDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDALEQIYQTVGRHEDTLFSHTLEGLEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVYQLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 569
>gi|163814508|ref|ZP_02205897.1| hypothetical protein COPEUT_00659 [Coprococcus eutactus ATCC 27759] >gi|158450143|gb|EDP27138.1| hypothetical protein COPEUT_00659 [Coprococcus eutactus ATCC 27759] (592 aa)
Score = 619, Expect = 3.8e-62, Identities = 159/510 (31%), Positives = 286/510 (56%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN---KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN--------------KWHYLTGNQMGIIFTHYVLTNKK-FDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE--MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----WNEP------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           K WLES+    K KE +  +  +++EI   F Y  L FGT G+R  MG GTN++N++T  + ++G+A ++L    + +   V++AHD R  +  +    A  L + GIK +++  + ++ TP +S++VRE G  A I+ TASHNP  Y G+KVY   G QI+  +  +I+  + + +   ++V T + D      L      ++ E+Y++A  +  I+ +I  +   +  ++ T  HGT +  +  +LK +G++++ +  +Q VPD +F+   + NPE+ ++F + ++ A+K  A++++  DPD+DRL + V+                  +     N  G +   YV   +K   K P    + +T VSTN    IAE YN K   T TGFK++G +  + +  +   F+ G EE+ G L  D  RDKD   A  +  E+      Q +T+ + ++E++ ++G +        ++ ++   +++E M+ F N       G+++ G+R       +P            +  L + LEN+ W   R SG EPK K Y+ +
  S:    13 KFWLESDCFDEKTKEELRSIADDDKEIQDRF-YKNLKFGTGGMRGIMGAGTNRMNIYTVTKATQGLAEYILEVGPEAAKRGVVIAHDCRNMSAEFTEASALCLNANGIKTYVF--DALRPTPELSFAVRELGCIAGIVVTASHNPPEYNGYKVYWEDGSQIVSPQDQDILKHVADVERY-EDVKTMDKDKAVADGLFCMVPASVDENYYQALIKQTIHGDIIPKVADDIKIVYTPLHGTGNVPVREVLKRLGFKHVYVVEEQTVPDGDFSTVKSPNPEEPSAFAMGIELAKKVDADVIMATDPDADRLGIYVKDSTGIWKDTEFADDPAYPYVRFNANMTGALIAEYVCREQKAVGKLPANGAICNTVVSTNLTKAIAENYNLKYIETLTGFKYIGEQILLFEKNNTYKFIFGMEESFGCLVGDYTRDKDACAAVVILCEIAAFYKLQGETICNAMEEVYRKYGYYFEGAFGITLKGVDGAAQIKEMMENFRNHPLTTFAGIKVTGMRDYVSGIRKPLDGEEENMGLPKSNVLYYELENNAWFAVRPSGNEPKIKFYFGV 568
>gi|116627655|ref|YP_820274.1| phosphoglucomutase [Streptococcus thermophilus LMD-9] >gi|116100932|gb|ABJ66078.1| alpha-phosphoglucomutase [Streptococcus thermophilus LMD-9] (572 aa)
Score = 619, Expect = 4.3e-62, Identities = 160/515 (31%), Positives = 283/515 (54%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM---------DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDF--VVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF-----ANVKNKDILGLE---------IKGIR--WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           + WL+   +    ++ ++ M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+  ++A+ +   +      IDN +T  +          LI    + +   Y +      IN ++  +  ++  ++ T+ HGT        L   G++ + +   Q VP  +F    + NPE++ +F L+ +      A++++  DPD+DRL V +R  +  +  L+GNQ+G I   Y+L   K   T      +  + VST  + +IAE Y A +F   TGFK++G ++++   + ++  + GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++++G ++ +T+S  +  ++   E+++ MDKF         N DI   E           G+      P+  L++ L +D W   R SGTEPK K Y    GET+
  S:     8 QKWLDFAELPAYLRDELVSMDEKTKEDAF-YTNLEFGTAGMRGLIGAGTNRINIYVVRQATEGLAQLIDSKGEEAKKRGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLHTFAGIMITASHNPAPFNGYKVYGEDGGQMPPADADALTDYI----RAIDNPFTVKLADLEDSKASGLIEIIGENVDAEYLKEVKDVNINQDLINEYGRDMKIVYTSLHGTGEMLARRALAQAGFDAVQVVEAQAVPHADFLTVKSPNPENQDAFALAEELGRNVDADVLVATDPDADRLGVEIRQPDGSYLNLSGNQIGAIIAKYILEAHKTAGTLPANAALCKSIVSTELVTKIAESYGATMFNVLTGFKFIGEKIHEFETQHNYTYMFGFEESFGYLIKPFVRDKDAIQAVLIVAEIAAYYRSRGMTLADGIEEIYKQYGYFSEKTISVTLSGVDGAAEIKKIMDKFRRNAPKQFNNTDIAKTEDFLEQTATTADGVEKLTTPPSNVLKYILADDSWFAVRPSGTEPKIKFYIATVGETE 552
>gi|149003288|ref|ZP_01828184.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP14-BS69] >gi|147758748|gb|EDK65745.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP14-BS69] (572 aa)
Score = 619, Expect = 4.4e-62, Identities = 157/516 (30%), Positives = 278/516 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N    +     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|15675406|ref|NP_269580.1| putative phosphomannomutase [Streptococcus pyogenes M1 GAS] >gi|50914601|ref|YP_060573.1| phosphoglucomutase [Streptococcus pyogenes MGAS10394] >gi|13622593|gb|AAK34301.1| putative phosphomannomutase [Streptococcus pyogenes M1 GAS] >gi|50903675|gb|AAT87390.1| phosphoglucomutase; phosphomannomutase [Streptococcus pyogenes MGAS10394] (564 aa)
Score = 618, Expect = 4.7e-62, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     4 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 553
>gi|168489659|ref|ZP_02713858.1| phosphoglucomutase (Alpha-phosphoglucomutase) (Glucosephosphomutase) (PGM) [Streptococcus pneumoniae SP195] >gi|183572010|gb|EDT92538.1| phosphoglucomutase (Alpha-phosphoglucomutase) (Glucosephosphomutase) (PGM) [Streptococcus pneumoniae SP195] (572 aa)
Score = 618, Expect = 4.8e-62, Identities = 157/516 (30%), Positives = 278/516 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N    +     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFMELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDIEYLKEVKDININPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|148988540|ref|ZP_01819973.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP6-BS73] >gi|147925741|gb|EDK76816.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP6-BS73] (572 aa)
Score = 618, Expect = 4.8e-62, Identities = 157/516 (30%), Positives = 278/516 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N    +     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLIGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDIEYLKEVKDININPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|148997441|ref|ZP_01825046.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP11-BS70] >gi|147756496|gb|EDK63537.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP11-BS70] (572 aa)
Score = 618, Expect = 4.9e-62, Identities = 157/516 (30%), Positives = 278/516 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N    +     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDIEYLKEVKDININPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMTKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|15901345|ref|NP_345949.1| phosphoglucomutase [Streptococcus pneumoniae TIGR4] >gi|15903394|ref|NP_358944.1| phosphoglucomutase [Streptococcus pneumoniae R6] >gi|111657050|ref|ZP_01407846.1| hypothetical protein SpneT_02001715 [Streptococcus pneumoniae TIGR4] >gi|116515604|ref|YP_816788.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae D39] >gi|149011730|ref|ZP_01832926.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP19-BS75] >gi|168483892|ref|ZP_02708844.1| phosphomannomutase [Streptococcus pneumoniae CDC1873-00] >gi|168492568|ref|ZP_02716711.1| phosphomannomutase [Streptococcus pneumoniae CDC0288-04] >gi|168493398|ref|ZP_02717541.1| phosphomannomutase [Streptococcus pneumoniae CDC3059-06] >gi|182684451|ref|YP_001836198.1| phosphoglucomutase [Streptococcus pneumoniae CGSP14] >gi|14972987|gb|AAK75589.1| phosphoglucomutase [Streptococcus pneumoniae TIGR4] >gi|15458998|gb|AAL00155.1| Phosphoglucomutase [Streptococcus pneumoniae R6] >gi|116076180|gb|ABJ53900.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae D39] >gi|147764161|gb|EDK71093.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP19-BS75] >gi|172042753|gb|EDT50799.1| phosphomannomutase [Streptococcus pneumoniae CDC1873-00] >gi|182629785|gb|ACB90733.1| phosphoglucomutase [Streptococcus pneumoniae CGSP14] >gi|183573294|gb|EDT93822.1| phosphomannomutase [Streptococcus pneumoniae CDC0288-04] >gi|183576642|gb|EDT97170.1| phosphomannomutase [Streptococcus pneumoniae CDC3059-06] (572 aa)
Score = 618, Expect = 5.1e-62, Identities = 157/516 (30%), Positives = 278/516 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N    +     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDIEYLKEVKDININPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|148992617|ref|ZP_01822285.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP9-BS68] >gi|147928634|gb|EDK79648.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus pneumoniae SP9-BS68] (572 aa)
Score = 618, Expect = 5.9e-62, Identities = 157/516 (30%), Positives = 278/516 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           + W++   + +  ++ +  M+E+  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+AR + +K  N     V +A+D+R  +  +A   A  L   GIK ++++   ++ TP +S++VR     A I+ TASHNP  + G+KVY   GGQ+   +A+ + + +     P    + D        LI    + +   Y +      IN  +  +  K+  ++ T  HGT        L   G++++ +   Q   DP+F+   + NPE +A+F L+ +   +  A++++  DPD+DR+ V V  K+  +  L+GNQ+G I   Y+L   K      +   +  + VST+ + +IAE Y A +F   TGFK++  ++ +  +K +  +++GFEE+ G L     RDKD  QA  +  E+      +  TL D ++EI++E+G +  +T+S  +  ++  E+++  M KF N    +     I  +                     P+  L++ L +  W+  R SGTEPK K Y  + GET E
  S:     8 QKWVDFVELPDYLRQDLENMDEKTKEDAF-YTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFE--SLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDIEYLKEVKDININPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPTEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNE 554
>gi|116490456|ref|YP_810000.1| alpha-phosphoglucomutase [Oenococcus oeni PSU-1] >gi|116091181|gb|ABJ56335.1| alpha-phosphoglucomutase [Oenococcus oeni PSU-1] (566 aa)
Score = 618, Expect = 6.0e-62, Identities = 172/504 (34%), Positives = 268/504 (53%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-ISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           Y  L+FGTAG+R  +G GTN++N++T  Q +E +AR +  +  +     V+++ D+R+N++ +  + A+ L + GI V+L+  N    TP +S++V      A I+ TASHN K Y G+K+Y   GGQ+    A+EIV    E Q + D  +   +   I      I + Y        IN ++ ++      +  T  HG         LK  G+  I+   +Q  PD  F      NPE    F    K +E Y A++ L VDPDSDR+ V  R K+  ++YLTGNQ+  +  +Y+LT ++      K   +V++ VS+N  + IA+ +  K F   TGFK++ +++ +   K +  F  GFEE+ G L      DKD  QA  L  E+     D+  T+ D LDEI  +FGA+  ET + +      +EEM   M KF N   K+I  L+I  +  N+                   A  ++++LE+  WV  R SGTEPK K+Y    GE     ++ L  L+ E E +L+
  S:    40 YQDLNFGTAGMRGLLGVGTNRMNIYTVAQTTEALARHMEKQGESAKQRGVVISGDSRINSELFKKISAEVLRAHGITVYLF--NGPHPTPELSFAVMHLHTYAGIMITASHNSKEYNGYKLYGEDGGQLPPKPADEIVR---ERQEVTDIFHIKKVSGGIKKIGSEIDKEYLNQVKTIPINRDLIKKWGDKLTISFTPLHGAGGDLGSKALKEAGFNKILTVKEQFKPDGTFPTVKYPNPE----FHEVFKISESYGADVELAVDPDSDRMGVGYRTKDGSYNYLTGNQIAALMVNYILTAQQKAGTLPKNGAIVTSIVSSNLPELIAKSFKVKQFTVLTGFKYIADKIVEFDKKQNYSFEFGFEESYGFLIKPFVHDKDAIQAITLMSELAAYYKDRGMTIGDGLDEIHAKFGAFAEETKATEFPGEKGQEEMTAVMTKFRNRGPKEIGNLKINLVEDNDLRIAKDLNTGATKKISLPRANVIKYWLEDGSWVALRPSGTEPKLKVYIGAKGENMSSANKRLDYLQTELEKLLK 565
>gi|19746456|ref|NP_607592.1| putative phosphomannomutase [Streptococcus pyogenes MGAS8232] >gi|19748659|gb|AAL98091.1| putative phosphomannomutase [Streptococcus pyogenes MGAS8232] (564 aa)
Score = 617, Expect = 6.1e-62, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     4 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 553
>gi|160013193|sp|Q2YW66|PGCA_STAAB Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) (552 aa)
Score = 617, Expect = 6.5e-62, Identities = 155/479 (32%), Positives = 256/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVV-VRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + +NPT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +          Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E L  K+++   M KF +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    40 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNNPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTAAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAECDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDALEQIYQTVGRHEDTLFSHTLEGLEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVYQLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 534
>gi|94992750|ref|YP_600849.1| phosphoglucomutase / phosphomannomutase [Streptococcus pyogenes MGAS2096] >gi|94546258|gb|ABF36305.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS2096] (567 aa)
Score = 617, Expect = 6.8e-62, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     7 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALKVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 556
>gi|71911048|ref|YP_282598.1| phosphoglucomutase [Streptococcus pyogenes MGAS5005] >gi|94988859|ref|YP_596960.1| phosphoglucomutase [Streptococcus pyogenes MGAS9429] >gi|71853830|gb|AAZ51853.1| phosphoglucomutase [Streptococcus pyogenes MGAS5005] >gi|94542367|gb|ABF32416.1| phosphoglucomutase [Streptococcus pyogenes MGAS9429] (567 aa)
Score = 617, Expect = 7.0e-62, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     7 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 556
>gi|118587565|ref|ZP_01544989.1| phosphoglucomutase [Oenococcus oeni ATCC BAA-1163] >gi|118432016|gb|EAV38758.1| phosphoglucomutase [Oenococcus oeni ATCC BAA-1163] (566 aa)
Score = 616, Expect = 8.2e-62, Identities = 172/504 (34%), Positives = 268/504 (53%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM-DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           Y  L+FGTAG+R  +G GTN++N++T  Q +E +AR +  +  +     V+++ D+R+N++ +  + A+ L + GI V+L+  N    TP +S++V      A I+ TASHN K Y G+K+Y   GGQ+    A+EIV    E Q + D  +   +   I      I + Y        IN ++ ++      +  T  HG         LK  G+  I+   +Q  PD  F      NPE    F    K +E Y A++ L VDPDSDR+ V  R K+  ++YLTGNQ+  +  +Y+LT ++      K   +V++ VS+N  + IA+ +  K F   TGFK++ +++ +   K +  F  GFEE+ G L      DKD  QA  L  E+     D+  T+ D LDEI  +FGA+  ET + +      +EEM   M KF N   K+I  L+I  +  N+                   A  ++++LE+  WV  R SGTEPK K+Y    GE     ++ L  L+ E E +L+
  S:    40 YQDLNFGTAGMRGLLGVGTNRMNIYTVAQTTEALARHMEKQGESAKQRGVVISGDSRINSELFKKISAEVLRAHGITVYLF--NGPHPTPELSFAVMHLHTYAGIMITASHNSKEYNGYKLYGEDGGQLPPKPADEIVR---ERQEVTDIFHIKKVAGGIKKIGSEIDKEYLNQVKTIPINRDLIKKWGDKLTISFTPLHGAGGDLGSKALKEAGFNKILTVKEQFKPDGTFPTVKYPNPE----FHEVFKISESYGADVELAVDPDSDRMGVGYRTKDGSYNYLTGNQIAALMVNYILTAQQKAGTLPKNGAIVTSIVSSNLPELIAKSFKVKQFTVLTGFKYIADKIVEFDKKQNYSFEFGFEESYGFLIKPFVHDKDAIQAITLMSELAAYYKDRGMTIGDGLDEIHAKFGAFAEETKATEFPGEKGQEEMTAVMTKFRNRGPKEIGNLKINLVEDNDLRIAKDLNTGATKKISLPRANVIKYWLEDGSWVALRPSGTEPKLKVYIGAKGENMSSANKRLDYLQTELEKLLK 565
>gi|195977749|ref|YP_002122993.1| probable phosphomannomutase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974454|gb|ACG61980.1| probable phosphomannomutase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (564 aa)
Score = 616, Expect = 8.3e-62, Identities = 157/515 (30%), Positives = 283/515 (54%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD-----LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI------RWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           + WL ++  + + K  +  +K +E EI   F Y  L FGTAG+R  +G GTN++N++   + ++ +A  +++         + +++D R  +  +A +    + + GIK ++YK   I+ TP+ SY++R     + ++ TASHNP+ Y G+K Y   G QILD  AN+I + M   +   D    P  +     L SY DD+I E+Y +      IN T+I   K+  V+ T  +G  +  +  +LK  G++++ +  +Q +PDP+FT     NPE   +F  S +  ++  A+I++  DPD DR+A+ VR  +  + +L GN++G + ++Y+ + +         P +V + V+ +    IA KY  +   T TGFK +  + N +    +  +V G+EE+IG       RDKD   A+ + +E+      + ++L+D L +I++EFG +    V+ ++E +  ++ +   M+ F N   +    + +K +        + P Q  L++Y ++  W   R SGTEPK K+Y    GET+
  S:     8 QEWLHNDFFNEEIKADLEAIKHDEAEIQDRF-YKVLEFGTAGLRGKLGAGTNRMNIYMVGKAAQALANTIIDHGPEAVSRGIAISYDVRYKSKEFAELTCSIMAANGIKSYIYK--GIRPTPMCSYAIRALNCISGVMITASHNPQAYNGYKAYWEEGSQILDDIANQIAAHMDAIERFEDVKQIPFEEALASGLTSYIDDSIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLKRRGFDHVFVVPEQEMPDPDFTTVGYPNPEVPKAFAYSERLGQEVGADILIATDPDCDRVALEVRAADGSYVFLNGNKIGALLSYYIFSQRHARHNLPDNPVLVKSIVTGDLSKAIAAKYGIETVETLTGFKNICGKANDYDITKEKTYVFGYEESIGFCYGTFVRDKDAVSASMMVVEMAAYYKQRGQSLLDVLQDIYKEFGYYNERQVALELEGVEGQKRIARIMEDFRNKPIERAGAMSLKTVVDFKDGYLDFPKQNCLKYYFDDGSWYALRPSGTEPKIKLYIYTIGETE 542
>gi|168185698|ref|ZP_02620333.1| phosphoglucomutase phosphomannomutase [Clostridium botulinum C str. Eklund] >gi|169296487|gb|EDS78620.1| phosphoglucomutase phosphomannomutase [Clostridium botulinum C str. Eklund] (563 aa)
Score = 616, Expect = 8.4e-62, Identities = 170/525 (32%), Positives = 280/525 (53%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL--TNKK--FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIK-------GIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           WL  + I  K K+ +  +K N  EI   F Y  L FGTAG+R  +G GTN++NV+   ++++G+A ++  K     N  V +A+D R  +  ++   A  L   GIK +L+++  I+ TP +S+++R+    A II TASHNPK Y G+KVY   G Q+L S A+ +   + +        I+D     +  L++     I + Y        I  NI   K+  V+ +  +GT +  +  +LK  G+ NII+  +Q  PDP+FT     NPED  +F  +    +K  A++++  DPD DRLA+ V+ KN ++    GNQ G I   Y++   N K    K   +V + V+ +    I EKY    F   TGFK +   + K     + +F+ G+EE+IG   S   RDKD   ++ L  E         KTL+D L+E+F+E+G +  + +S  +E +  ++ +   M ++      +I  +++K       G +    +  L++YL++  W   R SGTEPK KIY     +T    ++ LK +++
  S:    10 WLNDDFIDEKTKKELKSIKDNNAEIQDRF-YKNLEFGTAGLRGKLGAGTNRMNVYNISKVTQGIADFIKEKGQDYMNRGVAIAYDVRHFSKEFSKTAALVLAGNGIKSYLFED--IRPTPELSFTIRKLNATAGIIITASHNPKEYNGYKVYWEDGAQVLSSIADPMTEKINKINNFKDVKIMDEKEALDKGLLNIIGKEIDDEYTTNVKELSIRNNI--DKDIKVVYSPLNGTGNIPVRRVLKERGFTNIIVVPEQENPDPDFTTVGYPNPEDTKAFKYAGNLGKKVGADLLIATDPDCDRLAIEVKDKNGEYIAFNGNQTGAILIKYIVEGMNDKGTLPKNAAIVKSIVTGDLGKVIGEKYGVTTFEALTGFKNICGRIPKFEATGEYEFIFGYEESIGYNASTFVRDKDAVSSSMLLCEAAGYYKSIGKTLIDVLNEVFKEYGYYKEKQISLVLEGIEGQQRISRMMKEYRKSYPTEIGTMKLKECIDFIDGYKDIGASNVLKFYLDDGSWYAVRPSGTEPKIKIYLYTKADTPSKSEENLKIMEE 553
>gi|57651000|ref|YP_187296.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus aureus subsp. aureus COL] >gi|87160054|ref|YP_495067.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus aureus subsp. aureus USA300] >gi|88196428|ref|YP_501252.1| hypothetical protein SAOUHSC_02793 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161510689|ref|YP_001576348.1| bifunctional phosphoglucomutase/phosphomannomutase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57285186|gb|AAW37280.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus aureus subsp. aureus COL] >gi|87126028|gb|ABD20542.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203986|gb|ABD31796.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|160369498|gb|ABX30469.1| bifunctional phosphoglucomutase/phosphomannomutase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (602 aa)
Score = 616, Expect = 8.9e-62, Identities = 154/479 (32%), Positives = 257/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E    K+++   M KF +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    90 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 584
>gi|94990760|ref|YP_598860.1| phosphoglucomutase / phosphomannomutase [Streptococcus pyogenes MGAS10270] >gi|94544268|gb|ABF34316.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS10270] (567 aa)
Score = 616, Expect = 9.6e-62, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     7 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVRDVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 556
>gi|94994738|ref|YP_602836.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS10750] >gi|94548246|gb|ABF38292.1| Phosphoglucomutase / Phosphomannomutase [Streptococcus pyogenes MGAS10750] (567 aa)
Score = 616, Expect = 9.6e-62, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     7 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVRDVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 556
>gi|51599086|ref|YP_073274.1| phosphomannomutase [Borrelia garinii PBi] >gi|51573657|gb|AAU07682.1| phosphomannomutase [Borrelia garinii PBi] (569 aa)
Score = 616, Expect = 1.0e-61, Identities = 165/504 (32%), Positives = 273/504 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWNE----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           +KE  +K+    NE EI   F Y  L FGTAG+R  +G GT  IN +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ TP +SY++R+   D  ++ TASHNPK Y G+K Y   G QI+      I + + + + II+ +         +I   ++ I + Y +   +   +     +K N  V  T  HGT    +  L  +   + + L   + VP+P F      NPE K S    ++ A+K   +I L  DPD+DR+ V  + +N+W +L GNQ+  I  +Y+L+ +   K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   +EM K+     F    EE+ G L     RDKD F A      +   L  +++T+ +YL++I++EFG +    V    E  N + + +  M K    +     G++I         K I + +          P  A+++ LEN++ +  R SGTEPK K Y  +  E KE
  S:    22 FKEEAIKIQKTNNETEILNRF-YKDLEFGTAGMRGIIGAGTCYINTYNVKKISQGICNYVLKINKNPKVAISYDSRYFSKEFAYNTAQIFASNNFETYIYK--SLRPTPQLSYTIRKFDCDVGVMITASHNPKEYNGYKAYWKGGIQIMPPHDTLITNEIKKVKNIINKITIKEGIEKKIIKELNNEIDKEYVQTINKEFPDFEKNSKKTNLKVAYTALHGTGGTIIKKLFTNSKIQ-LFLEKSEIVPNPEFPTITYPNPEKKTSMLKVIELAKKEDCDIALATDPDADRIGVAFKDQNEWIFLNGNQISCILMNYILSKEINPKNTFVISSFVTTQMLEKIAKKYGSQIFRTYTGFKWIGSLIDEMEKNEPNKKFAFACEESHGYLIGKKVRDKDAFSAIKGICSLALYLKAKKQTIKNYLEKIYKEFGYYEELNVEKNFEGANGEIQREALMSKLRKEQKMQFAGIKIIEKLDYKTLKKINFKKEISEIKEYKYPINAIKFILENEIVITVRPSGTEPKIKFYISVKLEYKE 551
>gi|139473473|ref|YP_001128189.1| putative phosphoglucomutase [Streptococcus pyogenes str. Manfredo] >gi|134271720|emb|CAM29953.1| putative phosphoglucomutase [Streptococcus pyogenes str. Manfredo] (564 aa)
Score = 615, Expect = 1.1e-61, Identities = 161/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + Q I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     4 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYQEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKCIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 553
>gi|148543616|ref|YP_001270986.1| alpha-phosphoglucomutase [Lactobacillus reuteri F275] >gi|184153024|ref|YP_001841365.1| phosphoglucomutase [Lactobacillus reuteri F275] >gi|148530650|gb|ABQ82649.1| alpha-phosphoglucomutase [Lactobacillus reuteri F275] >gi|183224368|dbj|BAG24885.1| phosphoglucomutase [Lactobacillus reuteri F275] (574 aa)
Score = 615, Expect = 1.1e-61, Identities = 170/534 (31%), Positives = 282/534 (52%)
  Q:    21 KAWLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRC-----LINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH-IDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQ----------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K W E   +    K+ +  M+++ EI+  F Y  LSFGTAG+R  MGPG N++NV+T +Q +EG+A     L +      V + +D+R N+  +A   A+ L + GIKV++Y  + ++ TP +S++VR  G  A I+ TASHNPK Y G+K+Y   GGQ+   E++ +   + +   I D       +++    +TI     +A+Y        +N  + ++  K+   + T   GT        L+  G+ N  +   +  P+ +F    + NPE   +F  S+   +K  A++++  DPD+DRL   VR  + ++  LTGNQ+  I   Y+L   K      K    V + VSTN+  +IAE Y   +    TGFKW+ ++++++   K D  F+ GFEE+ G L     RDKD  Q+  L  EV      +  TL D L E+F+++G +  +T++     ++   +++  M KF         G ++        G +     +           L + L++D W+  R SGTEPK K Y    G + +  D+  + L D FE  L+
  S:     8 KVWQERTDLEPDLKQELAAMSDDKEIEDAF-YGPLSFGTAGMRGLMGPGINRMNVYTVRQATEGLATLMDSLGDDIKKRGVAIGYDSRHNSRKFAHDAARVLGAHGIKVYIY--DNLRPTPELSFAVRHMGTYAGIMITASHNPKEYNGYKIYGEDGGQMPPKESDMMTGYIRKIDDIFDIALADEQEMLDNGLETIMGEDVDAAYLANAKGVTVNPELAKEYGKDMKFVFTPLCGTGRMLGERALRQAGFTNYEMEPTEAQPNGDFPGLEHPNPEFPEAFVRSIALGKKVGADVLIATDPDADRLGCAVRQPDGEYQLLTGNQIASIMLAYILEAHKQAGTLPKNAAAVKSIVSTNFAAKIAESYGVDMINVLTGFKWIADQIHQYETGKADHTFMFGFEESYGYLIKPFVRDKDAIQSLTLLAEVAAYYRSRNMTLYDGLQELFKKYGYFREKTIANTYAGVDGPAKIKALMKKFREEAPTHFAGHQVVVTEDFANGTKTTADGEVSELGIPESNVLRYILDDDTWIAIRPSGTEPKLKFY---IGTSADTLDKANEKLAD-FEKALQ 570
>gi|151222600|ref|YP_001333422.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|168729512|ref|ZP_02761789.1| bifunctional phosphoglucomutase/phosphomannomutase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|150375400|dbj|BAF68660.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus aureus subsp. aureus str. Newman] (583 aa)
Score = 614, Expect = 1.4e-61, Identities = 154/479 (32%), Positives = 257/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E    K+++   M KF +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    71 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 565
>gi|21910694|ref|NP_664962.1| putative phosphomannomutase [Streptococcus pyogenes MGAS315] >gi|28895616|ref|NP_801966.1| putative phosphomannomutase [Streptococcus pyogenes SSI-1] >gi|21904897|gb|AAM79765.1| putative phosphomannomutase [Streptococcus pyogenes MGAS315] >gi|28810865|dbj|BAC63799.1| putative phosphomannomutase [Streptococcus pyogenes SSI-1] (564 aa)
Score = 614, Expect = 1.6e-61, Identities = 160/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + + I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     4 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYEEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 553
>gi|15925481|ref|NP_373015.1| phosphomannomutase [Staphylococcus aureus subsp. aureus Mu50] >gi|15928070|ref|NP_375603.1| hypothetical protein SA2279 [Staphylococcus aureus subsp. aureus N315] >gi|156980806|ref|YP_001443065.1| hypothetical protein SAHV_2475 [Staphylococcus aureus subsp. aureus Mu3] >gi|13702441|dbj|BAB43582.1| SA2279 [Staphylococcus aureus subsp. aureus N315] >gi|14248265|dbj|BAB58653.1| similar to phosphomannomutase [Staphylococcus aureus subsp. aureus Mu50] >gi|156722941|dbj|BAF79358.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (583 aa)
Score = 614, Expect = 1.6e-61, Identities = 155/479 (32%), Positives = 257/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LLKS+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N K     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E L  K++++  M  F +   ++I GL++K I                 + N     +   L ++ ++  R SGTEPK K+Y  +
  S:    71 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLKSLNFNQFNLVDAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVKYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSSKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 565
>gi|160013175|sp|Q2FE11|PGCA_STAA3 Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|160013184|sp|Q2FVC1|PGCA_STAA8 Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|160013199|sp|Q5HD61|PGCA_STAAC Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) (552 aa)
Score = 613, Expect = 1.8e-61, Identities = 154/479 (32%), Positives = 257/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E    K+++   M KF +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    40 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 534
>gi|88802649|ref|ZP_01118176.1| phosphoglucomutase phosphomannomutase [Polaribacter irgensii 23-P] >gi|88781507|gb|EAR12685.1| phosphoglucomutase phosphomannomutase [Polaribacter irgensii 23-P] (571 aa)
Score = 613, Expect = 1.9e-61, Identities = 158/511 (30%), Positives = 269/511 (52%)
  Q:    20 SKAWLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN--KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT----NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +K WL     +   +E+  ++  N  ++   F Y  + FGT G+R  MG GTN++N +T  + ++G++ +L    KK    V++A+D R N+  +A ++A   ++  IKVFL+++  ++ATP +S++VR    DA I+ TASHNP  Y G+KVY   GGQI+     +I+ ++        N +  N  LI      + + + +AS +    +    +KN  V+ T+ HGT+   +P  L   GY ++ L A+Q  PD +F    + NPE+  +  ++   A+K  A+I++G DPD DRL V VR  +     + GNQ  ++ T ++L       K +   F+ ST VST  ++ IA  Y+ +     TGFKW+  +M K   ++DF+ G EE+ G +  D  RDKD   A  LA EV         +  + L  ++ + G +    ++   + ++  EE+Q+ +    N   K+I G ++  +   +                   +  L +   N   +  R SGTEPK K Y+ +
  S:     8 AKQWLSPTFDTETRQEIQQLITTNAPDLADRF-YKDMEFGTGGMRGIMGAGTNRVNKYTLGRATQGLSNYLTENVKKEQLKVVIAYDCRHNSKKFAKIVANVFSANKIKVFLFED--LRATPELSFAVRHLDCDAGIVLTASHNPSEYNGYKVYWADGGQIVPPHDGKIIKNVNALDFSEIN-FNANTALIESIGAEVDDVFIDASVKHGCLSKSIDRKNLKVVFTSLHGTSIVSVPDTLAKAGYSDVHLVAEQSAPDGDFPTVMSPNPEEPEALKMATDLADKIGADIVVGTDPDCDRLGVAVRDTDGNMKLMNGNQTMVLMTEFLLKKWKETGKINGKQFIGSTIVSTELVNAIASSYHVETKVGLTGFKWIA-KMVKDFPELDFIGGGEESFGYMVGDFVRDKDAVTATLLACEVAAYAKQNGSSFYEELLNVYVKNGFYKEHLIAITKKGMDGAEEIQQMLSTMRNNPLKEIDGEQVASLSDYQASTKKDLITGKITTIELPKSNVLIYQTINGTRIAARPSGTEPKIKFYFSV 540
>gi|71903836|ref|YP_280639.1| phosphoglucomutase [Streptococcus pyogenes MGAS6180] >gi|71802931|gb|AAX72284.1| phosphoglucomutase [Streptococcus pyogenes MGAS6180] (567 aa)
Score = 613, Expect = 1.9e-61, Identities = 160/530 (30%), Positives = 291/530 (54%)
  Q:    17 NPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI---VSSMPECQTIIDNVYTPNMD--LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFD-----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N + + WL +N +S+  K  +  +K NE EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK +LYK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I   ++++ + + I    +   +D  L++Y D++I E+Y +      IN T+I   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S K  +   A+I++  DPD DR+A+ V++    + +L GN++G + ++Y+ + ++FD       P +V + V+ +    IA  Y  +   T TGFK +  + N++    + +++ G+EE+IG       RDKD   A+ + +E+      + + L+D L  I+  FG +    ++ ++E +  ++ +   M+ F       +  +        I G +       L++YL++  W   R SGTEPK K Y    G+T+E     L A++
  S:     7 NEVYQEWLHNNDLSDDIKADLAAIKDNEAEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAVKKGIAVSYDVRYQSRTFAELTCSIMAANGIKAYLYK--GIRPTPMCSYAIRALGCISGVMITASHNPQAYNGYKAYWQEGSQILDDIADQIAQHMAALTQYEEIKQMPFEKALDSGLVTYIDESIEEAYKKEVLGLTINDTDI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKTFAYSEKLGKAVDADILIATDPDCDRVALEVKNAVGDYVFLNGNKIGALLSYYIFS-QRFDLGNLPANPVLVKSIVTGDLSRAIASHYGIETVETLTGFKNICGKANEYDVTKQKNYLFGYEESIGFCYGTFVRDKDAVSASMMIVEMAAYYKKKGQNLLDVLQTIYATFGYYNERQIALELEGIEGQKRIARIMEDFRQTPIASVAEMALDKTIDFIDGYQDFPKQNCLKFYLDDGSWYALRPSGTEPKIKFYLYTIGQTQENSATKLDAIE 556
>gi|148268927|ref|YP_001247870.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Staphylococcus aureus subsp. aureus JH9] >gi|150395004|ref|YP_001317679.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Staphylococcus aureus subsp. aureus JH1] >gi|147741996|gb|ABQ50294.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Staphylococcus aureus subsp. aureus JH9] >gi|149947456|gb|ABR53392.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Staphylococcus aureus subsp. aureus JH1] (611 aa)
Score = 613, Expect = 2.0e-61, Identities = 155/479 (32%), Positives = 257/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LLKS+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N K     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E L  K++++  M  F +   ++I GL++K I                 + N     +   L ++ ++  R SGTEPK K+Y  +
  S:    99 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLKSLNFNQFNLVDAQCKPDPNFSSVQSANPEDHHAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVKYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSSKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 593
>gi|160013206|sp|Q99RE2|PGCA_STAAM Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|160013214|sp|Q7A3K7|PGCA_STAAN Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) (552 aa)
Score = 613, Expect = 2.0e-61, Identities = 155/479 (32%), Positives = 257/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LLKS+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N K     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ +E L  K++++  M  F +   ++I GL++K I                 + N     +   L ++ ++  R SGTEPK K+Y  +
  S:    40 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLKSLNFNQFNLVDAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVKYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLEGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSSKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 534
>gi|111115670|ref|YP_710288.1| phosphomannomutase [Borrelia afzelii PKo] >gi|167942967|ref|ZP_02530041.1| phosphomannomutase [Borrelia afzelii ACA-1] >gi|110890944|gb|ABH02112.1| phosphomannomutase [Borrelia afzelii PKo] (569 aa)
Score = 613, Expect = 2.2e-61, Identities = 165/510 (32%), Positives = 274/510 (53%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWNE----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           NE EI   F Y  L FGTAG+R  +G GT  IN +  +++S+G+  ++L     P V +++D+R  +  +A   A+   S   + ++YK   ++ TP +SY++R+   D  ++ TASHN K Y G+K Y   G Q++      I + + + + II+ +         +I   D+ I + Y +   +   +  N  ++ N  V  T  HGT    +  L  +   + + L   Q +P+P F      NPE K S    ++ A+K   +I L  DPD+DR+ V  + +N+W +L GNQ+  I  +Y+L+ +   K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   +EM K+     F    EE+ G L     RDKD F A      +   L  + +T+ DYL++I++EFG +    +    E  N + + +  M K    +     G++I         K I + +          P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    34 NETEILNRF-YKDLEFGTAGMRGVIGAGTCYINTYNVKKISQGICNYVLKINKTPKVAISYDSRYFSKEFAYHAAQIFASNNFETYIYK--NLRPTPQLSYTIRKFDCDVGVMITASHNSKEYNGYKAYWKGGIQMMPPHDALITNEIKKVKNIINTITIKEGIEKKIIKELDNEIDKEYVKTINKEFPDFENNSKKTNLKVAYTALHGTGGTIIKKLFTNSKVQ-LFLEKSQIMPNPEFPTINYPNPEKKTSMIKVIELAKKEDCDIALATDPDADRIGVAFKDQNEWIFLNGNQISCILMNYILSKETNPKNTFVISSFVTTQMLEKIAQKYGSRIFRTYTGFKWIGSLIDEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLMLDLKAKNQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREALMSKLRKEQKMQFAGIKIIEKLDYQALKKINFKKEISEIKEYKYPTNAIKFILENEIVITVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|70725302|ref|YP_252216.1| hypothetical protein SH0301 [Staphylococcus haemolyticus JCSC1435] >gi|123661455|sp|Q4L9R5|PGCA_STAHJ Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|68446026|dbj|BAE03610.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (548 aa)
Score = 612, Expect = 2.4e-61, Identities = 159/479 (33%), Positives = 258/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP---NMDLISYFDDTITESYFEASYRCLIN--TNIY---RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-----------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           ++L+FGTAGIR   G G  ++N +T Q+++ G+A +L +K+ NP++++ +D R  +  +A +I + LTS GIKV+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q+ +  + E+          I+N+  P   N+DL     +  T    EA Y   IN  TN+     Q +  V+ T+ HGT    +P +LK + ++N+ L   QC  DPNF+   + NPE++ +FDL+++ A    AN+++  DPD DR+  V R  N + +Y  G+++G +   Y+L          V+ + VS     R+A+++   V     GFK +   + +  D   F+  +EE+ G L  D  RDKD  Q   L ++  ++L ++ KTL D L EI  E G +  + +S   E    ++++   MDK        I GL++  +   E                 P   +   L  + ++  R SGTEPK K Y  +
  S:    32 TELAFGTAGIRGQFGLGPGRLNRYTIQRLALGIANYLKDKEDNPSIVIHYDIRHLSSEFAHIITQILTSKGIKVYL--ADVYKTTPQLSFAVRYLQTSAGIMITASHNPKDYNGIKVYGADGAQLDEDTSLEVAQ-------YINNLGNPLELNIDLNQELIEKNTFDLQEAVYDSYINEITNLIGDIPQSDLKVVYTSLHGTGVPIIPDVLKHLNFQNVSLVELQCELDPNFSSVKSANPEEREAFDLAIQQAHDLEANLIIATDPDVDRMGFVERDTNGQTYYFGGSEIGALLIKYLLEYTNVPNHSVVIQSIVSGELGKRLAQQHEVTVKEVLIGFKHIAKAIRELDDTESFLFAYEESYGYLADDFVRDKDAIQIVPLIIKYTSILKNEGKTLHDALKEIHREVGQYRDKPMSKVFEGREGQQQINALMDKLRRNIPDVIAGLKVIAVEDYETLKRNYKEDNTEEAISLPQANVIRILFKEGFIALRPSGTEPKLKFYLSL 527
>gi|21284140|ref|NP_647228.1| hypothetical protein MW2411 [Staphylococcus aureus subsp. aureus MW2] >gi|21205583|dbj|BAB96276.1| MW2411 [Staphylococcus aureus subsp. aureus MW2] (583 aa)
Score = 612, Expect = 2.4e-61, Identities = 153/479 (31%), Positives = 258/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ ++ L  K++++  M  F +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    71 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLDGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 565
>gi|169824729|ref|YP_001692340.1| putative phosphomannomutase [Finegoldia magna ATCC 29328] >gi|167831534|dbj|BAG08450.1| putative phosphomannomutase [Finegoldia magna ATCC 29328] (565 aa)
Score = 612, Expect = 2.4e-61, Identities = 165/503 (32%), Positives = 287/503 (57%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS-----YFDDTITESYFEASYRCLINT-NIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDILGLEIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQ 540
           +K N+EEI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  + N         V +++D R  +  +A + A  L S GIKV+L   + I+ TP++SYS+R+    + I+ TASHNPK Y G+K Y   G QIL+ +A+EI+S++ + ++  +        LI+     YF + + + YFE      IN  NI   K+  ++ T  +GT +  + ++L   G++N+ +  +Q  PD NFT     NPE+  +F+ ++   ++  A+++L  DPD+DR AV V    ++ +L GN++G + T+Y+L+ +       + P VV + V+ +   +IA+KY  ++  T TGFK V  + N++    +  +V G+EE+IG       RDKD   ++ +  E+      Q KTL+D L+++++EFG       S  +E L+ +E++   M++F +           V+ KD    ++    +  P +  L++Y ++  W   R SGTEPK K+Y     ++KE  +Q
  S:    27 IKDNDEEIKDRF-YKSLEFGTAGLRGKIGAGTNRMNKYNIMKTTQALADTIKNYGDEALKRGVSISYDVRKFSKEFAEISANVLASNGIKVYL--SDDIRPTPMLSYSIRKFNCISGIMITASHNPKEYNGYKAYWEEGSQILEDKADEILSNLDKIKSFTEVKIGDFEKLIAEGKIQYFGENLDKDYFEDVLSLTINDDNI--DKDVKIVYTPLNGTGNRFVRHILDVRGFKNVYVVKEQENPDSNFTTVPYPNPENPEAFEYAINLGKEVGADLLLATDPDADRTAVEVLSNGEYVFLDGNKIGALLTNYILSQRYEKHDLPENPAVVKSIVTGDLSSKIAKKYGVEMIETLTGFKNVCGKANEYEKTGEKSWVFGYEESIGYSYGTFVRDKDAVSSSMMISEMLAYYKTQGKTLIDVLNDLYKEFGYHENSLSSVVLEGLDGQEKIGRIMEEFRHNPISEIGSTKLVETKD---YDVNFEDYGTPRSNVLKYYYDDGSWYALRPSGTEPKIKLYIYSVADSKEKAEQ 548
>gi|83857371|ref|ZP_00950899.1| phosphoglucomutase phosphomannomutase [Croceibacter atlanticus HTCC2559] >gi|83848738|gb|EAP86607.1| phosphoglucomutase phosphomannomutase [Croceibacter atlanticus HTCC2559] (575 aa)
Score = 612, Expect = 2.5e-61, Identities = 165/529 (31%), Positives = 283/529 (53%)
  Q:    20 SKAWLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASY-RCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------------KGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--ETKEICDQILKALKDE 548
           + +W+ S   ++   ++  ++  N  E++  F Y  L FGT G+R  MG GTN+IN +T  + ++G++ ++  + +     V++A+D R N+   A  +A   T+ GI VFL+ +  ++ TP +S+SV+       I+ TASHNP  Y G+KVY   GGQ++  +   I++ +   +   D ++    + I+Y D TI E++F AS      NT    ++N  ++ T+ HGT+   +P +L+  GY N+ +  +Q  P+ +F    + NPE+  +  ++   A    A+I++G DPDSDRL + VR  K++   L GNQ  ++ T ++L       K     FV ST VST  +  + E Y A+     TGFKW+  +M K +  +DF+ G EE+ G +  D  RDKD   +  LA E+   L  +  +++D L +++ +FG +  E +S   +     EE+++ + +  N   + I G  +                 K    N P +  L +Y +    +  R SGTEPK K Y  +     +KE  D+    L  +
  S:    11 ANSWMTSTYDADTTAKVNHLITNNPTELEDSF-YKNLEFGTGGMRGIMGVGTNRINKYTLGKNTQGLSNFMKQQFNGEQLKVVIAYDCRHNSKSLAKTVADVFTANGIDVFLFSD--LRTTPELSFSVKYLNCHCGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDAAIINEIDSLK-YEDILFKGQDERITYIDSTIDEAFFAASVDNGSFNTPNSAKENLNIVFTSLHGTSITAIPQVLERAGYNNVNIVKEQAEPNGDFPTVKSPNPEEPEALKMATDLALAINADIVIGTDPDSDRLGIAVRDLKDQMVLLNGNQTMVVMTWFLLEQWKKAGKLHNDTFVGSTIVSTPMLKVMTEAYGAQYHEGLTGFKWIA-KMIKDLPDLDFIGGGEESFGFMVGDFVRDKDAVTSTLLACEIAAQLKAEGSSILDKLHDLYSQFGYYKEELISLVKKGKEGAEEIKQMLIELRNNPLQTIAGETVVKVEDYANSTSLNPVSQKTTELNIPKSNVLIYYTDKGTKIAARPSGTEPKIKFYISVNSTLSSKETIDETTAVLNSK 564
>gi|49487270|ref|YP_044491.1| putative phosphomannomutase [Staphylococcus aureus subsp. aureus MSSA476] >gi|81648648|sp|Q6G6I3|PGCA_STAAS Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|160013122|sp|Q8NUV4|PGCA_STAAW Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|49245713|emb|CAG44192.1| putative phosphomannomutase [Staphylococcus aureus subsp. aureus MSSA476] (552 aa)
Score = 612, Expect = 2.6e-61, Identities = 153/479 (31%), Positives = 258/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           SKL+FGTAGIR   G G  ++N FT ++++ G+AR+L  + ++PT+++ +D R  +  +A +IA  L +  I V+L   +  K TP +S++VR     A I+ TASHNPK+Y G KVY   G Q L ++A+E+ S   E       +  P    N   I  F  ++T+ Y +     +       + +  V+ T+ HGT+   +P LL+S+ +    L   QC PDPNF+   + NPED  +FD +++ A K  A++++  DPD+DRL +  R  +    Y  GNQ+G +  +Y +      +   ++ + VS+     +A   N +     TGFK++  E+ +  D  + +  FEE+ G L+    RDKD  Q   L ++  + L    KTL D L++I++  G       S+ ++ L  K++++  M  F +   ++I GL++K I                 + N P   +   L ++ ++  R SGTEPK K+Y  +
  S:    40 SKLTFGTAGIRGKFGLGEGRLNKFTIEKLALGLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYL--PDTYKTTPELSFAVRNLNTTAGIMITASHNPKDYNGIKVYGSDGAQ-LSTDASELASRYIEEVGDPLQIDIPISKQNTSYIKPFPKSVTDDYMKHIQNMI---GYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFNLVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHGHITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKFIAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDELEQIYQTVGRHEDTLFSHTLDGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVYHLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSL 534
>gi|153166182|ref|ZP_01926801.1| hypothetical protein LMHG_00047 [Listeria monocytogenes FSL N1-017] >gi|167214063|ref|ZP_02284370.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes FSL R2-503] >gi|133727698|gb|EBA29396.1| hypothetical protein LMHG_00047 [Listeria monocytogenes FSL N1-017] (557 aa)
Score = 612, Expect = 2.8e-61, Identities = 165/525 (31%), Positives = 290/525 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK-KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +S++++  + ++ E+E +++  Y  L+FGT G+R  MG GT +IN+FT +++++G+  +++ N  +   V +A+D+R ++  +A   AK L + G+KV+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   +      I +++T      PN  L+      + ++Y +A    +   ++         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SF+L+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +   Y+L  K    +   +++T V+ +   RIA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  I   +    L++YL ++ W   R SGTEPK KIY++  G+T+EI  + +  LK
  S:     9 AWQNAD-LSDEWRRELQRV-EQEQERFDGY--LTFGTGGMRGKMGVGTKRINLFTIRRVAKGLGDYVVANGGAEMGVAIAYDSRHHSGAFAQETAKVLAAQGVKVYL--SDTIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEN----ITDIFTIPVRELPN-PLVMTLGKEMDDAYLKALTAVVSRPDLLADYGNELQICYTPLHGAGKELVMRGLLENGFSETTMIAEQSEPDGDFPTVVSPNPEEENSFELAKKQAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLQYILEAKTSVTQADTMINTIVTGDLGGRIAHDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLQKLTNLYEKFGYHKEHLHTITLDDSDGTTKMNQVIDDLRKEPTCIPGITVLEDFLTSKRTNLSTMEMTNIELPK-ENVLKFYLNDNAWFAIRPSGTEPKCKIYFQTIGQTEEIATKAMDELK 549
>gi|153197784|ref|ZP_01941996.1| hypothetical protein LMRG_02288 [Listeria monocytogenes 10403S] >gi|127632743|gb|EBA22185.1| hypothetical protein LMRG_02288 [Listeria monocytogenes 10403S] (557 aa)
Score = 612, Expect = 2.8e-61, Identities = 168/525 (32%), Positives = 287/525 (54%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK-KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +SN+++  + ++ EEE +++  Y  L+FGT G+R  MG GT +IN FT +++++G+  +++ N+ +   V +A D+R ++  +A   AK L + GI ++L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   + +    I +++T      PN  L++     + ++Y  A    +   ++         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SFDL+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +   Y+L  K        +++T V+ +   RIA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  I   +    L++YL ++ W   R SGTEPK KIY++  GET+EI    +  LK
  S:     9 AWQNAD-LSNEWRRELQRV-EEEQERFDGY--LTFGTGGMRGKMGIGTKRINFFTIRRVAKGLGDYVVANEGAEMGVAIAFDSRHHSGAFAQETAKVLAAQGINIYL--SDSIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEK----ITDIFTIPVRELPN-PLVTPLGKEMDDAYLNALTAVVSRPDLLADYGNELRICYTPLHGAGKELVMRGLLENGFSETTIIAEQSEPDGDFPTVISPNPEEENSFDLAKKLAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLQYILEAKTSVTGADTMINTIVTGDLGGRIAHDFGINHIQTLTGFKYIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLQKLTNLYEKFGYHKEHLHTITLDDSDGTTKMNQVIDALRKEPTFIPGITVLEDFLTNKRTNLSTMEMTNIELPK-ENVLKFYLNDNAWFAIRPSGTEPKCKIYFQTIGETEEIATNAMDELK 549
>gi|15595180|ref|NP_212969.1| phosphomannomutase (cpsG) [Borrelia burgdorferi B31] >gi|2688773|gb|AAC67177.1| phosphomannomutase (cpsG) [Borrelia burgdorferi B31] (570 aa)
Score = 611, Expect = 3.1e-61, Identities = 173/518 (33%), Positives = 285/518 (55%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  + L +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    23 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKELPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKKDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 568
>gi|167944345|ref|ZP_02531419.1| phosphomannomutase (cpsG) [Borrelia burgdorferi Bol26] (569 aa)
Score = 611, Expect = 3.3e-61, Identities = 173/518 (33%), Positives = 285/518 (55%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  + L +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLIANEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKELPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|167933931|ref|ZP_02521006.1| phosphomannomutase (cpsG) [Borrelia burgdorferi ZS7] (569 aa)
Score = 611, Expect = 3.3e-61, Identities = 173/518 (33%), Positives = 285/518 (55%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  + L +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLIANEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKELPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|166030757|ref|ZP_02233586.1| hypothetical protein DORFOR_00431 [Dorea formicigenerans ATCC 27755] >gi|166029549|gb|EDR48306.1| hypothetical protein DORFOR_00431 [Dorea formicigenerans ATCC 27755] (560 aa)
Score = 611, Expect = 3.5e-61, Identities = 157/526 (29%), Positives = 277/526 (52%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP-----NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-----EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-IKGIRWNEP-------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG----ETKEICDQILKALK 546
           K W+E++      K  + ++  N+EEI + F+ + L FGTAG+R  +G GTN++N++  +Q ++G+A W+  +    TV +++D+R+ +D +A   A  L + GIKV +Y  + +   P +S++ R    +A ++ TASHNP  Y G+K Y   G Q+ D  A  +   + +   +    Y P        LI +  D    + ++A     +   + +     ++ +  +G+    +  +LK IG  +I +  +Q  P+  FT  +  NPE   + +  L  A++  A++ML  DPD+DR+ + ++  +  +  ++GN++G++   Y+   +       K P  V + VST   D +AE Y  ++    TGFKW+G+     E    +D+  F+ GFEE+ G L     RDKD    + L  E+         +L   ++EI+ E+G +  +  S++   L+  + M E M    +   + I G + +K   + +P       A  L + LEN+  V  R SGTEPK KIYY   G    E +   D++ +ALK
  S:     7 KRWMEADLEDADLKPELARIEENDEEIKERFAVA-LKFGTAGLRGVLGAGTNRMNIYVVRQATQGLANWVKTQGGTQTVAISYDSRIKSDIFAKNAASVLAANGIKVRIY--DALMPVPALSFATRYYNCNAGVMVTASHNPAKYNGYKAYGPDGCQMTDDAAAIVYEEIQKTDVLTGAKYMPFAQGVEEGLIRFVGDDCKRALYDAIEDRQVRPGLCKTAGLKLVYSPLNGSGLVPVTQVLKDIGITDITIVPEQEYPNGYFTTCSYPNPEIFEALEKGLNLAKETGADLMLATDPDADRVGIAMKCPDGSYELVSGNEVGVLLLDYICAGRIEKGTMPKNPVAVKSIVSTPLADAVAEHYGVELRSVLTGFKWIGDQIAGLEAAGEVDR--FIFGFEESYGYLAGPYVRDKDAIIGSMLICEMAAYYRSIGSSLKQRMEEIYSEYGRYLNKIDSFEFPGLSGMDRMSEIMQGLRDKPLEKIAGYKVVKVTDYKKPEETGLPAANVLIYKLENNETVIVRPSGTEPKIKIYYTTLGKDLAEAQAEKDKLSEALK 556
>gi|153201565|ref|ZP_01943374.1| hypothetical protein LMSG_00392 [Listeria monocytogenes HPB2262] >gi|133735873|gb|EBA37571.1| hypothetical protein LMSG_00392 [Listeria monocytogenes HPB2262] (557 aa)
Score = 611, Expect = 3.5e-61, Identities = 165/525 (31%), Positives = 290/525 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK-KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +S++++  + ++ E+E +++  Y  L+FGT G+R  MG GT +IN+FT +++++G+  +++ N  +   V +A+D+R ++  +A   AK L + G+KV+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   +      I +++T      PN  L+      + ++Y +A    +   ++         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SF+L+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +   Y+L  K    +   +++T V+ +   RIA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  I   +    L++YL ++ W   R SGTEPK KIY++  G+T+EI  + +  LK
  S:     9 AWKNAD-LSDEWRRELQRV-EQEQERFDGY--LTFGTGGMRGKMGVGTKRINLFTIRRVAKGLGDYVVANGGAEMGVAIAYDSRHHSGAFAQETAKVLAAQGVKVYL--SDTIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEN----ITDIFTIPVRELPN-PLVMTLGKEMDDAYLKALTAVVSRPDLLADYGNELQICYTPLHGAGKELVMRGLLENGFSETTMIAEQSEPDGDFPTVVSPNPEEENSFELAKKQAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLQYILEAKTSVTQADTMINTIVTGDLGGRIAHDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLQKLTNLYEKFGYHKEHLHTITLDDSDGTTKMNQVIDDLRKEPTCIPGITVLEDFLTSKRTNLSTMEMTNIELPK-ENVLKFYLNDNAWFAIRPSGTEPKCKIYFQTIGQTEEIATKAIDELK 549
>gi|81428134|ref|YP_395133.1| phosphoglucomutase [Lactobacillus sakei subsp. sakei 23K] >gi|78609775|emb|CAI54821.1| Phosphoglucomutase [Lactobacillus sakei subsp. sakei 23K] (574 aa)
Score = 611, Expect = 3.7e-61, Identities = 155/505 (30%), Positives = 261/505 (51%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR------------WNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIY 527
           W    ++    +E +  M  +EE ++K FS   + FGTAG+R  +GPG N +N++T +Q +EG+A++   L        V ++ D+R  ++ +A   A+ L    I  F++  + ++ TP +S++VR     A I+ TASHNPK Y G+K+Y   G Q+   E++ I S + +        + D +      +++   + + ++Y     +  IN  +     K   +I T  HGT        L+  G+E   + A+Q V DP F  +   NPE   +FD++++  +  +A++++  DPD+DRL   VR  +  +  +TGNQ+  +   Y+L   K           V + VST    +IA  YN K+    TGFK++  ++    D  +  F+ GFEE+ G L     RDKD  Q   L  EV        KTL D + E++ E+G +  +T +   E +N  ++M + M K       D  G+++                  EP     +  L+++LE+  W+  R SGTEPK K Y
  S:    10 WNNQTKMDLPLREALDNMANDEEALEKAFSVP-MEFGTAGMRGLLGPGINCMNIYTVRQATEGLAQFMETLPEATKKRGVAISFDSRYQSETFAHEAARVLGQHQIPTFVF--DALRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGAQMPPKESDMITSYIRQVSDLFAIEVADEMALREAGIMALIGENVDQAYLAEVKKVTINQELVDTVGKTMSLIYTPLHGTGKVLGERALRQAGFEQFTMVAEQAVADPEFATTPFPNPEFPQTFDMAIELGKSQKADLLIATDPDADRLGAAVRQPDGSYQLMTGNQIASVLLRYILQASKDAGTLPANAAAVKSIVSTELATKIAASYNVKMIDVLTGFKFIAEQIQHFEDTNENTFMFGFEESYGYLVKPFVRDKDAIQTLVLLAEVAAYYKSNGKTLYDGIQELYAEYGYYAEQTTAIDFEGVNGPQQMADLMVKCREESPVDFAGIKVASAEDFQTQTQTFADGHTEPINLPTSNVLKYHLEDGTWIAIRPSGTEPKVKFY 547
>gi|86132313|ref|ZP_01050908.1| putative phosphoglucomutase [Cellulophaga sp. MED134] >gi|85817232|gb|EAQ38415.1| putative phosphoglucomutase [Dokdonia donghaensis MED134] (575 aa)
Score = 610, Expect = 4.0e-61, Identities = 158/491 (32%), Positives = 270/491 (54%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASY-RCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKT------PFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE------------------WYLENDMWVKFRLSGTEPKFKIYYEIY 531
           N +E+   F Y  L FGT G+R  MG GTN+IN +T  + ++G++ +L  + ++   +V +A+D R N+   A V+A   ++ GIKVFL+ +  ++ TP +S++VR       I+ TASHNP  Y G+KVY   GGQ++  +   I+ ++ +     D  +  N DLI   D T+ +++ +AS  +     +   +++  ++ T+ HGT+   +P  LK  G+ N+ +  +Q VPD NF    + NPE+ A+  ++L+  EK  A+I++G DPD DRL + VR  N K   L GNQ  I+ T Y+L  ++F ++      PFV ST VST  +D +A  Y+ +     TGFKW+  +M +   +  F+ G EE+ G +  D  RDKD   A  LA  +        +TL + L  ++ + G +    +S   +  +   E+++ +        ++I G ++  +   + + +L+                  +Y ++   V  R SGTEPK K Y  ++
  S:    35 NPDELADSF-YKNLEFGTGGMRGVMGAGTNRINKYTLGKNTQGLSDYLYTQFTDEQISVAIAYDCRHNSKELAQVVADVFSANGIKVFLFSD--LRPTPELSFAVRHLNCHCGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDAAIIKTI-DALDFSDIKFKGNDDLIERIDTTVDKAFIDASVAKVSFGLDNKTKEDLGIVFTSLHGTSITLVPDTLKQAGFTNLSIVKEQEVPDGNFPTVVSPNPEETAALKMALELGEKEGADIVIGTDPDCDRLGIAVRGDNGKLTILNGNQTMILMTDYLL--ERFRESANQHPQPFVGSTIVSTPMMDVLAASYDVECKTGLTGFKWIA-KMIEDYPQQHFIGGGEESFGFMVGDFVRDKDAVTATLLACTIAAEAKKNGQTLFEKLKTLYLKHGFYQETLISLVKKGQSGAAEIKQMLKDLRENPMQEINGSKVTRVEDYQASTSLDLTTGKTTTIDIPKSNVLIYYTQDGSKVAARPSGTEPKIKFYISVH 546
>gi|77409336|ref|ZP_00786039.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae COH1] >gi|77172068|gb|EAO75234.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae COH1] (564 aa)
Score = 609, Expect = 6.5e-61, Identities = 165/521 (31%), Positives = 282/521 (54%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM---PECQTIIDNVYTPNM--DLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL---------GLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           N   + + WLE++ +    K  +  +K +E EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK ++YK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I + M    + Q I    +   +   L SY D++I E+Y +      IN TNI   K+  V+ T  +G  +  +  +L+  G+ENI +  +Q +PDP+FT     NPE   +F  S    +   A+++L  DPD DR+A+ V+  K ++ +L GN++G + ++Y+ + +         P +V + V+ +    IA+KYN +   T TGFK +  + N++    D  ++ G+EE+IG       RDKD   A+ + +E+     ++ +TL+D L  I++EFG +     S ++E    +E +   M+ F   +   IL          ++ K    + P Q  L++Y     W   R SGTEPK K Y    G T+
  S:     2 NYKEIYQEWLENDSLGKDIKSDLEAIKGDESEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAIARGIAVSYDVRYQSKEFAELTCSIMAANGIKSYIYK--GIRPTPMCSYAIRALGCVSGVMVTASHNPQAYNGYKAYWKEGSQILDDIADQIANHMDAITDYQQIKQIPFEEALASGLASYIDESIEEAYKKEVLGLTINDTNI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENIYVVPEQEMPDPDFTTVGYPNPEVPKAFAYSESLGKSVDADVLLATDPDCDRVALEVKDSKGEYIFLNGNKIGALLSYYIFSQRCALGNLPHHPVLVKSIVTGDLSKVIADKYNIETVETLTGFKNICGKANEYDISKDKTYLFGYEESIGFCYGTFVRDKDAVSASMMVVEMTAYYKERGQTLLDVLQTIYDEFGYYNERQFSLELEGAEGQERISRIMEDF---RQNPILQVGEMTLENSIDFKDGYKDFPKQNCLKYYFNEGSWYALRXSGTEPKIKCYLYTIGCTE 542
>gi|93280014|gb|ABF06649.1| phosphoglucomutase [Lactobacillus reuteri] (574 aa)
Score = 608, Expect = 7.1e-61, Identities = 168/534 (31%), Positives = 283/534 (52%)
  Q:    21 KAWLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRC-----LINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH-IDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQ----------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K W E   + +  K+ +  M+++ EI+  F Y  LSFGTAG+R  MGPG N++NV+T +Q +EG+A     L +      V + +D+R N+  +A   A+ L + GIKV++Y  + ++ TP +S++VR  G  A I+ TASHNPK Y G+K+Y   GGQ+   E++ +   + +   I D       +++    +TI     +A+Y        +N  + ++  K+   + T   GT        L+  G+ N  +   +  P+ +F    + NPE   +F  S+   +K  A++++  DPD+DRL   VR  + ++  LTGNQ+  I   Y+L   K      K    V + VSTN+  +IAE Y  ++    TGFKW+ ++++++   K D  F+ GFE++ G L     RDKD  Q+  L  EV      +   L D L E+F+++G +  +T++     ++   +++  M KF         G ++        G +     +           L + L++D W+  R SGTEPK K Y    G + +  D+  + L D FE  L+
  S:     8 KVWQERTDLESDLKQELAAMSDDKEIEDAF-YGPLSFGTAGMRGLMGPGINRMNVYTVRQATEGLATLMDSLGDDIKKRGVAIGYDSRHNSRKFAHDAARVLGAHGIKVYIY--DNLRPTPELSFAVRHMGTYAGIMITASHNPKEYNGYKIYGEDGGQMPPKESDMMTGYIRKIDDIFDIALADEQEMLDNGLETIMGEDVDAAYLANAKGVTVNPELAKEYGKDMKFVFTPLCGTGRMLGERALRQAGFTNYEMEPTEAQPNGDFPGLEHPNPEFPEAFVRSIALGKKVDADVLIATDPDADRLGCAVRQPDGEYQLLTGNQIASIMLAYILEAHKQAGTLPKNAAAVKSIVSTNFAAKIAESYGVEMINVLTGFKWIADQIHQYETGKADHTFMFGFEKSYGYLIKPFVRDKDAIQSLTLLAEVAAYSRSRNMPLYDGLQELFKKYGYFREKTIANTYAGVDGPAKIKALMKKFREEAPTHFAGHQVVVTEDFANGTKTTADGEVSELGIPESNVLRYILDDDTWIAIRPSGTEPKLKFY---IGTSADTLDKANEKLAD-FEKALQ 570
>gi|195959613|ref|ZP_03095822.1| phosphomannomutase (cpsG) [Borrelia sp. SV1] (569 aa)
Score = 608, Expect = 7.8e-61, Identities = 172/518 (33%), Positives = 285/518 (55%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +   + L +     ++ N  +  T  HGT    +  L  +   + + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKTINKELPDFEKNSKETNLRIAYTALHGTGGTIIKKLFANSKIQ-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|163756457|ref|ZP_02163570.1| phosphomannomutase [Kordia algicida OT-1] >gi|161323565|gb|EDP94901.1| phosphomannomutase [Kordia algicida OT-1] (574 aa)
Score = 608, Expect = 8.4e-61, Identities = 164/511 (32%), Positives = 279/511 (54%)
  Q:    20 SKAWLESNRISN---KYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIY--RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM-----DKFANVKNKDILGLEIKGIRWNEPAQA-------------LEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           + AWL S+  S+   K ++LI   + +E+ + F Y  L+FGT G+R  MGPGTN+IN +T  + ++G++ +L  KK+ P     V +A+D R N+   A V+A   ++ GI+V+L+ +  ++ TP +S++V+       I+ TASHNP  Y G+KVY   GGQI+  +  EI+  +          +  N DLI   D  + E++ +AS   + N +     + +  ++ T+ HGT+   +P +LK  GY N+ +  +Q  PD +F    + NPE+  + +++L+ AEK  A+I++G DPDSDRL + VR  +     L GNQ  ++ T ++L     N K +   F+ ST VST  +  +   Y+ +     TGFKW+  +M K   +M+F+ G EE+ G +  D  RDKD   AA LA E+ T       +    L +++   G +  + +S   + ++   E+++ M     +    +    ++ +E          +A             L +Y  +   +  R SGTEPK K Y+ +
  S:    12 ATAWLSSSFDSDTQAKVQQLI-DSDPKELTESF-YKDLAFGTGGMRGVMGPGTNRINKYTLGKNTQGLSNYL--KKTYPNEQLKVAIAYDCRHNSKSLAQVVANVFSANGIEVYLFSD--LRPTPELSFAVKYLDCHCGIVLTASHNPPEYNGYKVYWTDGGQIVPPQDGEIIEEI-NALDFAQVQFDANADLIHLIDTDVDEAFIKAS---VANADFKAPNKDDVTIVFTSLHGTSITMIPEVLKRAGYNNVHIVEEQAKPDGDFPTVVSPNPEEPEALEMALQLAEKTNADIVIGTDPDSDRLGIAVRDLEGNMILLNGNQTMVVMTDFLLQQWKNNNKINGKQFIGSTIVSTPMMTTLGNAYDVECKIGLTGFKWIA-KMIKDFPEMEFIGGGEESFGFMTGDFVRDKDAVTAALLACEIATTAKANGSSFYASLIDMYVAHGFYKEKLISLVKKGIDGAAEIKQTMIDLRENSLTTLDGSKVVRIEDYQTSMTTDIEAGTSTPISIPKSNVLIYYTADGTKIAARPSGTEPKIKFYFSV 543
>gi|168692592|ref|ZP_02725384.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 94a] >gi|195960700|ref|ZP_03096905.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 64b] (569 aa)
Score = 608, Expect = 8.7e-61, Identities = 172/518 (33%), Positives = 284/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|25010608|ref|NP_735003.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae NEM316] >gi|77414017|ref|ZP_00790189.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae 515] >gi|23094962|emb|CAD46183.1| Unknown [Streptococcus agalactiae NEM316] >gi|77159943|gb|EAO71082.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae 515] (564 aa)
Score = 607, Expect = 8.8e-61, Identities = 165/521 (31%), Positives = 282/521 (54%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM---PECQTIIDNVYTPNM--DLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL---------GLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           N   + + WLE++ +    K  +  +K +E EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK ++YK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I + M    + Q I    +   +   L SY D++I E+Y +      IN TNI   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S    +   A+I+L  DPD DR+A+ V+  K ++ +L GN++G + ++Y+ + +         P +V + V+ +    IA+KYN +   T TGFK +  + N++    D  ++ G+EE+IG       RDKD   A+ + +E+     ++ +TL+D L  I++EFG +     S ++E    +E +   M+ F   +   IL          ++ K    + P Q  L++Y     W   R SGTEPK K Y    G T+
  S:     2 NYKEIYQEWLENDSLGKDIKSDLEAIKGDESEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAIARGIAVSYDVRYQSKEFAELTCSIMAANGIKSYIYK--GIRPTPMCSYAIRALGCVSGVMVTASHNPQAYNGYKAYWKEGSQILDDIADQIANHMDAITDYQQIRQIPFEEALASGLASYIDESIEEAYKKEVLGLTINDTNI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKAFAYSESLGKSVDADILLATDPDCDRVALEVKDSKGEYIFLNGNKIGALLSYYIFSQRCALGNLPHHPVLVKSIVTGDLSKVIADKYNIETVETLTGFKNICGKANEYDISKDKTYLFGYEESIGFCYGTFVRDKDAVSASMMVVEMTAYYKERGQTLLDVLQTIYDEFGYYNERQFSLELEGAEGQERISRIMEDF---RQDPILQVGEMRLENSIDFKDGYKDFPKQNCLKYYFNEGSWYALRPSGTEPKIKCYLYTIGCTE 542
>gi|195955710|ref|ZP_03094403.1| phosphomannomutase (cpsG) [Borrelia burgdorferi CA-11.2a] (569 aa)
Score = 607, Expect = 8.9e-61, Identities = 172/518 (33%), Positives = 284/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEKYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|195941955|ref|ZP_03087337.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 80a] (569 aa)
Score = 607, Expect = 9.4e-61, Identities = 172/518 (33%), Positives = 284/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYTSVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|28377622|ref|NP_784514.1| phosphoglucomutase [Lactobacillus plantarum WCFS1] >gi|28270455|emb|CAD63357.1| phosphoglucomutase [Lactobacillus plantarum WCFS1] (575 aa)
Score = 606, Expect = 1.2e-60, Identities = 154/504 (30%), Positives = 264/504 (52%)
  Q:    51 YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARW---LLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI-----SYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL-TNKKFDKTPF---VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID---KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP-----------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           Y  + FGTAG+R  +GPG N++N++T +Q +EG+AR+   L  +     V ++ D+R +++ +A   A+ L   GIK ++++   ++ TP +S++VR     A I+ TASHNPK Y G+K+Y   GGQ+   E++ I S + +   +          L+     +   D + + Y        IN  +  +  K+  ++ T  HGT        LK+ G++N  +  +Q V DP F+     NPE   +F +++   +K  A++++ VDPD+DRL   VR  N ++  LTGNQ+  +  HY+L  NK     P     V + VS+ +  ++A  Y   +    TGFK++  ++ +H +   +  ++ GFEE+ G L      DKD  Q   L  EV      Q K L D L ++F+E+G +  +T S + + +   +++   M KF +       G ++ G    +                  A  L+++L +  W+  R SGTEPK K Y    G T E  +  L   +D  +  ++
  S:    39 YEPMEFGTAGMRGVLGPGINRMNIYTVRQATEGLARFMDTLPAEVKERGVAISFDSRHHSEDFAHESARVLGQHGIKSYVFE--SLRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGGQMPPKESDLITSYIRKVDDVFAIAVADEQQLLADKTETIIGDDVDQDYLAKVKEVTINQKLVDEVGKDMKLVFTPLHGTGRMLGEKALKNAGFKNFSVVKEQAVADPEFSTVKFPNPEFPEAFKMAIDLGKKEGADVLIAVDPDADRLGTAVRQPNGEYVLLTGNQIAAVLLHYILQANKDAGTLPTNAAAVKSIVSSEFATKVAASYGVTMINVLTGFKYIAEQI-EHFEATGEHTYMFGFEESYGYLIKPFVHDKDAIQTTVLLAEVAAYYKQQGKNLYDGLQDLFKEYGYFREQTTSEEFDGVGGSDKIAALMTKFRSEAPTAFAGYDVTGTEDFQSQTESFADGHTAPIALPKANVLKYHLNDGTWIAIRPSGTEPKIKFYIGTLGSTLEEANDKLAKFEDAIQAFIK 574
>gi|150025210|ref|YP_001296036.1| phosphoglucomutase/phosphomannomutase family protein [Flavobacterium psychrophilum JIP02/86] >gi|149771751|emb|CAL43225.1| Phosphoglucomutase/phosphomannomutase family protein [Flavobacterium psychrophilum JIP02/86] (575 aa)
Score = 606, Expect = 1.2e-60, Identities = 165/508 (32%), Positives = 280/508 (55%)
  Q:    23 WLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNV-YTPNMDLISYFDDTITESYFE-----ASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM-------------------DKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL     S    E+  I+  + +E++  F Y  L FGT G+R  MG G+N+IN +T  + ++G++ +L   KS P     V +A+D R N+D  A V+A   ++ GIKVFL+ +  ++ TP +S++V+  G  A I+ TASHNP  Y G+KVY   GGQ++  +  EI+  +       D + +  N +LI Y D  + +++       AS++ L       ++   ++ T+ HGT+   +P +L+  GY+N+ + A+Q +PD NF    + NPE+  +  +++  A+K  A+I++G DPDSDR+ V VR+ + K   L GNQ  ++ T+++L       K     F+ ST VST  +  +A  Y  +     TGFKW+   + K      F+ G EE+ G +  D  RDKD   A  L  E+     +   +L + L +++ +FG +    +S   + +    E+++ M                   + + N+  K+I   EI+ +   + +  L +YLE+   +  R SGTEPK K Y+ +
  S:    14 WLTPTFDSKTQDEIKEIMTSSPKELEDCF-YKNLEFGTGGMRGIMGVGSNRINKYTLGKNTQGLSDYL--HKSFPNQEIKVAIAYDCRHNSDSLAKVVADVFSANGIKVFLFSD--MRPTPELSFAVKYLGCQAGIVLTASHNPPEYNGYKVYWEDGGQLVPPQDKEIIQVIDALN--YDQIKFDANENLIEYIDVKVDDAFINSTIENASFKTLATA----KEKLKIVFTSLHGTSIKLIPDVLEKAGYKNVEIVAEQAIPDGNFPTVKSPNPEEPEALTMAMALADKTNADIVIGTDPDSDRVGVAVRNTQGKMVLLNGNQSMVVMTNFLLEQWKKQGKITGNEFIGSTIVSTPMMLELASAYGIECKVGLTGFKWIAKFI-KDFPNQKFIGGGEESFGFMVGDAVRDKDAVAATLLVCEMAAQAKENGSSLYEELLKLYVDFGFYKEHLISITKKGIEGANEIKQMMVNLRENPLKEINGERVVFIEDYQNLTAKNIFTNEIEALHLPK-SNVLIYYLEDGSKICARPSGTEPKIKFYFSV 544
>gi|46907096|ref|YP_013485.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b F2365] >gi|46880363|gb|AAT03662.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b F2365] (557 aa)
Score = 605, Expect = 1.5e-60, Identities = 164/525 (31%), Positives = 288/525 (54%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK-KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +S++++  + ++ E+E +++  Y  L+FGT G+R  MG GT +IN+F  +++++G+  +++ N  +   V +A+D+R ++  +A   AK L + G+KV+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   +      I +++T      PN  L+      + ++Y +A    +   ++         +  T  HG     +   L   G+    + A+Q  PD  F    + NPE++ SF+L+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +   Y+L  K    +   +++T V+ +   RIA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  I   +    L++YL ++ W   R SGTEPK KIY++  G+T+EI  + +  LK
  S:     9 AWQNAD-LSDEWRRELQRV-EQERERFDGY--LTFGTGGMRGKMGVGTKRINLFIIRRVAKGLGDYVVANGGAEMGVAIAYDSRHHSGAFAQETAKVLAAQGVKVYL--SDTIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEN----ITDIFTIPVRELPN-PLVMTLGKEMDDAYLKALTAVVSRPDLLADYGNELQICYTPLHGAGKELVMRGLLENGFSETTMIAEQSEPDGGFPTVVSPNPEEENSFELAKKQAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLQYILEAKTSVTQADTMINTIVTGDLGGRIAHDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLQKLTNLYEKFGYHKEHLHTITLDDSDGTTKMNQVIDDLRKEPTCIPGITVLEDFLTSKRTNLSTMEMTNIELPK-ENVLKFYLNDNAWFAIRPSGTEPKCKIYFQTIGQTEEIATKAMDELK 549
>gi|187918689|ref|YP_001884256.1| phosphoglucomutase [Borrelia hermsii DAH] >gi|119861537|gb|AAX17332.1| phosphoglucomutase [Borrelia hermsii DAH] (578 aa)
Score = 605, Expect = 1.8e-60, Identities = 169/520 (32%), Positives = 266/520 (51%)
  Q:    31 NKY--KELILKMNEEEIDKYFS--YSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP---NMDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------------------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--ETKEICDQILKALKDEFE 550
           NKY   E I  +NE    K ++  Y +L FGTAG+R  +G GT  IN +   + S+G+A ++L    NP V +++D+R  +  +A   A+   S G+KV++YK   +++TP +SY+VR+   D  I+ TASHN K Y G+KVY   G Q++      I+S + +   I + +      N   I+  +D +   Y E       N N   +  N  V  T  HGT    +  L K    E ++    Q  PDP F      NPE+  +    ++ A++   +I    DPD+DR+ +      +W  L GNQ+  I  HY+L+ ++     F +++FV+T  +D+I++KYN+ +FRT TGFKW+G   +EM        F+ G EE+ G L     RDKD F A     ++   L   + T+  YL E+++E G +    ++   +  N     ++ + KF N   K   G+ I                   K   +     A+++ LEN + +  R SGTE K K Y  IY   E K     I+  +K E E
  S:    28 NKYFKDEAIRLLNENNEGKIYNRFYKELEFGTAGMRGIIGAGTYYINTYNIAKASQGIANYILEITQNPKVAISYDSRYFSKEFAYNAAEIFASNGLKVYIYK--HLRSTPQLSYTVRKLDCDLGIMITASHNAKEYNGYKVYWKGGAQVIPPHDTRIISEIKKVSKIKNTLTKEEGINTQAITEINDELDMMYIEKVNEEFPNFNKKSKNINLRVAYTPLHGTGGTMIKNLFKGSQVE-LLTEPSQINPDPEFPTVNYPNPEEHVAMSRVIELAKRKNCDIAFATDPDADRMGIAFNEGKEWKILNGNQIACILMHYLLSIEENPNNVFTIASFVTTPMLDKISQKYNSTLFRTYTGFKWIGHLIDEMKTKEPNKKFIFGCEESHGYLIGTGTRDKDAFSAIKGFCDLMFTLKKNQITIGTYLQEMYKELGYYEDFIINKSFQESNGDFLKEDLISKFRNEVKKKFAGINIIKKLDYKTLKETDINGNVHKIKEYKHTTNAIKFLLENGIEITIRPSGTESKIKFYVSIYSRYEKKNNIFDIMNNIKMEIE 576
>gi|16802906|ref|NP_464391.1| hypothetical protein lmo0865 [Listeria monocytogenes EGD-e] >gi|16410268|emb|CAC98943.1| lmo0865 [Listeria monocytogenes] (557 aa)
Score = 605, Expect = 1.9e-60, Identities = 170/525 (32%), Positives = 291/525 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +SN+++  + ++ EEE +++  Y  L+FGT G+R  MG GT +IN+FT +++++G+  +++ N+ +   V +A D+R ++  +A   AK L + GI V+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   + +    I +++T      PN  L++     + ++Y  A    +   ++         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SFDL+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +  +Y+L      KTP      +++T V+ +   +IA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  +FE+FG       +  ++  +   +M + +D                 F   K  + + +E+  I   +    L++YL +  W   R SGTEPK KIY++  GET+EI  + +  L+
  S:     9 AWQNAD-LSNEWRRELQRV-EEEQERFDGY--LTFGTGGMRGKMGIGTKRINLFTIRRVAKGLGDYVVANEGAEMGVAIAFDSRHHSGAFAQETAKVLAAQGINVYL--SDSIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEK----ITDIFTIPVRELPN-PLVTPLGKEMDDAYLNALTAVVSRPDLLADYGNELRICYTPLHGAGKELVMRGLLENGFSETTIIAEQSEPDGDFPTVISPNPEEENSFDLAKKLAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLNYILEA----KTPVTGADTMINTIVTGDLGGKIAYDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLGKLTNLFEKFGYHKEYLHTITLDDSDGITKMIQVIDALRKEPIFMPEITVVEDFLTSKRTNFVTMEVTNIELPK-ENVLKFYLMDSSWFAIRPSGTEPKCKIYFQTSGETEEIATKAMNELR 549
>gi|195962686|ref|ZP_03098891.1| phosphomannomutase [Borrelia spielmanii A14S] (569 aa)
Score = 604, Expect = 2.0e-60, Identities = 164/496 (33%), Positives = 271/496 (54%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------TGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-IKGIRWNE----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           NE EI   F Y  L FGTAGIR  +G GT  IN +  +++S+G+  ++L     P V +++D+R  +  +A   A+   S   + ++YK   ++ TP +SY++R+   D  ++ TASHN K Y G+K Y   G Q++      I + + + + II+ +         +I   D+ I + Y +   +   +     +K N  +  T  HGT    +  L  +   + + L   Q +P+P F      NPE K S    ++ A+K   +I L  DPD+DR+ V  + +N+W +L GNQ+  I  +Y+L+ +   K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   +EM K+     F    EE+ G L     RDKD F A      +   L  +++T+ +YL++I++EFG +          G     + E+L  K   ++KM +FA +K  + L  E +K I + +          P  A+++ LEN++ +  R SGTEPK K Y  +  E KE
  S:    34 NEAEILNRF-YKDLEFGTAGIRGVVGAGTCYINTYNVKKISQGICNYVLKINKTPKVAISYDSRYFSKEFAYHTAQIFASNNFETYIYK--NLRPTPQLSYTIRKFDCDVGVMITASHNSKEYNGYKAYWRGGIQMMPPHDALITNEIKKVKNIINTITIKEGIAKKIIKELDNEIDKEYIKTINKEFPDFEKNSKKTNLKIAYTALHGTGGTIIKKLFTNSKVQ-LFLEKSQIMPNPEFPTINYPNPEKKTSMLKVIELAKKEDCDIALATDPDADRIGVAFKDQNEWIFLNGNQISCILMNYILSKEINPKNTFVISSFVTTQMLEKIAKKYGSQIFRTYTGFKWIGSLIDEMEKNEPNKKFAFACEESHGYLIGGKVRDKDAFSAIKGICSLAIDLKAKQQTIKNYLEKIYKEFGYYEEFNIEKNFEGANGEIQREALMLKLRKEQKM-QFAGIKVIEKLDYETLKKINFKKEISEIKEYKYPTNAIKFILENEIVITIRPSGTEPKIKFYISVKLEYKE 551
>gi|56963264|ref|YP_174995.1| phosphomannomutase [Bacillus clausii KSM-K16] >gi|56909507|dbj|BAD64034.1| phosphomannomutase [Bacillus clausii KSM-K16] (579 aa)
Score = 603, Expect = 2.9e-60, Identities = 160/506 (31%), Positives = 279/506 (55%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------TGETVSYKIESL--NWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------PA-QALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           N++ ++  F Y +L+FGT G+R  +GPG N++N +T ++ +EG+AR++  +     +  V +A D+R  +  +A   A TL + GIK ++++   ++ TP +S++VR  G +A I+ TASHNP  Y GFKVY   G Q   + A E+V+ +   Q+I D +     D        L       I ++Y +     L+   + +Q      ++ T  HGTA+  +   LK  G+ N+ + A+Q  PDP+F+  ++ NPE+ A+F L++ Y E+  A+++L  DPD+DR+ + V+  +  +  LTGNQ G +   Y+L  ++      +   V+ T V++     +A+ Y      T TGFK++G +M ++    +  F+ G+EE+ G L  D  RDKD  QA   A E+      +  T+ + + +++ ++G +          G+  + KI S+  + ++E    M        +D    +       E      PA   L++ LE+  W   R SGTEPK K Y+ + G + E  +Q L  L+
  S:    30 NDKALEDCF-YRELAFGTGGMRGEIGPGPNRMNTYTVRKAAEGLARFIEKRGETAKSKGVAIAFDSRHKSAKFAHEAAITLGAHGIKAYVFE--SLRPTPELSFAVRYLGAEAGIVITASHNPPEYNGFKVYGSDGCQFPPAPAEELVACV---QSIEDELAIEVGDEEELKAAQLYELISTEIDDAYNDQLKTILLQPEMDKQYGDELAIVFTPLHGTANVAVRRALKESGFTNVTVVAEQEQPDPDFSTVSSPNPEEHAAFTLAMDYGERQEADLLLATDPDADRVGLAVKDDEGNYVVLTGNQTGALLLDYLLETRQQKGTLPQNGIVLKTIVTSELGRAVADAYGLTTIDTLTGFKFIGEKMGEYERSGEHTFLFGYEESYGYLIGDFVRDKDAIQACLFAAELALHYKRKGMTVYEAMQQVYRKYGYYREGLQSLTLKGKEGAEKIASILASLRQEAPTHMASKLITTVEDFESRQALATATGERTAIELPASNVLKYTLEDGSWFCVRPSGTEPKVKFYFGVVGSSNEESEQKLTQLQ 567
>gi|34764147|ref|ZP_00145016.1| PHOSPHOGLUCOMUTASE; PHOSPHOMANNOMUTASE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886080|gb|EAA23387.1| PHOSPHOGLUCOMUTASE; PHOSPHOMANNOMUTASE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (492 aa)
Score = 602, Expect = 4.1e-60, Identities = 154/453 (33%), Positives = 250/453 (55%)
  Q:    97 VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQ-----TIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAV-VVRHKNKWHYLTGNQMGIIFTHYVLTNKK-FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM----NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEF 549
           V +A+D+R+++   A+  A TL   GIKV+L+  + +++TP +S++VRE    A I+ TASHNPK Y G+KVY   G QI+D +A  IVSS+          ++D     +  L+ Y  + +   Y E   +  IN N+  +     + +  HG A+  +  +LK +GY N+    +Q  PD NF      NPED   F LS + A+K  A I +  DPD DR+ + V+ +  KW +  GNQ+GI+F  Y+L +KK   +   +++T VST  +D I +K   K  R  TGFK++G ++    NK +D   F+ GFEEAIG L     RDKD   A+ +  E+ T   +   ++ + + +I+E++G     TV    +  +  EE+Q+ M       + +I G+++       KG+     A  ++  LE+D ++  R SGTEPK K Y  +    +++ +  L  ++ EF
  S:    18 VAIAYDSRLDSVENAINTAMTLAGNGIKVYLF--DGVRSTPELSFAVRELKAQAGIMITASHNPKEYNGYKVYWEDGAQIVDPQATGIVSSVGAVDIFNDIKLMDEKEAIDKGLLVYVGEKLDNRYIEEVKKNAINPNVENKNKIKFVYSPLHGVAARPVERVLKEMGYTNVYPVKEQEKPDGNFPTCDYANPEDTTVFKLSTELADKVGAKICIANDPDGDRMGLAVLDNDGKWFFPNGNQIGILFAEYILNHKKNIPENGTMITTVVSTPLLDTIVKKNGKKALRVLTGFKYIGEKIRQFENKELDGT-FLFGFEEAIGYLIGTHVRDKDAVVASMVIAEMATTFENNGSSIYNEIIKIYEKYGWRLEITVPVTKKGKDGLEEIQKIMKSMRAKNHTEIAGIKVKEYRDYQKGVEGLPKADVIQIVLEDDTYLTVRPSGTEPKIKFYISVVDSDRKVAENKLAKMEKEF 485
>gi|153173796|ref|ZP_01929491.1| hypothetical protein LMIG_01920 [Listeria monocytogenes FSL N3-165] >gi|133730630|gb|EBA32328.1| hypothetical protein LMIG_01920 [Listeria monocytogenes FSL N3-165] (557 aa)
Score = 602, Expect = 4.3e-60, Identities = 168/525 (32%), Positives = 292/525 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +S++++  + ++ E+E +++  Y  L+FGT G+R  MG GT +IN+FT +++++G+  +++ N  +   V +A+D+R ++  +A   AK L + GIKV+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   +      I N++T      PN  L+      + ++Y +A    +   N+         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SFDL+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +  +Y+L      KTP      +++T V+ +   +IA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  +   +    L+++L ++ W   R SGTEPK KIY++  GET+EI  + +  L+
  S:     9 AWQNAD-LSDEWRRELERV-EQEQERFDGY--LTFGTGGMRGKMGVGTKRINLFTIRRVAKGLGDYVVANGGAEMGVAIAYDSRHHSGAFAKETAKVLAAQGIKVYL--SDTIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEN----ITNIFTIPVRELPN-PLVMTLGKEMDDAYLKALTAVVSRPNLLADYGNELRICYTPLHGAGKELVMRGLLENGFSETTIIAEQSEPDGDFPTVISPNPEEENSFDLAKKLAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLNYILEA----KTPVTGADTMINTIVTGDLGGKIAYDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLGKLTNLYEKFGYHKEYLHTITLDDSDGITKMNQVIDALRKEPTCISGISVLEDFLTSKRTNLSTMEMTNLELPK-ENVLKFHLNDNAWFAIRPSGTEPKCKIYFQTSGETEEIATKAMNELR 549
>gi|167766190|ref|ZP_02438243.1| hypothetical protein CLOSS21_00684 [Clostridium sp. SS2/1] >gi|167712270|gb|EDS22849.1| hypothetical protein CLOSS21_00684 [Clostridium sp. SS2/1] (574 aa)
Score = 601, Expect = 4.4e-60, Identities = 166/502 (33%), Positives = 269/502 (53%)
  Q:    29 ISNKY------KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEI------VSSMPECQTII-DNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-------------WNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +SN Y      KEL    N+E   K   Y+ L+FGTAG+R  +G G N++N++  ++ ++G+A ++L + ++   V +A D+R  +  +A   A+TL + GIK F+++   ++ TP +S++VR     A I  TASHNP  Y G+KVY   G Q  D  A+ +      ++ +  C+T+  ++  T    L       + ++Y     + +IN     +      ++ T  HGT +  +  +L  +G++N+ +  +Q +PD +F   +  NPE K +F L L  A++  A+++L  DPD+DRL V V+      Y  LTGN  G +   YVL+ KK           VV + V+TN +D IA+ YN K+    TGFKW+G E+   +   K  ++ G EE+ G L     RDKD   A     E       + KTL D + +++E++G       +     L   ++M+  +        KDI G ++  IR               EP     +  L + LE+  WV  R SGTEPK K YY +
  S:    11 LSNPYFDEDTKKELTAIENDENEIKERFYADLAFGTAGLRGIIGAGINRMNIYVVRKATQGLADYILEQGTDKKRVAIAFDSRHMSPEFADEAARTLAANGIKAFIFE--SLRPTPELSFAVRHLDCIAGINVTASHNPPQYNGYKVYWEDGAQFTDPHASGVTAKVNAITDISTCKTMSKEDAVTAG--LYEVIGKEVDDAYIAEVEKQVINQASIDEMASKLKIVYTPLHGTGNLPVRRVLDDLGFKNVYVVPEQELPDGDFPTVSYPNPEAKEAFALGLALAKEKDADLVLATDPDADRLGVYVKDAKSGEYIPLTGNMSGSLLCEYVLSQKKEKAGSLPADGAVVKSIVTTNLVDEIAKAYNVKLIEVLTGFKWIGKEILGFEQSGKGTYLFGLEESYGCLIGTYARDKDAVSATVALCEAAAYYATKGKTLWDVMIDMYEKYGYCVDSITAMDFPGLEGMDKMKAMLANLRENPLKDIAGYKVLKIRDYSKDTVLDVESGKVEPTGLPSSDVLYYELESGAWVCVRPSGTEPKIKFYYGV 551
>gi|195948214|ref|ZP_03089400.1| phosphomannomutase [Borrelia garinii PBr] (569 aa)
Score = 601, Expect = 4.9e-60, Identities = 163/504 (32%), Positives = 272/504 (53%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWNE----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           +KE  +K+    NE EI   F Y  L FGTAG+R  +G GT  IN +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ TP +SY++R+   D  ++ TASHN K Y G+K Y   G QI+      I + + + + II+ +         +I   ++ I + Y +A  +   +     +K N  V  T  +GT    +  L  +   + + L   + VP+P F      NPE K S    ++ A+K   +I L  DPD+DR+ V  + +N+W +L GNQ+  I  +Y+L+ +   K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   +EM K+     F    EE+ G L     RDKD F A      +   L  +++T+ +YL+ I++EFG +    +    E  N + + +  M K    +     G++I         K I + +          P  A+++ LEN++ +  R SGTEPK K Y  +  E KE
  S:    22 FKEEAIKIQKTNNETEILNRF-YKDLEFGTAGMRGIIGAGTCYINTYNVKKISQGICNYVLKINKNPKVAISYDSRHFSKEFAYNAAQIFASNNFETYIYK--SLRPTPQLSYTIRKFDCDVGVMITASHNSKEYNGYKAYWKGGIQIMPPHDTLITNEIKKVKNIINKITIKEGIEKKIIKELNNEIDKEYVQAINKEFPDFEKNSKKTNLKVAYTALYGTGGTIIKKLFTNSKIQ-LFLEKNEIVPNPEFPTITYPNPEKKTSMLKVIELAKKEDCDIALATDPDADRIGVAFKDQNEWIFLNGNQISCILMNYILSKEINPKNTFVISSFVTTQMLEKIAKKYGSQIFRTYTGFKWIGSLIDEMEKNEPNKKFAFACEESHGYLIGKKVRDKDAFSAIKGICSLALDLKAKQQTIKNYLENIYKEFGYYEELNIEKNFEGANGEIQREALMSKLRKEQKMQFAGIKIIEKLDYKTLKKINFKKEISEIKEYKYPINAIKFILENEIVITVRPSGTEPKIKFYISVKLEYKE 551
>gi|77412384|ref|ZP_00788694.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae CJB111] >gi|77161572|gb|EAO72573.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae CJB111] (567 aa)
Score = 599, Expect = 9.2e-60, Identities = 162/523 (30%), Positives = 279/523 (53%)
  Q:    13 HANVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI-----SYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL---------GLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           H N   + + WLE++ +    K  +  +  +E EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK ++YK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I + M            P  + +     SY D++I E+Y +      IN TNI   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S    +   A+I+L  DPD DR+A+ V+  K ++ +L GN++G + ++Y+ + +         P +V + V+ +    IA+KYN +   T TGFK +  + N++    D  ++ G+EE+IG       RDKD   A+ + +E+     ++ +TL+D L  I+++FG +     S ++E    +E +   M+ F   +   IL          ++ K    + P Q  L++Y     W   R SGTEPK K Y    G T+
  S:     3 HMNYKEIYQEWLENDSLGKDIKSDLEAIXGDESEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAIARGIAVSYDVRYQSKEFAELTCSIMAANGIKSYIYK--GIRPTPMCSYAIRALGCVSGVMITASHNPQAYNGYKAYWKEGSQILDDIADQIANHMDAITDYQQIKQIPFEEALASGSASYIDESIEEAYKKEVLGLTINDTNI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKAFAYSESLGKSVDADILLATDPDCDRVALEVKDSKGEYIFLNGNKIGALLSYYIFSQRCALGNLPHHPVLVKSIVTGDLSKVIADKYNIETVETLTGFKNICGKANEYDISKDKTYLFGYEESIGFCYGTFVRDKDAVSASMMVVEMTAYYKERGQTLLDVLQTIYDKFGYYNERQFSLELEGAEGQERISRIMEDF---RQDPILQVGEMTLENSIDFKDGYKDFPKQNCLKYYFNEGSWYALRPSGTEPKIKCYLYTIGCTE 545
>gi|154505530|ref|ZP_02042268.1| hypothetical protein RUMGNA_03067 [Ruminococcus gnavus ATCC 29149] >gi|153794188|gb|EDN76608.1| hypothetical protein RUMGNA_03067 [Ruminococcus gnavus ATCC 29149] (576 aa)
Score = 599, Expect = 9.5e-60, Identities = 168/513 (32%), Positives = 275/513 (53%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM--------DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYK---IESLNWKEEMQEKMDK--------FANVKNKDILGLEIKGIRWNE------PAQALEWY-LENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +E EI + F Y+ L FGTAG+R  +G GTN++N++T ++ ++G+A ++L    +   V +A D+R  +  +A   A  L + GIK +++  + ++ TP +SY+VR+ G  A I  TASHNP  Y G+KVY   G QI       I   M E + + D      M         L       + ++Y     + +I+ +      K+  ++ +  HGT +     +LK +G+EN+ +  +Q +PD  F   +  NPE   +F+L LK A +  A+I+L  DPD+DRL V V+ KN ++H LTGN  G +   Y +  +       +  +++ T V+TN  D IA+ YN  +    TGFK++G ++   +   K +++ GFEE+ G L     RDKD   A     E       ++ TL D + E++E +G +  +  S     IE L   +E+ E + K        +  +K +D     I+ ++  E      P   + +Y L +D W+  R SGTEPK K YY I G +    D+   A+  E   M+
  S:    30 DENEIKERF-YTDLEFGTAGLRGIIGAGTNRMNIYTVRKATQGLANYILKSGNAEKGVAIAFDSRRMSPEFAQEAACCLAANGIKAYVF--DSLRPTPELSYAVRKLGCIAGINITASHNPPEYNGYKVYWEDGAQITPPHDKGI---MDEVKAVTDYTTMKTMPAEDAKAAGLYEVIGAEVDDAYIAELKKQVIHQDAIDAVGKDLKIVYSPLHGTGNIPARRILKELGFENVYVVKEQELPDGEFPTVSYPNPEAAEAFELGLKLAREVDADIVLATDPDADRLGVRVKDKNGEYHDLTGNMSGCLLADYEIGQRNALRGLPEDGYLIKTIVTTNMADAIADYYNTGLIEVLTGFKYIGQQILGFETSKKGEYLFGFEESYGCLIGTHARDKDAIVATMALCEAAAYYKTKDMTLWDAMIEMYERYGYYKDDIQSITLKGIEGLAKIQEILETLRKNPPAEIAGYKVLKARDYKADTIQDMQTGEVSSTGLPTSNVLYYDLSDDAWLCVRPSGTEPKVKFYYGIKGTSLSDADEKSAAMGREVLAMI 572
>gi|160945524|ref|ZP_02092750.1| hypothetical protein FAEPRAM212_03053 [Faecalibacterium prausnitzii M21/2] >gi|158443255|gb|EDP20260.1| hypothetical protein FAEPRAM212_03053 [Faecalibacterium prausnitzii M21/2] (560 aa)
Score = 598, Expect = 1.0e-59, Identities = 148/513 (28%), Positives = 268/513 (52%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD-----LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-----HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-IKGIRWNEP-------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           K WL ++      K  + K+  N++EI   F+ + L FGTAG+R  +G GTN++N++  +Q ++G+A W+L +    TV +++D+R+ +D +A   A  L + GIKV +Y  + +   P +S++ R    +A I+ TASHNP  Y G+K Y   G Q+ D  A  +   + +   +    Y    +     +I +  D   ++ ++A     +   + +     ++ +  +G+    + ++L  +G  +I +  +Q  P+  FT  +  NPE   +  L L+ A K  A++ML  DPD+DR+ + ++  +  +  ++GN+MG++   Y+   +       K P  V + VST   D +A+ Y  ++    TGFKW+G+++        +D+  F+ GFEE+ G L     RDKD    + L  E+         ++   L+EI+ ++G +  +  S++   L   E+M   M K  +    ++ G + +K   + +P       A  L + LEN   V  R SGTEPK K Y+   G+
  S:     7 KRWLAADLEDADLKPELAKVEGNDDEIKDRFAVA-LKFGTAGLRGVLGAGTNRMNIYVVRQATQGLANWVLTQGGTQTVAISYDSRLKSDVFAKTAAGVLAANGIKVRIY--DALMPVPALSFATRYYNCNAGIMVTASHNPAKYNGYKAYGPDGCQMTDDAAAIVYDEIQKTDVLTGAKYISFAEGVENGMIRFVGDDCKKALYDAIEARQVRPGLCKTAGLKLVYSPLNGSGLVPVTHVLNDMGITDITIVPEQEYPNGYFTTCSYPNPEIFEALKLGLELATKTGADLMLATDPDADRVGIAMKCPDGSYELVSGNEMGVLLLDYICAGRIEKGTMPKNPVAVKSIVSTPLADAVAKHYGVEMRNVLTGFKWIGDQIANLEAAGEVDR--FIFGFEESYGYLAGPYVRDKDAVIGSMLICEMAAYYRSIGSSIKQRLEEIYAQYGRYLNKVDSFEFPGLTGMEKMASIMQKLRDQPPVELAGHKVVKVTDYKKPEETGLPAANVLIYTLENGATVVVRPSGTEPKIKTYFTTLGK 539
>gi|47094871|ref|ZP_00232485.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153178940|ref|ZP_01932227.1| hypothetical protein LMMG_01501 [Listeria monocytogenes F6900] >gi|153185385|ref|ZP_01935972.1| hypothetical protein LMOG_01908 [Listeria monocytogenes J0161] >gi|153190259|ref|ZP_01937681.1| hypothetical protein LMPG_01858 [Listeria monocytogenes J2818] >gi|47016753|gb|EAL07672.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126941951|gb|EBA19823.1| hypothetical protein LMOG_01908 [Listeria monocytogenes J0161] >gi|127766191|gb|EBA26533.1| hypothetical protein LMPG_01858 [Listeria monocytogenes J2818] >gi|133733628|gb|EBA35326.1| hypothetical protein LMMG_01501 [Listeria monocytogenes F6900] (557 aa)
Score = 598, Expect = 1.2e-59, Identities = 167/525 (31%), Positives = 292/525 (55%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           AW  ++ +SN+++  + ++ EEE +++  Y  L+FGT G+R  MG GT +IN+FT +++++G+  +++ N+ +   V +A D+R ++  +A   AK L + GI V+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   + +    I +++T      PN  L++     + ++Y  A    +   ++         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SFDL+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +  +Y+L      KTP      +++T V+ +   +IA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  +   +    L+++L ++ W   R SGTEPK KIY++  GET+EI  + +  L+
  S:     9 AWQNAD-LSNEWRRELQRV-EEEQERFDGY--LTFGTGGMRGKMGIGTKRINLFTIRRVAKGLGDYVVANEGAEMGVAIAFDSRHHSGAFAQETAKVLAAQGINVYL--SDSIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLEK----ITDIFTIPVRELPN-PLVTPLGKEMDDAYLNALTAVVSRPDLLADYGNELRICYTPLHGAGKELVMRGLLENGFSETTIIAEQSEPDGDFPTVISPNPEEENSFDLAKKLAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLNYILEA----KTPVTGADTMINTIVTGDLGGKIAYDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLGKLTNLYEKFGYHKEYLHTITLDDSDGITKMNQVIDALRKEPTCISGISVLEDFLTSKRTNLSTMEMTNLELPK-ENVLKFHLNDNAWFAIRPSGTEPKCKIYFQTSGETEEIATKAMNELR 549
>gi|22536672|ref|NP_687523.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae 2603V/R] >gi|76788263|ref|YP_329226.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae A909] >gi|76799069|ref|ZP_00781261.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae 18RS21] >gi|77405321|ref|ZP_00782417.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae H36B] >gi|22533512|gb|AAM99395.1|AE014214_9 phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae 2603V/R] >gi|76563320|gb|ABA45904.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae A909] >gi|76585584|gb|EAO62150.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae 18RS21] >gi|77176116|gb|EAO78889.1| phosphoglucomutase/phosphomannomutase family protein [Streptococcus agalactiae H36B] (564 aa)
Score = 597, Expect = 1.4e-59, Identities = 162/521 (31%), Positives = 279/521 (53%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI-----SYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL---------GLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETK 535
           N   + + WLE++ +    K  +  +K +E EI   F Y  L FGTAG+R  +G GTN++N +   + ++ +A  +++         + V++D R  +  +A +    + + GIK ++YK   I+ TP+ SY++R  G  + ++ TASHNP+ Y G+K Y   G QILD  A++I + M            P  + +     SY D++I E+Y +      IN TNI   K+  V+ T  +G  +  +  +L+  G+EN+ +  +Q +PDP+FT     NPE   +F  S    +   A+I+L  DPD DR+A+ V+  K ++ +L GN++G + ++Y+ + +         P +V + V+ +    IA+KYN +   T TGFK +  + N++    D  ++ G+EE+IG       RDKD   A+ + +E+     ++ +TL+D L  I+++FG +     S ++E    +E +   M+ F   +   IL          ++ K    + P Q  L++Y     W   R SGTEPK K Y    G T+
  S:     2 NYKEIYQEWLENDSLGKDIKSDLEAIKGDESEIQDRF-YKTLEFGTAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAIARGIAVSYDVRYQSKEFAELTCSIMAANGIKSYIYK--GIRPTPMCSYAIRALGCVSGVMITASHNPQAYNGYKAYWKEGSQILDDIADQIANHMDAITDYQQIKQIPFEEALASGSASYIDESIEEAYKKEVLGLTINDTNI--DKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPKAFAYSESLGKSVDADILLATDPDCDRVALEVKDSKGEYIFLNGNKIGALLSYYIFSQRCALGNLPHHPVLVKSIVTGDLSKVIADKYNIETVETLTGFKNICGKANEYDISKDKTYLFGYEESIGFCYGTFVRDKDAVSASMMVVEMTAYYKERGQTLLDVLQTIYDKFGYYNERQFSLELEGAEGQERISRIMEDF---RQDPILQVGEMTLENSIDFKDGYKDFPKQNCLKYYFNEGSWYALRPSGTEPKIKCYLYTIGCTE 542
>gi|70950230|ref|XP_744456.1| phosphoglucomutase [Plasmodium chabaudi chabaudi] >gi|56524417|emb|CAH75717.1| phosphoglucomutase, putative [Plasmodium chabaudi] (593 aa)
Score = 596, Expect = 1.7e-59, Identities = 171/514 (33%), Positives = 286/514 (55%)
  Q:    29 ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDD-------TITESYFEASYRCLINTNIYRQKNFP----------VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN---KKFDKTPFV-VSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID-KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI----YGETKEICDQIL 542
           +S++ KE+I   NE+E+ K F  ++L+FGTAG+R  MG G N +NV T  Q ++G+  +L+NK       N  +I   D R N++ +A V +    S G KV+L+  +Q  ATPI+ YS  +      ++ TASHNPK   G+K+Y   G QI+      +  ++ +C  I+DN+  P  D+  Y DD       ++ +  +   +   I +++ ++ NF           ++ +  HG     +  +++ +GY N++   QQ +PDP F+     NPE+K + DLS++ A++ ++ +++  DPD+DR A   ++ NKW  L+G+++GIIF ++++ +   K  DK+  V + T V +  +  + +K+  K   T TGFKW+ N+  ++ D K + +  +EEA+G   S   RDK G  A A  +E+   LY+   T    L++I +E G +      Y I   N    +  +     N K K +   +I  IR                      +Q +  Y EN   V  R SGTEPK K Y EI    Y E K+  D+++
  S:    25 LSDQTKEVINNSNEDELKKLF-LNRLNFGTAGLRGKMGVGFNAMNVVTIIQTTQGLCTYLINKYGADACKNRGIIFGFDGRHNSESFAHVASAVCLSKGFKVYLF--SQTVATPILCYSSFKKSCLCGVMVTASHNPKIDNGYKLYGENGAQIIPP----VDKNVSDC--ILDNL-KPWNDIYKYLDDDFYLKDKSLVKDIYHEMFDSFI-SDLKKEFNFSCNRNSRTKLVIVYSPMHGVGRKFVQGIMQIVGYNNLLTVPQQALPDPEFSTVTFPNPEEKGALDLSMELADQVKSPLVVANDPDADRFACAEKYNNKWKILSGDELGIIFAYFIMKDYEKKNIDKSKHVFLCTIVCSRMLKMLCQKHGYKYDETLTGFKWLINKAIEYNDNKHNTLYCYEEALGHALSKHIRDKCGISALAYWVEIAIHLYENNSTFHQCLEDIRKEIGYFVSNNGYYTILDSNDVANIFNEFRSKGNYK-KQLASYKIAHIRDLTTGYDSQTPDKKSLIAPTPDSQNITLYFENTAIVTIRASGTEPKIKWYGEISRKSYDEAKKDIDKLI 575
>gi|163814961|ref|ZP_02206348.1| hypothetical protein COPEUT_01111 [Coprococcus eutactus ATCC 27759] >gi|158449644|gb|EDP26639.1| hypothetical protein COPEUT_01111 [Coprococcus eutactus ATCC 27759] (584 aa)
Score = 596, Expect = 1.8e-59, Identities = 169/534 (31%), Positives = 280/534 (52%)
  Q:    15 NVNPLSKAWLESNRISNKYKE--LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS--------YFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM--------DKFANVKNKDILGLEIKGIRWNEP----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           N   + + W+ +     + K+  L +K +E+EI++ F Y  L FGTAG+R  +G GTN++N++  ++ ++G+A +++   K +  V +A+D+R  +  ++M  A  L + GIK   Y+   ++ TP +S++VR     A I  TASHNP  Y G+KVY   G QI       I   M E + I D   T  MD++              + ++Y     + ++N +   +  K+  ++ T  HGT +  +  +LK IG+EN+ +  +Q +PD  F      NPE K +F L+LK A++  A+++L  DPD+DRL    +      Y   TGN  G +   Y ++  K           +V T V+TN +D IA+ Y   +    TGFK +G E+ +     K  ++ GFEE+ G L     RDKD   A     E       Q KTL D + +++E++G +  +  +  ++ +   +++   M        ++ A  K K +    ++ IR  E           A  L + LEND W+  R SGTEPK K YY I G + +   +   A  D+
  S:     6 NYKDVYEQWVNNPLFGQETKDELLAIKDDEKEIEERF-YCDLVFGTAGLRGIIGAGTNRMNIYVVRKATQGLANYIIKAGKQDKGVAIAYDSRRMSPEFSMEAALCLAANGIKA--YRFESLRPTPELSFAVRYLDCVAGINVTASHNPPEYNGYKVYWEDGAQITPPHDQGI---MAEVKAITDFADTKTMDMVEAKKKGLLVTIGSEVDDAYMGELKKLILNQDAIDKYGKDLKIVYTPLHGTGNIPVRRILKEIGFENVYVVPEQELPDGEFPTVEYPNPEAKEAFTLALKLAKEVDADLVLATDPDADRLGCYAKDSKTGEYKVFTGNMSGSLLCEYEVSQMKEKNGSLPADGAIVKTIVTTNMVDAIAKYYGTDLIECFTGFKNIGREILRFEQTGKGTYLFGFEESYGCLIGTHARDKDAVVATMALCEAAAYYRGQGKTLWDAMMDMYEKYGYYVDDIKTVTLKGVEGSKKIGHIMNILRANVPEQVAGYKTKVVRDYRLEYIRNIETGEVKPTGFPNANVLYYELENDAWLAVRPSGTEPKIKFYYGIKGSSYDEAQKESAAFGDK 573
>gi|160943653|ref|ZP_02090885.1| hypothetical protein FAEPRAM212_01145 [Faecalibacterium prausnitzii M21/2] >gi|158445108|gb|EDP22111.1| hypothetical protein FAEPRAM212_01145 [Faecalibacterium prausnitzii M21/2] (577 aa)
Score = 596, Expect = 2.0e-59, Identities = 161/515 (31%), Positives = 264/515 (51%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFE-ASYRCLIN--TNIYRQK--------NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKG-IRWNEP------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           NE+ I   F Y +L FGT G+R  +G GTN++NV+  ++ ++G+A +L        V + +D+R+ +D +A   A  L + GIK ++Y   +++ TP +S++VR  G  A +  TASHNP  Y G+KVY   G QI    A +I++++      +D       D    FD  + E   E +S +CL +    +Y Q+        +  ++ T  +G+    +  LL  +G  ++ +  +Q  PD NF      NPE + +    L+  +K   +++LG DPD DR    V   K  +  +TGN+MGII   Y+   +K      + P  V+T VST+    +A KY  ++ RT TGFK++G ++   +   + D ++ GFEE+ G L+    RDKD   A  L  E       Q  TL+D +++++ EFG +     S+  E  +    M   M +        I G+ ++  + +N        A  LE+ L     +  R SGTEPK K+Y      T+E  D I   L      +L++
  S:    48 NEDAITDRF-YRELEFGTGGLRGVIGAGTNRMNVYNIRKATQGLANYLNASDLPKKVAIGYDSRIKSDVFAKETAAVLAANGIKAYIYP--RLEPTPALSWAVRYYGCGAGVCITASHNPAKYNGYKVYGADGCQITLEVAAKILAAIEA----VDCFAVQPAD----FDAALAEGKIEYSSEKCLDDFVDAVYAQRVGDGAGTADLKLVYTPLNGSGLECVKKLLAKLGVTHVTVVPEQEKPDGNFPTCPYPNPEIREAMQKGLELCDKVHPDLLLGTDPDCDRCGTAVPDGKGGYRLITGNEMGIILLDYICRTRKALGTMPEHPVAVTTIVSTDMATPVAAKYGVELRRTLTGFKFIGEQIGLLEAAGEADRYIFGFEESYGYLSGAHVRDKDAVNATLLVCEAAAWYAKQGMTLLDAINQLYAEFGCYRNALHSFAFEGESGMHTMDAIMKQLRQTPPTAIGGMAVESLVDYNTAGTGLPKANVLEFRLAGGAKLMVRPSGTEPKIKVYLSAVAPTEEAADAINDTLGKAASALLKA 577
>gi|104162028|emb|CAJ75736.1| phosphomannomutase [uncultured Thermotogales bacterium] (575 aa)
Score = 595, Expect = 2.2e-59, Identities = 159/514 (30%), Positives = 286/514 (55%)
  Q:    23 WLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN---KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTII-------DNVYTPNM--DLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDK-------------------FANVKNKDILGLEIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL+S  I    +  +L +  NE EI + F Y +L FGTAG+R  +G G N++N +T  + ++G+A  +L+   +     V++AHD+R  +  +A + A  LT+  IKV+L+  + I+ TP++S+SV +    + I+ TASHNPK Y G+K+Y   G Q+L   A+ +   M   +  +       D   T  +  ++    DD         + R   ++     K+  ++ T  +GT +  +  +L+  G++N+ +  +Q  PDP+F+     NPED  +F L+ +  ++ RA+I+L  DPD+DRLAV+VR    +  L GNQ G +  +Y+L + K      +  F+V + V+ +    IA+ Y  K +   TGFK +  +  +  ++ +  F+ G+EE+IG +  +  RDKD   ++ L  E+      + KTL++ L+E+F ++G +  + +S  +E +  ++ +++ M +                   F +  + DI  L  + +    P +  +++  ++  W   R SGTEPK KIY  IY   K+
  S:    10 WLDSPVIDEATRRELLSIAENETEIKERF-YKELEFGTAGLRGKLGAGDNRMNKYTVARATQGLANLILSGDPEYRRRGVVIAHDSRHMSRAFAEIAASVLTANEIKVYLF--DDIRPTPLLSFSVLQLSTISGIMITASHNPKEYNGYKLYWEDGAQVLSDIADRVYEEMRSTELFLGPKMIELDEARTKGLLVEVGEELDDLYISKVLSLTLR---DSEEELDKSIRIVYTPLNGTGNVPVRRVLRERGFKNVFVVPEQEEPDPDFSTIGYPNPEDLKAFTLAREVGQEKRADILLATDPDADRLAVMVRENGDFVPLNGNQTGALIVNYLLLSMKEKSSMPEDGFIVKSIVTGDMAKTIADSYGVKTYEALTGFKNICGKALEVEERREGKFIFGYEESIGYVAGNFVRDKDAVSSSMLLCEMAAYFLRRGKTLLNVLEELFVKYGVFAEKQISMVLEGVAGQKRVRKIMKEYRKEYPTAIGDSKIVRYIDFFSATDNDI--LSGRTVETGVPTSDVIKFQFDDGSWYAIRPSGTEPKLKIY--IYTGAKD 553
>gi|86133848|ref|ZP_01052430.1| phosphoglucomutase phosphomannomutase [Tenacibaculum sp. MED152] >gi|85820711|gb|EAQ41858.1| phosphoglucomutase phosphomannomutase [Polaribacter dokdonensis MED152] (571 aa)
Score = 595, Expect = 2.4e-59, Identities = 161/511 (31%), Positives = 270/511 (52%)
  Q:    20 SKAWLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK--KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-------RWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +K WL     +    E+  ++  N+ E+   F Y  + FGT G+R  MG GTN+IN +T  + ++G++ +L++   K    V++A+D R N+  +A V+A  L++  IKVFL+++  ++ TP +S++VR    DA I+ TASHNP  Y G+KVY   GGQI+    + I+S +   +    N +  N DLI      + + + EAS +    ++   + +  ++ T  HGT+   +P+ LK  GY ++ +  +Q  P+ +F    + NPE+  +  ++ + A    A+I++G DPD DRL V VR  N     L GNQ  ++ T ++L   K     +   F+ ST VST  +++IA KYN +     TGFKW+  +M     +++F+ G EE+ G +  D  RDKD   A  LA EV         +    L  I+ E   +    +S   + ++   E+Q+ +    N    +I G +I+ +       R N             +  L +   +   +  R SGTEPK K Y+ +
  S:     8 AKQWLTPTFDAETQSEIQNLIDNNQAELADRF-YKDMEFGTGGMRGVMGAGTNRINKYTLGRATQGLSNYLVDNVSKDQIRVVIAYDCRHNSKKFAKVVADVLSANNIKVFLFED--LRPTPELSFAVRHLNCDAGIVLTASHNPPEYNGYKVYWADGGQIVPPHDSGIISKVNALEFSEIN-FDANEDLIEVIGKNVDDVFIEASVKNGSLSDKIDRNSLKIVFTPLHGTSIMSIPHTLKGAGYTDVHIVEEQRKPNGDFPTVKSPNPEEPEALHMATELANNIGADIVIGTDPDCDRLGVAVRDLNGNMKLLNGNQTMVVMTDFLLKKWKEEGRLNGKEFIGSTIVSTELVNQIAAKYNVETKVGLTGFKWIA-KMVVDFPELEFIGGGEESFGYMVGDFVRDKDAVTATLLACEVAAYAKQNGSSFYHELLNIYIENSFYKEHLISITKKGMDGAAEIQQMLSDMRNNPLTEIDGEKIESLSDYQASTRKNLITGEVSNMDIPKSNVLIYQTASGTRIAARPSGTEPKIKFYFSV 540
>gi|167624727|ref|YP_001675021.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella halifaxensis HAW-EB4] >gi|167354749|gb|ABZ77362.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella halifaxensis HAW-EB4] (577 aa)
Score = 595, Expect = 2.6e-59, Identities = 161/510 (31%), Positives = 271/510 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEE---EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN------WKEEMQEKMDKFANVKNKDI-------LGLEIKGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           K W+ ++  S++ +EL   ++ +   E++  F+  +L+FGTAG+R  +G G  ++N    QQ S G+A +L   ++  S+  V++ +D R ++  +A   A  LT+ GIKV+L     + ATP++++ V   G  A ++ TASHNP  Y G+KVY   G QI+    + I + + +  T    +++        L+   +D   ++Y +   +  +  N  + ++  +  T  HG  +     +LK  G+  +   A+Q +PD +F  + NF NPE+K + D  +  A+K+ A +    DPD+DR AV VR +  ++  LTG+Q+G++F HY+LT+   D+     +T VS++ + R+A+  NA    T TGFKW+ N  M++  D   F+  +EEA+G     +  DKDG  A     ++   L  Q +T+ D L+ I+ E G      VS  ++          +E    ++     V   DI        G    G         +  L + LEN   V  R SGTEPK K YYE+
  S:    10 KHWMATDPDSSRRQELQALIDSDDGAELEARFA-GRLAFGTAGLRGVVGAGPTRMNRLVIQQTSAGLASYLKAQISDVSSRGVVIGYDGRHDSKQFAHDAACVLTAMGIKVYLTA--NVAATPLLAFGVLHLGCAAGVVVTASHNPPQYNGYKVYWGNGAQIIPPHDSGIAACIDKAATEAIPLLEIQQAKASGLLVMLEDDFYDAYRQGVKQAAVLQNHTQPESVSLAYTAMHGVGNAMALNVLKDAGFTKVYSVAEQALPDGDFP-TVNFPNPEEKGAMDRVIAEAKKHNAMLACANDPDADRFAVAVRTYDGEYQMLTGDQVGVLFGHYLLTHASDDQR-LTCTTIVSSSLLSRVAQSLNATCLTTLTGFKWLTNVGMSEETDDNRFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELTSQGQTIWDRLEAIYREHGFHLNAQVSIALKPTTPNIGAYLREHPPVEIAGHKVVSTDDISIGKRFFSGGSADGTEEEIALPASDVLIYRLENGARVIVRPSGTEPKIKCYYEV 543
>gi|153815228|ref|ZP_01967896.1| hypothetical protein RUMTOR_01462 [Ruminococcus torques ATCC 27756] >gi|145847487|gb|EDK24405.1| hypothetical protein RUMTOR_01462 [Ruminococcus torques ATCC 27756] (579 aa)
Score = 593, Expect = 3.8e-59, Identities = 158/497 (31%), Positives = 270/497 (54%)
  Q:    38 LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNK-WHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP------------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET 534
           +K +E EI + F Y  L FGTAG+R  +G GTN++N++T ++ ++G+A +++ N      V +A+D+R  +  +A   A  L + GIK ++++   ++ TP +SY+VR+ G  A I  TASHNP  Y G+KVY   G QI       I   M E + + D      M         L       + ++Y     + +++ +      K+  ++ T  HGT +     +LK +G+EN+ +  +Q +PD +F   +  NPE + +F+L LK A++  A+I+L  DPD+DRL V V+ K+  +H LTGN  G +   Y +  +K      +  +++ T V++N  D IAE YN  +    TGFK++G ++   +   K +++ GFEE+ G L     RDKD   A     E       +  TL D + E++E +G +  +  S  ++ +   E++++ +    +   K+I G ++  +R  +                   +  L + L +  WV  R SGTEPK K YY + G +
  S:    27 IKEDENEIKERF-YMDLEFGTAGLRGIIGAGTNRMNIYTVRKATQGLANYIMKNDGQGKGVAIAYDSRHMSTEFAKEAACCLAANGIKAYIFE--SLRPTPELSYAVRKLGCIAGINITASHNPPEYNGYKVYWEDGAQITPPHDKGI---MDEVKAVEDYTTMKTMTEEDAKAAGLYEVIGAEVDDAYIAELKKQVLHKDAIEAAGKDLKIVYTPLHGTGNIPARRILKELGFENVYVVKEQELPDGDFPTVSYPNPEAEEAFELGLKLAKEIDADIVLATDPDADRLGVRVKDKDGVYHDLTGNMSGCLLADYEIGQRKELKGLPEDGYLIKTIVTSNMADAIAEHYNVGLIECLTGFKYIGQQILGFETKGKGEYLFGFEESYGCLIGTHARDKDAIVATMALCEAAAYYRTKGMTLWDAMIEMYERYGYYKDDIQSITMKGIEGLEKIRQILATLRSEPPKEIAGYKVLKVRDYQADTIRDMETGEVTATGLPNSNVLYYELPDGAWVCVRPSGTEPKVKFYYGVKGTS 553
>gi|167748107|ref|ZP_02420234.1| hypothetical protein ANACAC_02851 [Anaerostipes caccae DSM 14662] >gi|167652099|gb|EDR96228.1| hypothetical protein ANACAC_02851 [Anaerostipes caccae DSM 14662] (574 aa)
Score = 592, Expect = 5.1e-59, Identities = 163/527 (30%), Positives = 275/527 (52%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ-------KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKK-----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-----------------PAQALEWY-LENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQI 541
           N     + WL +       KE +  ++ ++ EI + F YS L+FGTAG+R  +G G N++N++  ++ ++G+A ++L + ++   V +A D+R  +  +A   A  L + GIK ++++   ++ TP +S++VR     A I  TASHNP  Y G+KVY   G Q        + + +     I         D +S     +  S  + +Y   +   ++ Q           ++ T  HGT +  +  +LK +G++N+ +  +Q +PD  F   +  NPE K +F+L LK A +  A+++L  DPD+DRL V V+      Y  LTGN  G +   YVL+ KK           VV + V+TN +D +A+ Y   +    TGFK++G +M   ++  K  ++ G EE+ G L     RDKD   A     E       Q KTL D + +++E++G +  +  + +   L+  E++Q  +        K+I GL++   R  +                 PA  + +Y LEN+ W+  R SGTEPK K YY + G + E  + I
  S:     2 NYQETYQEWLNNPYFDEATKEELKNIQDDDNEIKERF-YSDLAFGTAGLRGIIGAGINRMNIYVVRKATQGLADYILEQGTDKKRVAIAFDSRHMSPEFADEAALCLAANGIKAYIFE--SLRPTPELSFAVRYYNCIAGINITASHNPPEYNGYKVYWEDGAQFTPPHDKGVTAKVNAVTDISKVKTMSREDAVSAGLYEVIGSEVDDAYIAEVEKQVHNQDAIDQMASKLKIVYTPLHGTGNLPVRRVLKDLGFQNVYVVPEQELPDGAFPTVSYPNPESKEAFELGLKLAREKDADLVLATDPDADRLGVYVKDSKTGDYIALTGNMSGSLLCEYVLSQKKAMNGSLPDDGAVVKSIVTTNLVDAVADGYGVNLIEVLTGFKFIGQQMLNFENTGKGTYLFGLEESYGCLIGTYARDKDAVSATVALCEAAAYYMTQGKTLWDAMTDMYEKYGYYLDKVKALEFAGLDGAEKIQNMLKSLRENPPKEIGGLKVLKSRDYQNDTITDLTTGETVPTGLPASNVLYYELENNAWLCVRPSGTEPKIKFYYGVKGSSMEDAEAI 562
>gi|167575978|ref|ZP_02368852.1| phosphomannomutase [Borrelia valaisiana VS116] (569 aa)
Score = 592, Expect = 5.3e-59, Identities = 156/496 (31%), Positives = 266/496 (53%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLINTNIYRQK-NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWNE----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           NE EI   F Y  L FGTAG+R  +G GT  IN +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK  +++ TP +SY++R+   D  ++ TASHN K Y G+K Y   G Q++      I + + + + II+ +         +I    + I + Y +   +   +     +K N  +  T  HGT    +  L ++   + + L   Q +P+  F      NPE K S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +   K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   +EM K+     F    EE+ G L     RDKD F A      +   L  +++T+ +YL++I++EFG +    +    E  N + + +  M K    +     G++I         K I + +          P  A+++ LEN++ +  R SGTEPK K Y  +  E KE
  S:    34 NEPEILNRF-YKDLEFGTAGMRGIIGAGTCYINTYNIKKISQGICNYVLKINKNPKVAISYDSRYFSKEFAYSAAQIFASNNFETYIYK--KLRPTPQLSYTIRKFDCDVGVMITASHNSKEYNGYKAYWKGGIQMMPPHDTLITNEIKKVKNIINTITIKEGIEKKIIKELGNEIDKEYVKTINKEFSDFEKSSKKTNLKIAYTALHGTGGTIIKKLFENSKIQ-LFLEKSQIMPNSEFPTIKYPNPEKKTSMIKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEINPKNTFVISSFVTTQMLEKIAKKYGSQIFRTYTGFKWIGSLIDEMEKNEPNKKFAFACEESHGYLIGKTVRDKDAFSAIKGICSLVLDLKAKQQTIKNYLEKIYKEFGYYEEFNIEKNFEGANGEIQREAIMLKLRKEQKMQFAGIKIIEKLDYKTLKKINFKKEISEIKEYKYPINAIKFILENEIAITVRPSGTEPKIKFYISVKLEYKE 551
>gi|163762827|ref|ZP_02169891.1| transposase, IS204/IS1001/IS1096/IS1165 family protein [Bacillus selenitireducens MLS10] >gi|160356760|gb|EDP83409.1| transposase, IS204/IS1001/IS1096/IS1165 family protein [Bacillus selenitireducens MLS10] (577 aa)
Score = 592, Expect = 5.9e-59, Identities = 158/524 (30%), Positives = 283/524 (54%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMP------ECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH--IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVK-----NKDILGLE--IKGIRW----------NEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           W     + +K +E +  L  +++ I+ +F Y  L FGT GIR  +GPG N++NV+T ++ ++G+A ++ +K     N  V++A+DNR  +  +A+  A+TL   G+K +++ E  ++ TP++S++VR     A  + TASHNP  Y GFK Y   G Q++  +A++++  +       E +T   N    N  L+ +  D + ++Y       +++  +  +      ++ T  HGTA   +       G+ N+   ++Q  PD  FT   + NPE+ ++F+L++K  E+  A++++  DPD+DR+ + V+ H+  +   +GNQ G +   Y+L  +K          V+ T V++     IAE Y  +     TGFK++G ++ ++    +  F+ G+EE+ G L     RDKD  Q   LA E+         +L D L ++++ +G +  + VSY  +     E++   MD F           D++ +E    G R           N P +  L+ +L +  W   R SGTEPK K Y+ + G++ E     L+ LK
  S:    10 WQAYEGLDSKVREQLDQLSGDDKAIEDHF-YKTLEFGTGGIRGEIGPGINRMNVYTMRKAAKGLADYVASKGKEAMNRGVVIAYDNRRMSKEFAVEAAETLGKNGVKAYVFSE--LRPTPVLSFAVRHLNTFAGAMITASHNPPEYNGFKAYGEDGCQLVPEDADQLIGFVNAVEDELEVETGDQNELLSN-GLMQWVLDEVDDAYLHEMKAVIMDQGLIDEMGGELSIVFTPLHGTAQKPMMNTFAMAGFTNVHPVSEQAEPDTEFTTVKSPNPEEHSAFELAIKKGEEVNADLLIATDPDADRIGLAVKNHQGDYQVFSGNQTGGLLLDYLLMKRKEKGNLPDNGMVLKTIVTSELGRVIAEAYGMQSLDVLTGFKFIGEKIRQYETSGEHTFLFGYEESYGYLIEPFARDKDAIQPGLLAAEMAAYYKKLGMSLYDALLDLYKRYGFFYEDLVSYTFKGKEGSEKIVRIMDTFRQSVADGELEDDVVAVEDYKSGKRTDLKSGQESDVNLPSSNVLKMFLADGSWYCLRPSGTEPKIKFYFGVNGDSHEQTSARLEELK 567
>gi|195949434|ref|ZP_03090534.1| phosphomannomutase (cpsG) [Borrelia burgdorferi WI91-23] (570 aa)
Score = 590, Expect = 8.8e-59, Identities = 171/518 (33%), Positives = 283/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKV-FLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   +  ++YK   ++ +P +SY++R+   D  ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETTYIYK--SLRPSPQLSYTIRKFDCDIGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 568
>gi|167932171|ref|ZP_02519258.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 156a] (570 aa)
Score = 590, Expect = 9.1e-59, Identities = 171/518 (33%), Positives = 283/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKV-FLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   +  ++YK   ++ +P +SY++R+   D  ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETTYIYK--SLRPSPQLSYTIRKFDCDIGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYTSVKLEYKEKHKIFD-IINAIKMEIK 568
>gi|163788926|ref|ZP_02183371.1| putative phosphoglucomutase [Flavobacteriales bacterium ALC-1] >gi|159876163|gb|EDP70222.1| putative phosphoglucomutase [Flavobacteriales bacterium ALC-1] (575 aa)
Score = 590, Expect = 9.6e-59, Identities = 162/509 (31%), Positives = 281/509 (55%)
  Q:    22 AWLES--NRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-----------KGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +WL    ++ S +  + ++  + +E+++ F Y  L FGT G+R  MG GTN+IN +T  + ++G++ +L  K+S P     V +A+D R N+  +  V+A   ++  I+V+L+++  ++ TP +S+S++       I+ TASHNP  Y G+KVY   GGQ++  +  EI++ +       +  +  N  LI Y    I + +   S +    NT+   ++N  V+ T+ HGT+   +P  LK  GY N+ +  +Q  P+ +F    + NPE+  +  ++++ A+K   +I++G DPD DRL VVVR+ +N+   L GNQ  ++ T ++L       K +   FV ST VST  +  +AE YN +     TGFKW+  +M K   ++ F+ G EE+ G +  D  RDKD   +  LA E+       +KT+   L +++ E G +    VS   + +   +E+++ M    N   K+I G ++           K ++ ++        +  L +Y EN   +  R SGTEPK K Y  +
  S:    14 SWLTPAFDKDSQEQIKHLIASDPKELEESF-YKDLEFGTGGMRGVMGLGTNRINKYTLGKNTQGLSNYL--KQSFPNEQLKVAIAYDCRHNSKTFGKVVADIFSANNIEVYLFED--LRPTPELSFSLKYLNCHCGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDAEIIAEINRLD-YSEIKFEANDSLIKYIGKEIDDVFINNSIKNGSFNTSDDARQNLNVVFTSLHGTSITAIPETLKRAGYTNVSIVEEQSEPNGDFPTVISPNPEEPEALKMAMQLADKVDGDIVIGTDPDCDRLGVVVRNLENELVILNGNQAMLLMTDFLLKQWKNLGKINGNQFVASTIVSTPMMSVLAEAYNVECKIGLTGFKWIA-KMIKDFPELYFIGGGEESFGFMVGDFVRDKDAVTSTLLACEIAAQAKANDKTVFQALIDLYIEHGFYKERLVSLTKKGIEGAQEIKQMMVDARNNPLKEINGEKVVLIEDYQLSISKNLQTHQETIIDIPKSNVLIYYTENGTKIALRPSGTEPKIKFYISV 545
>gi|116492249|ref|YP_803984.1| alpha-phosphoglucomutase [Pediococcus pentosaceus ATCC 25745] >gi|116102399|gb|ABJ67542.1| alpha-phosphoglucomutase [Pediococcus pentosaceus ATCC 25745] (574 aa)
Score = 589, Expect = 1.1e-58, Identities = 158/506 (31%), Positives = 273/506 (53%)
  Q:    31 NKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL-----LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNM---DLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM-----------DKFANVKNKDILGL-------EIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           N  KEL     +++  K   Y+ + FGTAG+R  MGPG N++N++T +Q +EG+A ++      +KK    V ++ D+R ++  +A+  A  L   GI  F++  + ++ TP +SY+VRE    A I+ TASHNPK Y G+K+Y   GGQ+   E+++I   + +   I  ++ +    +    L++   + I   Y E      IN  + ++   +  +I +  HGT        L++ G+++  +  +Q + DP F  +   NPE   +FDL+++  +K  A++++  DPD+DRL   VR  N  +  LTGNQ+  +   Y+LT              V + VS+    RIAE ++ ++    TGFK++ +++  + +  D  F+ GFEE+ G L     RDKD  Q   L  E+      + +TL D L  +F  +G    +T+S     ++ KE+M   M           D++  ++ +D L           + I+  + A  L++ L++  W+  R SGTEPK K Y    GE ++
  S:    19 NLKKELATLAEDKDALKEAFYAPMEFGTAGMRGVMGPGINRMNIYTVRQATEGLANFMDTLDFTDKKRG--VAISFDSRYHSQEFALAAAGVLGKHGIPSFVF--DSMRPTPELSYTVRELNTYAGIMITASHNPKQYNGYKIYGPDGGQMPPMESDKITEYIRQVTDIFGVETLTQSELRAKGLMTIIGEDIDLKYLEEVKTVSINHELIQRFGADMKLIYSPLHGTGKVVGGRALENAGFKDYTMVPEQAIADPEFITTPFPNPEFPQTFDLAIELGKKQDADLLIATDPDADRLGAAVRLPNGDYKLLTGNQIAALMLEYILTAHDAAGDLPSNAAAVKSIVSSELATRIAEAHHVEMINVLTGFKYIADQIKHYEENGDHTFMFGFEESYGYLVRPFVRDKDAIQGIVLLAEIAAYYRSKGQTLYDGLQNLFTTYGYHEEKTISKDFPGVDGKEKMAAIMEKVREERPSQFDQYKVLETEDFLAQTKYEADGSTQAIKLPK-ADVLKFTLDDGTWIAIRPSGTEPKIKFYIGTVGEDEK 556
>gi|116872278|ref|YP_849059.1| phosphoglucomutase/phosphomannomutase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741156|emb|CAK20276.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (557 aa)
Score = 589, Expect = 1.1e-58, Identities = 173/528 (32%), Positives = 281/528 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEE-IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAV-VVRHKNKWHYLTGNQMGIIFTHYVLTNK-KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID-KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN--------VKNKDILGLEIKGIRWNEPA-------QALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           KAW  ++       EL    NE E  D Y     L+FGT G+R  MG G+ +IN +T ++++ G+  +++ N      V +A+D+R  ++ +A   AK L++ GIKV+L   + I+ TP +S+ VRE    A ++ TASHNP  Y GFKVY+  G QI    A EI   + E   I  I     PN+ + S   + + ++Y  A  + +   ++         +  T  HG     +   L   G+ NI L ++Q  PD +F   ++ NPE++ SF L+ K AEK +A+I+L  DPD+DRL V V+  +N++  LTGNQ+G +   Y+L  K    KT  +++T V+ +   +IA+ +     +T TGFK++G ++ +  + +  F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L ++++ FG       +  +E  N  E+M + +D            V  +D        +  NE           L++YL +  W   R SGTEPK KIY++   +T+E   + +  LK +
  S:     8 KAWQNADLPKKWQNELNQVANERERFDGY-----LTFGTGGMRGKMGIGSKRINRYTIRRVARGLGEYVVANGGKEQGVAIAYDSRHQSNEFAAETAKVLSALGIKVYL--SDAIRPTPALSFCVREKAAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAEEIAGYLAEITDIFSIPVCELPNLHVTSRSKE-MDDAYLNALTKVVSRPDLLADYGNELGICYTPLHGAGKELVMRGLLKNGFSNITLISEQSEPDGDFPTVSSPNPEEENSFSLAKKQAEKVQADIILATDPDADRLGVAVLNDQNEYQILTGNQLGALLLDYILAAKADLSKTDTMINTIVTGDLGGKIAQHFGINHIQTLTGFKFIGEKIAEMENTEAHFIFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGITLLTKLKKLYKAFGYHKEHLHTITLEDNNGLEKMNQVLDSLRKEPAFLAEIVAVEDFFTSVRTNLLTNETVSIELPRENVLKFYLADGSWFAIRPSGTEPKCKIYFQTVAKTEENATKAMNNLKKQ 551
>gi|168526293|ref|ZP_02719932.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 118a] (570 aa)
Score = 589, Expect = 1.1e-58, Identities = 171/518 (33%), Positives = 283/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKV-FLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   +  ++YK   ++ +P +SY++R+   D  ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETTYIYK--SLRPSPQLSYTIRKFDCDIGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLIANEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKIRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 568
>gi|27468960|ref|NP_765597.1| phosphomannomutase [Staphylococcus epidermidis ATCC 12228] >gi|81842539|sp|Q8CN38|PGCA_STAES Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|27316508|gb|AAO05683.1|AE016750_288 phosphomannomutase [Staphylococcus epidermidis ATCC 12228] (546 aa)
Score = 588, Expect = 1.7e-58, Identities = 148/479 (30%), Positives = 254/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPEC----QTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           + LSFGTAGIR   G G  ++N FT  +++ G A +L +  ++P V++ +D R  +  +A +IA  L S  IKV+L   +  + TP +S++VR    DA ++ TASHNPK+Y G KVY   G Q+   ++  + + + +        + ++ T    LI      + E YF+ + + L+ T    Q +  V+ T+ HGT+   +P +L S+ +    L A QC PD +F+  A+ NPED  +FD S++ A    A++++G DPD+DRL +V R  +   +Y  GNQ+G +  +Y +   +      +  + VS      +A+ +N       TGFK++  E+     + +F+ G+EE+ G L     RDKD  Q   L ++    L ++ + L D L++I    G +  +  S+  E    K +++  M +F +    ++ GL++  I   E                   A  ++ Y  N+ ++  R SGTEPK K+Y  +
  S:    32 TTLSFGTAGIRGKFGLGEGRLNKFTVSKVALGFAHYLTSSIAHPVVVIHYDTRHLSPEFAQIIANILASLDIKVYL--ADTYRTTPDLSFAVRYLQADAGVMITASHNPKDYNGIKVYGEDGAQLSTDDSARLSTYIDKLGHPLHINLPSLTTEQQSLIHSVPSEVREDYFK-NVQDLVGT--IPQSDLKVVFTSLHGTSVPVVPDILSSLNFNQFELVASQCEPDSDFSSVASANPEDHKAFDQSIELANLIDADLLIGTDPDADRLGIVERDAEGNIYYYNGNQIGALLLNYRIKQTEGLPNRIMFQSIVSGGLAKSLAQYHNVNFKEVLTGFKYIAAEIRHLSPEQNFIFGYEESYGFLARPFVRDKDAIQIVPLMIKYAAELKNEGRMLKDELEDITRNVGNFNDKLFSHTFEGTQGKAKIENIMTQFRSETPTEMCGLKVIAIEDFETGKKTDLQNDEVSDITLPKANVIKIYF-NEGFIALRPSGTEPKIKLYVSL 527
>gi|153853006|ref|ZP_01994443.1| hypothetical protein DORLON_00428 [Dorea longicatena DSM 13814] >gi|149754648|gb|EDM64579.1| hypothetical protein DORLON_00428 [Dorea longicatena DSM 13814] (560 aa)
Score = 587, Expect = 1.9e-58, Identities = 153/526 (29%), Positives = 276/526 (52%)
  Q:    21 KAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD-----LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-----HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNE----PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG----ETKEICDQILKALK 546
           K WL ++      K  + K+  N++EI + F+ + L FGTAG+R  +G GTN++N++  +Q ++G+A W+  +    TV +++D+R+ +D +A   A  L + GIKV +Y  + +   P +S++ R    +A ++ TASHNP  Y G+K Y   G Q+ D  A  +   + +   +    Y    +     LI +  D    + ++A     +   + +     ++ +  +G+    +  +LK IG  +I +  +Q  P+  FT  +  NPE   + +L L  A++  A++ML  DPD+DR+ + ++  +  +  ++GN++G++   Y+   +       +    V + VST   D +A  Y  ++    TGFKW+G+++ +      +D+  F+ GFEE+ G L     RDKD   A+ L  E+         +L   L+EI+ E+G +  +  S++   L+  ++M   M         +I G ++  +    +  E     A  L + LEN+  V  R SGTEPK KIYY   G    E +   D++ +ALK
  S:     7 KRWLAADLEDADLKPELSKIEGNDDEIKERFAVA-LKFGTAGLRGVLGAGTNRMNIYVVRQATQGLANWVKTQGGTQTVAISYDSRLKSDVFAKTAAGVLAANGIKVRIY--DALMPVPALSFATRYYNCNAGVMVTASHNPAKYNGYKAYGPDGCQMTDDAAAIVYEEIQKTDVLTGAKYMSFAEGVEEGLIRFVGDDCKRALYDAIESRQVRPGLCKTAGLKLVYSPLNGSGLVPVTQVLKDIGITDITIVPEQEYPNGYFTTCSYPNPEIFEALELGLNLAKESDADLMLATDPDADRVGIAMKCPDGSYELVSGNEVGVLLLDYICAGRIEKGTMPEKAVAVKSLVSTPLADAVAAHYGVELRNVLTGFKWIGDQIAQLEAAGEVDR--FIFGFEESYGYLAGPYVRDKDAVIASMLICEMAAYYRSIGSSLKQRLEEIYAEYGRYLNKIDSFEFPGLSGMDKMSGIMQNLRENAPAEIAGYKVTEVTDYTKTEETGLPAANVLVYKLENNETVIVRPSGTEPKIKIYYTTLGNDLAEAQAEKDKLAEALK 556
>gi|89894415|ref|YP_517902.1| hypothetical protein DSY1669 [Desulfitobacterium hafniense Y51] >gi|89333863|dbj|BAE83458.1| hypothetical protein [Desulfitobacterium hafniense Y51] (575 aa)
Score = 587, Expect = 2.0e-58, Identities = 166/532 (31%), Positives = 281/532 (52%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKS---NPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD-----LISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG-NEMNKHID-KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQE-KTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWNEPAQALEWYLENDMWVKF----------RLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           WL S       +  +  +N+E EI+  F Y+ L FGT G+R  +G GTN++N++  ++ ++G+A  +L  +    N  V++A+D+R  +D +A   A  L   GIK +L+  + ++ TP +S++VR     A ++ TASHNPK Y G+KVY   GGQ+    A+ I++ +   Q   D +     +     L+    + I   Y        +   + R K  N  ++ T  HG  +  +  +L  +GY ++    +Q  PDP FT     NPE  ++FDL+  Y +   A +++  DPD+DRL + +R  +  +  LTGNQ+G + ++Y+LT KK      +   V+ T  ST+  D + +   A+V    TGFK++   E    I    DF  GFEE+ G L     RDKD   A+ L  E      ++E ++L++ L++I+ ++G +  + +S  +E    KE+M++ M K      K   G+ +         KG R   P  + E  L     +++          R SGTEPK K Y+ I G   +     L+ +K +   +++
  S:     9 WLTSPYFDEDTRSEVAAINDEKEIEDRF-YTDLEFGTGGLRGVLGAGTNRMNIYVIRKATQGLADLILEGEEAGKNRGVVIAYDSRRFSDRFAKEAALVLAGNGIKAYLF--DDLRPTPELSFAVRHLKAQAGLVITASHNPKEYNGYKVYWEDGGQVPPDRADRILAHIKAHQAWDDILPLEEAEARAKGLLVEIGEEIDAVYLSKVKELALYPELSRAKGSNRSIVYTPLHGAGNVLVNRILTEMGY-SVFTVPEQEKPDPEFTTVPYPNPEIPSTFDLARSYGKARNAQMLIATDPDADRLGMALRTPQGDYRQLTGNQVGTLLSYYLLTQKKRLGILPEQAVVIKTIASTDLADLLVKDLGARVENVLTGFKFIAEKEQEMEIQGSGDFQFGFEESYGYLAGHFVRDKDAVIASLLLAEAALYYQEKEGRSLLEVLEDIYGKYGYFIDDQISITLEGKAGKEQMEKMMVKLRETDVKSFGGIAVACIDDYELRKGRRMIAPFHSYELALPQSNVIRYSFQGGGFVMARPSGTEPKIKFYFNIRGVDPQRLQATLENVKKDLLELIK 574
>gi|57865456|ref|YP_189611.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus epidermidis RP62A] >gi|81673345|sp|Q5HLD2|PGCA_STAEQ Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|57636114|gb|AAW52902.1| phosphoglucomutase/phosphomannomutase family protein [Staphylococcus epidermidis RP62A] (546 aa)
Score = 587, Expect = 2.0e-58, Identities = 151/479 (31%), Positives = 256/479 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           + LSFGTAGIR   G G  ++N FT  +++ G A +L +  ++P V++ +D R  +  +A +IA  L S  IKV+L   +  + TP +S++VR    DA ++ TASHNPK+Y G KVY   G Q L ++A+  +S+  +         + ++ T    LI      + E YF+ + + L+ T    Q +  V+ T+ HGT+   +P +L S+ +    L A QC PD +F+  A+ NPED  +FD S++ A    A++++G DPD+DRL +V R  +   +Y  GNQ+G +  +Y +   +      +  + VS      +A+ +N       TGFK++  E+     + +F+ G+EE+ G L     RDKD  Q   L ++    L ++ + L D L++I    G +  +  S+  E    K +++  M +F +    ++ GL++  I   E                   A  ++ Y  N+ ++  R SGTEPK K+Y  +
  S:    32 TTLSFGTAGIRGKFGLGEGRLNKFTVSKVALGFAHYLTSSIAHPVVVIHYDTRHLSPEFAQIIANILASHDIKVYL--ADTYRTTPDLSFAVRYLQADAGVMITASHNPKDYNGIKVYGEDGAQ-LSTDASAQLSTYIDKLGHPLHINVPSLTTEQQSLIHSVPSEVREDYFK-NVQDLVGT--IPQSDLKVVFTSLHGTSVPIVPDILSSLNFNQFELVASQCEPDSDFSSVASANPEDHKAFDQSIELANLIDADLLIGTDPDADRLGIVERDAEGNIYYYNGNQIGALLLNYRIKQTEGLPNRIMFQSIVSGGLAKSLAQYHNVNFKEVLTGFKYIAAEIRHLSPEQNFIFGYEESYGFLARPFVRDKDAIQIVPLMIKYAAELKNEGRMLKDELEDITRNVGNFNDKLFSHTFEGTQGKAKIENIMTQFRSETPTEMCGLKVIAIEDFETGKKTDLQNDEVSDITLPKANVIKIYF-NEGFIALRPSGTEPKIKLYVSL 527
>gi|160880395|ref|YP_001559363.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Clostridium phytofermentans ISDg] >gi|160429061|gb|ABX42624.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Clostridium phytofermentans ISDg] (573 aa)
Score = 587, Expect = 2.1e-58, Identities = 164/525 (31%), Positives = 280/525 (53%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYL--TGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE------------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           W E      K K  +  L+ N+ EI   F Y  L FGT G+R  +G GTN++N++T ++ ++G+A ++  +   +  V +A+D+R  +  ++  +A  L + GIK   Y+   ++ TP +S+++R     + I+ TASHNP  Y G+KVY   G QI   +  +I++ +    T  + V T N +      L       I + Y     + +I+ ++ ++   +  ++ T  HGT +     +L  +G+EN+ +  +Q +PD NF+     NPED  +F L+L  A+K  A+++L  DPD+DRL V  +      Y+  TGN  G++   Y+L+ +K      K   ++ T VSTN  D+IA++YN ++    TGFK++G ++   +   K  +  GFEE+ G L     RDKD   A     E       +  TL D +  I+E++G +     +  ++ +   E+++E M+ F     K +   ++   R  E                   +  L + L+ND WV  R SGTEPK K Y  + G + E  ++ LK+L D
  S:    10 WCEDAYFDEKTKTELKSLEGNDIEIKDRF-YKSLEFGTGGLRGIIGAGTNRMNLYTVRKATQGLANFIKKEHGEDRGVAIAYDSRNMSIEFSEEVALCLCANGIKA--YRFESLRPTPELSFALRTLNCISGIVITASHNPPEYNGYKVYWEDGAQITYPKDEQIINEVNNV-TDFNTVKTMNKEDAIAAGLYHTIGKEIDDLYITELKKQVIHPDVIKKVGGDIKIVYTPLHGTGNIPARRVLSELGFENVYVVPEQELPDGNFSTVGYPNPEDPKAFRLALDLAKKVDADLVLATDPDADRLGVYAKDSKTGDYISFTGNMSGMLICEYLLSQRKENGTIAKDGALIKTIVSTNMADKIAQEYNIQLIEVLTGFKYIGEQIKLFEETGKGTYEFGFEESYGCLIGTHARDKDAIVAVMALCEAAAYYSTKGLTLWDQMLNIYEKYGYFREGLETMTLKGVEGAEKIKEMMESFRQNPPKQLGDYKVVSFRDYEMDKVINLETNEVSKTGLPKSNVLYFELDNDAWVCVRPSGTEPKIKFYIGVKGTSNEDANEQLKSLTD 567
>gi|109644800|ref|ZP_01368720.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Desulfitobacterium hafniense DCB-2] >gi|109642749|gb|EAT52302.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Desulfitobacterium hafniense DCB-2] (575 aa)
Score = 587, Expect = 2.3e-58, Identities = 163/532 (30%), Positives = 282/532 (53%)
  Q:    23 WLESNRISNKYKELILKMNEE-EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN---KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM---DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQE-KTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWNEPAQALEWYLENDMWVKF----------RLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           WL S       +  +  +N+E EI+  F Y+ L FGT G+R  +G GTN++N++  ++ ++G+A  +L       N  V++A+D+R  +D +A   A  L   GIK +L+  + ++ TP +S++VR     A ++ TASHNPK Y G+KVY   GGQ+     + I++ +   Q       ++     +  L+    + I   Y        +   + + K  N  ++ T  HG  +  +  +L  +GY ++    +Q  PDP FT     NPE  ++FDL+  Y +   A +++  DPD+DRL + +R  +  +  LTGNQ+G + ++Y+LT KK      +   V+ T  ST+  D + +   A+V    TGFK++  E  + ++     DF  GFEE+ G L     RDKD   A+ L  E      ++E ++L++ L++I+ ++G +  + +S  +E    KE+M++ M K      K   G+ +         KG R   P  + E  L     +++          R SGTEPK K Y+ I G   +     L+A+K +   +++
  S:     9 WLTSPYFDEDTRSEVAAINDEKEIEDRF-YTDLEFGTGGLRGVLGAGTNRMNIYVIRKATQGLADLILEGGEAGKNRGVVIAYDSRRFSDRFAKEAALVLAGNGIKAYLF--DDLRPTPELSFAVRHLKAQAGLVITASHNPKEYNGYKVYWEDGGQVPPDRGDRILAHIKAHQAWDDILPLEEAEARDKGLLVEIGEEIDAVYLSKVKELALYPELSQAKGSNLSIVYTPLHGAGNVLVNRILTEMGY-SVFTVPEQEKPDPEFTTVPYPNPEIPSTFDLARSYGKARNAQMLIATDPDADRLGMALRTPQGDYRQLTGNQVGTLLSYYLLTQKKRLGILPEQAVVIKTIASTDLADLLVKDLGARVENVLTGFKFIA-EKEQEMEVQGSGDFQFGFEESYGYLAGHFVRDKDAVIASLLLAEAALYYQEKEGRSLLEVLEDIYGKYGYFIDDQISITLEGKAGKEQMEKMMVKLRETDVKSFGGIAVACIDDYELRKGRRMIAPFHSYELALPQSNVIRYSFQGGGFVMARPSGTEPKIKFYFNIRGVNPQELPTTLEAVKKDLLELIK 574
>gi|168580025|ref|ZP_02724005.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 72a] (570 aa)
Score = 586, Expect = 2.7e-58, Identities = 170/518 (32%), Positives = 283/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKV-FLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   +  ++YK   ++ +P +SY++R+   D  ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   N+M K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETTYIYK--SLRPSPQLSYTIRKFDCDIGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINTITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINKMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 568
>gi|73663046|ref|YP_301827.1| putative phosphomannomutase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123642229|sp|Q49WH7|PGCA_STAS1 Phosphoglucomutase (PGM) (Alpha-phosphoglucomutase) (Glucose phosphomutase) >gi|72495561|dbj|BAE18882.1| putative phosphomannomutase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (552 aa)
Score = 586, Expect = 2.8e-58, Identities = 160/522 (30%), Positives = 280/522 (53%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID------NVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKTP-FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN--EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI-----------------RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKA 544
           WLE N   +  K+      EEE +  F    LSFGTAGIR+T G G  ++N FT ++++ G+A++L +   + +V++  D R  +  ++  +A  L + GI   +   +  K+TP +S++VR   V+A I+ TASHNPKNY G K+YN  GGQ+L   + ++   +   +T ++      N +  N   I Y  + +TESY +     + + + +  K   VILT+ HGT+   +  +L  + Y N ++  +Q  P+ NF   A  NPED+A+F L  + A+K  A +++  DPD+DRL  + R+  N + Y  GN++G++       +   D TP +++ + V++   +R+A   N +V    TGFK++ +  E  +  D    ++ FEE+ G L   I RDKD  Q   L ++   +L     T  + +++I+E  G +   T++   E     ++++  M +F N +   I G+++  I                 +   P   L  ++  + ++  R SGTEPK K+Y+ +  E  +   Q  +A
  S:     5 WLE-NINESLVKDFYETQTEEEQNAGFE-GVLSFGTAGIRSTFGLGPARLNAFTVRKVALGLAQYLNHNVDDASVVIHFDTRFLSKAFSQEMASVLANNGITAII--SDNYKSTPELSFAVRHLQVNAGIMITASHNPKNYNGIKIYNEKGGQLLPEASEQLSEYINSIETPLNIEKGDFNAFVENGK-IKYMSNEVTESYKKEVKSLVGSIDAHDAK---VILTSLHGTSLPLVSDILTELDYHNFVIEKEQSEPNGNFPTVAIANPEDEAAFTLGKQLADKTDAQLIIATDPDADRLGFIERYGDNDFRYFNGNEIGLLLMKLRFQDLTEDSTPQYMIKSIVTSELAERLATSLNVEVNDVLTGFKFISDLIEHKQKDDDKQLLLAFEESHGYLAQPISRDKDAIQMVPLLVKYKNLLDKNGITFKETIEDIYENIGYFKDRTLAPTFEGKAGVKKIESIMSQFRNEQVFSICGMDVLKIEDYHVGEVRDMITGHTEKLTLPKTNLIRFIFENGFIALRPSGTEPKIKLYFSLEVENIDEITQQFEA 545
>gi|89891164|ref|ZP_01202671.1| phosphomannomutase/phosphoglucomutase [Flavobacteria bacterium BBFL7] >gi|89516476|gb|EAS19136.1| phosphomannomutase/phosphoglucomutase [Flavobacteria bacterium BBFL7] (591 aa)
Score = 586, Expect = 3.1e-58, Identities = 160/516 (31%), Positives = 271/516 (52%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK--KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL---DSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL--TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM-----DKFANVKNKDILGLE--IKGIRWNE-----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           N    +KA  +++ I+      ++  N  +  + F Y  L FGT G+R  MG GTN+IN +T  + ++G++++L          V +A+D R N+   A V+A   ++ GI V+L+++  ++ TP++SY+V+     A I+ TASHNP  Y G+KVY   GGQ++   D    E+++S+       D  +  N DLI         ++   S +         +    ++ T+ HGT+   +P  LK  GY ++ +  +Q +PD NF    + NPE+  +  ++++ A++  A+I++G DPDSDRL V VR  + K   L GNQ  I  T ++L  ++ K    PF+ ST VST  +  +A  Y  +     TGFKW+   +  H  + DF+ G EE+ G +  D  RDKD   AA LA E+Y        T    L +++ + G +  + VS   + ++  +E+++ M     +    +  +D++ +E      R N+            +  L +YL +   +  R SGTEPK K Y  +
  S:    30 NAQSWTKAPFDTDTITKTLA--LISANNADFQESF-YKDLEFGTGGMRGIMGVGTNRINKYTLGKNTQGLSQYLKETFIDEQIKVAIAYDCRHNSKELAQVVADVFSANGIHVYLFED--LRPTPLLSYTVKAKNCHAGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDKAILELIASL----NFKDINFNGNADLIELLTPADDNAFIVDSIKAGKIAGDVDRSRLKIVFTSLHGTSITLIPETLKRAGYTDLHVVKEQAIPDGNFPTVVSPNPEEPEALKMAVELADRVHADIVIGTDPDSDRLGVAVRDNDGKMVLLNGNQTMIAMTDFLLQQSDLKNATQPFIGSTIVSTPMMHDLAMDYQVECKEGLTGFKWIAKMIKDH-PQQDFIGGGEESFGYMVGDFVRDKDAVTAALLACEMYAYAKANSSTTYQDLLKLYVKHGCYQEKLVSLVKKGISGAQEIKQMMIDLRENTPTQIAGQDVIIVEDYAASTRENKHLKKTESLEIPKSNVLIFYLADGSKIAARPSGTEPKIKFYISV 561
>gi|195950804|ref|ZP_03091901.1| phosphomannomutase (cpsG) [Borrelia burgdorferi 29805] (569 aa)
Score = 585, Expect = 3.4e-58, Identities = 172/518 (33%), Positives = 284/518 (54%)
  Q:    33 YKELILKM----NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN---MDLISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVG---NEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN---WKEEMQEKMDK-----FANVKNKDILGL----------EIKGIR-WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFE 550
           +KE  +K+    N  EI   F Y  L FGTAGIR  +G GT  +N +  +++S+G+  ++L    NP V +++D+R  +  +A   A+   S   + ++YK   ++ +P +SY++R+   DA ++ TASHN K Y G+K Y   G QI+      I + +   + II+ +         +I    + I E Y +A  +   +     ++ N  +  T  HGT    +  L  +     + L   Q +P+P F      NPE + S    ++ A+K   +I L  DPD+DR+ +  + +N+W +L GNQ+  I  +Y+L+ +K  K  FV+S+FV+T  +++IA+KY +++FRT TGFKW+G   NEM K+     F    EE+ G L     RDKD F A      +   L  +++T+ DYL++I++EFG +    +    E  N    +E++  K+ K     FA +K  + L            EI  I+ +  P  A+++ LEN++ +  R SGTEPK K Y  +   Y E  +I D I+ A+K E +
  S:    22 FKEEAIKIQKTNNSTEILNRF-YKDLEFGTAGIRGIIGAGTCYMNTYNIKKISQGICNYILKINKNPKVAISYDSRYFSKEFAYNAAQIFASNNFETYIYK--SLRPSPQLSYTIRKFDCDAGVMITASHNSKEYNGYKAYWKGGIQIIPPHDTLITNEIKNTKNIINIITIKEGIEKGIIKELGNEIDEEYVKAINKEFPDFEKNSKETNLKIAYTALHGTGGTIIKKLFANSKIR-LFLEKNQILPNPEFPTINYPNPEKQTSMLKVIELAKKEDCDIALATDPDADRIGIAFKDQNEWIFLNGNQISCILMNYILSKEKNPKNTFVISSFVTTPMLEKIAKKYGSQIFRTYTGFKWIGSLINEMEKNEPNKKFAFACEESHGYLIGRKVRDKDAFSAIKGICSLALDLKAKQQTIKDYLEKIYKEFGYYEEFNIEKNFEGANGEIQREKLMLKLRKEQKVQFAGIKIIEKLDYKTLKKINFKNEISEIKEYKYPINAIKFILENEIAIIVRPSGTEPKIKFYISVKLEYKEKHKIFD-IINAIKMEIK 567
>gi|42527503|ref|NP_972601.1| phosphohexose mutase family protein [Treponema denticola ATCC 35405] >gi|41818088|gb|AAS12512.1| phosphohexose mutase family protein [Treponema denticola ATCC 35405] (587 aa)
Score = 584, Expect = 4.4e-58, Identities = 167/500 (33%), Positives = 274/500 (54%)
  Q:    28 RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP------TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI---IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ---KNFP----VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYV-LTNKKFDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID--KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR---------WNEPAQ----------ALEWYLENDMWVKFRLSGTEPKFKIY 527
           + + + K LI K +E+E+   F Y  L FGTAG+R  +G GTN++N    +  ++G+A +L+  KS        + ++A+D+R  +D +A   A    +  I+ +L+  + ++ TP +SY++RE G D  I+ TASHNP  Y G+K Y   G QI       I+  + E  +I    +     N  L+   D  I E Y+      ++   I RQ   KN      ++ T  HGT +  +  +L  +G+ N+I   +Q  PD NF   +  NPED  +  +++  A K  A+I++  DPD+DR A  V++   +   ++GNQMG +F  Y+ LT K+ +K P    +V + V++   D IA  YN +     TGFKW+     + +      ++ G+EE+ G       RDKDG  ++A+  E+      + K+L+D L+EIF +FG +  +T++         + MQ+ M +       +I G+++K IR           EPA+           L++YLE+   +  R SGTEPK KIY
  S:    21 KFAEEVKALIEKNDEKELYDRF-YRDLEFGTAGLRGIIGGGTNRMNPLVIKNATQGLADYLIEAKSEKAKAGSLSAVIAYDSRRFSDVFAKTAALIFAANNIRCYLF--SSLRPTPELSYAIRELGCDTGIVVTASHNPPEYNGYKAYWSDGAQITPPHDLGIIKKVGEVSSIKMMSEEEALKNGKLV-IIDKEIDEKYW-----AMLKKKISRQEIIKNMASKVKIVYTPLHGTGAMHVEKVLGEMGF-NVISVPEQREPDGNFPTVSYPNPEDPKALKMAMDLAIKEGADILMATDPDADRFACAVKNDAGEMQLISGNQMGALFADYICLTLKEQNKLPQNAAIVRSIVTSPLSDLIAASYNVQSEECLTGFKWICGVAERMVSTGSHSYLYGYEESFGYNFGTEVRDKDGIASSAICAEMTLYWRSKGKSLLDRLNEIFSQFGFYGEKTINMVYPGAEGLKIMQDMMVRVRERNLSEIAGVKVKTIRDIQESTEYSPLEPAKKTKVTLPKSNVLQYYLEDGSIICIRPSGTEPKIKIY 552
>gi|167752112|ref|ZP_02424239.1| hypothetical protein ALIPUT_00354 [Alistipes putredinis DSM 17216] >gi|167660353|gb|EDS04483.1| hypothetical protein ALIPUT_00354 [Alistipes putredinis DSM 17216] (581 aa)
Score = 581, Expect = 9.8e-58, Identities = 166/531 (31%), Positives = 278/531 (52%)
  Q:    20 SKAWLESNRISNKYKELILKMNEE--EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT--VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT-PNMDLISYFDDTITESYFEASYR-CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHI-DKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEK-TLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM-DKFAN----------VKNKDILGLEIKGIRW-------NEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICD--QILKALKDEFE 550
           ++ WL+ N  +   K++   M+ +  E+ + F Y  L FGT G+R  MG GTN++N++T    ++G++ +L    +     V+V HD+R N+  +A  +A    S G  VFL+  + ++ TP +S+++RE    + ++ TASHNPK Y G+K Y   G Q+       I+  + E  T +D V T  N   I        E Y    Y   L + ++ R  +  ++ +  HG     +P  LK  G+ N+ +  +Q V D NF    + NPE++ +  +++  A+K +A+++L  DPDSDR+ V +  +N ++  L GNQ  ++   Y LT      + +   +V+ T V+T  +D +A+ +  K +   TGFK++   +  H    M ++ G EE+ G L  D  RDKDG  A +LA E    + D    +L ++L +++ ++G +    VS         E +Q  M D  AN          VK  DI  LE   +R         + +  L+WY E+   V  R SGTEPK K Y+ +      + D  ++   L D+ E
  S:    13 AQKWLDGNYDAETKKQVKYLMDNDMKELVESF-YKDLEFGTGGLRGVMGVGTNRMNIYTVGAATQGLSNYLKRNFAGEEIRVVVGHDSRNNSRMFAERVADIFASNGFTVFLF--DALRPTPELSFAIRELKCQSGVVVTASHNPKEYNGYKAYWSDGSQVTAPHDKNIIDEV-EKITEVDQVLTGRNPQNIHALGKDFDELYLNKIYELSLSSESVKRFHDMKIVYSPMHGAGVRLVPESLKRFGFTNVQMVPEQAVIDGNFPTVESPNPEERKTMSMAIDLAKKVKADLVLATDPDSDRIGVALPDENGEYVLLNGNQTLVLLMTYQLTRWAELGRLNGHQYVIKTIVTTEMVDAVADYFKVKCYECLTGFKYIAKIIRGHEGTDMQYIGGGEESFGYLAGDYVRDKDGVSACSLAAEAAAWVRDTMGISLYEWLKQLYVKYGFYQEGLVSVVRTGKEGAELIQRMMVDYRANPPKEILGSLVVKINDIQTLESFDVRTGKKTHLEQDKSNVLQWYTEDGTRVCVRPSGTEPKIKFYFGVKATLPSVADYEKVRAELNDKIE 572
>gi|160937815|ref|ZP_02085174.1| hypothetical protein CLOBOL_02707 [Clostridium bolteae ATCC BAA-613] >gi|158439254|gb|EDP17007.1| hypothetical protein CLOBOL_02707 [Clostridium bolteae ATCC BAA-613] (594 aa)
Score = 581, Expect = 1.0e-57, Identities = 165/505 (32%), Positives = 263/505 (52%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL---DSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIY--RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKK-FDKTP---FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-----------------PAQALEWYLEND-MWVKFRLSGTEPKFKIYYEIYGETKEICDQILKAL 545
           +E EI + F Y  L FGTAG+R  +G G N++N++  ++ ++G+A +++ +  ++  V +A+D+R  +  +AM  A TL + GIK   YK   ++ TP +S++VRE G  A I  TASHNP  Y G+KVY   G Q     D    E V ++ +  T+   D                I + Y       ++N       Q    ++ T  HGT +     ++K +G+ ++ +  +Q +PD  F   +  NPE   +F L LK A +  A+++L  DPD+DRL V V+      Y  LTGN  G +   YVL+ KK   K P    V+ + VSTN ID +A++Y  ++    TGFKW+G ++  N+   +  ++ G EE+ G L     RDKD   A A   E       +  TL D +  ++E++G +     S  +  +    ++Q  M+   N   K++ G ++   R  +                 P+  + +Y  ND  W+  R SGTEPK K YY I G + E  D   +AL
  S:    47 DENEIKERF-YMDLEFGTAGLRGVIGAGINRMNIYVVRRATQGLANYIIKQGGADKGVAIAYDSRHMSPEFAMEAAMTLAANGIKA--YKFESLRPTPELSFAVRELGCIAGINITASHNPPEYNGYKVYWEDGAQFTPPHDKGVTEEVLAIEDLSTVKTTDEASAAAAGKYEVIGREIDDKYIAQVKAQVVNQKAIDEMQDQISIVYTPLHGTGNIPARRVMKELGFTHVYVVPEQELPDGGFPTVSYPNPEAAEAFSLGLKLAAEKNADLVLATDPDADRLGVYVKDAGSGEYIPLTGNMSGSLLCEYVLSQKKAAGKIPDDGQVIKSIVSTNLIDAVAKEYGCELIEVLTGFKWIGQQVLKNEKTGRGTYLFGMEESYGCLIGTYARDKDAISATAALCEAAAYYKQKGMTLWDAMVAMYEKYGYYKDAVKSIGLSGIEGLAKIQSIMETLRNNTPKEVGGYKVVSARDYKLDTIKDMASGEVKPTGLPSSNVLYYDLNDGAWICVRPSGTEPKIKFYYGIKGSSMEDADAKSEAL 582
>gi|149372605|ref|ZP_01891717.1| phosphomannomutase [unidentified eubacterium SCB49] >gi|149354648|gb|EDM43212.1| phosphomannomutase [unidentified eubacterium SCB49] (572 aa)
Score = 581, Expect = 1.1e-57, Identities = 174/513 (33%), Positives = 276/513 (53%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYR--CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDILGLEIKGIRWN-------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIY---GETKEICDQILKALK 546
           KE+I    E   D +  Y  L+FGT G+R  MG G N+IN +T  + ++G++ +L  KK  P+    V +A+D R N+   A V+A   ++ GI V+L+ +  ++ TP +S++V+       I+ TASHNP  Y G+KVY   GGQ++  +  EI+  +        N    N  LI   D  + +++  AS +  C +  N  R+ N  V+ T+ HGT+   +P +L+  GY N+ L  +Q  PD +F    + NPE+  +  +++  A+K +A+I++G DPD DRL + VR  + K   L GNQ   I T+++L      K  ++  F+ ST VST  I +IA K+        TGFKW+  +M K   ++DFV G EE+ G +  D  RDKD   A  LA E+  +   +  TL+DY + +  E G +    +S   +     EE+ E + +              V+ +D L  E K +  N         +  L +Y E+   +  R SGTEPK K Y  +    G T  + DQ +K ++
  S:    29 KEMIAHDPEGLEDSF--YKSLAFGTGGMRGVMGVGDNRINKYTLGKNTQGISEYL--KKQFPSETLKVAIAYDCRHNSKELAKVVADVFSANGIHVYLFTD--LRPTPELSFAVKHLECHCGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDGEIIDLINSLDYNDINFKGDNT-LIKAIDKEVDDAFAAASLKNGCKVKDNSLRE-NLKVVFTSLHGTSITMIPRVLEDAGYTNVHLVKEQESPDGDFPTVVSPNPEEPEALSMAIALADKEQADIVIGTDPDCDRLGIAVRDSDGKMQILNGNQAMAIKTYFLLDQLKEQKALNQKHFIASTIVSTPMIAKIAAKFGVMYKEGLTGFKWIA-KMVKDFPELDFVGGGEESFGYMVGDFVRDKDAVTATLLACEIAAIEKAKGNTLLDYFNTVQNEVGYYKEHLISVVKKGKKGAEEIAEILKQLRENPFTEINGSKVVRIEDYLTSESKDLVKNISETIEIPKSNVLIYYTEDGSKIAARPSGTEPKIKFYMSVTVQGGNTDTVLDQRIKDIQ 564
>gi|148377728|ref|YP_001256604.1| phosphomannomutase [Mycoplasma agalactiae PG2] >gi|148291774|emb|CAL59163.1| Phosphomannomutase [Mycoplasma agalactiae PG2] (523 aa)
Score = 579, Expect = 1.6e-57, Identities = 160/502 (31%), Positives = 268/502 (53%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK--KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID------NVYTPNMDLISYFDDTITESYFEASYRCLINTNI---YRQKNFPVILTTHHGTASYDLPYLLKSI----GY---ENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           +KL FGTAGIR  +G G   +N+   +++  G A++LLNK  K    +++  DNR  +  +A+  A+ L S+GIKV+  K   I  TP +SYS+        I  TASHNPK Y G K+YN +  Q+L  E  E+ S   + +  ++      ++     + + +  + + + Y  +  +   N +       +N  V+ +  HGT S  +P L K +     Y   E+I    +    D NF Y    NPE  ++++L +K  ++  A+I+L  DPDSDR+ + V+H +++  L GN+  II   ++L    +  K     ++V +FVSTN  + +A     K    PTGFKW+G  +N+  ++   F+  FEE+ GSL + ++ RDKD  Q+ A+  ++ +    Q KTL+D L+E++E  G    E +  +++       +QEK  K  N +NK I    +K          +++  +N  W+  R SGTEPK K Y   + +T ++  Q L   K+  + +L
  S:     2 NKLEFGTAGIRGKIGSGVENLNIAHVRRIMHGYAKYLLNKYAKQEIKIVIGRDNRRKSYSFALCSAQILDSYGIKVYFSK--NICPTPFVSYSIMHYKAHGGINITASHNPKEYNGIKLYNESAFQMLPEEIQEVSSYFDDYEKYLEPYKTVKSIKKSEFNNLEFISEKVKDKYLNSVAQIANNLDKSVNLNPENIKVVYSPLHGTGSKFVPKLFKKLFSESAYDINESIFYVKEHMKIDANFKYVQYPNPEKHSAYELLIKLGKQKDADILLMSDPDSDRVGLAVKHSDEYRILNGNETAIIVFKFLLDLVKSTIKQPNNHYIVYSFVSTNIPEILALSEGIKSVVVPTGFKWIGKIINEFSNEGKKFMFAFEESYGSLIDENLSRDKDALQSIAILTKMASYYKKQNKTLIDILNEVYETVGYVASENIEIEVDESTDLALLQEKF-KNLNFENKIIEDFNLKSSFMKSNMIQIKFKNDNS-WLALRPSGTEPKIKFYVFAFDKTIDLAQQKLNKFKETIKSIL 523
>gi|160895442|ref|ZP_02076211.1| hypothetical protein CLOL250_02999 [Clostridium sp. L2-50] >gi|156862944|gb|EDO56375.1| hypothetical protein CLOL250_02999 [Clostridium sp. L2-50] (604 aa)
Score = 579, Expect = 1.7e-57, Identities = 167/536 (31%), Positives = 283/536 (52%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEE--EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDD--------TITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLT-----NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWY-LENDMWVKFRLSGTEPKFKIYYEIYGE--------TKEICDQILKALKDEFE 550
           N   + + W+ +     + K+ +L + ++  EI++ F Y  L FGTAG+R  +G GTN++N +  ++ ++G+A +++ + K +  V +A+D+R  +  ++M  A  L + GIK   Y+   ++ TP +S++VR     A I  TASHNP  Y G+KVY   G QI       I   M E + I D   T  M++I              + ++Y     + +++ +   +  K+  ++ T  HGT +     +L  +G+EN+ +  +Q +PD NF      NPE K +F L+L  A+K  A+++L  DPD+DRL V  +      Y   TGN  G +   Y ++     + K  +   ++ T V+TN +D IA+ YN  +    TGFK +G E+ +     K  ++ GFEE+ G L     RDKD   A     E       Q KTL D + +++E++G +  +  +  ++ +   +++   M+   +    +I G + K +R                    P   + +Y LEND W+  R SGTEPK K YY I G         + E  D+I+  + D  E
  S:    26 NYMEVYEQWVNNPLFGQETKDELLSIKDDPKEIEERF-YCDLVFGTAGLRGIIGAGTNRMNKYVVRKATQGLANYIIKQGKQDKGVAIAYDSRRMSPEFSMEAALCLAANGIKA--YRFESLRPTPELSFAVRYLDCVAGINVTASHNPPEYNGYKVYWEDGAQITPPHDTGI---MAEVKAITDFADTKTMEMIDAIKAGLLVTIGAEVDDAYMGELKKLVLHQDAIDKYGKDLKIVYTPLHGTGNIPARRILSDLGFENVYVVPEQELPDGNFPTVDYPNPEAKEAFTLALDLAKKVDADLVLATDPDADRLGVYAKDSKTGEYKVFTGNMSGSLLCEYEVSQMKARDGKLPEDGAIIKTIVTTNMVDAIAKYYNTDLIECFTGFKNIGREILRFEQEGKGTYLFGFEESYGCLIGTHARDKDAIVATMALCEAAAFYKGQGKTLWDVMMDMYEKYGYYVDDIKTVTLKGVEGSKKIGHIMNVLRDNTPAEIAGYKTKVVRDYRLETIKNLETGETVKTGMPNSNVLYYELENDAWLAVRPSGTEPKIKFYYGIKGSSYDEAQKMSAEAGDKIMDLIYDILE 603
>gi|116334471|ref|YP_795998.1| phosphomannomutase [Lactobacillus brevis ATCC 367] >gi|116099818|gb|ABJ64967.1| alpha-phosphoglucomutase [Lactobacillus brevis ATCC 367] (576 aa)
Score = 578, Expect = 2.3e-57, Identities = 152/491 (30%), Positives = 251/491 (51%)
  Q:    52 SKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL---NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTII-----DNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR----------------WNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQIL 542
           + +SFGTAG+R  MGPG  Q+NV+T +Q +EGVAR+L    +      V ++ D+R ++  +A   A  L +  I  +++  + ++ TP +S++VR       I+ TASHNPK Y GFK+Y   GGQ+    ++ I   +   + +      D     +  L+    + + + Y +      IN+ + R   K   +I T  HGT        L+  G+EN  +  +Q + DP F      NPE   +FD+++   +K  A++++  DPD+DRL   VR  N  +  LTGNQ+  I   Y+L  +K          VV + VST    +IA  Y  ++    TGFK++  +++++    D  F+ GFEE+ G L     RDKD  Q+  L  EV      +  TL D ++E++  +G +  +T   +   ++  ++M   M +F         G +I+ +                  + P +  L+++L +  W+  R SGTEPK K Y     ET     Q L
  S:    40 APMSFGTAGMRGVMGPGIGQMNVYTVRQATEGVARYLDTLDDATKQQGVAISFDSRYHSREFAHEAAHVLGAHHIPSYVF--DDMRPTPELSFAVRHLQTAMGIMITASHNPKQYNGFKIYGPDGGQMPPKASDMITDFVRSAKDVFAIDVADETQLRSNKLLRIIGEDVDQPYLQNVESVTINSELIRSVGKTMKLIYTPLHGTGKVIGERALRGAGFENFTMVPEQAIADPEFPTVPFPNPEFSQAFDMAIALGKKEGADLLVATDPDADRLGAAVRQPNGDYQLLTGNQIASILLAYILKARKQAGQLPSDGRVVKSIVSTELATKIAAAYGVEMKNVLTGFKFIAEQIHQYETAHDHTFLFGFEESYGYLIKPFVRDKDAIQSTVLLAEVAADYKQRGMTLYDGIEELYATYGYFAEKTTFEEFPGVDGADQMAHLMSEFRENAPTAFAGNQIEAVEDFSTSVKTLADGTTSSIDLPQSNVLKYWLSDGTWICIRPSGTEPKVKFYIGTSDETDAAAQQRL 562
>gi|113970876|ref|YP_734669.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella sp. MR-4] >gi|113885560|gb|ABI39612.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella sp. MR-4] (573 aa)
Score = 577, Expect = 2.8e-57, Identities = 168/519 (32%), Positives = 277/519 (53%)
  Q:    12 MHANVNPLSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFP----VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM----DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLEI-----KGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           M+ ++    K WLE++   R   + + LI   N+ E++  F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV L    ++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+    + I + +    T     +D V       + +  D     Y+E   R +++ N+ +    P    +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++   D+   V +T VS++ + +IA+ +  + + T TGFKW+   MN  I +      F+  +EEA+G    ++  DKDG  A     ++   L  + +++ D L++I+ E G      VS   K ++ N    ++E     + + A V   D+  LE      K  + N PA   L + L N   V  R SGTEPK K YYE+
  S:     1 MNTHLQLQVKHWLENDPDPRTQAQLQALIDAGNDTELEARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGTYLLEQIKDAAERGVVIGYDGRHDSRTFAHDTASVLTAMGIKVRLTA--KVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIELAATQAIPFMDQVEATKQGKLIWLQD----DYYETYRRGVMHANVLQNNTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVAAQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRKDDGEYQMLTGDQVGVLFGHYLLSHAAKDQR-LVGTTIVSSSLLSKIAKGFGVESYTTLTGFKWL---MNVGIAQTQPDNQFLFAYEEALGYTVGNMVWDKDGLSALVAFAQLTAELAAKGQSIWDRLEQIYREQGFHLNAQVSIALKPDTPNIGAYLREHPPLAIGEHAVVSTDDLKALERRFADGKVEKINLPASDVLTYRLANGARVIVRPSGTEPKIKCYYEV 539
>gi|20809047|ref|NP_624218.1| phosphomannomutase [Thermoanaerobacter tengcongensis MB4] >gi|20517719|gb|AAM25822.1| Phosphomannomutase [Thermoanaerobacter tengcongensis MB4] (556 aa)
Score = 577, Expect = 3.3e-57, Identities = 169/533 (31%), Positives = 283/533 (53%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK--KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEA--SYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLT---NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYY-EIYGETKEICDQILKALKDEFEYML 553
           +AWL    IS + KE + KM+ EEI + F +  L FGTAG+R  MG G N++N +T  + ++ +A ++ NK  +   +V V++D R  +  +A+  A+ L + GIKV+L+  +  + TP++S++VR     A I+ TASHNP  Y G+KVY   G QI+      I+    +      +V   + D       +      +  +YFE   SY   I++     K+  ++ T  HGT    +P LL+ +G++  I   QQ +PD +F   +  NPE   +F+L+LK A    A+I++  DPD+DR+ V+V+HK  +  + GNQMGI+  +++LT    K   + P V+ + VS+    +IA  +  +V    TGFKW+ NE ++   +       +EE+ G    D   DKD      +  E+      +  TLVD L+EI++++G +  + +S   E     ++++  M++      + + G         +KG     P+  L+      + V  R SGTEPK K Y+  +  E  E   ++LK  K+E   +L
  S:    10 EAWLNDPAISYEDKEKLKKMSPEEIKEAF-FMDLEFGTAGLRGIMGLGANRMNFYTVGRATQALANYI-NKTVEEEKSVAVSYDTRKFSKEFAVESAQILAANGIKVYLF--DDFRPTPLLSFAVRFLKATAGIMITASHNPPEYNGYKVYWSNGAQIIPPHDKGIIEEYEKLS--FADVKRMSFDEAKDKGFVVMVGKEVDSAYFEKALSYSFGISS-----KDLKIVYTPLHGTGIKIVPPLLEKVGFDVYIQKEQQ-IPDGSFPTVSYPNPEFDEAFELALKDARSIDADIVVASDPDADRMGVLVKHKGDYVRIDGNQMGILLLNFLLTMYFEKGMPENPAVIESIVSSKLFAKIARAHGVEVSEVLTGFKWICNEADRLRKEGKTVFFAYEESYGYNVGDFVYDKDSGTPIMVTCEMAAYYKKKGMTLVDALEEIYKKYGYYLEDQLSPVYEGEKGLKKIKGIMERLREKPIESLAGHRLTRVVDYLKGYDRISPSDVLKMEFGEKLIVYVRPSGTEPKIKFYFMAMEMENIEEAKKLLKRAKEELVKVL 552
>gi|114048100|ref|YP_738650.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella sp. MR-7] >gi|113889542|gb|ABI43593.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella sp. MR-7] (573 aa)
Score = 576, Expect = 3.8e-57, Identities = 163/519 (31%), Positives = 275/519 (52%)
  Q:    12 MHANVNPLSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFP----VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE------SLNWKEEMQEKMDKFANVKNKDILGLEI-----KGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           M+ ++    K WLE++   R   + + LI   N+ E++  F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV L    ++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+    + I + +    T     +D V       + +  D     Y+E   R +++ N+ +    P    +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++   ++   V ST VS++ + +IA+ +  + + T TGFKW+ N  + +   +  F+  +EEA+G    ++  DKDG  A     ++   +  + +++ D L++I+ E G      VS  ++          +E   + + + A V   D+  LE      K  + N PA   L + L N   V  R SGTEPK K YYE+
  S:     1 MNTHLQLQVKHWLENDPDPRTQAQLQALIDAGNDAELEARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLEQIKDAAERGVVIGYDGRHDSRTFAHDTASVLTAMGIKVRLTA--KVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIELAATQAIPFMDQVEATKQGKLIWLQD----DYYETYRRGVMHANVLQNNTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVAAQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRKDDGEYQMLTGDQVGVLFGHYLLSHASKEQR-LVGSTIVSSSLLSKIAKGFGVESYTTLTGFKWLMNVGIAQTQPENQFLFAYEEALGYTVGNMVWDKDGLSALVAFAQLTAEVAAKGQSIWDRLEQIYREQGFHLNAQVSIALKPDTPNIGAYLREHSPQAIGEHAVVSTDDLKALERRFADGKVEKINLPASDVLTYRLANGARVIVRPSGTEPKIKCYYEV 539
>gi|157374656|ref|YP_001473256.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella sediminis HAW-EB3] >gi|157317030|gb|ABV36128.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella sediminis HAW-EB3] (582 aa)
Score = 575, Expect = 5.6e-57, Identities = 168/510 (32%), Positives = 258/510 (50%)
  Q:    21 KAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQI-----------LDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH----------KNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE--IKGIRWNE---------PAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           K WLE++   R   + + LI   +E E+   FS  +L FGTAG+R  +G G  ++N    QQ S G+  +L ++  +     V++ +D R ++  +A   A  LT+ GIKV+L  E  + ATP++++ V   G  A I+ TASHNP  Y G+KVY   G QI           +D  A + +      +TI DN  T         +    E+Y +      I  N  R     +  T  HG  +     +LK  G   +   A Q  PD +F      NPE+K + D  +  A+K+   +    DPD+DR AV VR           K ++  LTG+Q+G++  HY+LT+    +     +T VS++ + ++A  +NA    T TGFKW+ N  M++  D   F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D LDEI+ E G      VS  ++          + +   ++  K +L  +    G+RW E         PA   L + LE    V  R SGTEPK K YYE+
  S:    10 KNWLENDPDPRTKQELQGLIDANDETELGHRFS-GRLVFGTAGLRGVVGAGPMRMNRLVVQQTSAGLGMYLKHQTRDVETRGVVIGYDGRHDSKQFAHDAAAVLTAMGIKVYLTSE--VAATPLVAFGVTHFGAAAGIVVTASHNPPEYNGYKVYWGNGAQIIPPHDSGIAACIDRAATQAIVMQELEKTIADNSLT-------MLEADFYEAYRQGVRTAEILQNHTRPDLVSLSYTAMHGVGAKMAETVLKDAGVTQVYSVATQREPDGDFPTVKFPNPEEKGAMDRVIAEAKKHHTLLACANDPDADRFAVAVRKGEYESKDESAKGEYQMLTGDQVGVLLGHYLLTHAASSQR-LTCTTIVSSSLLSKVAASFNATCRTTLTGFKWLTNVGMSEQTDDNRFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELASKGQTIWDRLDEIYREHGFHLNAQVSIALKPETPNIGAYLRNNPPLSIAGKKVLVTDDISSGLRWFEDGHTESIALPASDVLIYQLEGGARVIVRPSGTEPKIKCYYEV 548
>gi|84387577|ref|ZP_00990595.1| Phosphomannomutase [Vibrio splendidus 12B01] >gi|84377625|gb|EAP94490.1| Phosphomannomutase [Vibrio splendidus 12B01] (574 aa)
Score = 574, Expect = 6.6e-57, Identities = 169/507 (33%), Positives = 275/507 (54%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT-------ITESYFEASYRCLINTNIY-----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-------KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTG--ETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRW---------NEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYE 529
           WL  +   R   + + LI +   +E++  F+  +L FGTAG+R  +G G N++N    Q+ + G+  +L+   +N +   V+V +D R+++  +A+  A  LT+ GIKV+L  +  + ATPI+++ +      AA++ TASHNP  Y GFKVY   G QI+      I          ID   T  + L+S  D         +TE Y++ +YR  IN + Y        N  +  T  HG  +     LL   G+  +   A+Q  PD NF  + NF NPE+K + DL +  A+   A+I    DPD+DR AV VR  +        +  LTG+Q+G++F HY+L+ K   K   V ++ VS+  ++++A+ + A  F+T TGFKW+ N  M    ++ +F+  +EEA+G       RDKDG  A  +  ++   L  Q +T+ D L +I  E G  T    +++   +S +   +++    K  N     ++      +R+         N P+   L ++LE+   +  R SGTEPK K+YYE
  S:     7 WLARDPDPRTREELQHLIDEGMHDELEDRFT-QRLEFGTAGLRGKVGCGPNRMNRLVIQETATGLGHYLIEHVANASIRGVVVGYDGRLDSKQFAIDTASVLTALGIKVYLTSD--VAATPIVAFGIEHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAGE-------IDIASTKPIPLMSLSDAETQGKLVWLTEGYYQ-TYRAAINQSPYVNNALESANTTITYTAMHGVGAKMAEDLLHDAGFHKVFSVAEQREPDGNFP-TVNFPNPEEKGAMDLVVNLAKSVDADIACANDPDADRFAVAVRTDDTARTDDASYKMLTGDQVGVLFAHYLLS-KPHTKNQLVGNSIVSSTLLEKVAQSHGATYFQTLTGFKWLANIGMQLENEQNEFLFAYEEALGYTIGTQVRDKDGLSAIVVFAQLVEELKSQGRTVWDLLAQISFEHGVHTNAQRSIALDPDSPSIGSKLRAAQPKAINGVAISVIEDLQSSLRFVIGGNTEAINLPSSDVLIYHLEDGTRIIVRPSGTEPKVKVYYE 539
>gi|167759628|ref|ZP_02431755.1| hypothetical protein CLOSCI_01986 [Clostridium scindens ATCC 35704] >gi|167662754|gb|EDS06884.1| hypothetical protein CLOSCI_01986 [Clostridium scindens ATCC 35704] (577 aa)
Score = 573, Expect = 8.4e-57, Identities = 163/535 (30%), Positives = 282/535 (52%)
  Q:    21 KAWLESNRISNKYKELILKMNEE--EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLL-NKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY--LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDK-----------FANVKNKDILGLEIKGIRWNEPAQA-------LEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           + WL +       K+ +  + E+  EI + F Y  L FGTAG+R  +G GTN++N++T ++ ++G+A +++ N      V +A+D+R  +  +A   A  L + GIK ++++   ++ TP +SY+VR  G  A I  TASHNP  Y G+KVY   G QI       I+  + E  T  + V T  ++      L       + + Y     + +I+ +      K   ++ +  HGT +     +LK +G+EN+ +  +Q +PD  F   +  NPE K +F+L L  A++  A+++L  DPD+DRL V V+      Y  LTGN  G +   Y +  +K         +++ T V++N  D IA+ Y+  +    TGFK++G ++   +   K  ++ GFEE+ G L     RDKD   A     E       + KTL D + ++++++G +  +  S  ++ +   +++QE ++            +  +K +D     IK +   + AQ        L + L +D W+  R SGTEPK K YY I G + +  D+    L +E   M+ +
  S:     8 EGWLSNPYFDENTKDELRSIAEDDNEIKERF-YKDLEFGTAGLRGIIGAGTNRMNIYTVRKATQGLANYIMKNGGQAKGVAIAYDSRRMSPEFADEAALCLAANGIKAYVFE--SLRPTPELSYAVRTLGCIAGINITASHNPPEYNGYKVYWEDGAQITPPHDKGIMDEV-EAVTDYNTVKTMGLEEAKKAGLYEVIGQEVDDGYIAKLKKQVIHQDSIDAVGKELKIVYSPLHGTGNIPARRILKELGFENVYVVKEQELPDGEFPTVSYPNPEAKEAFELGLALAKEVDADLVLATDPDADRLGVYVKDAKSGEYKVLTGNMSGCLLADYEIGQRKEVSGLPDDGYLIKTIVTSNLADAIAKGYDIGLIEVLTGFKYIGQQILGFETTGKGTYLFGFEESYGCLIGTYARDKDAIVATMALCEAAAYYKTKGKTLWDAMVDMYDKYGYYKDDIQSITLKGIEGLQKIQEILETLRKNPPLEVGGYKVLKVRDYQADTIKDVATGDVAQTGLPTSNVLYYDLTDDAWLCVRPSGTEPKVKFYYGIKGSSLKDADEKSSKLGEEVLSMINT 575
>gi|163814509|ref|ZP_02205898.1| hypothetical protein COPEUT_00660 [Coprococcus eutactus ATCC 27759] >gi|158450144|gb|EDP27139.1| hypothetical protein COPEUT_00660 [Coprococcus eutactus ATCC 27759] (574 aa)
Score = 573, Expect = 9.7e-57, Identities = 164/531 (30%), Positives = 273/531 (51%)
  Q:    23 WLESNRISN-KYKELI-LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLIN-TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAV--VVRHKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKV-FRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDI------------LGLEIKGIRWNEPAQALE------WYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           WL S+++     KELI ++ N EEI+  F Y+ L FGT G+R  MG GTN++N++T +  ++G+A +L     S P+  +A DNR NA  YA+  A  L + G+KV+L+  + ++ TP +S++VR    +  +  TASHNPK Y G+KVY   G QI+  +  EI++   E   I D      MD        L++     I ++Y    ++ ++N   I +  +  ++ +  HGT    +  +L  +G++++ +  +Q V D NF    + NPE   ++ LSL+ A+K    ++L  DPD+DRL +       N++   TGN  G I   YVL  +    +  + P +V+T V TN +  I +KY+         GFK + + M   +   + ++V G E+  G L     RDKD      L  E      ++  TL D + E+++E+G +  +  + K +      ++Q  +    +   + +            LG E         A  L       + L +  W   R SGTEPK K Y  + G ++E   + L  L    + M 
  S:    10 WLGSDQVDEYTKKELISIRDNAEEIEDRF-YTNLEFGTGGLRGVMGAGTNRMNIYTVRMATQGIANYLAKLGISEPSAAIAFDNRNNASLYALETALCLCANGVKVYLF--DALRPTPELSFAVRYLHCNIGVNITASHNPKEYNGYKVYWDDGAQIVSPQDKEIIA---EVNNIEDFSMVKTMDKDAAIDAGLLNVIGQEIDDAYIGELHKLVMNPEEIQKAGDLKIVYSPLHGTGLKPVTRVLSELGFKDVHVVEEQAVQDGNFPTVKSPNPEGAEAYALSLELAKKVGGELILVTDPDADRLGMYGYDSKNNEYKEFTGNMFGAILCDYVLMQRSRSGRLPENPAIVTTVVITNMVKEICKKYDTFCDCNNLIGFKNIASRMRAYEQTGEHNYVFGLEDTFGCLPGTYARDKDSVGTLMLLCEAAAYYKNRGMTLWDRMVELWQEYGFYKEKVQTMKFDGREGAAKIQSMIQTLRDNPVRKVGAYSVEKIYDYKLGTETDAATGKSEAAVLPKSNMIYYQLADGAWFLVRPSGTEPKIKFYLGVKGSSQEDAAEQLDELAANVKAMF 573
>gi|148975710|ref|ZP_01812541.1| Phosphomannomutase [Vibrionales bacterium SWAT-3] >gi|145964783|gb|EDK30035.1| Phosphomannomutase [Vibrionales bacterium SWAT-3] (568 aa)
Score = 572, Expect = 1.2e-56, Identities = 172/507 (33%), Positives = 270/507 (53%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT-------ITESYFEASYRCLIN-----TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR----------------WNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYE 529
           WL  +   R   + + LI +   +E++  F+  +L FGTAG+R  +G G N++N    Q+ + G+  +L+   +N T   V+V +D R+++  +A+  A  LT+ GIKV+L   + + ATPI+++ +      AA++ TASHNP  Y GFKVY   G QI+      I +        ID   T  + L+S  D         +TE Y++ +YR  IN      N     N  +  T  HG  +     LL   G+  +   A+Q  PD +F  + NF NPE+K + DL +  A+   A+I    DPD+DR A  VR  +  +  LTG+Q+G++F HY+L+ K  +K   V ++ VS+  ++++A  + A  F+T TGFKW+ N  M    ++ +F+  +EEA+G       RDKDG  A  +  ++   L  Q +T+ D L +I  E G  T    S  ++      +      K    + K I G+ I  I                  N PA   L ++LE+   +  R SGTEPK K+YYE
  S:     7 WLARDPDPRTREELQHLIDEGMHDELEDRFT-QRLEFGTAGLRGKVGCGPNRMNRLVIQETATGLGHYLIEHVANATMRGVVVGYDGRLDSKQFAIDTASVLTALGIKVYL--TSNVAATPIVAFGIEHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAAE-------IDFAATKPIPLMSLSDAETQYKLVWLTEGYYQ-TYRAAINKSPFVKNDIESANTTIAYTAMHGVGAQMAEDLLHDSGFHKVFSVAEQREPDGHFP-TVNFPNPEEKGAMDLVVNLAKSVDADIACANDPDADRFAAAVRTDDGSYKMLTGDQVGVLFAHYLLS-KPHNKNQLVGNSIVSSTLLEKVANSHGATYFQTLTGFKWLANIGMQLEDEQNEFLFAYEEALGYTIGTQVRDKDGLSAIVVFAQLVEELKSQGRTVWDLLAQISFEHGVHTNAQRSIALDP-----DSPSIGSKLRAAQPKTINGIAISVIEDLHSSLRFITGGATEAINLPASDVLIYHLEDGSRIIVRPSGTEPKVKVYYE 533
>gi|117921148|ref|YP_870340.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella sp. ANA-3] >gi|117613480|gb|ABK48934.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella sp. ANA-3] (573 aa)
Score = 572, Expect = 1.3e-56, Identities = 165/519 (31%), Positives = 275/519 (52%)
  Q:    12 MHANVNPLSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFP----VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLEI-----KGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           M+ ++    K WLE++   R   + + LI   N+ E++  F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV L    ++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+    + I + +    T     +D V       + +  D     Y+E   R +++ N+ +    P    +  T  HG  +     +LK  G+  +     Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++   ++   V +T VS++ + +IA+ +  + + T TGFKW+ N  + +      F+  +EEA+G    ++  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E     + + A V   D+  LE      K  + N PA   L + L N   V  R SGTEPK K YYE+
  S:     1 MNTHLQLQVKHWLENDPDPRTQAQLQALIDAGNDAELEARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLEQIKDAAERGVVIGYDGRHDSRTFAHDTASVLTAMGIKVRLTA--KVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAKIELAATQAIPFMDQVEATKQGKLIWLQD----DYYETYRRGVMHANVLQNNTAPEKVSLAYTAMHGVGAEMAETVLKDAGFAQVYSVVAQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRKDDGEYQMLTGDQVGVLFGHYLLSHASKEQR-LVGTTIVSSSLLSKIAKGFGVESYTTLTGFKWLMNVGIAQSQPDNQFLFAYEEALGYTVGNMVWDKDGLSALVAFAQLTAELAAKGQTIWDRLEQIYREQGFHLNAQVSIALKPDTPNIGAYLREHPPLAIGEHALVSTDDLKALERRFADGKVEKINLPASDVLTYRLANGARVIVRPSGTEPKIKCYYEV 539
>gi|58337008|ref|YP_193593.1| phosphoglucomutase [Lactobacillus acidophilus NCFM] >gi|58254325|gb|AAV42562.1| phosphoglucomutase [Lactobacillus acidophilus NCFM] (574 aa)
Score = 569, Expect = 2.5e-56, Identities = 167/527 (31%), Positives = 278/527 (52%)
  Q:    21 KAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-----ISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT----NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDILGLEIKGIRWNEP------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKD 547
           K W  +  + +  K+ +  L  +E+ I+  F    ++FGTAG+R  + PGTN+IN+FT  +++EG+AR L+++         V++A D+R ++  +A   A+ L + GI V+L+  + ++ TP +SY+VR     A I  TASHN K Y G+KVY   G Q+    A+ + +   +   I         +L     +    + + E+Y     +  ++  + +       +I T  HGT         +  G++N+I    Q + DP F  +   NPE +  F+   K A+K  AN+++  DPD+DR+   VR  +  +  LTGNQ+  +  +Y+L     + K      +V++ VS+    +IAE +  K     TGFK++G E   MNK  D   F++GFEE+ G L     RDKD  Q A +  EV +    +  T+ D L EI++++G     T + ++  +  +++M E M K  N           VK +D L  E        P      +  L+++L+++ WV  R SGTEP  K Y    G  KE  ++  KA +D
  S:     8 KEWQNATGLPDYLKDQLDTLGKDEKWIEDAFG-QDINFGTAGMRGRLEPGTNRINLFTVGRVTEGLAR-LIDENGEEAKKRGVVIAFDSRYHSREFAEHAARVLGAHGIHVYLF--DDLRPTPELSYAVRHLNTFAGINITASHNAKQYNGYKVYGEDGAQMAPENADRLFAYAQKVTDIFGVEVASVKELRANNTLQLIGEDVDEAYLNELKQVTVDKEMVKANADKLKIIYTPLHGTGKMLYDRAFRQGGFDNVIPVPSQSIIDPEFPTTIKPNPEYRDVFEPGFKLADKVDANVIIATDPDADRMGAAVRKSDGDFQVLTGNQIATLMAYYLLAHLKESGKLTDDYEIVTSVVSSALPFKIAEDFGIKTKHVLTGFKYIGEEVDRMNKAGDA-KFLMGFEESYGYLFKPFARDKDAMQGALMFAEVASYYASRGMTVFDGLQEIWKKYGVAYEITRAIEMPGIGGQKKMAELMSKLRNEHLTEIGGSKVVKIQDFLKQETIENGEKTPLEGFPESNVLKYFLDDETWVALRPSGTEPVIKAY---VGVNKENIEKAEKAAED 564
>gi|86144420|ref|ZP_01062752.1| Phosphomannomutase [Vibrio sp. MED222] >gi|85837319|gb|EAQ55431.1| Phosphomannomutase [Vibrio sp. MED222] (574 aa)
Score = 568, Expect = 3.2e-56, Identities = 166/490 (33%), Positives = 269/490 (54%)
  Q:    40 MNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT-------ITESYFEASYRCLINTNIYRQK-----NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNK-------WHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTG--ETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRW---------NEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYE 529
           M++E  D++    +L FGTAG+R  +G G N++N    Q+ + G+  +L+    N +   V+V +D R+++  +A+  A  LT+ GIKV+L   + + ATPI+++ +      AA++ TASHNP  Y GFKVY   G QI+      I +        ID   T  + L+S  D         +TE Y++ +YR  IN + +  K     N  +  T  HG  +     LL   G+  +   A+Q  PD +F  + NF NPE+K + DL +  A+   A+I    DPD+DR AV VR  +K       +  LTG+Q+G++F HY+L+ K   K   V ++ VS+  ++++A+ + A  F+T TGFKW+ N  M    +K +F+  +EEA+G       RDKDG  A  +  ++   L  Q +T+ D L +I  E G  T    +++   +S +   +++    K  N     ++      +R+         N P +  L ++LE+   +  R SGTEPK K+YYE
  S:    28 MHDELEDRFIQ--RLEFGTAGLRGKVGCGPNRMNRLVIQETATGLGHYLIEHVENASMRGVVVGYDGRLDSKQFAIDTASVLTALGIKVYL--TSNVAATPIVAFGIEHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAAE-------IDIASTKPIPLMSLSDAETQGKLVWLTEGYYQ-TYRAAINQSPHVSKEIESANTTITYTAMHGVGAQMAEDLLHDSGFHKVFSVAEQREPDGHFP-TVNFPNPEEKGAMDLVVNLAKSVDADIACANDPDADRFAVAVRTDDKVRTEDDSYKMLTGDQVGVLFAHYLLS-KPHTKNQLVGNSIVSSTLLEKVAQSHGATYFQTLTGFKWLANIGMQLEDEKNEFLFAYEEALGYTIGTQVRDKDGLSAIVVFAQLVEELKSQGRTVWDLLAQISFEHGVHTNAQRSIALDPDSPSIGSKLRAAQPKAINGVAISVIEDLQSSLRFIVGGATEAINLPVSDVLIYHLEDGSRIIVRPSGTEPKVKVYYE 539
>gi|161507207|ref|YP_001577161.1| phosphoglucomutase [Lactobacillus helveticus DPC 4571] >gi|160348196|gb|ABX26870.1| phosphoglucomutase [Lactobacillus helveticus DPC 4571] (574 aa)
Score = 568, Expect = 3.5e-56, Identities = 154/513 (30%), Positives = 273/513 (53%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-----ISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-----------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIY 527
           N   + + W  +N + +  ++ +  L  +E+ I+  F    ++FGTAG+R  + PGTN+IN+FT  +++EG+AR L+++         V ++ D+R ++  +A   A+ L +  I V+L+  + ++ TP +SY+VR     A I  TASHN K Y G+KVY   G Q+    A+ + +   +   I      P  +L     +    + + E Y +   +  ++  + +       +I T  HGT         +  G++N+I    Q + DP F  +   NPE +  F+   K A+K +AN+++  DPD+DR+   VR  +  +  LTGNQ+  +  +Y+L +     K      +V++ VS+    +IAE +  K     TGFK++G E+++     D  F++GFEE+ G L     RDKD  Q A +  EV +    +  T+ D L EI+ ++G     T + ++  +  +++M E M K  N    +I G+++  I+                     +  L+++L+++ WV  R SGTEP  K+Y
  S:     2 NAREIFEEWQNANNLPDYLRDQLDTLGKDEKWIEDAFG-QDINFGTAGMRGRLEPGTNRINLFTVGRVTEGLAR-LIDENGEEAKKRGVAISFDSRYHSREFAEHAARILGAHRIHVYLF--DDLRPTPELSYAVRHLHTFAGINITASHNAKQYNGYKVYGEDGAQMAPENADRLFAYAQKVTDIFGVKAAPVQELRANGTLQLIGEDVDEDYLQELKQVTVDPEMVKANADKLKIIYTPLHGTGKMLYDRAFRQGGFDNVIPVPIQSIIDPEFPTTIKPNPEYRDVFEPGFKLADKVKANVIIATDPDADRMGAAVRKSDGDFQVLTGNQIATLMAYYLLVHMKESGKLTSDYEIVTSVVSSALPFKIAEDFGIKTKHVLTGFKYIGEEVDRMKKAGDAKFLMGFEESYGYLFKPFARDKDAMQGALMFAEVASYYASKGMTVFDGLQEIWNKYGVAYEITKAIEMPGIGGQKKMAELMSKLRNEHLSEINGVKVNKIQDFLKKETIENCNVTPLEGFPESNVLKYFLDDETWVALRPSGTEPVIKVY 547
>gi|116629947|ref|YP_815119.1| phosphomannomutase [Lactobacillus gasseri ATCC 33323] >gi|116095529|gb|ABJ60681.1| alpha-phosphoglucomutase [Lactobacillus gasseri ATCC 33323] (574 aa)
Score = 568, Expect = 3.6e-56, Identities = 160/540 (29%), Positives = 283/540 (52%)
  Q:    15 NVNPLSKAWLESNRISNKYKELILKMNEEE--IDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-----ISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPF----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE-----------------WYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           N   +   W  +N + +  K+ + K+ ++E  I+  F    ++FGTAG+R  + PGTN+IN+FT  +++EG+AR L+++         V ++ D+R ++  +A   A+ L + GI V+L+  + ++ TP +S++VR     A I  TASHN K Y G+KVY   G Q+    A+ + +   +   I      P  +L     +    + + E+Y        ++  + +       +I T  HGT         +  G++N+I    Q + DP F  +   NPE +  F+   K A +  AN+++  DPD+DR+   VR  +  +  LTGNQ+  +  +Y+L + K + T      +V++ VS+    +IA+ +  K     TGFK++G E   MNK  D   F++GFEE+ G L     RDKD  Q A +  EV +    +  T+ D L EI++++G     T + ++  +  +++M E M K       +I G ++  I+  E  + +E                 ++L+++ WV  R SGTEP  K Y  +  +  E  ++  +  +D    +L+
  S:     2 NAKEIYSQWTNANNLPDYLKDQLDKLGKDEKWIEDAFG-QDINFGTAGMRGRLEPGTNRINLFTVGRVTEGLAR-LIDENGEEAKKRGVAISFDSRYHSREFAEHAARILGAHGIHVYLF--DDLRPTPELSFAVRHLNTFAGINITASHNAKQYNGYKVYGEDGAQMAPENADRLFAYAQKVDDIFGVKAAPVEELRANGTLQLIGEDVDEAYLAHLKDVTVDPEMVKANADKLKIIYTPLHGTGKMLYDRAFRQGGFDNVIPVPSQSIIDPEFPTTIKPNPEYRDVFEPGFKLANEVDANVIIATDPDADRMGAAVRKSDGDFQVLTGNQIATLMAYYLLVHMKENGTLSPDYELVTSVVSSALPFKIADDFGIKTKHVLTGFKYIGEEVDRMNKENDG-KFLMGFEESYGYLFKPFARDKDAMQGALMFAEVASYYASKGMTVFDGLQEIWQKYGVAYEITKAIEMPGIGGQKKMAELMSKLRKEHLTEINGAKVVKIQDFETQETIEGDKKTPLTGFPKSNVLKYFLDDETWVALRPSGTEPVIKAYVGVNKKDIETAEKAAEEYQDALANLLK 574
>gi|34541601|ref|NP_906080.1| phosphomannomutase, putative [Porphyromonas gingivalis W83] >gi|34397918|gb|AAQ66979.1| phosphomannomutase, putative [Porphyromonas gingivalis W83] (550 aa)
Score = 568, Expect = 3.8e-56, Identities = 150/489 (30%), Positives = 270/489 (55%)
  Q:    43 EEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYF-EASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------TGETVSYKIESL--NWKE---------EMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIY 531
           E +D +  Y  L FGT G+R  MG GTN++N +T    ++G++ +LL +    SN +V++ +D R N+ ++A   A   ++ GI V+L++E  ++ TP ISY++R  G  + ++ TASHNPK Y G+K Y   G QI+      I++ +   +++ +  +    +LI    + I  ++  E     L   +I R ++  ++ T  HGT S  +P  L+  G+ NII   +Q V   +F    + NPE+ A+  +++  AE+  A+++L  DPD+DR+ V VR ++ +   + GN++  +  +Y +  +K         ++V T V+T  I  IA+K +  +F   TGFKW+   + ++  +  ++ G EE+ G L  D  RDK    A AL  E+     D+  ++   +  I+ E+G +          G++ + +IE++  N++E          +QE +D +A+++ KD    E   +     +  L++  E+   V  R SGTEPK K Y  ++
  S:     9 ELVDAF--YRDLEFGTGGLRGIMGAGTNRMNRYTVGAATQGLSNYLLREFAGSSNISVVIGYDCRNNSRFFADTAAAVFSANGIGVYLFEE--LRPTPEISYAIRHLGCKSGVMITASHNPKEYNGYKAYWEDGAQIIAPHDRNIIAEVNRIRSVDEIKFEAKPELIRMIGENIDSAFIAEVKALSLSPESIARHRDMKIVYTPIHGTGSTVVPRALREYGFANIIHVPEQDVVSGDFPTVHSPNPEEPAALAMAIAKAEETGADLVLASDPDADRIGVAVRNNEGRMVLINGNEICSLLIYYSIMRRKELGDLHPDDYIVKTIVTTELIRDIAKKEHVSMFDCYTGFKWIAAVIRENEGRRRYIGGGEESYGFLWEDFIRDKSSVSACALFCEMAAWALDRGMSVYRLIRSIYLEYGLYYEKGLSVVRKGKSGAEEIEAMMRNYREYAPVELGGSPVQEILD-YASLEGKDFTRGEKFSLDMPTTSNVLQYKTEDGTKVSIRPSGTEPKIKFYIGVH 521
>gi|154484256|ref|ZP_02026704.1| hypothetical protein EUBVEN_01968 [Eubacterium ventriosum ATCC 27560] >gi|149734733|gb|EDM50650.1| hypothetical protein EUBVEN_01968 [Eubacterium ventriosum ATCC 27560] (577 aa)
Score = 566, Expect = 5.9e-56, Identities = 163/499 (32%), Positives = 264/499 (52%)
  Q:    34 KEL-ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD--------LISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN--KWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-----------IKGIRWNE------PAQALEWY-LENDMWVKFRLSGTEPKFKIYYEIYG 532
           KEL  +K + +EI+  F Y  L FGTAG+R  +G GTN++N++T ++ ++G+A +++     +  V +A D+R  +  +A   A  L + GIK +++  + ++ TP +S++VRE    A I  TASHNP  Y G+KVY   G QI        V+ M     I D      MD        L       + + Y  A  + + + +     QK+  ++ T  HGT +  +  +LK +G+EN+ +  +Q +PD +F   +  NPE + +F+L++K   +  A+I+L  DPD+DRL V VR K    +H LTGN  G +   Y ++  K      +   ++ T V+TN  + IA+ YN  +    TGFK++G ++   +   K  +  GFEE+ G L     RDKD   A     E       +  +L D + E++E +G W     +  ++     E++Q  ++K       +I G +           IK +   E      P   + +Y LE   WV  R SGTEPK K YY + G
  S:    22 KELEAIKDDNKEIEDRF-YKDLEFGTAGLRGVIGAGTNRMNIYTVRRATQGLANYIIKMNGQDKGVAIAFDSRHMSPEFADEAALCLNANGIKAYVF--DSLRPTPELSFAVRELKCIAGINVTASHNPAEYNGYKVYWEDGAQITPPHD---VNIMDAVLAITDYADVKTMDKDEAVKAGLYVQIGKDVDDKYIAALKKQVKHQDAIDAVQKDIKIVYTPLHGTGNIPVRRVLKELGFENVYVVKEQELPDGDFPTVSYPNPESEEAFELAVKLGNEIGADILLATDPDADRLGVYVRGKEPGTYHVLTGNMSGCLLAEYEISQMKEAGTLPEDGALIKTIVTTNLANDIAKYYNVNLIEVLTGFKYIGEQILGFETTGKGHYCFGFEESYGCLIGTHARDKDAVVATMALCEAVAYYKTKGMSLWDKMTEMYERYGYWLDGVQAITLKGKEGIEKIQNTIEKLRQQVPTEINGYKVLSARDYKLNTIKNMETGEVTETGLPKSNVLYYDLEGGAWVCVRPSGTEPKLKFYYGVKG 552
>gi|139439215|ref|ZP_01772657.1| Hypothetical protein COLAER_01668 [Collinsella aerofaciens ATCC 25986] >gi|133775239|gb|EBA39059.1| Hypothetical protein COLAER_01668 [Collinsella aerofaciens ATCC 25986] (564 aa)
Score = 565, Expect = 7.2e-56, Identities = 158/514 (30%), Positives = 270/514 (52%)
  Q:    14 ANVNPLSKAWLESNRISN-KYKELILKMN-------EEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASY-RCLINTNIYRQKNFP--VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKF---DKTPFV-VSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD---FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKG-IRWNE------PAQALEWYLENDMWVKFRLSGTEPKFKIY 527
           A+V+ L   W     I+N K +EL+ ++N       E+ I   F +  L+FGTAG+R T+G GTN++N++T  + ++G A +L     +PTV +A D+R   + +    A  L + G+   +Y   +I   P +S++VR+      I  TASHNP  Y G+K Y   G QI    A+ I  ++ E  T    V + + D      L+ + DD+  E Y++A   R + N +       P  ++ T  +GT    +  +L+  G  ++ +  +Q  P+ +F      NPE + +    +   E+   +++L  DPD+DR+ V V++ + +  LTGN+MG++   Y+   +     D T  V V+T VS+  +D +A++Y  ++ R  TGFK++G+ +    D  +   F+ GFEE+ G L  D  RDKD    + L  ++      Q K L D + E++E++G +  +T+S          +M   M         ++ G +I+  + +N        A  +E+ LE       R SGTEPK K+Y
  S:     2 ADVHELLDTW-----IANVKDEELLAELNTMKEQGDEDAITDAF-FQDLAFGTAGLRGTIGAGTNRMNIYTVGRATQGFADYLNATFEHPTVAIARDSRNKGELFVKTTAAILAANGVTALVYP--KISPVPTLSWAVRDLKCSGGICMTASHNPAPYNGYKAYGPDGCQITSEAADAISKAIAETDTFT-GVKSMDFDEALEQGLVKWIDDSCLERYYDAVLARGVTNLSAEEIAGAPLKLVYTPLNGTGLIPVTTVLERAGITDVTVVPEQKEPNGDFPTCPYPNPEIRQAMQKGIDLCEQVHPDLLLATDPDADRVGVAVKNGDDYLLLTGNEMGVLLLDYICKTRAARGEDLTKKVAVTTIVSSAMVDALADEYGFELRRCLTGFKYIGDIITSLSDAGEVDRFIFGFEESYGYLAGDHVRDKDAVSTSLLICQMAQYYKLQGKNLADAMHELYEKYGYYHNKTISLSYPGAEGAAKMAGIMAGLRENPPAELAGSKIEAVVDYNTCVNGLPKANVIEFDLEGGNKGIVRPSGTEPKIKLY 537
>gi|153000084|ref|YP_001365765.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella baltica OS185] >gi|151364702|gb|ABS07702.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella baltica OS185] (573 aa)
Score = 564, Expect = 9.5e-56, Identities = 162/508 (31%), Positives = 267/508 (52%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R   + + LI   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        ++   D   +SY     +  +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR ++ ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   D+  LE       ++ I    P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQTQLQTLIDNGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIERAANQAIPFLEHDEAVKQGKLTLLQDDFYQSYRHGVQQAEVLQNHTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRREDGEYQMLTGDQVGVLFGHYLLSHAK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPVKIGEQDVLSTDDLKALERRFADGRVEKIDL-PPSDVLTYCLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|163727938|ref|ZP_02135423.1| phosphoglucomutase [Vibrio fischeri MJ11] >gi|161398839|gb|EDQ23123.1| phosphoglucomutase [Vibrio fischeri MJ11] (569 aa)
Score = 563, Expect = 1.3e-55, Identities = 159/501 (31%), Positives = 264/501 (52%)
  Q:    36 LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE--SLNWKEEMQ-EKMDKFANVKNKDILGLEIKGIRW---------NEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           L+   N +E+++ F +S+L FGTAG+R  +G G N++N    Q+ + G+  +L+++  +     V+V +D R ++  +A   A  LT+ GIKVFL   +++ ATPI+++ ++      A++ TASHNP  Y GFKVY   G QI+    + I  ++    T   ++    +D      L+ + +D   ++Y        + +N     +  +  T  HG  +     LL+  G+ ++   A+Q  PD NF  + NF NPE+  + D+    A    A+I    DPD+DR A+  R  +  +  LTG+Q+G +F HY+LT+ +      V +T VS+  + +IAE   A+ F+T TGFKW+ N  M K  ++  F+  +EEA+G        DKDG  A     ++   L  Q K + D L+ I+ + G       S  ++  S    E ++  +    A VK   +  L+   +R+         + PA   L ++LEN   +  R SGTEPK K YYE+  +  E
  S:    24 LVDSHNTQELEERF-HSRLQFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLIDQVKDAKQRGVVVGYDGRNDSKQFAHDTASVLTALGIKVFL--TSKVAATPIVAFGIKHFNAAGAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAQTIDIAAT--KSIVMMPLDEAEEKGLLVWLEDDYYQTYRNTMNSNKLLSNHTDPSSITIAYTAMHGVGADMAETLLRDAGFNHVFSVAEQREPDGNFP-TVNFPNPEEAGAMDMVEALAASANADIACANDPDADRFALAARKPDGGYKMLTGDQVGTLFGHYLLTHTE-ASGKLVGNTIVSSTLLKKIAESTGAQYFQTLTGFKWLTNVAMQKETNEKQFLFAYEEALGYTIGSQVWDKDGLSALVAFAQLTAELATQGKCVWDQLESIYRQHGIHINAQRSIALDPSSPAIGEHLRANQPTHIAGVKIDVVEDLK-ASLRYLPNGATESIDLPASDVLIYHLENGARIIVRPSGTEPKLKCYYEVVADISE 541
>gi|188995819|ref|YP_001930071.1| phosphomannomutase [Porphyromonas gingivalis ATCC 33277] >gi|188595499|dbj|BAG34474.1| phosphomannomutase [Porphyromonas gingivalis ATCC 33277] (582 aa)
Score = 562, Expect = 1.6e-55, Identities = 150/489 (30%), Positives = 270/489 (55%)
  Q:    43 EEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYF-EASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------TGETVSYKIESL--NWKE---------EMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIY 531
           E +D +  Y  L FGT G+R  MG GTN++N +T    ++G++ +LL +    S+ +V++ +D R N+ ++A   A   ++ GI V+L++E  ++ TP ISY++R  G  + ++ TASHNPK Y G+K Y   G QI+      I++ +   +++ +  +    +LI    + I  ++  E     L   +I R ++  ++ T  HGT S  +P  L+  G+ NII   +Q V   +F    + NPE+ A+  L++  AE+  A+++L  DPD+DR+ V VR ++ +   + GN++  +  +Y +  +K         ++V T V+T  I  IA+K +  +F   TGFKW+   + ++  +  ++ G EE+ G L  D  RDK    A AL  E+     D+  ++   +  I+ E+G +          G++ + +IE++  N++E          +QE +D +A+++ KD    E   +     +  L++  E+   V  R SGTEPK K Y  ++
  S:    41 ELVDAF--YRDLEFGTGGLRGIMGAGTNRMNRYTVGAATQGLSNYLLREFAGSSDISVVIGYDCRNNSRFFADTAAAVFSANGIGVYLFEE--LRPTPEISYAIRHLGCKSGVMITASHNPKEYNGYKAYWEDGAQIIAPHDRNIIAEVNRIRSVDEIKFEAKPELIRMIGENIDSAFIAEVKALSLSPESIARHRDIKIVYTPIHGTGSTVVPRALREYGFANIIHVPEQDVVSGDFPTVHSPNPEEPAALALAIAKAEETGADLVLASDPDADRIGVAVRNNEGRIVLINGNEICSLLIYYSIMRRKELGDLHPDDYIVKTIVTTELIRDIAKKEHVSMFDCYTGFKWIAAVIRENEGRRRYIGGGEESYGFLWEDFIRDKSSVSACALFCEMAAWALDRGMSVYRLIRSIYLEYGLYYEKGLSVVRKGKSGAEEIEAMMRNYREYAPVELGGSPVQEILD-YASLEGKDFTRGEKFSLDMPTTSNVLQYKTEDGTKVSIRPSGTEPKIKFYIGVH 553
>gi|120435415|ref|YP_861101.1| phosphoglucomutase/phosphomannomutase [Gramella forsetii KT0803] >gi|117577565|emb|CAL66034.1| phosphoglucomutase/phosphomannomutase [Gramella forsetii KT0803] (576 aa)
Score = 562, Expect = 1.7e-55, Identities = 167/511 (32%), Positives = 284/511 (55%)
  Q:    20 SKAWLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM-----DKFANVKNKDILGLE-----IKGIRWNEPAQALE--------WYLENDMWVKFRLSGTEPKFKIYYEI 530
           ++AWL     ++   E+  ++  N +E+++ F Y    FGT G+R  MG GTN+IN +T  + ++G++ +L  KKS P     V +A+D R N+   A V+A   ++ GIKVFL+ E  ++ TP +SY+V++      I+ TASHNP  Y G+KVY   GGQ++    +E+V+ +   +    N +  N +LI   D  + + + +AS +    + +   ++N  V+ T+ HGT+   +P +L+  G+ N+ +  +Q  P+ NF    + NPE+  +  ++L  AE+  A+I++G DPD DRL V VR  K +   L GNQ  ++ T ++L   K         FV ST VST  +  + E Y  K     TGFKW+   +  H  +MDF+ G EE+ G +  D  RDKD   A  LA E+   + D+ K+  + L E++ E G +  E +S   + +  ++E+++ +     + +  +  + ++ +E     I     N   ++++        +Y EN   +  R SGTEPK K Y  +
  S:    12 AEAWLTDIFDNDTRSEVNRLIDENPKELEESF-YKNAEFGTGGMRGMMGVGTNRINKYTLGKNTQGLSDYL--KKSFPDKEIKVAIAYDCRNNSQKLAKVVANVFSANGIKVFLFSE--LRPTPELSYAVKKLDCQCGIVLTASHNPPEYNGYKVYWKDGGQLVPPHDSEVVNMINALEYSAIN-FKANEELIQEIDTEVDQDFADASVKNGSFDNSASARENLNVVFTSLHGTSITIVPEVLEKAGFTNVHIVEEQREPNGNFPTVKSPNPEEPEALKMALNLAERKNADIVIGTDPDCDRLGVAVRDLKGEMILLNGNQTMLVMTWFLLEEWKRQGRIKGNEFVASTIVSTPMLKNLTEAYGVKYMEVLTGFKWIAKLIKDH-PEMDFIGGGEESFGYMVGDFVRDKDAVTATLLACEIAAKMKDEGKSFYEKLLELYTEHGLYREELISLVKKGIEGEQEIKQMLIDLRENPWEEIDGEKVVLVEDYKTSIAKNTQNHTEESIDIPKSNVLIYYTENGTKIAARPSGTEPKIKFYISV 545
>gi|59711663|ref|YP_204439.1| phosphoglucomutase [Vibrio fischeri ES114] >gi|59479764|gb|AAW85551.1| phosphoglucomutase [Vibrio fischeri ES114] (569 aa)
Score = 561, Expect = 2.3e-55, Identities = 158/501 (31%), Positives = 263/501 (52%)
  Q:    36 LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTG--ETVSYKIESLNWKEEMQEK-MDKFANVKNKDILGLEIKGIRW---------NEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           L+   N +E+++ F +S+L FGTAG+R  +G G N++N    Q+ + G+  +L+++  +     V+V +D R ++  +A   A  LT+ GIKVFL   +++ ATPI+++ ++      A++ TASHNP  Y GFKVY   G QI+    + I  ++    T   ++    +D      L+ + +D   ++Y        + +N     +  +  T  HG  +     LL+  G+ ++   A+Q  PD NF  + NF NPE+  + D+    A    A+I    DPD+DR A+  R  +  +  LTG+Q+G +F HY+LT+ +      V +T VS+  + +IAE   A+ F+T TGFKW+ N  M K   +  F+  +EEA+G        DKDG  A     ++   L  Q K + D L+ I+ + G       +++   +S    E ++       A VK   +  L+   +R+         + PA   L ++LEN   +  R SGTEPK K YYE+  +  E
  S:    24 LVDSHNTQELEERF-HSRLQFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLIDQVKDAKQRGVVVGYDGRNDSKQFAHDTASVLTALGIKVFL--TSKVAATPIVAFGIKHFNAAGAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAQTIDIAAT--KSIVMMPLDEAEEKGLLVWLEDDYYQTYRNTMNSNKLLSNHTDPSSITIAYTAMHGVGADMAETLLRDAGFNHVFSVAEQREPDGNFP-TVNFPNPEEAGAMDMVEALAASANADIACANDPDADRFALAARKPDGGYKMLTGDQVGTLFGHYLLTHTE-ASGKLVGNTIVSSTLLKKIAESMGAEYFQTLTGFKWLTNVAMQKETKEKQFLFAYEEALGYTIGSQVWDKDGLSALVAFAQLTAELATQGKCVWDQLESIYRQHGIHINAQRSIALNPDSPAIGEHLRANPPTHIAGVKIDVVEDLK-ASLRYLPDGATESIDLPASDVLIYHLENGARIIVRPSGTEPKLKCYYEVVADISE 541
>gi|120599451|ref|YP_964025.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella sp. W3-18-1] >gi|120559544|gb|ABM25471.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella sp. W3-18-1] (573 aa)
Score = 561, Expect = 2.4e-55, Identities = 161/508 (31%), Positives = 264/508 (51%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLEIKGIRWN------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R   + + LI   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        +    D   +SY     +  +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   D+  LE +    +       P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQAQLQTLIDSGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIERAANQAIPFLEHDDAVKQGKLILLQDDFYQSYRHGVQQAEVLQNHTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRRDDGEYQMLTGDQVGVLFGHYLLSHAK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPLKIGELDVLSTDDLKALERRFADGSVEKIDLPPSDVLTYCLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|124547327|ref|ZP_01706258.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella putrefaciens 200] >gi|124509329|gb|EAY53410.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella putrefaciens 200] (573 aa)
Score = 561, Expect = 2.4e-55, Identities = 161/508 (31%), Positives = 264/508 (51%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLEIKGIRWN------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R   + + LI   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        +    D   +SY     +  +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   D+  LE +    +       P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQAQLQTLIDSGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIERAANQAIPFLEHDDAVKQGKLILLQDDFYQSYRHGVQQAEVLQNHTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRRDDGEYQMLTGDQVGVLFGHYLLSHAK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPVKIGELDVLSTDDLKALERRFADGSVEKIDLPPSDVLTYCLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|90578126|ref|ZP_01233937.1| putative phosphomannomutase [Vibrio angustum S14] >gi|90441212|gb|EAS66392.1| putative phosphomannomutase [Vibrio angustum S14] (567 aa)
Score = 560, Expect = 2.6e-55, Identities = 157/508 (30%), Positives = 277/508 (54%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN---KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIY-----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW---------------TGETVSYKIES------LNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE +   +  N+ ++LI   N+ E+   F   +L+FGTAG+R  +G G N++N    Q+ + G+ ++LL    + ++  V++ +D R ++  +A   A  LT+ GIKV+L    ++  TP++++ V+     AA++ TASHNP  Y GFKVY   G QI+  +    A+EI  +     + +      +  L+ + D    E Y++A YR  +NTN         ++  +  T  HG  +     LL   G++++   A Q  PD  F      NPE+  + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G +F +Y+L++   ++   V +T VS++ + +IA    A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L+ +  T+ D L+ I+ E G +                G+T+ ++  +      +   E+ ++ +  F+   +  + G+E+        +  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLERDPDPKTRNELEQLIKDNNQAELTDRFD-GRLAFGTAGLRGVVGAGPNRMNRLVIQETAAGLGQYLLRSVPEGASKGVVIGYDGRPDSQQFAHDTASVLTAQGIKVYL--TVKVAPTPVVAFGVKHLHTAAAVVVTASHNPPQYNGFKVYWENGAQIIPPQDAGIADEIDKATKHELSYLPLEEAVDKGLLVWLD----EDYYQA-YRQTMNTNPLLMNHTNPQSINIAYTAMHGVGAEMAETLLADAGFDHVYSVAAQREPDGTFPTVKFPNPEETGAMDLVIAEAKKHDAVLACANDPDADRFAVAVRRDDGEYQMLTGDQVGTLFGYYLLSHAHANQN-LVGNTIVSSSLLGKIATTLGARYYQTLTGFKWLTNVAMAQQTEEHQFLFAYEEALGYTIGSKVWDKDGLSALVAFAQLTAELHAKGLTIWDQLEAIYREHGLYINAQRSIALDPIAAPIGDTLRHQPPTEIAGLPIVCTEDYKQSLRTFS---DGTVEGIELP------VSDVLIYHLQGGARVIVRPSGTEPKIKCYYEV 535
>gi|68525541|ref|XP_723630.1| hypoxanthine phosphoribosyltransferase [Plasmodium yoelii yoelii str. 17XNL] >gi|23477986|gb|EAA15195.1| hypoxanthine phosphoribosyltransferase, putative [Plasmodium yoelii yoelii] (872 aa)
Score = 559, Expect = 3.4e-55, Identities = 167/520 (32%), Positives = 274/520 (52%)
  Q:    29 ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYF-------DDTITESYFEASYRCL-------INTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN---KKFDKTPFV-VSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID-KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNK----------------DILGLEIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           +S++ +E+I   NEEE++K F   +L+FGTAG+R  MG G N +NV T  Q ++G+  +L+NK       N  +I   D R N++ ++ V A    S G +V+L+   Q  ATPI+ YS  +      ++ TASHNPK   G+K+Y+  G QI+      +  ++  C  I+DN+  P  D+  Y        D ++ E  +   Y           N + YR  +    ++ +  HG     +  +++ +GY N++   QQ +PD +F      NPE+K + +LS++ A+   + +++  DPD+DR A   ++ NKW   +G+++GIIF ++++     K  DK+  V + T V +  +  + +KY      T TGFKW+ N+  ++ D   + +  +EEA+G   +   RDK G  A A  +E+   LY+   T   YL+ I +E G +      Y +   N    + ++     N K +                D    + K +    P +Q +  Y EN   V  R SGTEPK K Y EI  ET E     +  L DE
  S:    25 LSDQTEEVINNYNEEELNKLF-LKRLNFGTAGLRGKMGVGFNAMNVVTIIQTTQGLCEYLINKYGINLCKNRGIIFGFDGRHNSESFSHVAASVCLSKGFRVYLF--GQTVATPILCYSSFKKNCLCGVMITASHNPKIDNGYKLYDENGAQIIPP----VDKNISNC--ILDNL-KPWNDIYEYLNEDFYLKDKSLVEDIYHEMYDMFTSDLKNEFNFSCYRNSRTKLVIVYSPMHGVGRKFVQKIMQIVGYNNLLTVPQQALPDADFPTVTFPNPEEKGALNLSIELADLVNSPLVVANDPDADRFACAEKYNNKWKIFSGDELGIIFAYFIMKQYEKKNIDKSKHVFLCTIVCSRMLKMLCQKYGYMYDETLTGFKWLINKAIEYNDNNYNTLYCYEEALGHALTKHVRDKCGISALAYWVEMAVYLYENNLTFHQYLENIRKEIGYFVSNNGYYTVFDSNDVASIFDEFRSNGNYKQQLASYKILHIRDLTTGYDSQTSDKKSLIAPTPDSQNITLYFENTAIVTIRASGTEPKVKWYGEISRETYEEAKNDIDKLIDE 577
>gi|126173795|ref|YP_001049944.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella baltica OS155] >gi|125997000|gb|ABN61075.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella baltica OS155] (573 aa)
Score = 559, Expect = 3.9e-55, Identities = 160/508 (31%), Positives = 264/508 (51%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLEIKGIRWN------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R   + + LI   +E E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        ++   D   +SY        +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   D+  LE +    +       P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQTQLQTLIDNGSEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIERAANQAIPFLEHDEAVKQGKLTLLQDDFYQSYRHGVQHAEVLQNHTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRRDDGEYQMLTGDQVGVLFGHYLLSHAK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPVKIGEHDVLSTDDLKALERRFADGSVEKIDLPPSDVLTYCLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|15643532|ref|NP_228578.1| phosphomannomutase [Thermotoga maritima MSB8] >gi|4981297|gb|AAD35851.1|AE001746_12 phosphomannomutase [Thermotoga maritima MSB8] (471 aa)
Score = 558, Expect = 4.9e-55, Identities = 152/499 (30%), Positives = 263/499 (52%)
  Q:    56 FGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           FGT GIR  M  G  + +  T ++ S   A WL  +K   +V++A+D R N+  +A +  +     GI+ +++ E     TP++S++VR       ++ TASHNP  Y G+KVY   G Q +    NEI     E    +D  +    + I +    + ESY +A     I +N+  + +  +  +  HGT +  +P +LK +G++ + L  +Q  PDPNF+     NPE+    D +L    K  A + L  DPD DR+ VV + +     LTGNQ+G++ T ++L + K +  P V+ T V+T+ +  I E+  A +  TPTGFK++G+ + +H  K D  FV GFEE+ G L  +  RDKDG   + L+   ++     EK     L+E+++++G +  + +++K E ++   E+      + ++KN D +    KG     P + + +  E    +  R SGTEPK K+Y  + G+T+E  ++++K  + + + +L+
  S:     4 FGTGGIRGVMRKG--EFDEETVKRASLSTALWL-KEKGQKSVVIAYDTRKNSKEFAELAGRVFAGEGIEAYVFPEPT--PTPVLSFAVRYMKTGGGVVITASHNPPEYNGYKVYTWDGVQAIPEYTNEIT----EIYKKVDLSHVKEGE-IKFVPPEVKESYIKAVLE--IVSNLPMKTDLDIAYSPLHGTGANYVPEVLKRLGFK-VRLVEEQMKPDPNFSTVPTPNPEE----DEALVLLNKKGATLGLATDPDCDRVGVVFKGRR----LTGNQVGVLLTDFLLDHVKVE-NPLVIKTIVTTDMVRPICEEKGAFLEETPTGFKFIGHLIEEHTKKGDRNFVFGFEESCGYLAGNHARDKDGVVGSVLSAVAFSNYDPYEK-----LEELYQKYGYYMEKLINFKFEDVDRAVEI------YRSLKNYDGIIDYSKGYGNVIPNETIAFVFEKSR-IFVRPSGTEPKLKVYIHVRGDTREEAEELMKESESKIKEILK 470
>gi|149114391|ref|ZP_01841144.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella baltica OS223] >gi|146865790|gb|EDK51071.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella baltica OS223] (573 aa)
Score = 557, Expect = 6.2e-55, Identities = 161/508 (31%), Positives = 266/508 (52%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R  ++ + L+   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        +    D   +SY     +  +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   D+  LE       ++ I    P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQSQLQNLVDSGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWDNGAQIIPPHDSGIAAQIERAANQVIPFLEHDEAVKQGKLIILQDDFYQSYRHGVQQAEVLQNHTAPEKVSLTYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRRDDGEYQMLTGDQVGVLFGHYLLSHAK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPVKIGEQDVLSTDDLKALERRFADGRVEKIDL-PPSDVLTYCLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|46446896|ref|YP_008261.1| putative phosphoglucomutase/phosphomannomutase [Candidatus Protochlamydia amoebophila UWE25] >gi|46400537|emb|CAF23986.1| putative phosphoglucomutase/phosphomannomutase [Candidatus Protochlamydia amoebophila UWE25] (592 aa)
Score = 556, Expect = 7.2e-55, Identities = 165/524 (31%), Positives = 280/524 (53%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPN-------MD--LISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK---HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKI-ESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-------------WNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE-----------TKEICDQILKALK 546
           WLE         + K+L+L+  +  +D +F+   L+FGT G+R  MG GTN++N +T +  ++G+A ++ NK+ N T     V + +D+R ++  +A   AK L +  I V+L+K+  I+ TP++S++ R     AA++ TASHNP  Y G+KVY   GGQ++    + +++   E   I+D    PN       +D  LI   D+ I E+Y +A         I R++     +  T+ HGT     P  LK  G+ N +    Q +PD  F      NPE+ A+  L ++   + + ++++  DPD+DR+ + V H  +   L GNQ+  +   +V       KK  +    + T  +T     I + Y    F   TGFK++  ++++      +  F+ G EE+ G L     RDKD    +AL  E+      + KTL+D L +++ ++G +  + +S    E+   KE+M   M K  +   K+I G+ +  I                +P     +  L ++L++   V  R SGTEPK KIY  +  +           +K  CDQ+L  +K
  S:    20 WLEGQYDVATKAEIKQLLLEDPKHIVDAFFT--NLTFGTGGLRGIMGVGTNRMNFYTVRAATQGLANYI-NKQPNETQKKRAVFIGYDSRHHSREFAEETAKVLAANKIHVYLFKD--IRPTPLVSFACRYKKCIAAVMITASHNPPEYNGYKVYWSDGGQLVPPHDDGVIA---EASKIVD----PNQVKVCHSLDDLLIEEIDNEIDEAYLKAIRPLQHYPEINRKQGSQLKIAYTSLHGTGITMAPLALKEWGFTNYVFVEPQVIPDGTFPTVRFPNPEEPAALKLGIELMLQSKCDLLIANDPDADRMGIAVLHNGEAVLLNGNQICALLLEHVCEALAKQKKLPEKAAFIKTIGTTELFQAICDAYERPCFNVLTGFKYIAEKIHEWELFKGRHQFIFGGEESYGYLLGTHARDKDAIVCSALISELALKAKLEGKTLLDKLHDLYHKYGIYQEKLLSINFGETKEGKEQMSLGMQKLRSTHLKNICGIPVMVIEDYLLSTKIHLETNQTDPITLPISDVLLYWLKDGTKVMVRPSGTEPKVKIYCGLVEKQFTTIEQGLEISKTRCDQLLNFMK 587
>gi|193808833|emb|CAQ39535.1| Phosphoglucomutase, putative [Plasmodium knowlesi strain H] (593 aa)
Score = 556, Expect = 7.6e-55, Identities = 170/520 (32%), Positives = 273/520 (52%)
  Q:    29 ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL---DSEANE-IVSSMPECQTIID----NVYTPNMDLISYFDDTITESY--FEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN---KKFDKTPFV-VSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID----KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESL------------NWKEEMQEKMDKFANVKN----KDILGLEIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           +S + KE +   NEEE+ + F   +L+FGTAG+R  MG G N +NV T  Q ++G+  +L+N        N  +I   D R +++ +A V A    S G +V+L+   Q  ATPI+ YS  +      ++ TASHNPK   G+KVY   G QI+   D   ++ I+S++     + D    + Y  +  L+   +D   E Y  F A  +   N N +R  +    ++ +  HG     +  ++  +GY N++   QQ +PD +F+     NPE+K S +LS++ A+   + I++  DPD+DR A   +  NKW   +G+++GIIF ++++     K  DK+  V + T V +  + ++ E Y  K   T TGFKW+   +NK ID        +  +EEA+G   +   RDK G  A A  +E+   LY+   T  +YL+ I +E G +      Y +               N   + Q    K  N+++     D    + K +    P +Q +  Y EN   +  R SGTEPK K Y EI   + E   + +  L DE
  S:    25 LSEETKEALSTYNEEELKRLF-LRRLNFGTAGLRGKMGVGFNAMNVVTIMQTTQGLCTYLINTYGVNLCKNRGIIFGFDGRYHSESFAHVAASVCLSRGFRVYLF--GQTVATPILCYSSFKKSCLCGVMVTASHNPKLDNGYKVYAANGAQIIPPVDKNISDCILSNLKPWTEVYDYLDEDFYLKDTSLV---EDIYYEMYDAFMADMKSEFNFNCHRNSRTKLVIVYSPMHGIGRKFVQGVMHIVGYNNLLTVPQQALPDADFSTVTFPNPEEKGSLNLSMQLADVVNSPIVVANDPDADRFACAEKFNNKWKIFSGDELGIIFAYHLMKQNEKKNIDKSKHVFICTVVCSRMLKKLCEMYGYKYEETLTGFKWL---INKAIDLSEKNYTTLYCYEEALGHALTKYVRDKCGISALAYWIEIAVYLYENGLTFHEYLENIRKEIGYFVSNNGYYTVLDPTDVVSIFNDFRGNGSYKNQLGSYKIVNIRDLTTGYDSTTADGKSLIAPTPDSQNITLYFENTAVLTIRASGTEPKVKWYSEISRGSYEAAKKEIDQLVDE 577
>gi|42518787|ref|NP_964717.1| phosphomannomutase [Lactobacillus johnsonii NCC 533] >gi|41583073|gb|AAS08683.1| probable phosphomannomutase [Lactobacillus johnsonii NCC 533] (574 aa)
Score = 556, Expect = 7.6e-55, Identities = 159/540 (29%), Positives = 281/540 (52%)
  Q:    15 NVNPLSKAWLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-----ISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPF----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE-----------------WYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           N   +   W  +N + +  K+ +  L  +E+ I+  F    ++FGTAG+R  + PGTN+IN+FT  +++EG+AR L+++         V ++ D+R ++  +A   A+ L + GI V+L+  + ++ TP +S++VR     A I  TASHN K Y G+KVY   G Q+    A+ + +   +   I      P  +L     +    + + E+Y        ++  + +       +I T  HGT         +  G++N+I    Q + DP F  +   NPE +  F+   K A +  AN+++  DPD+DR+   VR  +  +  LTGNQ+  +  +Y+L + K + T      +V++ VS+    +IA+ +  K     TGFK++G E   MNK  D   F++GFEE+ G L     RDKD  Q A +  EV +    +  T+ D L EI++++G     T + ++  +  +++M E M K       +I   ++  I+  E  + +E                 ++L+++ WV  R SGTEP  K Y  +  +  E  ++  +  +D    +L+
  S:     2 NAKEIYSQWTNANNLPDYLKDQLNDLGKDEKWIEDAFG-QDINFGTAGMRGRLEPGTNRINLFTVGRVTEGLAR-LIDENGEEAKKRGVAISFDSRYHSREFAEHAARILGAHGIHVYLF--DDLRPTPELSFAVRHLNTFAGINITASHNAKQYNGYKVYGEDGAQMAPENADRLFAYAQKVDDIFSVKAAPVEELRANGTLQLIGEDVDEAYLARLKDVTVDPEMVKANADKLKIIYTPLHGTGKMLYDRAFRQGGFDNVIPVPSQSIIDPEFPTTIKPNPEYRDVFEPGFKLANEVDANVIIATDPDADRMGAAVRKSDGDFQVLTGNQIATLMAYYLLVHMKENGTLSSDYELVTSVVSSALPFKIADDFGIKTKHVLTGFKYIGEEVDRMNKE-DDGKFLMGFEESYGYLFKPFARDKDAMQGALMFAEVASYYASKGMTVFDGLQEIWQKYGVAYEITKAIEMPGIGGQKKMAELMSKLRKEHLTEINDAKVVKIQDFETQETIEDGKKTPLTGFPKSNVLKYFLDDETWVALRPSGTEPVIKAYVGVNKKDIETAEKAAEEYQDALANILK 574
>gi|24373322|ref|NP_717365.1| phosphoglucomutase/phosphomannomutase family protein [Shewanella oneidensis MR-1] >gi|24347572|gb|AAN54809.1|AE015620_1 phosphoglucomutase/phosphomannomutase family protein [Shewanella oneidensis MR-1] (573 aa)
Score = 556, Expect = 8.2e-55, Identities = 164/508 (32%), Positives = 272/508 (53%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTI--------TESYFEASYRCLINTNIYRQKNFP----VILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEE--FGAWTGETVSYKIESLNWKEEMQE----KMDKFANVKNKDILGL-------EIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL+++       + + LI   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV L    ++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+    + I + + +  T       P M+L    DD I         + Y+E   R +++  + +    P    +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++   D+   V +T VS++ + +IA  +  + + T TGFKW+ N  + +      F+  +EEA+G    ++  DKDG  A     ++   L  + +T+ D L++I+ E  F      +++ K E+ N    ++E     + + A V   D+  L       +++ I  N PA   L + L N   V  R SGTEPK K YYE+
  S:    12 WLKNDPDPSTQAQLQALIDSGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLEQIHDVAERGVVIGYDGRHDSYTFAHDTASVLTAMGIKVRLTA--KVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAKIEQAAT----QAIPFMEL----DDAIKQGKLIWLNDDYYETYRRGVMHAKVLQNHTAPEKVSLAYTAMHGVGADMAETVLKDAGFTQVYSVAAQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHSAMLACANDPDADRFAVAVRKDDGEYQMLTGDQVGVLFGHYLLSHASADQR-LVGTTIVSSSLLSKIANGFGVESYTTLTGFKWLMNVGIAQSQPDNQFLFAYEEALGYTVGNMVWDKDGLSALVAFAQLTAELAAKGQTIWDRLEQIYREQGFHLNAQASIALKPETPNIGAYLREHPPLTIGEHAVVSTDDLKALSRRFADGKVENI--NLPASDVLTYRLSNGARVIVRPSGTEPKIKCYYEV 539
>gi|160874707|ref|YP_001554023.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella baltica OS195] >gi|160860229|gb|ABX48763.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella baltica OS195] (573 aa)
Score = 555, Expect = 1.0e-54, Identities = 161/508 (31%), Positives = 265/508 (52%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLE-------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R  ++ + L+   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        +    D   +SY        +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   D+  LE       ++ I    P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQSQLQTLVDSGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWDNGAQIIPPHDSGIAAQIERAANQVIPFLEHDEAVKQGKLIILQDDFYQSYRHGVQHAEVLQNHTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRRDDGEYQMLTGDQVGVLFGHYLLSHAK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPVKIGEQDVLSTDDLKALERRFADGRVEKIDL-PPSDVLTYRLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|127513472|ref|YP_001094669.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella loihica PV-4] >gi|126638767|gb|ABO24410.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella loihica PV-4] (584 aa)
Score = 555, Expect = 1.1e-54, Identities = 174/543 (32%), Positives = 282/543 (51%)
  Q:    12 MHANVNPLSKAWLESNRISNKYKE---LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQI-----------LDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVIL----TTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH---------KNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF--------ANVKNKDI-LGLEIKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIYYEI---YGETKEICDQILKALKDEFEYMLR 554
           M   +    K WL  +  +    E   L+ +  +EE+   F+  +L+FGTAGIR  +G G  ++N    QQ S+GVA +L  +  N     V++ +D R ++  +A   A  LT+ G KVFL   +++  TP++++ V   G  A I+ TASHNP  Y G+KVY   G QI           ++  AN  V  +P  +T ++   T  + ++        E Y++A  + ++N  + +    P ++    T  HG  +     LLK IG   +   A Q  PD +F  + NF NPE+  +  L +  A K+ A +    DPD+DR AV VR             +  LTG+Q+G++  HY+L++   D+   +  T VS++ + RI+E   A+   T TGFKW+ N  M+K   +  F+  +EEA+G     +  DKDG  A    +++   L  + +TL D L+ I+ ++G +    VS  +        + E++           A V   DI LG+        E      +  L + L+ +  V  R SGTEPK K YYE+   +GE + + D   +A     E++ R
  S:     1 MQTQIQARIKHWLSLDSDAKSRAEIQALVDQGAQEELVARFA-GRLTFGTAGIRGVVGAGPMRMNRLVVQQTSKGVAEYLKAQVENAVSRGVVIGYDGRHDSKQFAEDAASVLTAAGFKVFL--TSKVAPTPLVAFGVLHLGAAAGIVVTASHNPPQYNGYKVYWGNGAQIIPPHDTGIAARIELAANSPVDMLP-LETAVE---TGKLVMLE-------EDYYQAYRQGVLNAEVLQSPARPELVSLAYTAMHGVGAEMAETLLKDIGVTQVYSVAAQREPDGDFP-TVNFPNPEEAGAMVLVMAEAHKHGAMLACANDPDADRFAVAVRKPAATPEMLASEAYQMLTGDQVGVLLGHYLLSHASDDQR-LLCCTIVSSSLLTRISEACGARCETTLTGFKWLTNVGMSKQTQENRFLFAYEEALGYTVGSMVWDKDGLSALVAFVQLTAELAAKGETLWDRLETIYRQYGYYLNRQVSIALSGEPGAPTIGEQLRALDPSEIAGRALVSVDDISLGVRRFADGREETIDLPRSDVLIYRLQGNARVIVRPSGTEPKVKCYYEVVEPFGEQEGLADVQRRAEAAMAEFVSR 576
>gi|145640824|ref|ZP_01796406.1| phosphomannomutase [Haemophilus influenzae R3021] >gi|145274338|gb|EDK14202.1| phosphomannomutase [Haemophilus influenzae 22.4-21] (550 aa)
Score = 554, Expect = 1.3e-54, Identities = 165/516 (31%), Positives = 256/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G   +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     EI +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y + +G+  +  D+IL    +   ++LR
  S:    36 KAAEAELHARFD-GRLQFGTAGLRGRLQAGLMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKEIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGRFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDVQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNKPPAEISGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDAHGKDPKDADRILAEFDEGVRHILR 541
>gi|146292554|ref|YP_001182978.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella putrefaciens CN-32] >gi|145564244|gb|ABP75179.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella putrefaciens CN-32] (573 aa)
Score = 554, Expect = 1.5e-54, Identities = 159/508 (31%), Positives = 264/508 (51%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD----FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQE----KMDKFANVKNKDILGLEIKGIRWN------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WLE++   R   + + LI   NE E+   F+  +L FGTAG+R  +G G   +N    +Q S G+  +LL++  +     V++ +D R ++  +A   A  LT+ GIKV L   +++  TP++++ V+     A I+ TASHNP  Y G+KVY   G QI+       A +I  +  +    +++        +    D   +SY     +  +  N    +   +  T  HG  +     +LK  G+  +   A Q  PD +F  + NF NPE++ + DL +  A+K+ A +    DPD+DR AV VR  + ++  LTG+Q+G++F HY+L++ K D      +T VS++ + +IA+ +  + F T TGFKW+   MN  I K      F+  +EEA+G     +  DKDG  A     ++   L  + +T+ D L++I+ E G      VS   K ++ N    ++E    K+ +   +   ++  LE +    +       P+  L + L     V  R SGTEPK K YYE+
  S:    12 WLENDPDPRTQAQLQTLIDSGNEAELAARFA-GRLEFGTAGLRGVVGAGPMGMNRLVIRQTSAGLGAYLLDQIKDAAERGVVIGYDGRHDSFNFAHDAASVLTAMGIKVRL--TSKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAQIERAANQAIPFLEHDDAVKQGKLILLQDDFYQSYRHGVQQAEVLQNHTAPEKVSLAYTAMHGVGAEMAETVLKDAGFTQVYSVASQREPDGDFP-TVNFPNPEERGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRRDDGEYQMLTGDQVGVLFGHYLLSHSK-DNQRLTGTTIVSSSLLSKIAQGFGTQSFTTLTGFKWL---MNVGIAKTSPEDQFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELVAKGQTIWDRLEQIYREHGFHLNAQVSIALKPDTPNIGAYLREHPPLKIGELDVLSTDNLKALERRFADGSVEKIDLPPSDVLTYCLAGGARVIVRPSGTEPKIKCYYEV 539
>gi|90411211|ref|ZP_01219224.1| putative phosphomannomutase [Photobacterium profundum 3TCK] >gi|90328057|gb|EAS44378.1| putative phosphomannomutase [Photobacterium profundum 3TCK] (569 aa)
Score = 554, Expect = 1.6e-54, Identities = 157/508 (30%), Positives = 269/508 (52%)
  Q:    23 WLESNRISNKYKEL---ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIG-SLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL-EIKG----------IRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   N   EL   I      E++  F+  +L FGTAG+R  +G G N++N    Q+ + G+A +L  ++ +     V++ +D R ++  +A   A  LT+ GIKV+L    ++ ATP++++ V+  G  A I+ TASHNP  Y GFKVY   G QI+       A EI  +  +   ++D        L+ + DD   + Y        + +N  +     +  T  HG  +     LL   G+ ++   A Q  PD  F  + NF NPE+  + D+ +  A+K+ A +    DPD+DR AV V+  N ++  LTG+Q+G++F HY+L++ K ++   V +T VS++ +++IA+   A  ++T TGFKW+ N  M +  +   F+  +EEA+G ++ S++  DKDG  A     ++   L    +T+ D L+ I+ E G +     S  ++        + + +    +  + +L   ++K           +  + PA   L ++L++   V  R SGTEPK K YYE+
  S:     8 WLSRDPDPNTRDELQRLIDSQESAELEDRFN-GRLEFGTAGLRGIVGAGPNRMNRLVIQETAIGLAHYLKAQQHDAEFRGVVIGYDGRPDSKQFACDAASALTAHGIKVYL--TVRVAATPLVAFGVKHLGTAAGIVVTASHNPPAYNGFKVYWGNGAQIIPPHDSGIAAEIDLAAQKELHLMDLEIAHQQGLLVWLDDDFYQEYRRTMNENPLLSNNTQPDGISLAYTAMHGVGANMAETLLHDAGFNHVYSVAAQREPDGAFP-TVNFPNPEEPGAMDMVIAEAKKHGATLACANDPDADRFAVAVQLDNSEYKMLTGDQVGVLFGHYLLSHAKAEQN-LVGATIVSSSLLEQIAKSAGANFYQTLTGFKWLTNVGMQQETETSQFLFAYEEALGYTVGSEVW-DKDGLSALVAFAQLTAELASNGQTIWDQLEAIYREHGLYLNAQRSIALDPAAAPIGDKLRANPIMQIAGQTVLQTDDLKSSKRTFQDGTVVNIDLPASDVLIYHLDSGARVVVRPSGTEPKLKCYYEV 535
>gi|33152559|ref|NP_873912.1| phosphomannomutase [Haemophilus ducreyi 35000HP] >gi|33148783|gb|AAP96301.1| probable phosphomannomutase [Haemophilus ducreyi 35000HP] (553 aa)
Score = 553, Expect = 1.7e-54, Identities = 158/502 (31%), Positives = 256/502 (50%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS------YFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD---KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGET-KEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G   +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +        ID V T N+  ++        DD +  +Y E + R L   N   +     + T  HG     L   LK  G     L ++Q  PD NF   +  NPE+K + DL++K A++  A  ++  DPD+DRLAV +   +  W  L GN +G +   ++   KK+    +   +  + VS+  +  IA+KY  K   T TGFK++G      +D + F  GFEEAIG L + D  RDKDG  AA   L++   L  Q KT++DY++E  ++FGA+    +S ++  L    E+ + M    N     I G+++  +    + +  +  L + L N   +  R SGTEPK K Y ++ G   ++  ++ L    +    MLR
  S:    49 RLQFGTAGLRGPLQAGPMGMNRVLVAQAAAGLALYLKTYDKQPSIVIGYDGRKNSDVFARDTAEIMAGVGIKAYLLPRKL--PTPVLAYAIKHLDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADQQIAA-------FIDQVATGNIRELARSQDFNLLDDEVINAYIEKTAR-LSQEN---KMALNYVYTAMHGVGYEVLQKTLKQAGLSQPKLVSEQIEPDGNFPTVSFPNPEEKGALDLAIKLAQQENAEFIIANDPDADRLAVAIPDAQGIWKSLHGNVLGCLLGWHLA--KKYHAQGQQGVLACSLVSSPALAEIAKKYGLKSEETLTGFKYIGK-----VDNLLF--GFEEAIGYLVDPDKVRDKDGISAAVAFLDLVLYLKKQGKTILDYINEFNQQFGAYISGQISIRVSDL---AEISKLMTALRNNPPTKIGGVKVTQLIDHTKTDRQSDILVFNLANGSRLITRPSGTEPKIKFYLDVKGNNGQQEAERALAHFDESVRQMLR 544
>gi|30995397|ref|NP_438900.2| phosphomannomutase [Haemophilus influenzae Rd KW20] (550 aa)
Score = 550, Expect = 3.7e-54, Identities = 163/516 (31%), Positives = 257/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY+ +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D++L    +   ++LR
  S:    36 KAAEAELHARFD-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYSFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADRVLAEFDEGVRHILR 541
>gi|115373683|ref|ZP_01460977.1| phosphoglucomutase/phosphomannomutase, C-terminal domain family [Stigmatella aurantiaca DW4/3-1] >gi|115369230|gb|EAU68171.1| phosphoglucomutase/phosphomannomutase, C-terminal domain family [Stigmatella aurantiaca DW4/3-1] (575 aa)
Score = 550, Expect = 4.2e-54, Identities = 149/511 (29%), Positives = 260/511 (50%)
  Q:    20 SKAWLESNRISNKYKEL---ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD-----LISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNE-------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           ++AW +++   +  +EL   + + N  ++   F+   L FGTAG+R  +G G N++N    ++ S G+AR+L   + +  +  V++  D R  +  +A   A  L + GI   ++    +  TP+ +++    G  AA++ TASHNP  Y G+KVY   G QI+      I +++   +        P  +     L     +++ E+Y EA    ++   ++ +  +   V+ T  HG     +   +K+ G+      A+Q  PD  F      NPE+  + DLS+  AE+++A+++L  DPD+DRLAV+ R K+      TGN++G++  HY+LT       P V +T VS+  + +IA +  A      TGFKW+ N     +H +   FV G+EEA+G     + RDKDG  AA +  ++      +  T+V YL+EI    G + G   ++        + +   M+ F     K +    ++ ++  +       P+  + + LE    V  R SGTEPK K Y+E+
  S:    10 AEAWRKADPDPSTAEELGRVLAENNAADLADRFA-GNLEFGTAGLRGVLGAGPNRMNRAVVRRTSAGLARYLKAQVPEAVSRGVVIGRDGRRMSAEFAEDTACVLAAEGIPALVFP--GLVPTPLTAFATLRLGACAAVMVTASHNPPEYNGYKVYWGNGAQIVPPHDQGIAAAIDAVEPANQVRLLPPAEARARGLWRDIPESMGEAYLEA----ILGLRLHGRGAEALSVVYTAMHGVGGVWMERAMKAAGFSRFHPVAEQQQPDGTFPSVRFPNPEEPGAMDLSIAAAERHKADLVLANDPDADRLAVMARDKDGALRMFTGNEVGVLLGHYLLTQGPKQAKPHVATTIVSSVQLGQIAHELGAAFDEVLTGFKWIANRALEREHSEGTRFVFGYEEALGYTVGSVVRDKDGVSAALVFADLAAWCQSRGVTVVGYLEEIQRRHGLFVGAQRNFTFPGSEGAQTIARIMEGFRREPPKRVGAYAVQTVKDYKTGALRLPPSNVIAFELEGGGRVTLRPSGTEPKIKYYFEL 536
>gi|145637721|ref|ZP_01793373.1| export protein SecB [Haemophilus influenzae PittHH] >gi|145269070|gb|EDK09021.1| export protein SecB [Haemophilus influenzae PittHH] (550 aa)
Score = 550, Expect = 4.4e-54, Identities = 163/516 (31%), Positives = 256/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D++L    +   ++LR
  S:    36 KAAETELHARFD-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDEQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADRVLAEFDEGVRHILR 541
>gi|157962548|ref|YP_001502582.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella pealeana ATCC 700345] >gi|157847548|gb|ABV88047.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella pealeana ATCC 700345] (577 aa)
Score = 550, Expect = 4.6e-54, Identities = 155/510 (30%), Positives = 261/510 (51%)
  Q:    21 KAWLESNR---ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT-IIDNVYTPNMDL---ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE--IKGIRWNEPAQA--------------LEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           K W+ S+    +  + + L+   +  E++  F+  +L+FGTAG+R  +G G  ++N    QQ S G+  +L  + S+     V++ +D R ++  +A   A  LT+ GIKV+L     + ATP++++ V   G  A I+ TASHNP  Y G+KVY   G QI+    + I + + +  T +I  +  P       +   ++   ++Y +      +  N  + +   +  T  HG  +     +LK  G+  +   A+Q  PD +F  + NF NPE+K + D+ +  A+K+ A +    DPD+DR AV VR     +  LTG+Q+G++F HY+LT+   +      +T VS++ + ++A+  NA    T TGFKW+ N  M++  D   F+  +EEA+G     +  DKDG  A     ++   L  Q +T+ D L+ I+ E G      VS  ++          + +    +    +L  +    G R+     A              L + L+N   V  R SGTEPK K YYE+
  S:    10 KHWMASDPDPLMRQQLQTLLNSGDSAELEGRFA-GRLAFGTAGLRGVVGAGPTRMNRLVVQQTSAGLGAYLKAQISDVATRGVVIGYDGRHDSKQFAHDAASVLTAMGIKVYLTA--NVAATPLVAFGVLHLGTAAGIVVTASHNPPQYNGYKVYWGNGAQIIPPHDSGIAACIDKAATQVIPLLEMPQAKASGQLVMLEEDFYDAYRQGVKLAPVLQNHTQPEAVSLAYTAMHGVGNQMALDVLKDAGFTKVYSVAEQAQPDGDFP-TVNFPNPEEKGAMDMVMAEAKKHGAMLACANDPDADRFAVAVRTDSGDYQMLTGDQVGVLFGHYLLTHAS-ENQRLTCTTIVSSSLLSKVAQSLNATCRTTLTGFKWLTNVGMSEETDSNRFLFAYEEALGYTVGSMVWDKDGLSALVAFAQLTAELASQGQTIWDRLEAIYREHGFHINAQVSIALKPTTPNIGAYLRANPPTEIAGHKVLSTDDISLGKRFFFEGSADGTQEDIALPASDVLIYRLKNGARVIVRPSGTEPKIKCYYEV 543
>gi|166154506|ref|YP_001654624.1| phosphoglucomutase [Chlamydia trachomatis 434/Bu] >gi|165930494|emb|CAP03987.1| phosphoglucomutase [Chlamydia trachomatis 434/Bu] (593 aa)
Score = 549, Expect = 5.0e-54, Identities = 161/509 (31%), Positives = 274/509 (53%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTH---HGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA-------NVKNKDILGLE----------IKGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +WLE     +     +L  + E + + FS + L+FGTAG+R  MG GTN++NVFT ++ ++G+AR L  K+  P    +V++ +D R ++  +    AK L   GI  +L++  +  A  ++SYSVRE    A ++ TASHNP  Y G+KVY  TGGQ+L     EI+    + + +  ++++  P + +I   +D   E+Y+E +   L       +++  ++  ++   HGT    +P +LK  G+ ++ L  +Q VPD +F      NPED  +  L ++   + + ++ +  DPDSDR+ VV   K   +   GNQ+  +   ++L+ K+  K P      VV + V+T  +  I+E Y A +     GFK++G ++      M+ F+ G EE+ G L      DKD   AA L  E       +  TL D L E++E +G +   T S  +  ++  +  QE +D++        ++ ++ ++  E          +  I +         L +Y E D  V  R SGTEPK K+Y+EI
  S:    22 SWLEDVVCDHTSVLTLLDNDPERLRELFSET-LTFGTAGLRGLMGIGTNRLNVFTIRRATQGLARVL--KRRYPDEKISVVIGYDTRHDSFEFGQETAKVLAGNGILAYLFQIPEPLA--LVSYSVRELQAKAGVMITASHNPPAYNGYKVYMSTGGQVLPPMDQEIMEEFQKVEMVSAVESLDHPYIRMIQ--EDM--ENYYEETLHKLQLCEEDNRRHGSLLRISYSPLHGTGVTMIPRILKDWGFSSVSLVEKQMVPDGDFPTVVLPNPEDPEALVLGIQQMVEQKDDLFIATDPDSDRIGVVSLEKEGPYRFNGNQIACLLAAHILS-KESQKAPLGAEDKVVKSLVTTELLTAISESYGANIVNVGAGFKYIGEKIELWRSGMERFIFGAEESYGYLYGSYVEDKDAMIAAVLISEAALQQKIRGCTLRDALLELYEVYGYYANRTESIDL-PIDQPQRKQELLDRWETQDPLRMSLSSRKLIAFENYNTGEGRDLVTDITYKLSLPKMSMLCFYYEGDCRVIVRPSGTEPKMKLYFEI 554
>gi|145634847|ref|ZP_01790555.1| export protein SecB [Haemophilus influenzae PittAA] >gi|145268013|gb|EDK08009.1| export protein SecB [Haemophilus influenzae PittAA] (550 aa)
Score = 549, Expect = 5.2e-54, Identities = 164/516 (31%), Positives = 256/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F  S+L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D +L    +   ++LR
  S:    36 KAAEAELHARFD-SRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDEQGTWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPLAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADCVLAEFDEGVRHILR 541
>gi|46128873|ref|ZP_00154500.2| COG1109: Phosphomannomutase [Haemophilus influenzae R2846] (550 aa)
Score = 549, Expect = 5.8e-54, Identities = 163/516 (31%), Positives = 256/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D++L    +   ++LR
  S:    36 KAAEAELHARFD-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADRVLAEFDEGVRHILR 541
>gi|148827931|ref|YP_001292684.1| phosphomannomutase [Haemophilus influenzae PittGG] >gi|148719173|gb|ABR00301.1| phosphomannomutase [Haemophilus influenzae PittGG] (550 aa)
Score = 548, Expect = 6.3e-54, Identities = 163/516 (31%), Positives = 256/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D++L    +   ++LR
  S:    36 KAAEAELHVRFD-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGRFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVFG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSELS---EIGKLMTALRNNPPAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADRVLAEFDEGVRHILR 541
>gi|166155381|ref|YP_001653636.1| phosphoglucomutase [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165931369|emb|CAP06941.1| phosphoglucomutase [Chlamydia trachomatis L2b/UCH-1/proctitis] (593 aa)
Score = 548, Expect = 6.4e-54, Identities = 161/509 (31%), Positives = 274/509 (53%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTH---HGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA-------NVKNKDILGLE----------IKGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +WLE     +     +L  + E + + FS + L+FGTAG+R  MG GTN++NVFT ++ ++G+AR L  K+  P    +V++ +D R ++  +    AK L   GI  +L++  +  A  ++SYSVRE    A ++ TASHNP  Y G+KVY  TGGQ+L     EI+    + + +  ++++  P + +I   +D   E+Y+E +   L       +++  ++  ++   HGT    +P +LK  G+ ++ L  +Q VPD +F      NPED  +  L ++   + + ++ +  DPDSDR+ VV   K   +   GNQ+  +   ++L+ K+  K P      VV + V+T  +  I+E Y A +     GFK++G ++      M+ F+ G EE+ G L      DKD   AA L  E       +  TL D L E++E +G +   T S  +  ++  +  QE +D++        ++ ++ ++  E          +  I +         L +Y E D  V  R SGTEPK K+Y+EI
  S:    22 SWLEDVVCDHTSVLTLLDNDPERLRELFSET-LTFGTAGLRGLMGIGTNRLNVFTIRRATQGLARVL--KRRYPDEKISVVIGYDTRHDSFEFGQETAKVLAGNGILAYLFQIPEPLA--LVSYSVRELQAKAGVMITASHNPPAYNGYKVYMSTGGQVLPPMDQEIMEEFQKVEMVSAVESLDHPYIRMIQ--EDM--ENYYEETLHKLQLCEEDNRRHGSLLRISYSPLHGTGVTMIPRILKDWGFSSVSLVEKQMVPDGDFPTVVLPNPEDPEALVLGIQQMVEQKDDLFIATDPDSDRIGVVSLEKEGPYRFNGNQIACLLAAHILS-KESQKAPLGAEDKVVKSLVTTELLTAISESYGANIVNVGAGFKYIGEKIELWRSGMERFIFGAEESYGYLYGSYVEDKDAMIAAVLISEAALQQKIRGCTLRDALLELYEVYGYYANRTESIDL-PIDQPQRKQELLDRWETQDPLRMSLSSRKLIAFENYNTGEGRDLVTDITYKLSLPKMSMLCFYYEGDCRVIVRPSGTEPKMKLYFEI 554
>gi|114563330|ref|YP_750843.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella frigidimarina NCIMB 400] >gi|114334623|gb|ABI72005.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella frigidimarina NCIMB 400] (573 aa)
Score = 548, Expect = 6.4e-54, Identities = 156/508 (30%), Positives = 264/508 (51%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFL-YKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT------IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIES------LNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPA------QALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL ++      ++ + LI   NE E+   F+  +L+FGTAG+R  +G G   +N    +Q + G+  +LL +  N     V++ +D R ++  +A   A  LT+ GI V L YK   + ATP++++ V+     A I+ TASHNP  Y G+KVY   G QI+      I + +    T       +D+  +   D +++  D   ++Y +             Q    +  T  HG  +     +L   G+  +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV  R +N  +  LTG+Q+G++F HY+L++   ++     +T VS++ + +IA ++ ++ + T TGFKW+ N  + KH     F+  +EEA+G    ++  DKDG  A     ++   L D  +T+ D L++I+ + G    + VS  + +         +E    K+ ++A +   D+  L+      ++ A        L + LE    V  R SGTEPK K YYE+
  S:    12 WLNNDPDPHTRSQLQTLIDNGNETELAARFA-GRLAFGTAGLRGEVGVGPMAMNRLVIRQTTVGLGAYLLEQIDNAAERGVVIGYDGRHDSFTFAHDAASVLTAMGINVHLTYK---VAATPLVAFGVKHLNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDTGIAAQITRAATQAIPFLALDDAIS--QDKLTWLQDDFYQAYRQGIREAKELQYHSGQDKVSLAYTAMHGVGADMAETVLNDAGFTQVYSVAAQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHHATLACANDPDADRFAVAARTENGDYQMLTGDQVGVLFGHYLLSHAPKNQQ-LTGTTIVSSSLLSKIATEFGSQSYTTLTGFKWLMNVGIAKHQADNQFLFAYEEALGYTIGNLVWDKDGLSALVAFAQLTAELADNGQTIWDKLEQIYRQHGFHLNKQVSIALNADTPNIGAYLREHPPVKIGEYAVISTDDLKSLQRTDADGSKQAIDLPSSDVLIYALEGGARVIVRPSGTEPKIKCYYEV 539
>gi|146297878|ref|YP_001192469.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Flavobacterium johnsoniae UW101] >gi|146152296|gb|ABQ03150.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Flavobacterium johnsoniae UW101] (575 aa)
Score = 547, Expect = 8.7e-54, Identities = 161/506 (31%), Positives = 271/506 (53%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP--TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNV-YTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALE------------------WYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICD 539
           KEL +  + +++++ F Y  L FGT G+R  MG G N+IN +T  + ++G++ +L     N    V++A+D R N++  A V+A   ++ GI+V+L+ +  ++ TP +S++++  G    I+ TASHNP  Y G+KVY   GGQI+  +  EIV+ +       D + +  N  LI Y D  + +++ ++S      NT    + N  ++ T+ HGT+   +P +L   GY+N+ +  +Q VPD +F    + NPE+  +  ++L  A+K  ++I++G DPD DRL V VR+ + K   L GNQ  ++ T ++L       K +   FV ST VST  +  +A  Y  +     TGFKW+  +M K   +++F+ G EE+ G +  D  RDKD   A  L  EV         ++   L +++ E G +    VS   + +   EE+ + M        K+I G  +  +   + + AL                   +Y E+   +  R SGTEPK K Y  +  E + + D
  S:    28 KEL-MTTSPKDLEESF-YKNLEFGTGGMRGVMGVGNNRINKYTLGKNTQGLSDYLHQVFPNEPLKVVIAYDCRHNSNTLAKVVADVFSANGIQVYLFSD--LRPTPELSFALKYLGCQCGIVLTASHNPPEYNGYKVYWQDGGQIVPPQDKEIVNVIESLG--YDKIKFNANESLIQYIDTELDKAFIKSSIENASFNTPAEAKDNLHIVFTSLHGTSIKSIPDVLSQAGYKNVHIVPEQAVPDGDFPTVKSPNPEEPEALTMALALADKTNSDIVVGTDPDCDRLGVAVRNNDGKMILLNGNQTMVLMTSFLLKQWKKAGKINGKQFVGSTIVSTPMMMELATSYGVECKVGLTGFKWIA-KMIKDFPELEFIGGGEESFGFMVGDAVRDKDAVAATLLICEVAAQAKAAGSSVYKELLQLYVENGFYKEFLVSLTKKGMEGLEEINQMMVNLRQNPLKEINGQRVIMVEDYQSSTALNLLTNEESSMDIPKSNVLIYYTEDGSKICARPSGTEPKIKFYISVNAELESVLD 553
>gi|194538136|ref|YP_002073274.1| phosphomannomutase, putative [Vibrio cholerae V51] >gi|125622750|gb|EAZ51068.1| phosphomannomutase, putative [Vibrio cholerae V51] (567 aa)
Score = 547, Expect = 8.9e-54, Identities = 153/508 (30%), Positives = 260/508 (51%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+ ++L+ +  +     +++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  I  +     +   L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL  +G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G       S  ++            DK      KDI G ++      K +R               +  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGQYLITQLPDAKKRGIVIGYDGRPDSQQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVITASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQAIPYLALEQAEQQGLLHWLRDEYYQTYRKTIGASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADVGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQRSIALDP-----NSPPVGDKLRATPPKDIAGRKVLIVEDFKLVRRTFADGKTETITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|15602939|ref|NP_246011.1| YhxB [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721411|gb|AAK03158.1| YhxB [Pasteurella multocida subsp. multocida str. Pm70] (551 aa)
Score = 546, Expect = 1.1e-53, Identities = 164/536 (30%), Positives = 263/536 (49%)
  Q:    19 LSKAWLESNRISNKYKELILKMN---------EEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVS-TFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           L++ WL  +     + EL   ++           E++  F   +L FGTAG+R  +  G   +N     Q + G+A +L +    P++++ +D R N+D +A   A+ +   GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I         +ID V        P        DD + ++Y   +           Q +   + T  HG     L   L   G     L A+Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G     Y+           +++ + VS+  +  IA+KY  +   T TGFK++G      +D + F  GFEEA+G L + D  RDKDG  AA   L++   L  Q KTL DY DE  +EFGA+    +S +++ L+   E+ + M         DI G ++       + +  +  L + LEN   +  R SGTEPK K Y +  G+  +  +Q+L    +   ++LR
  S:     6 LAQHWLAQDPDPETHAELTALLDAAKTGDAKASTELNARFD-GRLQFGTAGLRGRLQAGPMGMNRVLVAQAAGGLADYLKDYDKTPSIVIGYDGRKNSDVFARDTAEIMAGAGIKAYLLPRKL--PTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADQDIAK-------LIDKVAAGSIKDLPRSQDFIVLDDEVVDAYIAKTASLAKEP----QTDINYVYTAMHGVGYEVLSKTLAKAGLPQPHLVAEQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAEGNWKPLHGNVVGCFLGWYLAKQYHAQGQKGILACSLVSSPALAEIAKKYGFQSEETLTGFKYIGK-----VDGLLF--GFEEALGYLVDPDKVRDKDGISAAISFLDLVRYLKKQGKTLADYADEFTQEFGAYVSGQISIRVDDLS---EIGKLMSALRQNPPSDIGGFKVAQFLDHTKTDRQSDILVFVLENGSRLIVRPSGTEPKIKFYLDAKGKDPKDAEQVLAQFDESVRHILR 542
>gi|91793321|ref|YP_562972.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella denitrificans OS217] >gi|91715323|gb|ABE55249.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella denitrificans OS217] (582 aa)
Score = 546, Expect = 1.3e-53, Identities = 161/495 (32%), Positives = 258/495 (52%)
  Q:    36 LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVS--------SMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQK----------NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE-MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE------SLNWKEEMQEKMDKFANVKNKDILGLEIK---GIR--WNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           LI + +E +I   FS  +L FGTAGIR  +GPG   +N    +Q + G+  +L   + +     V++ +D R ++  +A   A  LT  G KVFL    ++ ATP++++ V+  G  A I+ TASHNP  Y G+KVY H G QI+      I +        ++P C+ +ID       + + +  D   ESY    Y   ++   + + +          N  +  T  HG  +     +LK  G+  +   A Q  PD NF  + NF NPE+  + DL +  A++++A +    DPD+DR AV VR  +  +  LTG+Q+G++  HY+L++   D+   V  T VS++ + +IA  ++A  + T TGFKW+ NE +        F+  +EEA+G    ++  DKDG  A     ++   L     T+ D L EI+++ G      VS              + E  +++  FA +   D+   E +   G R   + P +  L + L     V  R SGTEPK K YYE+
  S:    28 LIAEGDEAKIAACFS-GRLEFGTAGIRGIVGPGPMGMNRLVVRQTTAGLGTYLQGQIKEACQRGVVIGYDGRHDSRQFAHDAASVLTGMGFKVFLTA--KVAATPLVAFGVKHFGAAAGIVVTASHNPPAYNGYKVYWHNGAQIIAPHDTGIAACIEYAATQALPFCE-LID---ATKQEKLHWLMDDFYESYRHQLYHAAVLQFGLEKNEEGKVFTPGADNISLAYTAMHGVGANMAEIVLKDAGFNRVFSVAVQREPDGNFP-TVNFPNPEEPGAMDLVIAEAKQHQAMLACANDPDADRFAVAVRKDDGDYQMLTGDQVGVLLGHYLLSHSSSDQR-LVGCTIVSSSLLSKIAAAFDAPCYTTLTGFKWLMNEAIGLSTPHSRFLFAYEEALGYTVGNLVWDKDGLSALVAFAKLCAELSCHNYTIWDRLTEIYQQHGYHLNSQVSIATSGDAGTIGAKLRAENVQQIGGFAVLACSDLNASEKRYSDGKREIIDLPKSDVLIYELAEGQRVIVRPSGTEPKVKCYYEV 550
>gi|153092428|gb|EDN73491.1| phosphomannomutase [Mannheimia haemolytica PHL213] (550 aa)
Score = 545, Expect = 1.4e-53, Identities = 161/502 (32%), Positives = 252/502 (50%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD---KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A ++      P++++ +D R N+D +A   A+ + + GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     EI +       +ID V        P     +  DD +  +Y E +    +      + N+  + T  HG     L   L+  G     L ++Q  PD +F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G     Y+   K+F    K   +  + VS+  +  IA+KY      T TGFK++G   N        + GFEEA+G L + D  RDKDG  AA + L++   L  + KTL DY  E  +EFGA+    +S ++  L    E+ + M    N    +I G ++       K  R N+    L + LEN   +  R SGTEPK K Y +  G   E  +Q+L    +    +LR
  S:    47 RLQFGTAGLRGRLQAGSMGMNRVLVAQAASGLAGFIKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAAAGIKTYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKEIAA-------LIDKVAAGDIRDLPRSQDFTVLDDEVVNAYIEKTAS--LAKRPKAEINY--VYTAMHGVGYEVLSKTLEKAGLPQPYLVSEQIQPDGSFP-TVNFPNPEEKGALDLAIKLAKEKNAEFIIANDPDADRLAVAVPDAQGNWKPLHGNVIGCFLGWYLA--KQFHAQGKQGVLACSLVSSPALAEIAKKYGLSSEETLTGFKYIGKVEN-------LLFGFEEALGYLVDPDKVRDKDGISAAIMFLDLVCSLKQEGKTLADYTTEFVQEFGAYVSGQISIRVCDL---AEIGKLMTALRNNPPSEIGGFKVAEFIDHTKTTRQND---ILVFVLENGSRLIARPSGTEPKIKFYLDARGTDAENAEQVLAQFDESVRSLLR 541
>gi|145632095|ref|ZP_01787830.1| phosphomannomutase [Haemophilus influenzae 3655] >gi|144987002|gb|EDJ93532.1| phosphomannomutase [Haemophilus influenzae 3655] (550 aa)
Score = 545, Expect = 1.5e-53, Identities = 163/516 (31%), Positives = 255/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D +L    +   ++LR
  S:    36 KAAEAELHARFD-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYIAKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDEQGTWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPLAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADCVLAEFDEGVRHILR 541
>gi|15605016|ref|NP_219800.1| phosphoglucomutase [Chlamydia trachomatis D/UW-3/CX] >gi|76789017|ref|YP_328103.1| phosphoglucomutase [Chlamydia trachomatis A/HAR-13] >gi|3328710|gb|AAC67888.1| Phosphomannomutase [Chlamydia trachomatis D/UW-3/CX] >gi|76167547|gb|AAX50555.1| phosphoglucomutase [Chlamydia trachomatis A/HAR-13] (593 aa)
Score = 545, Expect = 1.6e-53, Identities = 160/509 (31%), Positives = 266/509 (52%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKN--FPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA-------NVKNKDILGLE----------IKGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +WLE     +     +L  + E + + FS + L+FGTAG+R  +G GTN++NVFT ++ ++G+AR L  K+  P    +V++ +D R  +  +    AK L   GI  +L++  +  A  ++SYSVRE    A ++ TASHNP  Y G+KVY  TGGQ+L     EIV    + + ++  V + +   I    + +   Y E  +   +     R+      +  +  HGT    +P +LK  G+ ++ L  +Q VPD +F+     NPED  +  L ++   + + ++ +  DPDSDR+ VV   K   +   GNQ+  +   ++L+ K+  K P      VV + V+T  +  I+E Y A +     GFK++G ++      M+ F+ G EE+ G L      DKD   AAAL  E       +  TL D L E++E +G +   T S  +  ++  +  QE +D++        ++ ++ ++  E          +  I +         L +Y E D  V  R SGTEPK K+Y+EI
  S:    22 SWLEDVVCDHTSVLTLLDNDPERLRELFSET-LTFGTAGLRGLVGIGTNRLNVFTIRRATQGLARVL--KRRYPDEKISVVIGYDTRHYSFEFGQETAKVLAGNGILAYLFQIPEPLA--LVSYSVRELQAKAGVMITASHNPPPYNGYKVYMSTGGQVLPPMDQEIVEEFQKVE-MVSAVESLDHPYIRMVQEDMENCYEETLHNLQLCEEDNRRHGSLLRISYSPLHGTGVTMIPRILKDWGFSSVSLVEKQIVPDGDFSTVVLPNPEDPEALVLGIQQMVEQKDDLFIATDPDSDRIGVVSLEKEGPYRFNGNQIACLLAAHILS-KESQKAPLGAEDKVVKSLVTTELLTAISESYGANIVNVGAGFKYIGEKIELWRSGMERFIFGAEESYGYLYGSYVEDKDAMIAAALISEAALQQKIRGCTLRDALLELYEVYGYYANRTESIDL-PIDQPQRKQELLDRWETQDPLRMSLSSRKLIAFENYNTGEGRDLVTDITYKLSLPKMSMLCFYYEGDCRVIVRPSGTEPKMKLYFEI 554
>gi|104774530|ref|YP_619510.1| phosphoglucomutase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423611|emb|CAI98547.1| Phosphoglucomutase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (573 aa)
Score = 544, Expect = 1.8e-53, Identities = 155/514 (30%), Positives = 272/514 (52%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-----ISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDK--TP--FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-WNE----------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +E+ I+  F    ++FGTAG+R  + PGTN+INVFT  +++EG+AR L+++         V+++ D+R N+   A   A+ L + GI V+L+  + ++ TP +S++VR     A I  TASHN K Y G+K Y   G Q+    A+ + +   + + I      P   L     +    + + E+Y        +N ++ ++      ++ T  HGT         +  G+ N++    Q + DP F      NPE +  F+  ++ A +  A++++  DPD+DR+   VR  K  +  LTGNQ+  + ++Y+L N K     TP   +V++ VS+    +IA+ +  K     TGFK++G E   MNK  D   F++GFEE+ G L     RDKD  Q A +  EV +    +  T+ D L EI++++G     T + ++  +  +++M E M K    +  +I G ++  I  + E                 +  L+++L+++ WV  R SGTEP  K Y  +        ++  ++ +D    +L+
  S:    29 DEKWIEDAFG-QDINFGTAGMRGLLEPGTNRINVFTVGRVTEGLAR-LIDENGEEAKKRGVVISFDSRYNSRELATHAARVLGAHGIHVYLF--DDLRPTPELSFAVRYLHTFAGINITASHNAKQYNGYKAYGEDGAQMGPENADRLFAYAQKVEDIFSVKAAPVKKLRAEGTLQLIGEDVDEAYLAKLETVNVNKDMIKENADKLKIVYTPLHGTGKMLYDRAFRRGGFSNVVPVPSQAIVDPEFPTCKKPNPEFRDVFNPGVELANEIGADMIVATDPDADRMGACVRTDKGDFQVLTGNQIATLMSYYLLQNLKDSGKLTPDYEIVTSIVSSALPFKIAKDFGIKTKSVLTGFKYIGEEVDRMNKEGDG-KFLMGFEESYGYLFQAFARDKDAMQGALMFAEVASYYASKGMTVFDGLQEIWKKYGVAYEITRAIEMPGIGGQKKMAELMSKLREERLSEINGAKVLKIEDYQEQVTVENGEETPLTGFPKSNVLKYFLDDETWVALRPSGTEPVIKAYVGVNKADIATAEKAAESYQDAISELLK 573
>gi|170727491|ref|YP_001761517.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Shewanella woodyi ATCC 51908] >gi|169812838|gb|ACA87422.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Shewanella woodyi ATCC 51908] (577 aa)
Score = 544, Expect = 1.9e-53, Identities = 158/510 (30%), Positives = 267/510 (52%)
  Q:    21 KAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN---PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPEC--QTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHK-NKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVS--YKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP--------------AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           K W+E++   R   + ++L+   ++ E+ K F+  +L+FGTAG+R  +G G   +N F  QQ + G+  +L  + S+     V++ +D R ++  +A   A  LT+ GIKV+L   + + ATP++++ V   G  A I+ TASHNP  Y G+KVY   G QI+    + I + + +   Q+I   +   +++       +   +D   ++Y +      +  N  R +   +  T  HG  +     +LK  G   +   A Q  PD +F  + NF NPE+K + DL +  A K+ A +    DPD+DR AV VR +   +  LTG+Q+G++F HY+L +   ++     +T VS++ + ++A    A+   T TGFKW+ N  + +      F+  +EEA+G    D+  DKDG  A     ++   L  + +T+ D L +I++E G      VS   K ++ N    ++E       V  + +L ++   I   E               +  L + LE    V  R SGTEPK K YYE+
  S:    10 KNWIEADPDPRSKRELQQLVDNNDDTELGKRFA-GRLAFGTAGLRGVVGAGPMGMNRFVVQQTTSGLGSYLKAQVSDLDSRGVVIGYDGRHDSKQFAHDAAGVLTAMGIKVYL--TSNVAATPLVAFGVLHFGAAAGIVVTASHNPPQYNGYKVYWGNGAQIIPPHDSGIAACVHQAADQSICRTIELLSLEQARLSGTLVMLEDDFYQTYRQGIQDAEVLQNHTRPELVSLAYTAMHGVGAEMAETVLKDAGVSQVYSVAAQREPDGDFP-TVNFPNPEEKGAMDLVIAEATKHDAMLACANDPDADRFAVAVRKRAGDYQMLTGDQVGVLFGHYLLKHASKEQR-LTCTTIVSSSLLSKVAASMGARCITTLTGFKWLMNVAIAEQTPDNRFLFAYEEALGYTVGDMVWDKDGLSALVAFSQLTAELASKGETIWDRLADIYKEHGFHLNAQVSIALKPDTPNIGAYLREHPP--VTVAGRKVLSVD--DISCGERRFADGRLETIALPLSDVLIYSLEGGARVIVRPSGTEPKIKCYYEV 543
>gi|15639629|ref|NP_219079.1| phosphomannomutase (manB) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025867|ref|YP_001933639.1| phosphomannomutase [Treponema pallidum subsp. pallidum SS14] >gi|3322941|gb|AAC65616.1| phosphomannomutase (manB) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018442|gb|ACD71060.1| phosphomannomutase [Treponema pallidum subsp. pallidum SS14] (586 aa)
Score = 544, Expect = 2.1e-53, Identities = 155/498 (31%), Positives = 257/498 (51%)
  Q:    30 SNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT--------VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTII--DNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----------VKNKDI-LGLEIKGIRWNEPAQA----------LEWYLENDMWVKFRLSGTEPKFKIY 527
           + + ++L+ + N  E+++ F    LSFGTAG+R  +G GTN++N F  ++++  +A +LL  K+ P          ++A+D+R+++  +A   A    +  I  +L+ +   + TP +SY+V+    D  I+ TASHNP  Y G+KVY + G QI       I   M    +++  +          +  D  I E Y  +    L    + ++  ++  +  T  HGT +  +  +L  +G+ +I+   +Q +PD NF   ++ NPED A+   +  YA++  A +++  DPD+DR A  VR+ +     LTGNQMG +FT Y+L            P +V + V++   DRIA  Y A      TGFKW+     K        +V GFEE+ G       RDKDG  AAAL  E+      +  +L+D L ++F   G +  +T++     +     M   M+               +K +DI LG+E        PAQ           L++++++   V  R SGTE K K Y
  S:    23 AQQVRDLVAQNNIAELEERF-LQTLSFGTAGLRGVVGGGTNRMNPFMIKKITHAIALYLL--KTFPEKAARGALRAVIAYDSRVHSRLFAHTAAHVFLAHDITAYLFSDP--RPTPELSYAVQYLTCDVGIVVTASHNPPQYNGYKVYWNDGAQIAHPHEKNITEEMNAITSVVNLEEKVPVKRSAPTIIDAEIDEPYCTSIKEKLFRPGLTKETVQSMRIAYTPLHGTGALHVERILGDMGF-SIMTVPEQRLPDGNFPTVSSPNPEDPAALVHACAYADRVHAEVLMATDPDADRFACAVRNTRGVLQLLTGNQMGALFTDYILLTLQEQNNMPARPAIVRSVVTSPLSDRIARTYGATCVECLTGFKWICGTAEKISQSGAYSYVYGFEESYGHNFGIQVRDKDGINAAALCAEMGVYWKLRGMSLIDRLHQLFRTHGLFCEKTLNKTYAGVAGVSTMNAIMNTLRRQPLTQIARKRVMKVRDIYLGVEFSP---ENPAQTSALSFPQSNVLQYFVQDGSIVSIRPSGTEQKIKCY 552
>gi|116514641|ref|YP_813547.1| phosphomannomutase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093956|gb|ABJ59109.1| alpha-phosphoglucomutase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (573 aa)
Score = 544, Expect = 2.1e-53, Identities = 155/514 (30%), Positives = 272/514 (52%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDL-----ISYFDDTITESYFEASYRCLINTNIYRQK--NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDK--TP--FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE---MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR-WNE----------------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +E+ I+  F    ++FGTAG+R  + PGTN+INVFT  +++EG+AR L+++         V+++ D+R N+   A   A+ L + GI V+L+  + ++ TP +S++VR     A I  TASHN K Y G+K Y   G Q+    A+ + +   + + I      P   L     +    + + E+Y        +N ++ ++      ++ T  HGT         +  G+ N++    Q + DP F      NPE +  F+  ++ A +  A++++  DPD+DR+   VR  K  +  LTGNQ+  + ++Y+L N K     TP   +V++ VS+    +IA+ +  K     TGFK++G E   MNK  D   F++GFEE+ G L     RDKD  Q A +  EV +    +  T+ D L EI++++G     T + ++  +  +++M E M K       +I G+++  I  + E                 +  L+++L+++ WV  R SGTEP  K Y  +        ++  ++ +D    +L+
  S:    29 DEKWIEDAFG-QDINFGTAGMRGLLEPGTNRINVFTVGRVTEGLAR-LIDENGEEAKKRGVVISFDSRYNSRELATHAARVLGAHGIHVYLF--DDLRPTPELSFAVRYLHTFAGINITASHNAKQYNGYKAYGEDGAQMGPENADRLFAYAQKVEDIFSVKAAPVKKLRAEGTLQLIGEDVDEAYLAKLETVNVNKDMIKENADKLKIVYTPLHGTGKMLYDRAFRRGGFSNVVPVPSQAIVDPEFPTCKKPNPEFRDVFNPGVELANEIGADMIVATDPDADRMGACVRTDKGDFQVLTGNQIATLMSYYLLQNLKDSGKLTPDYEIVTSIVSSALPFKIAKDFGIKTKSVLTGFKYIGEEVDRMNKEGDG-KFLMGFEESYGYLFQAFARDKDAMQGALMFAEVASYYASKGMTVFDGLQEIWKKYGVAYEITRAIEMPGIGGQKKMAELMSKLREEHLSEINGVKVLKIEDYQEQVTVENGEETPLTGFPKSNVLKYFLDDETWVALRPSGTEPVIKAYVGVNKADIATAEKAAESYQDAISELLK 573
>gi|68249340|ref|YP_248452.1| phosphoglucomutase [Haemophilus influenzae 86-028NP] >gi|68057539|gb|AAX87792.1| phosphoglucomutase [Haemophilus influenzae 86-028NP] (547 aa)
Score = 543, Expect = 2.3e-53, Identities = 163/516 (31%), Positives = 255/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D +L    +   ++LR
  S:    36 KAAEAELHARFD-GRLQFGTAGLRGRLQAGSIGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADCVLAEFDEGVRHILR 541
>gi|145630482|ref|ZP_01786262.1| DNA polymerase III subunit alpha [Haemophilus influenzae 22.4-21] >gi|144983872|gb|EDJ91314.1| DNA polymerase III subunit alpha [Haemophilus influenzae R3021] (550 aa)
Score = 543, Expect = 2.4e-53, Identities = 162/516 (31%), Positives = 255/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F   +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I   + +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D++L    +   ++LR
  S:    36 KAAEAELHARFD-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFAHDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHTKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADRVLAEFDEGVRHILR 541
>gi|42631063|ref|ZP_00156601.1| COG1109: Phosphomannomutase [Haemophilus influenzae R2866] >gi|145628377|ref|ZP_01784178.1| export protein SecB [Haemophilus influenzae 22.1-21] >gi|145638462|ref|ZP_01794072.1| export protein SecB [Haemophilus influenzae PittII] >gi|144980152|gb|EDJ89811.1| export protein SecB [Haemophilus influenzae 22.1-21] >gi|145272791|gb|EDK12698.1| export protein SecB [Haemophilus influenzae PittII] (551 aa)
Score = 543, Expect = 2.5e-53, Identities = 161/512 (31%), Positives = 255/512 (49%)
  Q:    43 EEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           EE+   F+  +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV +   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I   + +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D+IL    +   ++LR
  S:    41 EELHARFN-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYIAKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAIPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHTKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDARGKDPKDADRILAEFDEGVRHILR 542
>gi|15835185|ref|NP_296944.1| phosphoglucomutase/phosphomannomutase, putative [Chlamydia muridarum Nigg] >gi|8163251|gb|AAF73572.1| phosphoglucomutase/phosphomannomutase, putative [Chlamydia muridarum Nigg] (593 aa)
Score = 541, Expect = 4.8e-53, Identities = 155/509 (30%), Positives = 265/509 (52%)
  Q:    22 AWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK--KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTH--HGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPF-----VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTG--ETVSYKIESLNWKEEMQEKMDK----FANVKNKDILGLE----------IKGIRWN---EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +WL+ N   N     +L  + E++ + F    L+FGTAG+R+ MG GTN++NVFT ++ ++ +A+ L  +    + +V+V +D R ++  +    AK L   GI  +L++  +  A  ++SYSVRE    A ++ TASHNP  Y G+KVY  TGGQ+L     EIV        ++ +V T +   I    + I   Y +A ++  +     RQ    + ++    HGT    +P +LK  G+ ++ L  +Q +PD +F      NPED  +  L ++     + ++ +  DPD+DR+ +V   K+  +   GNQ+  +   ++L+ ++  K P      VV + V+T  +  I E Y   V     GFK++G ++      M+ F+ G EE+ G L      DKD   +AAL  E       +  TL D L E++E  G +    E++   ++  N K+E+ E+ +     + ++  + ++  E          + GI +         L +Y E    V  R SGTEPK K+Y+E+
  S:    22 SWLQDNACDNTLILDLLDKDPEKLKERFG-DILTFGTAGLRSLMGVGTNRLNVFTVRRATQSLAQVLKQRYPDEDISVVVGYDTRHHSLEFGQETAKVLAGNGILTYLFQVPEPLA--LVSYSVREFQAKAGVMITASHNPPAYNGYKVYMSTGGQVLPPMDQEIVKEFQMIDQVL-SVDTLDHPCIRLIQEEIEADYEKALHQLQLCREDNRQHGSLLRMSYSPLHGTGVSMVPRILKDWGFSSVCLVEKQMIPDGDFPTIVLPNPEDPEALVLGIQQMLDQKDDLFIATDPDADRIGIVSLEKDGPYRFNGNQIACLLAAHILS-RESQKAPLGVEDKVVKSIVTTELLTAITESYGGSVVNVGAGFKYIGEKIELWRSGMERFIFGAEESYGYLYGSHVEDKDAMISAALIAETALQQKLRGYTLRDALLELYEIHGYYANLTESIDLPVDQPNQKQELLERWETQDPLYMSLPGRKLVAFENYKTGEGCDLVTGITYKLALPKMSMLCFYYEGSGRVIVRPSGTEPKIKLYFEL 554
>gi|167522319|ref|XP_001745497.1| predicted protein [Monosiga brevicollis MX1] >gi|163775846|gb|EDQ89468.1| predicted protein [Monosiga brevicollis MX1] (610 aa)
Score = 540, Expect = 5.9e-53, Identities = 177/523 (33%), Positives = 288/523 (55%)
  Q:    23 WLESNRISNKYKE---LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP--NMDLISYFDDTITESYFEA-----SYRCLIN----------------TNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFD------KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM----DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM--DK-FANVKNK-----DILGLEIKGIR--------------WNEPAQA---LEWYLENDMWVKFRLSGTEPKFKIYYEIY--GET---KEICDQILKAL 545
           WL+ ++  +  +E   L   M+ EEI++ F  S+++FGTAG+RA M  G   +N  T  Q S+G+A+ +L   S        V++  D R N+  +AM  A+     G +V+L+ E  +  TP I ++V      A I+ TASHNPK   G+KVY     QI+     EI + + +        + P    D +    + I+++YF+A     S  C +N                ++I R K   +  T  HG     +  +  + G    I  A+Q  PDP F      NPE+ K +  L++  AE++ + ++L  DPD+DRLA+ V H  KWH LTGN++G +F  +++ N +           F++++ VS+  +  +A     +   T TGFKW+GN   + ID M    + +  +EEAIG        DKDG  AAA+A E+   L  ++KTLV+ L+E++  +G +     SY I          +KM  D+ F N++        + G+ ++ +R                 P Q+   + + LEN++ + FR SGTEPK K Y E+   G T   ++  D+ L++L
  S:    12 WLKYDKYPDTLEEAKRLFASMDTEEIERRFG-SRMTFGTAGLRAPMQAGWACMNDLTVIQASQGLAKHVLEHTSANNHLAFRVVIGFDGRHNSSRFAMRAARAFKQLGAEVYLFGE--MVPTPFIPFAVSHLQCAAGIMVTASHNPKQDNGYKVYWSNAAQIISPTDKEIAAKIEDNLEPWPQAWDPLTEGDTVDALAE-ISDAYFQAARLIASPHCFVNISCTPTGTISSQQYLASSIDRNK-LKITYTAMHGVGYRYVEQVFSAFGLPGFIPVAEQVQPDPEFPTVEYPNPEEGKGALQLAMATAERHSSGLILANDPDADRLAIAVLHDGKWHILTGNEIGSLFAWWLVHNYRTQHPGGSMDNVFMLASTVSSKMLQTMANVEGFQFDETLTGFKWLGN---RAIDLMSANHEVLFSYEEAIGFCIGTNVVDKDGVTAAAVAAEMALFLAAEDKTLVNKLEELYALYG-YHATFNSYYI--------CHDKMIIDRIFGNIRKDGRYPDKLAGVPVRAVRDVTMGFDSSQPDHVSRLPVQSGHMITFVLENNLTITFRTSGTEPKIKFYSELISSGSTASERQAVDEQLRSL 589
>gi|54302294|ref|YP_132287.1| putative phosphomannomutase [Photobacterium profundum SS9] >gi|46915716|emb|CAG22487.1| putative phosphomannomutase [Photobacterium profundum SS9] (569 aa)
Score = 540, Expect = 6.1e-53, Identities = 154/508 (30%), Positives = 268/508 (52%)
  Q:    23 WLESNRISN---KYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIG-SLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE-------------IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   N   + + LI      E++  F+  +L FGTAG+R  +G G N++N    Q+ + G+A +L  ++ +     V++ +D R ++  +A   A  LT+ GIKV+L    ++ ATP++++ V+  G  A I+ TASHNP  Y GFKVY   G QI+       A EI  +  +   ++D        L+ + DD   + Y        + +N  +     +  T  HG  +     LL   G+ ++   A Q  PD  F  + NF NPE+  + D+ +  A+ + A +    DPD+DR AV V+  N ++  LTG+Q+G++F HY+L++ K ++   V +T VS++ +++IA+   A  ++T TGFKW+ N  M +  +   F+  +EEA+G ++ S++  DKDG  A     ++   L    +T+ D L+ I+ E G +     S  ++        + + +    +  + +L  +             ++ I   E +  L ++L++   V  R SGTEPK K YYE+
  S:     8 WLSRDPDPNTRYELQRLIDSQESAELEDRFN-GRLEFGTAGLRGIVGAGPNRMNRLVIQETAIGLAHYLKAQEHDAEFRGVVIGYDGRPDSKQFACDAASALTAHGIKVYL--TIRVAATPLVAFGVKHLGAAAGIVVTASHNPPAYNGFKVYWGNGAQIIPPHDSGIAAEIDLAAQQELHLMDLEIAHQQGLLVWLDDDFYQEYRRTMNENPLLSNHTQPDGISLAYTAMHGVGANMAETLLHDAGFNHVYSVAAQREPDGAFP-TVNFPNPEEPGAMDMVIAEAKSHGATLACANDPDADRFAVAVQLDNGEYKMLTGDQVGVLFGHYLLSHAKPEQN-LVGATIVSSSLLEQIAKSAGANYYQTLTGFKWLTNVGMKQETETSQFLFAYEEALGYTVGSEVW-DKDGLSALVAFAQLTAELASNGQTIWDQLEAIYREHGLYLNAQQSIALDPAAPPIGDKLRANPVMQIAGQIVLQTDDLKSSKRTFQDGTVEDIDLPE-SDVLIYHLDSGARVVVRPSGTEPKLKCYYEV 535
>gi|148826616|ref|YP_001291369.1| export protein SecB [Haemophilus influenzae PittEE] >gi|148716776|gb|ABQ98986.1| export protein SecB [Haemophilus influenzae PittEE] (550 aa)
Score = 539, Expect = 7.0e-53, Identities = 162/516 (31%), Positives = 256/516 (49%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYR------CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           K  E E+   F+  +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   G+K +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V        P  D     +D + ++Y   +        C IN           + T  HG     L   L   G     + A Q   D  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G  F  + L  +   K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY DE  +EFGA+    +S ++  L+   E+ + M    N    +I G++    I  I+ +  +  L + LEN   +  R SGTEPK K Y +  G+  +  D++L    +   ++LR
  S:    36 KAAEAELHARFN-GRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGVKAYLLPRKL--PTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVYLGKVNGGGQIVSPADKDIAA-------LIDKVAAGNIQDLPRSDNYVVLNDEVVDAYIAKTASLAKEPACDIN----------YVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWSDGTFP-TVNFPNPEEKGALDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVG-CFLGWYLAKQYQGKQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSG-------LLFGFEEALGYLVDPDKVRDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPAEIAGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDACGKDPKDADRVLAEFDEGVRHILR 541
>gi|154496019|ref|ZP_02034715.1| hypothetical protein BACCAP_00302 [Bacteroides capillosus ATCC 29799] >gi|150274902|gb|EDN01958.1| hypothetical protein BACCAP_00302 [Bacteroides capillosus ATCC 29799] (575 aa)
Score = 539, Expect = 8.5e-53, Identities = 169/522 (32%), Positives = 278/522 (53%)
  Q:    19 LSKAWLESNRISNKYKELILKM--NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMD------LISYFDDTITESYFEASYRCLINTNIYRQK---NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK--HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWN-EPAQALEWYLENDMWVKFRL----------SGTEPKFKIYYEIYGETKEICDQ 540
           + + WL S  +S   KE +  +  +E+EI+  F ++ L FGTAG+R TM  G +Q+NV   +  ++  A  +  K   P      V + +D R N+D +A   A  + + GIKV L+  + ++ TP +S++VRE    A +  TASHNPK Y G+KVY   G Q+    A  I + M E   + D++   + D      LI+      T+  F A+    +N     +K    F ++ T  HGT    +P  LK +G +++I   +Q V D NF    + NPE+   F L++  A+K  A+ +LG DPD+DR+ ++V+  K ++  +TGNQ G+I   Y++  K    K  + P  + T V+T    ++AE    K + T TGFK++  + +K  +  +   +  +EE+ G +  D  RDKD   AA    E+      Q  TL D L + +E++G +  +T++  +  L+   +M++ M         +I G+++        G   N E     E  L+    +K++L          SGTEPK K+Y    G TK   D+
  S:     6 MYEKWLNSPALSEAEKEELRSIANDEKEIESRF-FAPLEFGTAGLRGTMCVGLHQMNVHVIRHATQAFAEVI--KAEGPEAVERGVAICYDCRNNSDLFARETACVMAANGIKVRLF--DAMRPTPEVSFAVREYHCIAGVNVTASHNPKEYNGYKVYWQDGAQLPPHHAAAIAAKMEELD-LFDSIQRMDYDEAVKAGLITLMGAE-TDEKFLANVMGQVNDKAAVEKVADTFKMVYTPFHGTGYKLIPEALKRLGMKHVICVPEQMVIDGNFPTVVSPNPENPEGFYLAVDLAKKEGADFILGSDPDADRVGIMVKDDKGEYITITGNQTGVILLDYLIGAKQRTGKMPENPVALKTIVTTEMARKVAETNGLKCYDTFTGFKFLAEKKDKLENAGEGKVIFAYEESYGYMLGDYVRDKDAVTAALALTEMAAWYAGQGMTLYDALQKCYEKYGFYGEKTLNLVMPGLDGLAKMKKLMADLREKPLTEIAGVKVVLRKDYADGTETNVETGAVTEMELKGSNVLKYKLADGTDLVVRPSGTEPKVKVYILASGATKAEADE 561
>gi|28492984|ref|NP_787145.1| phosphomannomutase [Tropheryma whipplei str. Twist] >gi|28572192|ref|NP_788972.1| phosphomannomutase [Tropheryma whipplei TW08/27] >gi|28410323|emb|CAD66709.1| putative phosphomannomutase [Tropheryma whipplei TW08/27] >gi|28476024|gb|AAO44114.1| phosphomannomutase [Tropheryma whipplei str. Twist] (550 aa)
Score = 538, Expect = 1.0e-52, Identities = 161/530 (30%), Positives = 272/530 (51%)
  Q:    16 VNPLSKA--WLESNRISNKYKEL--ILKMNEE-----EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIF---------THYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESL--------NWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKF-----RLSGTEPKFKIYYEIYGETKEICDQILKAL 545
           +N L KA  W+E++ ++    E+  +L  +E+     E+++  S + L FGTAG+RA  G G N++N     Q +  ++++LL +    T+++ +D R N+  +A   A+  +S+ I   +    +   TP+++++VR+ G  A ++ TASHNP+ Y G+KVY      G QI D+ A +I  ++ +     D    P  D     D+ I E+Y   + + +       + +  +  T  HG        L++ +G+ N++   +Q +PDP F      NPE+K + DL+ + A     +I++  DPD+DR+AV   H +     TGN++G +           H VL+N           + VS+  + RIAE Y  +   TPTGFKWV           D   GFEEA+G + + ++ RDKDG  A A    +      Q ++L D LD++  + G +     + ++ SL        N + E   K+ +F   K +D+L         + P   LE+ L  D+   F     R SGTE K K Y +   +T +  +Q+L  L
  S:     1 MNILRKASLWIENDPVAITRLEMRRLLAESEKTGDVRELEERLSKT-LEFGTAGLRAPQGAGFNRVNAVVTAQAANALSQFLLEENRGRTLVIGYDGRYNSQLWARNTARIASSYDITALIMP--RALPTPLLAFAVRQLGAAAGVMVTASHNPREYNGYKVYLGGEDKGAQIPDTAAAKIAKNLRDEVAYSD---IPMKDSYGILDEEIIEAYLSRTAKAIKRQFGSPKADLKICHTAMHGVGHEIFVRLMEKLGFHNLVFVEEQKMPDPAFPTLPFPNPEEKGALDLAFETARLAECDIIIANDPDADRVAVA--HPDG-KVFTGNEIGALLGVEIARMQRGHGVLSN-----------SMVSSPIMRRIAETYGMQHVETPTGFKWVAR-------VPDICFGFEEALGYMIHPELVRDKDGLSAGAAIATIAASQKAQGRSLRDCLDDLQSKLGYFRSTQYAVRMASLDSVQAVMQNLRAESLNKIGRFRVTKYRDLL-------FGSPPVDLLEFNLGQDIDDLFGRLIVRPSGTELKLKCYIDSVAKTPDGAEQLLSEL 531
>gi|156096805|ref|XP_001614436.1| phosphoglucomutase, putative [Plasmodium vivax SaI-1] >gi|148803310|gb|EDL44709.1| phosphoglucomutase, putative [Plasmodium vivax] (593 aa)
Score = 538, Expect = 1.0e-52, Identities = 161/520 (30%), Positives = 272/520 (52%)
  Q:    29 ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILD----SEANEIVSSMPECQTIID----NVYTPNMDLISYFDDTITESY--FEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN---KKFDKTPFV-VSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHID----KMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKI----------ESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           ++++ KE +   +EEE+ + F   +L+FGTAG+R  MG G N +NV T  Q ++G+  +L+N        N  +I   D R +++ +A V A    S G +V+L+   Q  ATPI+ YS  +      ++ TASHNPK   G+KVY   G QI+     + ++ I+S++     + D    + Y  +  L+   +D   E Y  F +  +   N N +R  +    ++ +  HG     +  ++  +GY N++   QQ +PD +F+     NPE+K + ++S++ A+   + I++  DPD+DR A   +  NKW   +G+++GIIF ++++     K  DK+  V + T V +  + ++ E Y  K   T TGFKW+   +NK ID        +  +EEA+G   +   RDK G  A A  +EV   LY+   T  +YL+ I +E G +      Y +                   + ++  +  V  +D+      G     P           +Q++  + EN   +  R SGTEPK K Y EI   + E   + +  L DE
  S:    25 LADETKEALSTYDEEELKRLF-LRRLNFGTAGLRGKMGVGFNAMNVVTIMQTTQGLCTYLINTYGISLCKNRGIIFGFDGRYHSESFAHVAASVCLSKGFRVYLF--GQTVATPILCYSSFKKSCLCGVMVTASHNPKLDNGYKVYAANGAQIIPPVDVNISDCILSNLKPWSEVYDYLNEDFYLKDTSLV---EDIYYEMYDSFMSDMKSEFNFNCHRNSRTKLVIVYSPMHGIGRKFVQGVMHIVGYNNLLTVPQQALPDADFSTVTFPNPEEKGALNMSMQLADVVNSPIVVANDPDADRFACAEKFNNKWKIFSGDELGIIFAYHLMKQNEKKNIDKSKHVFICTVVCSRMLKKLCEMYGYKYDETLTGFKWL---INKAIDLSQENYTTLYCYEEALGHALTKYVRDKCGISALAYWIEVAVYLYENGLTFHEYLENIRKEIGYFVSNNGYYTVLDPTDVVSIFNDFRGNGSYRSELGSYKVVHVRDL----TTGYDSTTPDGKSLIAPTPDSQSITLHFENTAILTVRASGTEPKVKWYSEISRGSYESAKEEIDRLVDE 577
>gi|156977486|ref|YP_001448392.1| phosphomannomutase [Vibrio harveyi ATCC BAA-1116] >gi|156529080|gb|ABU74165.1| hypothetical protein VIBHAR_06273 [Vibrio harveyi ATCC BAA-1116] (566 aa)
Score = 537, Expect = 1.2e-52, Identities = 169/508 (33%), Positives = 268/508 (52%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFL-YKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT--------ITESYFEASYRCLINTNIY----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIR----------------WNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + + L+   NE+E+   F  S+L+FGTAG+R  +G G N++N    Q+ + G+  +L+ +    S+  V++ +D R ++  +A   A  LT+  IKV+L YK   + ATPI+++ VRE    AA++ TASHNP  Y GFKVY   G QI+    + I +        ID   T  + L+S  DD         + + Y++ +YR  +N N         +  ++ T  HG  +     LL   G+E +   ++Q  PD  F  + NF NPE+  + D+ +   +   A+I    DPD+DR AV V R   ++  LTG+Q+G +F  Y+L  +       V +T VS+  +  IA+ + A+ ++T TGFKW+ N  M +  +   F+  +EEA+G    +   DKDG  A     ++   L  Q KTL D L+E++ + G +     S  ++      +     DK      K+I G  I+ I                  N PA   L ++LE+   V  R SGTEPK K YYE+
  S:    10 WLARDPDPKTREELQHLVDANNEQELTDRFG-SRLAFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLIEQVKDASSRGVVIGYDGRPDSKQFAHDTASVLTALSIKVYLTYK---VAATPIVAFGVRELNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAAR-------IDEATTKPLPLMS-LDDAKQKGLLVWLEDEYYQ-TYRKTMNDNALLTPDSNTDISIVYTAMHGVGADMAETLLADAGFEKVASVSEQREPDGTFP-TVNFPNPEEAGAMDMVMALGKSVDADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLLQGQ---PNALVGNTIVSSRLLSSIAKAHGAEYYQTLTGFKWLTNVAMTQETEANPFLFAYEEALGYTVGNKVWDKDGLSALVAFSQLTGKLKAQGKTLWDKLEELYRQHGFYFNAQRSIALDP-----KSPPIGDKLRANPPKEIAGKRIEVIEDLKSSLRFVTDGPTEAINLPASDVLVYHLEDKSRVIVRPSGTEPKLKCYYEV 534
>gi|170718119|ref|YP_001785150.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Haemophilus somnus 2336] >gi|168826248|gb|ACA31619.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Haemophilus somnus 2336] (551 aa)
Score = 537, Expect = 1.4e-52, Identities = 159/513 (30%), Positives = 252/513 (49%)
  Q:    42 EEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           ++E+   F+  +L FGTAG+R  +  G+  +N     Q + G+A +L    S P++++ +D R N+D +    A+ +   GIK FL        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I         +ID V        P     +  DD I E+Y   +       +I +  Q N   + T  HG     L   L   G     L  +Q  PD +F  + NF NPE+K + DL++K A+   A  ++  DPD+DRLAV V   +  W  L GN +G     Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G ++N      D + GFEEA+G L + D  RDKDG  AA   L++   L  + KTL DY ++   EFGA+    +S ++  L+   +M   + K    +    +   I   + +  +  L + LEN   +  R SGTEPK K Y ++ G   +  D++L    +    +LR
  S:    39 QKELHNRFN-GRLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLAEYLKGYDSEPSIVLGYDGRKNSDVFVRDTAEIMAGAGIKTFLLPRKL--PTPVLAYAIKHLNTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADVDIAK-------LIDKVANGDIRDLPRSQHYTVLDDEIVEAYIAKT------ASIAKEPQANINYVYTAMHGVGYEVLSKTLAKAGLPQPHLVEEQIQPDGSFP-TVNFPNPEEKGALDLAIKLAKAKNAEFIIANDPDADRLAVAVPDSEGNWKPLHGNVIGCFLGWYLAKQYHAQGKQGKLACSLVSSPALAEIAKKYGFQSEETLTGFKYIG-KVN------DLLFGFEEALGYLVDPDKVRDKDGISAAIAFLDLVRSLKKEGKTLTDYANDFTAEFGAYVSGQISIRVNELSDIGKMMTALRKEPLTELGGFVTQFIDHSKTDRASDILVFVLENGSRLIVRPSGTEPKVKFYLDVCGTDPKNADEVLAEFDENVRQILR 542
>gi|170287963|ref|YP_001738201.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Thermotoga sp. RQ2] >gi|170175466|gb|ACB08518.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Thermotoga sp. RQ2] (471 aa)
Score = 536, Expect = 1.8e-52, Identities = 146/499 (29%), Positives = 260/499 (52%)
  Q:    56 FGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           FGT GIR  M  G  + +  T ++ S   A WL  +K   +V++A+D R N+  +A +  +     G++ +++ E     TP++S++VR       ++ TASHNP  Y G+KVY   G Q +    +EI     E    +D       + I +    + ESY       +  +N+  + +  +  +  HGT +  +P +LK +G++ + L  +Q  PDPNF+ +   NPE+    D +L    K  A + L  DPD DR+ VV R +     LTGNQ+G++ T ++L   K +  P V+ T V+T+ +  I E+  A +  TPTGFK++G+ + +H  K D  FV GFEE+ G L     RDKDG   + L+   ++     EK     L+E++++ G +  + +++K+      E++++ +  + ++K ++ +    KG     P + + +  E    +  R SGTEPK K+Y  + G+T+E  +++++  + + E +L+
  S:     4 FGTGGIRGVMRKG--EFDEETVKRASLSTALWL-KEKGQKSVVIAYDTRKNSREFAELAGRVFAGEGLEAYVFPEPT--PTPVLSFAVRYVKAGGGVVVTASHNPPEYNGYKVYTWNGVQAIPEYTDEIT----EIYKKVDTSRVKEGE-IKFVPPEVKESYINTVLELV--SNLPMKTDLDIAYSPLHGTGANYVPEVLKRLGFK-VRLVEEQMKPDPNFSTAPTPNPEE----DEALVLLNKKGATLGLATDPDCDRVGVVFRGRR----LTGNQVGVLLTDFLLDYVKVE-NPLVIKTIVTTDMVRPICEEKGAFLEETPTGFKFIGHLIEEHSRKGDRNFVFGFEESCGYLAGTHARDKDGVVGSVLSAIAFSNHDPYEK-----LEELYQKHGYYMEKLINFKV------EDVEKAIKIYESLKTRNDIIDYSKGYGNVIPNETIAFVFEKSR-IFVRPSGTEPKLKVYIHVRGDTREEAEELIRENEKKIEEILK 470
>gi|148269304|ref|YP_001243764.1| phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Thermotoga petrophila RKU-1] >gi|147734848|gb|ABQ46188.1| alpha-phosphoglucomutase [Thermotoga petrophila RKU-1] (471 aa)
Score = 535, Expect = 2.0e-52, Identities = 146/499 (29%), Positives = 260/499 (52%)
  Q:    56 FGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           FGT GIR  M  G  + +  T ++ S   A WL  +K   +V++A+D R N+  +A +  +     G++ +++ E     TP++S++VR       ++ TASHNP  Y G+KVY   G Q +    +EI     E    +D       + I +    + ESY       +  +N+  + +  +  +  HGT +  +P +LK +G++ + L  +Q  PDPNF+ +   NPE+    D +L    K  A + L  DPD DR+ VV R +     LTGNQ+G++ T ++L   K +  P V+ T V+T+ +  I E+  A +  TPTGFK++G+ + +H  K D  FV GFEE+ G L     RDKDG   + L+   ++     EK     L+E++++ G +  + +++K+      E++++ +  + ++K ++ +    KG     P + + +  E    +  R SGTEPK K+Y  + G+T+E  +++++  + + E +L+
  S:     4 FGTGGIRGVMRKG--EFDEETVKRASLSTALWL-KEKGQKSVVIAYDTRKNSREFAELAGRVFAGEGLEAYVFPEPT--PTPVLSFAVRYMKAGGGVVVTASHNPPEYNGYKVYTWNGVQAIPEYTDEIT----EIYKKVDTSRVKEGE-IKFVPPEVKESYINTVLELV--SNLPMKTDLDIAYSPLHGTGANYVPEVLKRLGFK-VRLVEEQMKPDPNFSTAPTPNPEE----DEALVLLNKKGATLGLATDPDCDRVGVVFRGRR----LTGNQVGVLLTDFLLDYVKVE-NPLVIKTIVTTDMVRPICEEKGAFLEETPTGFKFIGHLIEEHSRKGDRNFVFGFEESCGYLAGTHARDKDGVVGSVLSAIAFSNHDPYEK-----LEELYQKHGYYMEKLINFKV------EDVEKAIKIYESLKTRNDIIDYSKGYGNVIPNETIAFVFEKSR-IFVRPSGTEPKLKVYIHVRGDTREEAEELIRENEKKIEEILK 470
>gi|146328893|ref|YP_001209799.1| phosphoglucomutase/phosphomannomutase [Dichelobacter nodosus VCS1703A] >gi|146232363|gb|ABQ13341.1| phosphoglucomutase/phosphomannomutase [Dichelobacter nodosus VCS1703A] (538 aa)
Score = 534, Expect = 2.6e-52, Identities = 162/535 (30%), Positives = 265/535 (49%)
  Q:    20 SKAWLESNRISNKYKEL---ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVIL----TTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFT-HYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMW---------VKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           ++AWL  +  S    EL   I   +E E+ + F   +L FGTAG+R  +  G N +N     Q + G+AR+L   K    V++ +D R ++  +A   A+ L + GI+ +L  +  ++ TP++++++R    DA ++ TASHNP    G+KVY    H G QI+     +I + +      +     P          ++ + Y E +        +++ K  PV++    T  HG  +  L   L ++G     L   Q  PD NF   A  NPE+K + DL+++ A+K  A  ++  DPD+DRLAV +   +  W  L GN +G+    H     +   K      + VS+  + +IA  Y+     TPTGFKW+G      I+ + F  GFEEA+G L ++D   DKDG  AA   L++   L  Q KT +DY+     +FGA+  + +S +IE         EK+++  NV  +     ++   R       L+  + ++M          V  R SGTEPK KIY + + + ++   +I   L    E  L+
  S:     8 AQAWLAQDPDSETRAELQAFIDANDEAELKRRFE-GRLQFGTAGLRGRLQAGPNGMNRVLVAQAAAGLARYLGAGKK---VVIGYDGRKHSRRFAKDTAEILQASGIEAYLMPD--LRPTPVLAFALRVYQADAGVMVTASHNPAEDNGYKVYLGGEHRGAQIVPPADADIAAEIDYVAQHLRVNELPRDIHYHLIPMSVIDQYIERT------AAVFQSK--PVLMNYVYTAMHGVGTETLLDTLHAVGLTQPQLVETQAQPDANFPTVAFPNPEEKGALDLAIELAKKVNAEFIIANDPDADRLAVALPSSEGVWERLHGNMVGLYLAWHLAQRAQAQGKKGVFACSLVSSPLLKKIAAAYDMTYQETPTGFKWIG-----RIEGLIF--GFEEALGYLVDADKVADKDGISAAIAFLDLMATLKAQGKTFLDYMQAFQAQFGAFHSQQISIRIED-------NEKINRIINVLREKPFE-KVGDYRVMHYCDHLKTAMASNMLVFELVDGHRVIVRPSGTEPKLKIYLDTFADNQKTAAEIAAQLAMNIEQFLK 535
>gi|71897287|ref|NP_001026554.1| phosphoglucomutase 2 [Gallus gallus] >gi|53136744|emb|CAG32701.1| hypothetical protein [Gallus gallus] (609 aa)
Score = 532, Expect = 4.4e-52, Identities = 169/527 (32%), Positives = 272/527 (51%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVY-TPNMDLISYFDD---TITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT---NKKFD----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILG-----LEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--------ETKEICDQILKALKDEF 549
           W ++ + S   KEL+ + N EE+ KYF  S++ FGTAG+RA MG G + +N  T  Q ++G  R+L    +   N  V++  D R +      +  +A + A T  S G+ V+L+ +  +  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++ E +      +    +D  +   D   TI + YF+   +   + NI ++ N   + T+ HG     +    K+          +Q  PDP F      NPE+ K    LS   AEK  A I+L  DPD+DRLAV  + ++ +W   +GN++G +   ++ T   N+  D    K  +++S+ VS+  +  IA K       T TGFKW+GN   + +D+   V+  FEEAIG +      DKDG  AA +  E+ + L  +  +L   L  +++E+G    +  SY I   +  + +Q+  D   N   KD         ++ GIR                   ++ +Q + +   N      R SGTEPK K Y E+          + K+  D+++ AL+  F
  S:    22 WDQNPKTSAIVKELVAEGNVEELQKYFG-SRMEFGTAGLRAAMGAGISHMNDLTIIQTTQGFCRYLEKNFSDLKNRGVVIGFDARAHLSSGGSSKRFARLAANTFISQGVPVYLFSD--VTPTPFVPYTVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIISPHDKGISQAIEENKEPWPQAWDDKQIDSSALLHDPYATINKEYFKDIQKQCFHRNINKETNLKFVHTSVHGVGHKFVQLAFKAFDLRPPFAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALAEKDGAKIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKNQNRDACAIKDVYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLMDQGKAVLFAFEEAIGYMCCPAVLDKDGVSAAVITAEMASFLATRNLSLSQQLKAVYDEYGFHITKA-SYFI--CHDPKVIQQLFDNLRNYDGKDTYPKSCGRFKVSGIRDLTTGYDSSQPDLKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYSELCAPPGNSDVEQLKKELDELVSALEKHF 596
>gi|126663478|ref|ZP_01734475.1| phosphomannomutase [Flavobacteria bacterium BAL38] >gi|126624426|gb|EAZ95117.1| phosphomannomutase [Flavobacteria bacterium BAL38] (583 aa)
Score = 532, Expect = 4.5e-52, Identities = 167/526 (31%), Positives = 277/526 (52%)
  Q:     7 KNPSSMHANVNPLSKA--WLE---SNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTN----KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQA------------------LEWYLENDMWVKFRLSGTEPKFKIYYEIYG 532
           K  ++MH   + L+K   WL     N   +  KE++     +E+++ F Y  L FGT G+R  MG GTN+IN +T  + ++G++ +L   KS P     V +A+D R N++  A V+A   ++ GI V+L+ +  ++ TP +S++VR     A I+ TASHNP  Y G+KVY   GGQ++  +  EI+  + + +   +  +  N +LI Y D  + E++ +++      NT    + N  ++ T+ HGT+   +P +L   GY ++ +  +Q  P+ +F    + NPE+  +  +++  A+K  A++++G DPDSDRL V VR        L GNQ  +I T ++L       KF    F+ ST VST  +  +A  Y+ +     TGFKW+   + K      FV G EE+ G +  D  RDKD   A  L  E+         +L   L  ++ +FG +    +S   + +    E+++ M        K+I G  +  I   + A+                   L +YLE+   +  R SGTEPK K Y+ + G
  S:     4 KRNNNMHIEQSILNKVNEWLTPTFDNATQDAIKEMMTSA-PKELEESF-YKNLEFGTGGMRGVMGVGTNRINKYTLGKNTQGLSDYL--HKSFPNEQLKVAIAYDCRHNSNTLAKVVADVFSANGIHVYLFSD--MRPTPELSFAVRYLNCHAGIVLTASHNPPEYNGYKVYWQDGGQLVPPQDAEIIKVIEDLK-YSEIKFEANNNLIEYIDTKVDEAFAKSTIENASFNTQTEAKANLKIVYTSLHGTSIKAIPNVLAKAGYTDVNIVPEQAEPNGDFPTVVSPNPEEPEALSMAIALADKIGADMVVGTDPDSDRLGVAVRDLDGNIKLLNGNQTMVIMTAFLLEQWKRADKFKGNEFIGSTIVSTPMMLELAAAYDVECKVGLTGFKWIAKFI-KDFPNQKFVGGGEESFGYMVGDAVRDKDAVAAILLVSEIAAQAKASGSSLYQELLNLYIDFGFYKESLISITKKGIEGANEIKQMMIDLRENPLKEINGQRVICIEDYQTAKGKYFMNNEEFEIHIPKSNVLIYYLEDGSKICARPSGTEPKIKFYFSVNG 554
>gi|52424826|ref|YP_087963.1| CpsG protein [Mannheimia succiniciproducens MBEL55E] >gi|52306878|gb|AAU37378.1| CpsG protein [Mannheimia succiniciproducens MBEL55E] (553 aa)
Score = 530, Expect = 7.8e-52, Identities = 158/502 (31%), Positives = 247/502 (49%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN-PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS------YFDDTITESYFE--ASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFT-HYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE----IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A ++     N P++++ +D R N+D +A   A+ ++  GIK +L        TP+++Y++      A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V   N+  +         DD + ++Y E  AS      T+I    N+  + T  HG     L   L+  G     L  +Q  PD  F   +  NPE+K + DL++K A+K  A  ++  DPD+DRLAV +   K  W  L GN +G +   H         K   +  + VS+  +  IA+KY  +   T TGFK++G            + GFEEAIG L + D  RDKDG  A+   L++   L  Q KT++DY++E   EFGA+    +S ++  L    E+ + M    N    +I G +    I  ++       L + LEN   +  R SGTEPK K Y +  G+     D +L    +    +LR
  S:    49 RLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYIKQYDHNAPSIVIGYDGRKNSDIFARDTAEIMSGAGIKAYLLPRKL--PTPVLAYAINYFDATAGVMVTASHNPPEDNGYKVYLGKENGGGQIVSPADKDIAA-------LIDKVAAGNIKNLPRSQDYVVLDDQVVDAYIEKTASIAQEPRTDI----NY--VYTAMHGVGYEVLSKTLQKAGLSQPHLVKEQVYPDGTFPTVSFPNPEEKGALDLAVKLAKKQNAEFIIANDPDADRLAVAIPDAKGNWKSLHGNVLGCLLGWHLAKKYHAAGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGKVKG-------LLFGFEEAIGYLVDPDKVRDKDGISASVAFLDLVLYLKKQGKTILDYMNEFNREFGAYVSGQISIRVSDLT---EISKLMTALRNNPPSEIGGFKVTQFIDHLKTERNNDILVFTLENGSRLITRPSGTEPKIKFYLDAKGKDALDADNVLAQFDESVRALLR 544
>gi|183221690|ref|YP_001839686.1| phosphomannomutase (phosphomannose mutase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911765|ref|YP_001963320.1| Phosphomannomutase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776441|gb|ABZ94742.1| Phosphomannomutase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167780112|gb|ABZ98410.1| Phosphomannomutase (Phosphomannose mutase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (584 aa)
Score = 528, Expect = 1.4e-51, Identities = 152/474 (32%), Positives = 258/474 (54%)
  Q:    54 LSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL---DSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ------KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKT-LVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKG----------------------IRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIY 527
           LSFGT GIR  +G G  ++N++T  + + G   +L + K +P++++A+D+R  +  +A + A    + G+KV+L+   ++  TP++SY++R       I+ TASHNP  Y GFK Y   GGQ++   DS   + +S + +  +I      D VY         F  T+    F+   + L    I  Q       N  ++ +  HGT    +  + +  GY+++ L  +Q  PD  F      NPE+K +  L   +A+K +A + +  DPD+DRL V VR  + ++ YL GNQ+G I   Y+   KK   K   +V T V+T+  + IA+K   K+    TGFK++  EM +   K +  F+ G EE+ G L     RDKD   +A L +E+       EKT L+ YL+EI+ ++G +     S  +E  + +E++++ ++   +++ K+++G  I G                       +    +  ++  LE +  +  R SGTEPK K+Y
  S:    47 LSFGTGGIRGKIGYGIGKMNLYTVGRAALGFLSYLRDTKKSPSIVIAYDSRRMSKEFAELSAGIGATLGVKVYLFP--KVTPTPLLSYAIRYFEASGGIVITASHNPPEYNGFKAYLADGGQLVPPDDSLIIQRISGIEDWTSIPMISKTDKVYKK-------FVKTVGPDCFQNYLKELKKAGIQSQAKPKTRNNLKIVYSPLHGTGGEYMKEMFQYFGYKSVFLVPEQKKPDGEFPTVKYPNPEEKEALALCEFHAKKKKAEVFIATDPDADRLGVGVRKPDGEYEYLNGNQIGSIMAAYLSERKKQKGKVYHLVKTIVTTDLQEAIAKKNGIKIKNVLTGFKYIAEEMKQIESKKNNLFLFGGEESYGYLPVPFVRDKDSLSSALLFIEILA-----EKTDLLTYLNEIYLKYGLYRESLYSLTLEGSSGQEKIKQSIE---SLRTKNLIGKLIGGRKVISVLDYETQKADGKGKSSVFKGMPKSNVIQVELEGNAKLTIRPSGTEPKVKVY 544
>gi|165976005|ref|YP_001651598.1| phosphomannomutase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876106|gb|ABY69154.1| phosphomannomutase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (552 aa)
Score = 528, Expect = 1.5e-51, Identities = 158/502 (31%), Positives = 253/502 (50%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM-DL-----ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V   N+ DL      +  DD I E+Y E +    +      + N+  + T  HG     L   L+  G     L A+Q  PD +F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV +   +  W  L GN +G +   Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G      ++ + F  GFEEA+G L + D  RDKDG  AA + L+    L  Q KTL D + +   EFGA+    +S ++  L+   E+ + M    N     I G  +  +    + +  +  L + LEN   +  R SGTEPK K Y +  G+     D++L    +    +LR
  S:    49 RLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYLKGYDKAPSIVIGYDGRKNSDVFARDTAEIMAGAGIKAYLLPRKL--PTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIADLPRSQDFTVLDDEIVEAYIEKT--AALAKEQAAEINY--VYTAMHGVGYEVLSKTLEKAGLPQPHLVAEQIQPDGSFP-TVNFPNPEEKGALDLAIKLAKEKNAEFIIANDPDADRLAVAMPDAQGNWKGLHGNVVGCLLGWYLAKQYHAQGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGK-----VNGLLF--GFEEALGYLVDPDKVRDKDGISAAIVFLDFIRNLKAQGKTLQDAITDFNNEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPSAIGGFNVAQLIDHTKTDRQSDILVFVLENGSRLITRPSGTEPKIKFYLDAKGKDAADADKVLSQFDESVRELLR 543
>gi|194540036|ref|YP_002075079.1| Phosphomannomutase [Vibrio sp. Ex25] >gi|151938591|gb|EDN57427.1| Phosphomannomutase [Vibrio sp. Ex25] (567 aa)
Score = 527, Expect = 1.7e-51, Identities = 164/516 (31%), Positives = 270/516 (52%)
  Q:    15 NVNPLSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT--------ITESYFEASYRCLINTNIY----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE---------------------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           ++  L   WLE +   +   + + L+   NE+E+   F  S+L+FGTAG+R  +G G N++N    Q+ + G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV+L  +  + ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+    + I +        ID+  T  + L+S  DD         + + Y++ +YR  +N N         +  +  T  HG  +     LL   G++ +    +Q  PD +F  + NF NPE+  + D+ +   +   A+I    DPD+DR AV V R   ++  LTG+Q+G +F  Y+L  +       V +T VS+  +  IA+ + A+ ++T TGFKW+ N  M +  +   F+  +EEA+G    +   DKDG  A     ++   L  Q KTL D L+E++ E G +     S  ++                      +   E+++  +  F +   + I          + PA   L ++LE+   V  R SGTEPK K YYE+
  S:     3 DMTALITQWLERDPDPKTREELQHLVDTNNEQELTDRFG-SRLAFGTAGLRGKVGAGPNRMNRLVIQETATGLGNYLLEQVKDAASRGVVIGYDGRPDSKQFAHDTASVLTALGIKVYLTYD--VAATPIVAFGVRTLNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAAK-------IDDATTKPLPLMS-LDDAKQRGLLVWLKDGYYQ-TYRKTMNENALLTPDNNTDISIAYTAMHGVGANMAETLLADAGFKKVASVKEQREPDGSFP-TVNFPNPEEAGAMDMVMALGKSVDADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLLEQQ---SNALVGNTIVSSRMLSSIAKAHGAQYYQTLTGFKWLTNVAMEQETEANPFLFAYEEALGYTVGNKVWDKDGLSAIVAFAQLTGKLKAQGKTLWDKLEELYREHGFYFNAQRSIALDPNSPPIGDKLRANPPTEIAGKKVAVTEDLKTSVRMFDDGSEESI----------DLPASDVLIYHLEDQSRVIVRPSGTEPKLKCYYEV 535
>gi|124802225|ref|XP_001347407.1| phosphoglucomutase, putative [Plasmodium falciparum 3D7] >gi|23494986|gb|AAN35320.1|AE014830_64 phosphoglucomutase, putative [Plasmodium falciparum 3D7] (593 aa)
Score = 526, Expect = 2.4e-51, Identities = 164/517 (31%), Positives = 273/517 (52%)
  Q:    37 ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK-----SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQIL----DSEANEIVSSMP----ECQTIIDNVYTPNMDLISYFDDTITESY--FEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN---KKFDKTPFV-VSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN-----WKEEMQEKMDKFANVKNKDILGL------------EIKGIRWNEP-AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           ILK N+EE  K     +L+FGTAG+R  M  G N +NV T  Q ++G+  +L+N        N  +I   D R +++ +A V A    S G +V+L+   Q  ATPI+ YS  +      ++ TASHNPK   G+KVY   G QI+     + +N I++++       + + +N Y  +  L+   +D   E Y  F    +   N N YR  +    ++ +  HG     +  ++  +G+ N++   QQ +PD +F+  +  NPE+K + D+S++ A+K  + I++  DPD+DR A   +  NKW   +G+++GIIF ++++     K  DK+  V + T V +  + ++ EKY  K   T TGFKW+ N+  ++ ++    +  +EEA+G   +   +DK G  A    +E+   LY+   T   YL+ I EE G +      Y +   N     + E     + K  N+ +  I+ +            + K +    P +Q +  + EN   +  R SGTEPK K Y EI  +T E   + +  L DE   M 
  S:    32 ILKKNDEEELKCLFLKRLNFGTAGLRGKMCVGFNAMNVVTIMQTTQGLCSYLINTYGLNLCKNRGIIFGFDGRYHSESFAHVAASVCLSKGFRVYLFA--QTVATPILCYSNLKKNCLCGVMVTASHNPKLDNGYKVYASNGAQIIPPVDKNISNCILNNLEPWKDAYEYLNENFYLKDTSLV---EDIYFEMYDSFMDDLKHEFNFNCYRNSRTKLAIVYSPMHGIGRKFVQGIMHVVGFNNLLTVPQQALPDSDFSTVSFPNPEEKGALDMSMELADKVCSPIVVANDPDADRFACAEKFNNKWKVFSGDELGIIFAYHLMKQYEKKNIDKSKHVFLCTVVCSRMLKKLCEKYGYKYDETLTGFKWIINKAIEYNEQNYTILYCYEEALGHALTRHVKDKCGISALGYWIEIAVYLYENNLTFHQYLETIREEIGYFVNNNGYYIVLDSNDIVSIFNEFRSNGLYK-TNLGSYKIIHIRDLTTGYDSTTADKKSLIAPTPDSQNITIHFENTAILTIRASGTEPKVKWYAEISRDTYEQAKKEIDQLIDEVMPMF 582
>gi|126331831|ref|XP_001374449.1| PREDICTED: hypothetical protein [Monodelphis domestica] (703 aa)
Score = 526, Expect = 2.5e-51, Identities = 166/527 (31%), Positives = 265/527 (50%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT-------NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI--------YGETKEICDQILKALKDEF 549
           W ++ +     K++I   N  E+ K F  S++ FGTAG+RA MGPG  Q+N  T  Q ++G+ R+L    S+     V++ +D R +      +  +A + A    S G+ V+L+  + I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++ E         D+    N  L      TI   YFE   +   + NI +      + T+ HG     +    K+  +       +Q  PDP F      NPE+ K    LS   AEK +A I+L  DPD+DRLAV  + +N +W   +GN+MG +   ++ T       ++   K  +++S+ VS+  +  IA K       T TGFKW+GN   + ID+   V+  FEEAIG +      DKDG  AA ++ E+ + L  +  +L   L  I+ E+G    +   +     N  + + E +  +    N  K     E+ GIR                   ++ +Q + +   N      R SGTEPK K Y E+        + + K+  D+++ A+++ F
  S:   116 WDKNPKTLEMVKQIIANNNRVELQKCFG-SRMEFGTAGLRAAMGPGFAQMNDLTIIQTTQGLCRYLEKTFSDLKKRGVVIGYDARAHPSSGGGSKRFAQLAATAFISQGVPVYLF--SNITPTPFVPYTVSHLNLCAGIMVTASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWTKAWDDSIINNNPLHHDPYSTINNDYFEDLKKYCFHRNIDQSTQLKFVHTSVHGVGHDFVQSAFKAFDFVPPDAVPEQKAPDPEFPTVKYPNPEEGKGVLTLSFALAEKTQAKIILANDPDADRLAVAEQQENGEWKVFSGNEMGALLGWWLFTCWKEKNQDQNALKDLYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNMSLAQQLKAIYVEYGYHITKASYFICHDQNIIQNLFENLRNYDGKNNYPKTCGKFEVSGIRDLTTGYDSSQPDKKAILPTSKSSQMITFTFANGGVATLRTSGTEPKIKYYAELCVPPGNSDHEQLKKELDELVSAIEEYF 690
>gi|28900390|ref|NP_800045.1| putative phosphomannomutase [Vibrio parahaemolyticus RIMD 2210633] >gi|28808701|dbj|BAC61878.1| putative phosphomannomutase [Vibrio parahaemolyticus RIMD 2210633] (564 aa)
Score = 525, Expect = 3.5e-51, Identities = 163/512 (31%), Positives = 268/512 (52%)
  Q:    19 LSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT--------ITESYFEASYRCLINTNIY----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE---------------------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           L   WL  +   +   + + L+   NE+E+   F  S+L+FGTAG+R  +G G N++N    Q+ + G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV+L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+    + I +        ID   T  + L+S  DD         + + Y++ +YR  +N N         +  +  T  HG  +     LL   G++ +   A+Q  PD  F  + NF NPE+  + D+ +   +   A+I    DPD+DR AV V R   ++  LTG+Q+G +F  Y+L  +       V +T VS+  +  IA+ + A+ ++T TGFKW+ N  M++  ++  F+  +EEA+G    +   DKDG  A     ++   L  Q KTL D L+ ++ + G +     S  ++                      ++  E+++  +  F +   + I          + PA   L ++LE+   V  R SGTEPK K YYE+
  S:     4 LITQWLARDPDPKTREELQHLVDTNNEQELSDRFG-SRLAFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLLEQVQDAASRGVVIGYDGRPDSKQFAHDTASVLTALGIKVYL--TYQVAATPIVAFGVRTMNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAAK-------IDEATTKPLPLMS-LDDAKQQGLLVWLEDDYYQ-TYRKTMNENALLTPDSNTDISIAYTAMHGVGADMAETLLADAGFKKVASVAEQREPDGTFP-TVNFPNPEEAGAMDMVMALGKSVDADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLLEQQ---PNSLVGNTIVSSRLLSSIAKAHGAEYYQTLTGFKWLTNVAMSQETEQHPFLFAYEEALGYTVGNKVWDKDGLSAIVAFSQLTGKLKAQGKTLWDKLEALYRQHGFYFNAQRSIALDPNSPPIGDKLRANPPSEIAGKKVSVTEDLKTSVRTFEDGSEETI----------DLPASDVLIYHLEDKSRVIVRPSGTEPKLKCYYEV 532
>gi|118121115|ref|XP_001236252.1| PREDICTED: hypothetical protein, partial [Gallus gallus] (585 aa)
Score = 524, Expect = 3.8e-51, Identities = 167/516 (32%), Positives = 267/516 (51%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVY-TPNMDLISYFDD---TITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT---NKKFD----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILG-----LEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--------ETKEICDQILKALKDEF 549
           KEL+ + N EE+ KYF  S++ FGTAG+RA MG G + +N  T  Q ++G  R+L    +   N  V++  D R +      +  +A + A T  S G+ V+L+ +  +  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++ E +      +    +D  +   D   TI + YF+   +   + NI ++ N   + T+ HG     +    K+          +Q  PDP F      NPE+ K    LS   AEK  A I+L  DPD+DRLAV  + ++ +W   +GN++G +   ++ T   N+  D    K  +++S+ VS+  +  IA K       T TGFKW+GN   + +D+   V+  FEEAIG +      DKDG  AA +  E+ + L  +  +L   L  +++E+G    +  SY I   +  + +Q+  D   N   KD         ++ GIR                   ++ +Q + +   N      R SGTEPK K Y E+          + K+  D+++ AL+  F
  S:     9 KELVAEGNVEELQKYFG-SRMEFGTAGLRAAMGAGISHMNDLTIIQTTQGFCRYLEKNFSDLKNRGVVIGFDARAHLSSGGSSKRFARLAANTFISQGVPVYLFSD--VTPTPFVPYTVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIISPHDKGISQAIEENKEPWPQAWDDKQIDSSALLHDPYATINKEYFKDIQKQCFHRNINKETNLKFVHTSVHGVGHKFVQLAFKAFDLRPPFAVPEQKDPDPEFQRVKYPNPEEGKGVLTLSFALAEKDGAKIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKNQNRDACAIKDVYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLMDQGKAVLFAFEEAIGYMCCPAVLDKDGVSAAVITAEMASFLATRNLSLSQQLKAVYDEYGFHITKA-SYFI--CHDPKVIQQLFDNLRNYDGKDTYPKSCGRFKVSGIRDLTTGYDSSQPDLKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYSELCAPPGNSDVEQLKKELDELVSALEKHF 572
>gi|163751969|ref|ZP_02159180.1| phosphoglucomutase/phosphomannomutase family protein [Shewanella benthica KT99] >gi|161328127|gb|EDP99294.1| phosphoglucomutase/phosphomannomutase family protein [Shewanella benthica KT99] (573 aa)
Score = 524, Expect = 4.0e-51, Identities = 158/510 (30%), Positives = 264/510 (51%)
  Q:    21 KAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQT----IIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW--TGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGL-EIK-GIRW---------NEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           K WL+ +   R   + + LI   NE E+ + FS  +L+FGTAG+R  +  G   +N    QQ S G+  +L  + S+     V++ +D R ++  +A   A  LT+ GIKV+L    ++  TP++++ V      A I+ TASHNP  Y G+KVY   G QI+    + I + + +  T    ++D         +   +D   +SY +      +  N  + +   +  T  HG  +     +L   G   +   A Q  PD +F  + NF NPE+K + DL +  A+K+ A +    DPD+DR AV VR     +  LTG+Q+G++F HY++T+   ++   + +T VS++ + ++A   +A    T TGFKW+ N  M +  +    +  +EEA+G +   +  DKDG  A     ++   L  Q  T+ D L+ I+ E G    T  +++ K  + N    +++++     +  K +L   +I+ G+R          + PA   L + LE    V  R SGTEPK K YYE+
  S:    10 KHWLDKDPDPRSRQELQALIDNGNEAELQRRFS-GRLAFGTAGLRGVVEAGPMGMNRLVVQQTSAGLGAYLKQQVSDVDTRGVVIGYDGRHDSKQFAHDAAGVLTAMGIKVYL--TCKVAPTPLVAFGVIHLDAAAGIVVTASHNPPQYNGYKVYWGNGAQIIPPHDSGIAACIDKAATESIHLLDLESAKARGKLIMLEDDFYQSYRQGIKDAAVLQNHTQPELVSLSYTAMHGVGAEMAETVLADAGVTQVYSVAAQREPDGDFP-TVNFPNPEEKGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRTEAGDYQMLTGDQVGVLFGHYLMTHAAKNQR-LICTTIVSSSLLSKVAASLDATCLTTLTGFKWLTNVGMAEQTEDNQCLFAYEEALGYMVGSMVWDKDGLSALVAFAQLTAELASQGLTIWDRLEAIYREHGFHLNTQVSIALKPSTPNIGAYLRKELPSV--IAGKQVLSTDDIRCGLRTFKDGTSEVIDLPASDVLIFKLEGGGRVIVRPSGTEPKIKCYYEV 539
>gi|167856326|ref|ZP_02479056.1| YhxB [Haemophilus parasuis 29755] >gi|167852556|gb|EDS23840.1| YhxB [Haemophilus parasuis 29755] (552 aa)
Score = 523, Expect = 5.6e-51, Identities = 152/502 (30%), Positives = 248/502 (49%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ + + GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     EI + + +  Q  I ++  P     +  DD I ++Y   +           Q +   + T  HG     L   L   G     + A+Q  PD  F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV V   +  W  L GN +G     Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G      ++ + F  GFEEA+G L + D  RDKDG  AA + L++   L  Q KTL DY D+   EFGA+    +S +++ L+    + + M         ++ G ++       + +  +  L + LEN   +  R SGTEPK K Y +  G   +  +++L         +LR
  S:    49 RLQFGTAGLRGRLQAGSMGMNRVLVAQTAGGLAEFLKGYDKEPSIVLGYDGRKNSDVFARDTAEIMAAAGIKTYLLPRKL--PTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADQEIAACIDKVAQGSIKDL--PRSQNYTVLDDEIVDAYIAKTASLAKEP----QVDINYVYTAMHGVGYEVLSKTLAKAGLPQPSIVAEQVWPDGTFP-TVNFPNPEEKGALDLAIKVAKERNAEFIIANDPDADRLAVAVPDAQGNWKPLHGNVIGCFLGWYLAKQYHAQGKKGILACSLVSSPALAEIAKKYGFESEETLTGFKYIGK-----VNGLLF--GFEEALGYLVDPDKVRDKDGISAAIMFLDLVRNLKKQGKTLADYADDFTREFGAYVSGQISIRVDDLS---AIGKLMTALRTNPPSEVGGFKVATFLDHTKTDRQSDILVFVLENGSRLIARPSGTEPKIKFYLDARGTDPKNAEEVLAQFDASVRAILR 543
>gi|153837366|ref|ZP_01990033.1| phosphomannomutase [Vibrio parahaemolyticus AQ3810] >gi|149749281|gb|EDM60060.1| phosphomannomutase [Vibrio parahaemolyticus AQ3810] (564 aa)
Score = 522, Expect = 6.6e-51, Identities = 163/512 (31%), Positives = 267/512 (52%)
  Q:    19 LSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT--------ITESYFEASYRCLINTNIY----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE---------------------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           L   WL  +   +   + + L+   NE+E+   F  S+L+FGTAG+R  +G G N++N    Q+ + G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV+L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+    + I +        ID   T  + L+S  DD         + + Y++ +YR  +N N         +  +  T  HG  +     LL   G++ +   A Q  PD  F  + NF NPE+  + D+ +   +   A+I    DPD+DR AV V R   ++  LTG+Q+G +F  Y+L  +       V +T VS+  +  IA+ + A+ ++T TGFKW+ N  M++  ++  F+  +EEA+G    +   DKDG  A     ++   L  Q KTL D L+ ++ + G +     S  ++                      ++  E+++  +  F +   + I          + PA   L ++LE+   V  R SGTEPK K YYE+
  S:     4 LITQWLARDPDPKTREELQHLVDTNNEQELSDRFG-SRLAFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLLEQVQDAASRGVVIGYDGRPDSKQFAHDTASVLTALGIKVYL--TYQVAATPIVAFGVRTMNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAAK-------IDEATTKPLPLMS-LDDAKQQGLLVWLEDDYYQ-TYRKTMNENALLTPDSNTDISIAYTAMHGVGADMAETLLADAGFKKVASVADQREPDGTFP-TVNFPNPEEAGAMDMVMALGKSVDADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLLEQQ---PNSLVGNTIVSSRLLSSIAKAHGAEYYQTLTGFKWLTNVAMSQETEQHPFLFAYEEALGYTVGNKVWDKDGLSAIVAFSQLTGKLKAQGKTLWDKLEALYRQHGFYFNAQRSIALDPNSPPIGDKLRANPPSEIAGKKVSVTEDLKTSVRTFEDGSEETI----------DLPASDVLIYHLEDKSRVIVRPSGTEPKLKCYYEV 532
>gi|91228803|ref|ZP_01262711.1| putative phosphomannomutase [Vibrio alginolyticus 12G01] >gi|91187644|gb|EAS73968.1| putative phosphomannomutase [Vibrio alginolyticus 12G01] (564 aa)
Score = 522, Expect = 7.1e-51, Identities = 163/512 (31%), Positives = 268/512 (52%)
  Q:    19 LSKAWLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT--------ITESYFEASYRCLINTNIY----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIE---------------------SLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           L   WLE +   +   + + L+   NE+E+   F  S+L+FGTAG+R  +G G N++N    Q+ + G+  +LL +  +     V++ +D R ++  +A   A  LT+ GIKV+L  +  + ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+    + I +        ID+  T  + L+S  DD         + + Y++ +YR  +N N         +  +  T  HG  +     LL   G++ +    +Q  PD +F  + NF NPE+  + D+ +   +   A+I    DPD+DR AV V R   ++  LTG+Q+G +F  Y+L  +       + +T VS+  +  IA+ + A+ ++T TGFKW+ N  M +  +   F+  +EEA+G    +   DKDG  A     ++   L  Q KTL D L+E++ E G +     S  ++                      +   E+++  +  F +   + I          + PA   L ++LE+   V  R SGTEPK K YYE+
  S:     4 LITQWLERDPDPKTREELQHLVDTNNEQELTDRFG-SRLAFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLLEQVKDAASRGVVIGYDGRPDSKQFAHDTASVLTALGIKVYLTYD--VAATPIVAFGVRTLNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAAK-------IDDATTKPLPLMS-LDDAKQHGLLVWLEDDYYQ-TYRKTMNENALLTPDNNTDISIAYTAMHGVGANMAETLLADAGFQKVASVKEQREPDGSFP-TVNFPNPEEAGAMDMVMALGKSVDADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLLEQQ---PNALIGNTIVSSRMLCSIAKAHGAQYYQTLTGFKWLTNVAMEQETETNPFLFAYEEALGYTVGNKVWDKDGLSAIVAFSQLTGKLKAQGKTLWDKLEELYREHGFYFNAQRSIALDPNSPPIGDKLRANPPTEIAGKKVAVTEDLKTSVRMFDDGSEESI----------DLPASDVLIYHLEDQSRVIVRPSGTEPKLKCYYEV 532
>gi|108759054|ref|YP_633855.1| putative phosphoglucomutase/phosphomannomutase [Myxococcus xanthus DK 1622] >gi|108462934|gb|ABF88119.1| putative phosphoglucomutase/phosphomannomutase [Myxococcus xanthus DK 1622] (575 aa)
Score = 522, Expect = 7.3e-51, Identities = 151/487 (31%), Positives = 240/487 (49%)
  Q:    44 EIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTV-----IVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID-NVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEM--NKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           E++  FS   L FGTAG+R  +G G N++N    ++ + G+AR+L  K+  P V     +V  D R  +   A   A  L + GI   ++ E     TP+++++       AA++ TASHNP  Y G+KVY   G QI+      I S++   +      + TP           +  +  +A  R ++   +  +  ++  ++ T  HG         L+  G+  +   A+Q  PD  F      NPE+  + DL+   AE+ +A+++L  DPD+DRLAV+ R  +     LTGN++G++  HYVLT       P VV+T VS+  +  IA    A      TGFKW+ N     +  +   FV G+EEA+G     + RDKDG  +A +  ++      +  T++ YL+EI    G + G   ++        + ++  MD F     KDI G  +       KG R   P+  +   LE+   V  R SGTEPK K Y+E+
  S:    37 ELEDRFS-QDLEFGTAGLRGVLGAGPNRMNRAVIRRTTAGLARYL--KEQVPDVATRGVVVGRDARNLSAELAEDTAAVLAAEGIPAHVFPEPV--PTPLVAFAALHLNAAAAVMVTASHNPPEYNGYKVYWGNGAQIIPPHDTGIASAIARVEPANRVPLLTPADARAKGLWRDLPAAIGDAYVRAILGLRVVGKGSESLSIVYTAMHGVGGDWAVRALREAGFPRVTPVAEQQQPDGRFPTVRFPNPEEPGAMDLATATAERVKADVVLANDPDADRLAVMARDADGSLRLLTGNEVGVLLGHYVLTQGAKQGKPHVVTTIVSSAQLGDIARSLGAACDEVLTGFKWIANRALEREQAEGTRFVFGYEEALGYTVGTVTRDKDGVGSALVMADLAAWCQARGTTVLGYLEEIQRAHGLYVGAQRNFTFPGAAGAQVIRGIMDAFRASPPKDIGGDAVRAVSDYKKGERGLPPSNVVALELESGGRVTLRPSGTEPKIKYYFEL 536
>gi|167395885|ref|XP_001741790.1| phosphoglucomutase-2, putative [Entamoeba dispar SAW760] >gi|165893502|gb|EDR21744.1| phosphoglucomutase-2, putative [Entamoeba dispar SAW760] (583 aa)
Score = 521, Expect = 9.1e-51, Identities = 166/533 (31%), Positives = 270/533 (50%)
  Q:    23 WLESNRISNKYKE---LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVA---RWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDD--TITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKF----DKTP-FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM--DFVVGFEEAIGSLNSDIGRDKDGFQA----AALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD-------KFANVKNKDILGLEIKGIRWNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           WL+ ++     KE   L+   NEEE+ K F   ++ FGTAG+R  M  G N +N    QQ S+G++     L+       V++ +D R ++  +A + AK   S G K +L+  + +  TP  +++V        ++ TASHNPK   G+KVY   G QI++    +I S +    + ++     N+D+    D    ++  Y++     + +     Q     + T  HG  S  +    K+      IL   Q  PDP F      NPE+ K +   S++ AE   A +++  DPD+DRL+V V+  N W   TGN+M  +   +  T  K+    DKTP F+V + VS+++I ++ E      + T TGFKW+GN+  + +D      ++ +EEAIG +  ++  DKDG +A    AA+ALE      +Q  TL D L++++E++G +      Y        E++  KM        KF     K I  L + GI   +P            Q + +  EN      R SGTEPK K Y E+ G+     + ++  L D    +L++
  S:    11 WLKWDKTPETRKEIEDLVASKNEEELKKRFC-KRIEFGTAGLRGKMCAGFNCMNNLIVQQASQGLSLAVEELVQNAHEKGVVIGYDGRYHSKEFAAITAKVFLSKGFKTYLF--STLCPTPWTAFAVGYLKTACGVMVTASHNPKADNGYKVYWENGCQIVEPIDAKIASKI---HSNLEPWDLSNVDISKVIDPLADVSAEYYKQMMLTVPHFVCPEQPKVKYVYTAMHGVGSRYVQDAFKAAKLPQPILVPLQNEPDPEFPTVPFPNPEEGKGALKCSIEVAEANGATVIIANDPDADRLSVAVKSGNGWRQFTGNEMANLIADW--TYNKYIASGDKTPAFMVRSTVSSSFISKMGEVEGFDTYETLTGFKWIGNKAKEIVDTQHKKLLMAYEEAIGFVIGNMSYDKDGVRAAVCFAAMALE----YAEQGITLEDRLNQVYEKYGYFASNNKYYFCYDPKLMEKIFNKMRNNGQYYWKFGKYAVKSIRDLTV-GIDTAQPDKNPLLPVSASTQMITYTFENGCKATLRGSGTEPKLKYYIELPGKKGVKPEDVIAELMDLSHELLQA 568
>gi|126208073|ref|YP_001053298.1| phosphoglucomutase/phosphomannomutase [Actinobacillus pleuropneumoniae L20] >gi|126096865|gb|ABN73693.1| phosphoglucomutase/phosphomannomutase [Actinobacillus pleuropneumoniae L20] (552 aa)
Score = 521, Expect = 9.7e-51, Identities = 158/502 (31%), Positives = 256/502 (50%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM-DL-----ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----VKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V   N+ DL      +  DD I E+Y E +    +      + N+  + T  HG     L   L+  G     L A+Q  PD +F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV +   +  W  L GN +G +   Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G      ++ + F  GFEEA+G L + D  RDKDG  AA + L+    L  Q KTL D + +   EFGA+    +S ++  L+   E+ + M    N     + + +++ L I   + +  +  L + LEN   +  R SGTEPK K Y +  G+     D++L    +    +LR
  S:    49 RLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGIKAYLLPRKL--PTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIADLPRSQDFTVLDDEIVEAYIEKT--AALAKEQAAEINY--VYTAMHGVGYEVLSKTLEKAGLPQPHLVAEQIQPDGSFP-TVNFPNPEEKGALDLAIKLAKEKNAEFIIANDPDADRLAVAMPDAQGNWKGLHGNVVGCLLGWYLAKQYHAQGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGK-----VNGLLF--GFEEALGYLVDPDKVRDKDGISAAIVFLDFIRNLKAQGKTLQDAITDFNNEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPSAIGSFNVVQL-IDHTKTDRQSDILVFVLENGSRLITRPSGTEPKIKFYLDAKGKDAADADKVLSQFDESVRELLR 543
>gi|46143712|ref|ZP_00134557.2| COG1109: Phosphomannomutase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (552 aa)
Score = 521, Expect = 9.8e-51, Identities = 158/502 (31%), Positives = 256/502 (50%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM-DL-----ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFAN-----VKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V   N+ DL      +  DD I E+Y E +    +      + N+  + T  HG     L   L+  G     L A+Q  PD +F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV +   +  W  L GN +G +   Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G      ++ + F  GFEEA+G L + D  RDKDG  AA + L+    L  Q KTL D + +   EFGA+    +S ++  L+   E+ + M    N     + + +++ L I   + +  +  L + LEN   +  R SGTEPK K Y +  G+     D++L    +    +LR
  S:    49 RLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYLKGYDKEPSIVIGYDGRKNSDVFARDTAEIMAGAGIKAYLLPRKL--PTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIADLPRSQDFTVLDDEIVEAYIEKT--AALAKEQAAEINY--VYTAMHGVGYEVLSKTLEKAGLPQPHLVAEQIQPDGSFP-TVNFPNPEEKGALDLAIKLAKEKNAEFIIANDPDADRLAVAMPDAQGNWKGLHGNVVGCLLGWYLAKQYHAQGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGK-----VNGLLF--GFEEALGYLVDPDKVRDKDGISAAIVFLDFIRNLKAQGKTLQDAITDFNNEFGAYVSGQISIRVSDLS---EIGKLMTALRNNPPSAIGSFNVVQL-IDHTKTDRQSDILVFVLENGSRLITRPSGTEPKIKFYLDAKGKDAADADKVLSQFDESVRELLR 543
>gi|126303166|ref|XP_001377583.1| PREDICTED: hypothetical protein [Monodelphis domestica] (626 aa)
Score = 520, Expect = 1.1e-50, Identities = 166/527 (31%), Positives = 265/527 (50%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT-------NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI--------YGETKEICDQILKALKDEF 549
           W ++ +     K++I   N  E+ K F  S++ FGTAG+RA MGPG  Q+N  T  Q ++G+ R+L    S+     V++ +D R +      +  +A + A    S G+ V+L+  + I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++ E         D+    N  L      TI   YFE   +   + NI +      + T+ HG     +    K+  +       +Q  PDP F      NPE+ K    LS   AEK +A I+L  DPD+DRLAV  + +N +W   +GN+MG +   ++ T       ++   K  +++S+ VS+  +  IA K       T TGFKW+GN   + ID+   V+  FEEAIG +      DKDG  AA ++ E+ + L  +  +L   L  I+ E+G    +   +     N  + + E +  +    N  K     E+ GIR                   ++ +Q + +   N      R SGTEPK K Y E+        + + K+  D+++ A+++ F
  S:    39 WDKNPKTLEMVKQIIANNNRVELQKCFG-SRMEFGTAGLRAAMGPGFAQMNDLTIIQTTQGLCRYLEKTFSDLKKRGVVIGYDARAHPSSGGGSKRFAQLAATAFISQGVPVYLF--SNITPTPFVPYTVSHLNLCAGIMVTASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWTKAWDDSIINNNPLHHDPYSTINNDYFEDLKKYCFHRNIDQSTQLKFVHTSVHGVGHDFVQSAFKAFDFVPPDAVPEQKAPDPEFPTVKYPNPEEGKGVLTLSFALAEKTQAKIILANDPDADRLAVAEQQENGEWKVFSGNEMGALLGWWLFTCWKEKNQDQNALKDLYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNMSLAQQLKAIYVEYGYHITKASYFICHDQNIIQNLFENLRNYDGKNNYPKTCGKFEVSGIRDLTTGYDSSQPDKKAILPTSKSSQMITFTFANGGVATLRTSGTEPKIKYYAELCVPPGNSDHEQLKKELDELVSAIEEYF 613
>gi|62859765|ref|NP_001016701.1| phosphoglucomutase 2 [Xenopus tropicalis] >gi|89268292|emb|CAJ82739.1| phosphoglucomutase 2 [Xenopus tropicalis] (610 aa)
Score = 520, Expect = 1.1e-50, Identities = 159/508 (31%), Positives = 261/508 (51%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWL---LNKKSNPTVIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT---NKKFD----KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL--GLEIKGIR-------WNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           W ++ +     K+++    +E++   F  S++ FGTAG+RA MGPG +Q+N  T  Q ++G  R+L   +N      V++ +D R +      +  +A + A T  S GIKV+++ +  I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+    + I  S+ E      T  D++   +  L+     +I + YF+   +   + +I +      + T+ HG     +    K+  +   +   +Q  PDP FT     NPE+ K    LS   AEK  A I+L  DPD+DRLAV  + ++ +W   +GN++G +   ++ T    K  D    K  +++++ VS+  +  IA K       T TGFKW+GN   + ID+   V+  FEEAIG +      DKDG  AA +A E+ + L  +  TL   L+ IF ++G    +   +         ++ E +  +   K    L   +++  +R        N+P           +Q + +   N      R SGTEPK K Y E+
  S:    23 WDKNPKTLELVKQMVADGKKEDLQACFG-SRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNINDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSD--ITPTPFVPYAVTHLKLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEENLEPWPTAWDDIVIDDSSLLQDPYQSINKDYFKDIQKHCFHRDINKASKVKFVHTSVHGVGHKFVQSAFKAFDFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEKEGARIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKNQDPEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNSIFNKYGYHISQNSYFICYDQKTIHDLFEHLRNYNGEKAYPKLCGKIDVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAEL 570
>gi|124520841|ref|ZP_01695924.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III [Bacillus coagulans 36D1] >gi|124497292|gb|EAY44856.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III [Bacillus coagulans 36D1] (452 aa)
Score = 520, Expect = 1.2e-50, Identities = 135/410 (32%), Positives = 224/410 (54%)
  Q:   139 ISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLIS-----YFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVR-HKNKWHYLTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM---DFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKG-------IRWNE-----------PAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           +S++VR     A ++ TASHNPK Y G+KVY   GGQ+   EA+E+   +   +  +        DLI      Y  + + ++Y +   +   N  +      +F ++ T  HGT +  +   L++ G++N+ +  +Q +PD  F+   + NPE+ A+F+L+++Y E+  A+I+LG DPD+DRL V V+ H+ K+  LTGNQ G +  HY+LT K+      +   V+ T V++     IA  +      T TGFK++G ++ K  +K     F+ G+EE+ G L  D  RDKD  Q+A LA EV        KTL + L +IFE++G +     S  ++     E++   +  F      ++ G+ +         +R N             +  L+++LE+  W   R SGTEPK K Y+ +  ++    +Q  K L DE
  S:     1 MSFAVRYLNAYAGVVITASHNPKEYNGYKVYGPDGGQMPPKEADELTGYVNRVENELLVEVGEEKDLIEKGLLVYIGENVDKAYQDQLIKLRQNKEVISSVADSFKIVYTPLHGTGNLPVRRGLENFGFQNVTVVKEQELPDSEFSTVKSPNPEEHAAFELAIRYGEEIGADILLGTDPDTDRLGVAVKNHEGKYEVLTGNQTGALLLHYLLTQKQKQGTLPENGIVIKTIVTSEIGRDIARSFGIPTIDTLTGFKFIGEKI-KEFEKTGAHTFLFGYEESYGYLIGDFVRDKDAVQSAVLAAEVAAYYKSMGKTLYEGLLDIFEQYGYYKESLTSLTLKGKEGSEKIAGILANFRAHPLTEVAGIPVSAREDYQSQVRTNAKTGETSKIELPKSNVLKFFLEDGSWFCMRPSGTEPKVKFYFGVKADSLAESEQRNKRLSDE 442
>gi|47092071|ref|ZP_00229864.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b H7858] >gi|47019511|gb|EAL10251.1| phosphoglucomutase/phosphomannomutase family protein [Listeria monocytogenes str. 4b H7858] (479 aa)
Score = 520, Expect = 1.2e-50, Identities = 143/450 (31%), Positives = 237/450 (52%)
  Q:    97 VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK-KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNK-HIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD----------------KFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALK 546
           V +A+D+R ++  +A   AK L + G+KV+L   + I+ TP +S+ VRE G  A ++ TASHNP  Y GFKVY+  G QI    A EI   +     I  I     PN  L+      + ++Y +A    +   ++         +  T  HG     +   L   G+    + A+Q  PD +F    + NPE++ SF+L+ K A++ +A+I+L  DPD+DRL V V +K   +  LTGNQ+G +   Y+L  K    +   +++T V+ +   RIA  +     +T TGFK++G ++ +    + +F+ G+EE+ G L +   RDKD  QAA L  E+      +  TL+  L  ++E+FG       +  ++  +   +M + +D                 F   K  ++  +E+  I   +    L++YL ++ W   R SGTEPK KIY++  G+T+EI  + +  LK
  S:     3 VAIAYDSRHHSGAFAQDTAKVLAAQGVKVYL--SDTIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVAQEIAGYLENTTDIFTIPVRELPN-PLVMTLGKEMDDAYLKALTAVVSRPDLLADYGNELQICYTPLHGAGKELVMRGLLENGFSETTMIAEQSEPDGDFPTVVSPNPEEENSFELAKKQAKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLQYILEAKTSVTQADTMINTIVTGDLGGRIAHDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAPFVRDKDAVQAALLTAEMALFYKKEGTTLLQKLTNLYEKFGYHKEHLHTITLDDSDGTTKMNQVIDDLRKEPTCIPGITVLEDFLTSKRTNLSTMEMTNIELPK-ENVLKFYLNDNAWFAIRPSGTEPKCKIYFQTIGQTEEIATKAMDELK 471
>gi|190149905|ref|YP_001968430.1| phosphoglucomutase/phosphomannomutase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915036|gb|ACE61288.1| phosphoglucomutase/phosphomannomutase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (552 aa)
Score = 519, Expect = 1.5e-50, Identities = 156/502 (31%), Positives = 252/502 (50%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYTPNM-DL-----ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           +L FGTAG+R  +  G+  +N     Q + G+A +L      P++++ +D R N+D +A   A+ +   GIK +L        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I +       +ID V   N+ DL      +  DD I E+Y   +    +      + N+  + T  HG     L   L+  G     L A+Q  PD +F  + NF NPE+K + DL++K A++  A  ++  DPD+DRLAV +   +  W  L GN +G +   Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G      ++ + F  GFEEA+G L + D  RDKDG  AA + L+    L  Q KTL D + +   EFGA+    ++ ++  L+   E+ + M    N     I G  +  +    + +  +  L + LEN   +  R SGTEPK K Y +  G+     D++L    +    +LR
  S:    49 RLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYLKGYDKAPSIVIGYDGRKNSDVFARDTAEIMAGAGIKAYLLPRKL--PTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADKDIAA-------LIDKVAAGNIADLPRSQDFTVLDDEIVEAYIAKT--AALAKEQAAEINY--VYTAMHGVGYEVLSKTLEKAGLPQPHLVAEQIQPDGSFP-TVNFPNPEEKGALDLAIKLAKEKNAEFIIANDPDADRLAVAMPDAQGNWKGLHGNVVGCLLGWYLAKQYHAQGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGK-----VNGLLF--GFEEALGYLVDPDKVRDKDGISAAIVFLDFIRNLKAQGKTLQDAITDFNNEFGAYVSGQIAIRVSDLS---EIGKLMTALRNNPPSAIGGFNVAQLIDHTKTDRQSDILVFVLENGSRLITRPSGTEPKIKFYLDAKGKDAADADKVLSQFDESVRELLR 543
>gi|92399539|gb|ABE76511.1| phosphoglucomutase [Toxoplasma gondii] >gi|156105471|gb|ABU49221.1| phosphoglucomutase 2 [Toxoplasma gondii] (596 aa)
Score = 519, Expect = 1.5e-50, Identities = 152/495 (30%), Positives = 263/495 (53%)
  Q:    35 ELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLN----KKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQI---LDSEANEIVSSMPECQTIIDNVYTPNMDLI-------SYFDD---TITESYFE--ASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGY-ENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKK---FDKTPF-VVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNE-MNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR-------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYE 529
           EL+  + E+E+ K F  ++L FGTAG+R  MG G +++N  T QQ ++G   +L++       +  V++  D R N+  +A + A    S G +V L+ +  I  TP++ Y+V      A I+ TASHNPK   G+KVY   G QI   +DSE +  ++S  +  + +D  +     ++       S  +D   T  ++Y +  A+  C+      +  +   + T  HG  +  +  +L + G+ +N++    QC PDP F   A  NPE+K + DL+ + A+ +   +++  DPD+DR A   +   +W+  TG+++G I   Y +  ++     K+   ++ + VS+  + +IA++       T TGFKW+ N+ +    + +  V  +EEA+G   S   RDKDG  AAA+ +++   LY + +T++D+L  + + +G +      +          +Q     FAN  N  K +    I+ IR             +    + L  YL+N   V  R SGTEPK K Y E
  S:    35 ELLKNLTEDELAKLF-LARLEFGTAGLRGRMGAGFSRMNDVTIQQTTQGYCAFLVDVFGEDGKDRGVVIGFDARHNSRRFAQLTAAVFLSKGFRVQLFSD--IVHTPMVPYTVVAANCIAGIMITASHNPKADNGYKVYAANGAQIIPPMDSEISAFINSNLDFWSDVDEYFDSKTGMLTEKAANSSLLEDPLNTYVDAYIKDIAADLCVAEQ---QGSDLKFMYTAMHGVGTPMVKKMLAAFGFNDNLLTVDAQCTPDPEFPTVAFPNPEEKGALDLAFQEADSHGLTLVIANDPDADRFAAAEKCDGRWYQFTGDELGAILGAYAIKLREGQGISKSKMALICSAVSSRMLQKIAKENGCTFAETMTGFKWMENKAIEMEAEGLIPVFVYEEALGYALSQRVRDKDGVSAAAVWMQMAIDLYSRGQTVMDFLMSLRKRYGYFVTRNSYFICPD---PRLIQGLFKDFANGGNYPKQLGPFTIRRIRDVGRGYDSEEQCSFPSNCEMLTVYLDNGAVVTLRGSGTEPKLKYYAE 560
>gi|29829885|ref|NP_824519.1| phosphomannomutase [Streptomyces avermitilis MA-4680] >gi|29606994|dbj|BAC71054.1| putative phosphomannomutase [Streptomyces avermitilis MA-4680] (543 aa)
Score = 519, Expect = 1.6e-50, Identities = 152/519 (29%), Positives = 260/519 (50%)
  Q:    12 MHANVNPLSKAWLESNRISNKYKELILKMNEEEIDKY---FSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK-KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIG-SLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLN--------WKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           MH  +   +KAWL  +  +   +EL   ++ E++ +    FS   L FGTAG+R  +G G  ++N     + + G+A +L  K +    V++ +D R  +  +A   A  +T  G++  +    +   TP+++Y++R  G  A +  TASHNP    G+KVY   G QI+     EI + +   + + D V  P+       DD++  +Y   +   L   +    +    + T  HG     L       G+   +L A+Q  PDP+F   A  NPE+  + DL+   A +   ++++  DPD+DR AV V+    W  L G+++G +   ++++     +  F  S  VS++ + RIAEK       T TGFKW+       ++ + +  G+EEA+G  ++ +  RDKDG  AA L  E+ + L ++ +TLVD+LD+I  E G    + +S ++E L+         +E+   ++   A  +++D+     KG     P   L + L+    V  R SGTEPK K Y E+
  S:     1 MHDELIARAKAWLAEDPDAETREELAKLIDAEDVTELAARFS-GTLQFGTAGLRGELGAGPMRMNRAVVIRAAAGLAAYLKAKGEQGGLVVIGYDARHKSADFARDTAAVMTGAGLRAAVLP--RPLPTPVLAYAIRHLGAVAGVEVTASHNPPRDNGYKVYLGDGSQIVPPADAEIAAEIDAVRALAD-VPRPDSGW-ETLDDSVLNAYLARTDAVLAEGS---PRTARTVYTAMHGVGKDVLLAAFARAGFPEPVLVAEQAEPDPDFPTVAFPNPEEPGAMDLAFAKARETDPDLIIANDPDADRCAVAVKGGTDWRMLRGDEVGALLAQHLVSRGA--RGTFAES-IVSSSLLGRIAEKAGVPYEETLTGFKWIA-----RVEGLRY--GYEEALGYCVDPEGVRDKDGITAALLITELASELKERGRTLVDFLDDIAVEHGLHATDQLSVRVEDLSVIANAMRRLREQPPTRLAGLAITRSEDL----TKGTDRLPPTDGLRYTLDGAR-VIVRPSGTEPKLKCYLEV 509
>gi|153827849|ref|ZP_01980516.1| putative phosphomannomutase [Vibrio cholerae 623-39] >gi|148876694|gb|EDL74829.1| putative phosphomannomutase [Vibrio cholerae 623-39] (567 aa)
Score = 519, Expect = 1.7e-50, Identities = 154/508 (30%), Positives = 258/508 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +     N  V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  I  +     +   L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL  +G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G            S+          DK      KDI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKNRGVVIGYDGRPDSQQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQAIPYLALEQAEQQGLLHWLRDEYYQTYRKTIGASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADVGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQ-----RSIALAPNSPPVGDKLRATPPKDIAGRKVLIVEDFKLARRTFADGKTEAITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|171912031|ref|ZP_02927501.1| phosphomannomutase [Verrucomicrobium spinosum DSM 4136] (651 aa)
Score = 518, Expect = 2.0e-50, Identities = 170/529 (32%), Positives = 277/529 (52%)
  Q:     7 KNPSSMHA-NVNPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRA-TMGP---------------------GTNQINVFTYQQMSEGVARWLLNKKSN------PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP----NMDLISYFDDTITESYFEASYRCLINTNIY-RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLT--------NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKH------------IDKMD-------------FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI-------KGIRWNE-----PAQALEWYLEND-MWVKFRLSGTEPKFKIYYEIYGETK 535
           KN  S+ A +VNP+ +A +E    + ++ EL         D++  Y+ L FGT G+R  T+G                      GTN +N +   + ++G+  + +  ++N      P ++ +HD R  +  +A   AK  T  G  V+L+  +  +ATP +S+SVR+   DA ++ TASHNP +  G+KV    G  I++  A  I++   E   I    YTP        ++   + + + Y +     ++   +  + +N  ++ T  HG     +P +L+ +G+ N +   +Q + D  F   A+ NPE+  +  +++  A+K  A+I++G DPD DR+ V VR    K   LTGNQ+G +   Y +         N    K   ++ TFV+T+    +AE +   V  T TGFK++  ++ K+             D  D             FV G EE+ G L +D  RDKDG  A  +  EV      Q KTLV+ LD+I+ EFG +     S   E      ++Q+  D +AN    +  G  +       KG   +E     P + + W    D      R SGTEPK K Y  +YG  +
  S:    22 KNIQSLFAGSVNPVYRASVEELANAGQWTELN--------DRF--YAALKFGTGGLRGRTIGKIVTTAERGNAAADARPEYACVGTNSMNEYNVSRATQGLVAYAIKYRANAGLAGKPKIVFSHDTRHFSPEFAKDCAKIATDLGCDVYLF--DGPRATPEMSFSVRQLRADAGVMLTASHNPAHDNGYKVNYADGAGIVEPHATGIIT---EVNAIKSEAYTPLPEDQRGTLTILGEEMDQIYLKRVEALMLQPELLEKARNLKIVYTALHGAGGVLVPRILRKLGF-NTLTVPEQDIFDGRFPTVASPNPENAPTLAMAVALADKEGADIVIGTDPDCDRMGVGVRGLDGKMQLLTGNQIGSLIGWYRIKTFFDLGIINDANKKNAVLIKTFVTTDLQSAVAEGFGIGVVNTLTGFKYISAKLEKYEQALPADIRAKYRDMTDAETRAARLEHSKFFVFGGEESYGYLGTDSTRDKDGNGAVVMFAEVAAYAASQGKTLVELLDDIYAEFGYFLESNHSKTFEGAEGAAKIQKLADSYANQPPTEFDGSPVIRTVDYSKGGHLDEEGDTIPKEKMLWVFTADGRAFAVRPSGTEPKIKYY--LYGRQQ 613
>gi|149173793|ref|ZP_01852422.1| phosphomannomutase [Planctomyces maris DSM 8797] >gi|148847323|gb|EDL61657.1| phosphomannomutase [Planctomyces maris DSM 8797] (615 aa)
Score = 517, Expect = 2.9e-50, Identities = 174/524 (33%), Positives = 269/524 (51%)
  Q:    21 KAWLESNRISNKYKELILKMNE----EEIDKYFSYSKLSFGTAGIRATMGP-GTNQINVFTYQQMSEGVARWL--LNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYT----PNMD--------LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF--NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRH-KNKWHYLTGNQMGIIFTHYVLTNKKFDKT----PFVVSTFVSTNYIDRIAEKYNAKVFRT-PTGFKWVGNEMNKH-IDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN-----------KDILGLEIKGIRWNEPAQA----------LEWYLEND---MWVKFRLSGTEPKFKIYYEIYGETKE--ICDQILKA 544
           K W+   + +  Y+  +LK+ E    +++D  F +  + FGT G R  M   G+  IN  T  + + G+A +    + K      +AHD+R+N+ ++A + A  L   G+ V+ +K +  ++TP +S++VRE G D   + TASHNP +  GFK Y  TGGQ+L           P  Q IID VY     P +D        LI   D+ I   Y  +      + N    ++     T  HG     +  +L+  G+  I     QC  D NF    +   NPE    +  +++ A++    I+L  DPD+DR+ V V++   ++ +LTGNQ+G +   YVL  ++   T     FVV T V+T  I  IA K N ++      GFK++   M++   DK  FV G EE++G L  +  RDKD   AA  A E+   L  + KTL+D LDE++ E G      VS   +  +  E++++ M  F N              +D   LEI+ +  N   +           LE   E     + +  R SGTEPK K YY    E  +  + DQ  +A
  S:    35 KRWVTEPQYA-PYQPALLKLIEDKDFQQLDTCF-WEVIPFGTGGRRGLMSELGSATINERTIAESAHGLAAYSKKFSGKETGKAAIAHDSRINSSHFARIAASVLAGHGLTVYFFKTS--RSTPELSFAVRECGCDVGAMITASHNPPSDNGFKAYWSTGGQVLP----------PHDQGIIDEVYQATEIPLLDFDQAVEQGLIQLIDEDIASKYRSSVVSHSHSDN----RDLTGYFTPLHGVGEASVYQVLQQAGFTGIQRYEPQCAQDGNFPNVPDQLPNPERTEVYQPAIEQAKQTGGEIILASDPDADRMGVCVKNGAGEFIHLTGNQVGALLADYVLRKRQAAGTLSPQHFVVETIVTTPLIAAIARKANVRIINNLLVGFKYIAETMDEEGPDK--FVFGTEESLGYLAGEYCRDKDAAIAALWACELAAELKAEGKTLLDRLDELYREHGFHLEGQVSKTCKGSSGNEQIKQLMKAFRNTPPEKMGKLKFTLVRDYQDLEIRSLPENTVTETFSKPKGNVLMLEARAEGSPLTVQLGVRPSGTEPKIKFYYFAQAEVTDPGLLDQTKEA 592
>gi|150020471|ref|YP_001305825.1| phosphomannomutase [Thermosipho melanesiensis BI429] >gi|149792992|gb|ABR30440.1| Phosphomannomutase [Thermosipho melanesiensis BI429] (474 aa)
Score = 517, Expect = 2.9e-50, Identities = 156/498 (31%), Positives = 268/498 (53%)
  Q:    56 FGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN-PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI----IDNVYTPNMDL---ISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN--EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYML 553
           FGT GIR  M  G  + +  T    S+GV+ ++  K +N  ++++A+D R N+  +A + A    + G KV+++ E     TP +S++VRE   D  I+ TASHNP  Y G+KVY   G           V ++P+   I    ++  +   ++L    +Y +  I  +Y +   + LI+TN+       ++ T  HGT    +  +LK++G E +IL ++Q   D NF    + NPED  +  L  +Y EK+ A++ +  DPD DR+ V+ + K     LTGNQ+G++ T Y+L N    +   ++ T V+T+ +  + ++ N K+F TPTGFK++G+  E + H    +F+ GFEE+ G L  ++ RDKDG   AAL   V      ++  L++ L+ ++E++G +  + ++YK ++    + + +K+ K  N + K I     KG    EP + +    E    +  R SGTEPK K Y     +++E   + L+ L ++F  +L
  S:     4 FGTGGIRGIMKEG--EFDEKTVMVASKGVSNYM--KDNNLKSMVIAYDTRNNSQKFAEISASVFAADGHKVYIFPEPV--PTPALSFAVRELKCDMGIVITASHNPPEYNGYKVYTSDG-----------VQAVPKLTDILAKYVERAWNTPIELSKNFNYLEKKILNNYVDKVAK-LISTNL---SGLKIVYTPLHGTGLKPVVSVLKNLGAE-LILVSEQAFFDGNFPTVKSPNPEDDEALVLLKEYMEKFEADLGIATDPDCDRVGVIWKGKR----LTGNQVGVLITDYLLENAT--ENDMIIKTIVTTDMVKPMCKEKNVKLFETPTGFKFIGHLAENSNH----NFLFGFEESCGYLTGNLSRDKDGAVGAALIAAV-----SKKFDLIERLNSLYEKYGYYMEKLLTYKFKNAEIAKNIYKKL-KTINFREKII--DYSKGYENIEPNETIAIIFEEGK-IFIRPSGTEPKLKAYVMTVSDSEETSSKNLEILVNKFNDIL 470
>gi|1658319|emb|CAA87406.1| unknown [Streptococcus pneumoniae] (405 aa)
Score = 516, Expect = 3.1e-50, Identities = 122/384 (31%), Positives = 218/384 (56%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY-LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEA 404
           + WL    +    K+ +L M+++  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR  G  A I+ TASH P  + G+KVY   GGQ+L ++A+ +   +     P    + D     +  LI    +T+  +Y E      IN ++  Q  ++  ++ T  HGT        L   G+E++ +   Q  PDP+F+  A+ NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  ++ L+GNQ+G +   Y+L   K      K   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+
  S:     8 QKWLNVPDLPAYLKDELLSMDDKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLVESKGETAKKAGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLGAFAGIMVTASHTPAPFNGYKVYGSDGGQMLPADADALTDYIRAIDNPFAVVLADLEEAKSTGLIEVIGETLDAAYLEEVKSVNINEDLIDQYGRDMQIVYTPLHGTGEMLARRALAQAGFESVQVVEAQAKPDPDFSTVASPNPESQAAFALAEELGRQVDADVLVATDPDADRLGVEIRQADGSYWNLSGNQIGALIAKYILEAHKQAGTLPKNAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEES 405
>gi|110766229|ref|XP_395823.3| PREDICTED: similar to Phosphomannomutase 45A CG8073-PA, isoform A [Apis mellifera] (574 aa)
Score = 516, Expect = 3.3e-50, Identities = 161/514 (31%), Positives = 271/514 (52%)
  Q:    23 WLESNR---ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM------PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTP------FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV--GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKF---ANVKNKDILG--LEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE 536
           WL+ N+   I NK +ELIL  N++ +   F   +L FGTAG+R  MGPG NQIN     Q  +G++ +LL+   + T   +++ +D R  +  +A + A    +  IKV+L+  +++  TP I YS+ +    A ++ TASHNPKN  G+KVY   G QI+     EI   +       E    I  +Y  ++ L  +  D I +SYF      ++   + +        T  HG     +     +  ++  I+  +Q +PDP F      NPE+ K++ DLS++ A K  ++I+L  DPD+DR+A   + KN +W+  +GN++G +   +++   +   T       +++++ VS+  +  +A++       T TGFKW+GN+    ++KM  +V   +EEAIG +      DKDG  A     E+   L     TL D L+EI+ ++G    +   +     N  +++ E++  +    N    +IL     I GIR                   ++  Q + +  +N + V  R SGTEPK K Y E+    +E
  S:    21 WLKWNKVFNILNKVQELILNNNKKVLSSLF-LKRLEFGTAGLRGRMGPGYNQINDLVIIQTGQGLSMYLLDTIVDATEKGIVIGYDGRHCSKRFAELTAAIFMAKNIKVYLF--SKVVPTPFIPYSILKYKCAAGVMITASHNPKNDNGYKVYWENGAQIISPHDKEIQKYIFNHLEPMESSWNITKIYENSLYLNPW--DNIMQSYFNDLKETVLYPEVNKNTILKFTYTPMHGVGYQYMTAAFNAANFKPFIIVEEQKLPDPEFPTVKFPNPEEGKSTLDLSIQVANKNSSSIILANDPDADRVACATKMKNDEWYIFSGNELGALLGWWMIHKYQVQHTDTDFSNVYMLASTVSSKILASMAKQEGFNFEETLTGFKWMGNK-TIELEKMGKIVLFAYEEAIGFMCGSKVLDKDGISAGMHIAELAAYLETMGLTLHDKLNEIYNQYGYHISKNSYWICHEPNIIKKIFERLRTYLGKPNTYPTNILNGKYPIIGIRDLTTGYDNTKPENKAILPISKSNQMITFTFKNGLVVTLRTSGTEPKIKYYSELCASPEE 573
>gi|67464960|ref|XP_648671.1| phosphoglucomutase/phosphomannomutase family protein [Entamoeba histolytica HM-1:IMSS] >gi|56464908|gb|EAL43285.1| phosphoglucomutase/phosphomannomutase family protein [Entamoeba histolytica HM-1:IMSS] (594 aa)
Score = 515, Expect = 4.1e-50, Identities = 165/533 (30%), Positives = 268/533 (50%)
  Q:    23 WLESNRISNKYKE---LILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVA---RWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDD--TITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGII-----FTHYVLTNKKFDKTP-FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKM--DFVVGFEEAIGSLNSDIGRDKDGFQA----AALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMD-------KFANVKNKDILGLEIKGIRWNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLRS 555
           WL+ ++     KE   L+   NEEE+ K F   ++ FGTAG+R  M  G N +N    QQ S+G+A     L+       V++ +D R ++  +A + AK   S G K +L+  + +  TP  +++V        ++ TASHNPK   G+KVY   G QI++     I S +    + ++     N+D+    D    ++  Y++     + +     Q     + T  HG  S  +    K+      IL   Q  PDP F      NPE+ K +   S++ AE   A +++  DPD+DRL+V V+  N W   TGN+M  +     +  Y+++    DKTP F+V + VS+++I ++ E      + T TGFKW+GN+  + +D      ++ +EEAIG +  ++  DKDG +A    AA+ALE      +Q   L D L+ ++E++G +      Y        E++  KM        KF     K I  L + GI   +P            Q + +  EN      R SGTEPK K Y E+ G+     + ++  L D    +L++
  S:    22 WLKWDKTPETRKEIEDLVASKNEEELKKRFC-KRIEFGTAGLRGKMCAGFNCMNNLIVQQASQGLALAVEELVQNAHEKGVVIGYDGRYHSKEFAAITAKVFISKGFKTYLF--STLCPTPWTAFAVGYLKTACGVMVTASHNPKADNGYKVYWENGCQIIEPIDANIASKI---HSNLEPWDLSNVDISKVIDPLADVSAEYYKQMMLTIPHFECPEQPKVKYVYTAMHGVGSKYVQDAFKTAKLPQPILVPLQNEPDPEFPTVPFPNPEEGKGALKCSIEVAEANGATVIIANDPDADRLSVAVKSGNGWRQFTGNEMANLIADWTYNKYIVSG---DKTPAFMVRSTVSSSFISKMGEVEGFDTYETLTGFKWIGNKAKEIVDTQHKKLLMAYEEAIGFVIGNMSYDKDGVRAAVCFAAMALE----YAEQGFNLEDRLNMLYEKYGYFASNNKYYFCYDPKLMEKIFNKMRNNGQYYWKFGKYAVKSIRDLTV-GIDTAQPDKKPLLPVSASTQMITYTFENGCKATLRGSGTEPKLKYYIELPGKKGVKAEDVIAELMDLSHELLQA 579
>gi|148983764|ref|ZP_01817083.1| putative phosphomannomutase [Streptococcus pneumoniae SP3-BS71] >gi|147923911|gb|EDK75023.1| putative phosphomannomutase [Streptococcus pneumoniae SP3-BS71] (405 aa)
Score = 515, Expect = 4.4e-50, Identities = 122/384 (31%), Positives = 217/384 (56%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY-LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEA 404
           + WL    +    K+ +L M+++  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q +EG+A+ + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR  G  A I+ TASHNP  + G+KVY   GGQ+L ++A+ +   +     P    + D     +  LI    +T+  +Y E      IN ++  Q  ++  ++ T  HGT        L   G+E++ +   Q  P P+F+  A+ NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  ++ L+GNQ+G +   Y+L   K      K   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE 
  S:     8 QKWLNVPDLPAYLKDELLSMDDKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLVESKGETAKKAGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLGAFAGIMVTASHNPAPFNGYKVYGSDGGQMLPADADALTDYIRAIDNPFAVALADLEEAKSTGLIEVIGETLDSAYLEEVKSVNINQDLIDQYGRDMKIVYTPLHGTGEMLARRALAQAGFESVQVVEAQAKPAPDFSTVASPNPESQAAFALAEELGRQVDADVLVATDPDADRLGVEIRQADGSYWNLSGNQIGALIAKYILEAHKQAGTLPKNAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEEG 405
>gi|15601792|ref|NP_233423.1| phosphomannomutase, putative [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587154|ref|ZP_01676929.1| phosphomannomutase, putative [Vibrio cholerae 2740-80] >gi|121726660|ref|ZP_01679896.1| phosphomannomutase, putative [Vibrio cholerae V52] >gi|153220524|ref|ZP_01951658.1| phosphomannomutase, putative [Vibrio cholerae MAK 757] >gi|153821718|ref|ZP_01974385.1| phosphomannomutase, putative [Vibrio cholerae B33] >gi|194533875|ref|YP_002069290.1| phosphomannomutase, putative [Vibrio cholerae MO10] >gi|9658485|gb|AAF96935.1| phosphomannomutase, putative [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121548593|gb|EAX58645.1| phosphomannomutase, putative [Vibrio cholerae 2740-80] >gi|121630966|gb|EAX63346.1| phosphomannomutase, putative [Vibrio cholerae V52] >gi|124120355|gb|EAY39098.1| phosphomannomutase, putative [Vibrio cholerae MAK 757] >gi|125619927|gb|EAZ48453.1| phosphomannomutase, putative [Vibrio cholerae MO10] >gi|126520714|gb|EAZ77937.1| phosphomannomutase, putative [Vibrio cholerae B33] (567 aa)
Score = 515, Expect = 4.9e-50, Identities = 153/508 (30%), Positives = 259/508 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +  +     V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  I  +     +   L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL  +G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G       S  ++            DK      KDI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKSRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQAIPYLALEQAEQQGLLHWLRDEYYQTYRKTIGASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADVGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQRSIALDP-----NSPPVGDKLRATPPKDIAGRKVLIVEDFKLARRTFADDKTETITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|156543479|ref|XP_001601687.1| PREDICTED: similar to phosphoglucomutase 2 [Nasonia vitripennis] (605 aa)
Score = 514, Expect = 6.5e-50, Identities = 163/527 (30%), Positives = 271/527 (51%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTV-----IVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDK------TPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKD------ILG--LEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKE--------ICDQILKALKDEF 549
           W    +   + + L+ + + + +   F   +L FGTAG+R  MGPG NQ+N     Q  +G+A++L+  K+ P V     I+ +D R N+  +A + A    +  IKV++Y  +++  TP I Y V +    A ++ TASHNPK   G+KVY   G QI+        N I+ ++   Q+  D     N  L     D +  +YF      ++   I +      + T  HG     +    K   ++  I+  +Q  PDP F+     NPE+ ++ +LS+K A K  + I+L  DPD+DRLA  V+  N +WH  +GN++G +   ++L   +  K        +++++ VS+  +  +A+K   K   T TGFKW+GN  ++ I     V+  +EEAIG +      DKDG  AA    E+   L     TL+D ++EI+ E+G    +  SY I   + KE +    ++  N   K+      ILG    I  +R                   ++ +Q + +  +N +    R SGTEPK K Y E+     +        I  +++ A+ +EF
  S:    23 WNNDEKAEKEIQALMQQGDVKTLSNLF-LKRLEFGTAGLRGRMGPGYNQMNDLVIIQTGQGLAKYLM--KTIPDVKEKGIILGYDGRYNSKRFAELTAAIFLNHDIKVYMY--SKLCPTPFIPYGVLKYKCAAGVMVTASHNPKEDNGYKVYWDNGSQIISPHDKGIQNSILENLEPLQSSWDTSNVYNHSLFKDPLDEVMNTYFNDIKNNVLYPEINKNTPLKFVYTPVHGVGHNYMIEAFKVANFKPFIVVEEQKDPDPEFSTVKFPNPEEPSALELSIKTANKNGSTIILANDPDADRLACAVKKPNGEWHIFSGNELGGLLGWWMLHTLRVRKPDANIADTYMLASTVSSKILASMAKKEGFKFEETLTGFKWMGNRASELIKSGKTVLFAYEEAIGFMCGSHVLDKDGVSAATCVAEMAAYLQTIGLTLIDKINEIYCEYGHHISDN-SYWI--CHEKEVINSIFNRLRNFGGKENAYPTCILGGRYTITSVRDLTTGYDNTKPGNKAVLPVSKSSQMITFTFKNGLVCTLRTSGTEPKVKYYNELCASPDQKDLKQLQGILSEMVAAIVEEF 592
>gi|147671586|ref|YP_001215041.1| putative phosphomannomutase [Vibrio cholerae O395] >gi|146313969|gb|ABQ18509.1| putative phosphomannomutase [Vibrio cholerae O395] (567 aa)
Score = 513, Expect = 7.0e-50, Identities = 153/508 (30%), Positives = 258/508 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +  +     V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  I  +     +   L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL  +G+ ++    +Q  PD  F  + NF NPE+    D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G       S  ++            DK      KDI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKSRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQAIPYLALEQAEQQGLLHWLRDEYYQTYRKTIGASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADVGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGGMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQRSIALDP-----NSPPVGDKLRATPPKDIAGRKVLIVEDFKLARRTFADDKTETITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|113461806|ref|YP_719875.1| phosphomannomutase [Haemophilus somnus 129PT] >gi|112823849|gb|ABI25938.1| phosphomannomutase [Haemophilus somnus 129PT] (552 aa)
Score = 513, Expect = 7.0e-50, Identities = 154/513 (30%), Positives = 250/513 (48%)
  Q:    42 EEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVY---NHTGGQILDSEANEIVSSMPECQTIIDNVYT------PNMDLISYFDDTITESYFEASYRCLINTNIYR--QKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFD-KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGI----RWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           ++E+   F+  +L FGTAG+R  +  G+  +N     Q + G+A +L    S P++++ +D R N++ +    A+ +   GIK FL        TP+++Y+++     A ++ TASHNP    G+KVY    + GGQI+     +I         +ID V        P     +  DD I E+Y   +       +I +  Q N   + T  HG     L   L   G     L  +Q  PD +F      NPE+K + DL++K A+   A  ++  DPD+DRLAV V   +  W  L GN +G     Y+        K   +  + VS+  +  IA+KY  +   T TGFK++G ++N      D + GFEEA+G L + D  RDKDG  AA   L++   L  + KTL DY ++   EFGA+    +S ++  L+   ++ + M         ++ G ++       + +  +  L + LEN   +  R SGTEPK K Y ++ G   +   ++L    +    +LR
  S:    39 QKELHNRFN-GRLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLAEYLKGYDSEPSIVLGYDGRKNSNVFVRDTAEIMAGAGIKTFLLPRKL--PTPVLAYAIKYLNTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADVDIAK-------LIDKVANGDIRDLPRSQHYTVLDDEIVEAYIAKT------ASIAKEPQANINYVYTAMHGVGYEVLSKTLAKAGLPQPHLVEEQIQPDGSFPTVKFPNPEEKGALDLAIKLAKAKNAEFIIANDPDADRLAVAVPDSEGNWKPLHGNVIGCFLGWYLAKQYHAQGKQGKLACSLVSSPALAEIAKKYGFQSEETLTGFKYIG-KVN------DLLFGFEEALGYLVDPDKVRDKDGISAAIAFLDLVRSLKKEGKTLTDYANDFTAEFGAYVSGQISIRVNELS---DIGKMMTALRKEPLTELGGFKVTQFIDHSKTDRASDILVFVLENGSRLIVRPSGTEPKVKFYLDVCGTDPKNAGEVLAEFDENVRQILR 543
>gi|37676777|ref|NP_937173.1| phosphomannomutase [Vibrio vulnificus YJ016] >gi|37201320|dbj|BAC97143.1| phosphomannomutase [Vibrio vulnificus YJ016] (568 aa)
Score = 513, Expect = 7.3e-50, Identities = 153/492 (31%), Positives = 263/492 (53%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT-------ITESYFEASYRCLINTNIYRQK----NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW--TGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRW---------NEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           KM EE  D++    +L FGTAG+R  +G G N++N    Q+ + G+  +L+    +     V++ +D R ++  +A   A  LT+ GIKV+L   +++  TP++++ V++    AA++ TASHNP  Y GFKVY   G QI+      I + + +        + P + L+S  D         + E Y++ +YR  +NT+   +     +  +  T  HG  +     LL   G+ +++   +Q  PD  F  + NF NPE+  + D+ +  A+   A I    DPD+DR AV VR  +  +  LTG+Q+G +F +Y+L++    K   V +T VS+  +  IA+++ A  ++T TGFKW+ N  M +  D   F+  +EEA+G    +   DKDG  A     ++   L +   TL D L++++ + G +     +++   +S    ++++ K  K    +   ++      +R+         N PA   L ++LE+   V  R SGTEPK K YYE+
  S:    28 KMTEELQDRF--RGRLEFGTAGLRGKVGSGPNRMNRLVVQETATGLGHYLIETIRDAAARGVVIGYDGRTDSKQFAHDTAAVLTALGIKVYL--THKVAPTPVVAFGVKQFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAAEIEQA------THKP-IPLMSLSDAEKHGLLVWLKEDYYQ-TYRQAMNTHPLLKSGHAVDISIAYTAMHGVGAEMAETLLADAGFTHVLSVPEQQEPDGTFP-TVNFPNPEEAGAMDMVMNLAKTVDAEIACANDPDADRFAVAVRKPDGNYQMLTGDQVGALFANYLLSSVDASKQ-LVGNTIVSSRLLADIAKQHGAHYYQTLTGFKWLTNVAMTQQSDDKQFLFAYEEALGYTVGNKVWDKDGLSALVAFAQLTAHLKENGLTLWDKLEQLYRQHGFYFNAQRSIALSPDSPPIGDQLRAKPPKTIAGQKVTVIEDLKASLRYVTNGVTEAINLPASDVLIYHLEDRSRVIVRPSGTEPKLKCYYEV 534
>gi|150425447|gb|EDN17223.1| phosphomannomutase, putative [Vibrio cholerae AM-19226] (567 aa)
Score = 513, Expect = 7.8e-50, Identities = 155/508 (30%), Positives = 259/508 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVIL----TTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +     N  V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  +  +     +   L+ +  D     Y++   + +  + + +    P +L    T  HG  +     LL   G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G            S+          DK      KDI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKNRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQALPYLSLEEAEQQGLLHWLRD----EYYQTYRKTIGASPLLQHHTKPQVLSLAYTAMHGVGANMAETLLADAGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQ-----RSIALAPNSPPVGDKLRATPPKDIAGRKVLIVEDFKLARRTFADGKTEAITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|149187366|ref|ZP_01865664.1| putative phosphomannomutase [Vibrio shilonii AK1] >gi|148838902|gb|EDL55841.1| putative phosphomannomutase [Vibrio shilonii AK1] (564 aa)
Score = 513, Expect = 8.5e-50, Identities = 165/500 (33%), Positives = 264/500 (52%)
  Q:    31 NKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFL-YKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT--------ITESYFEASYRCLINTNIY----RQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVV-RHKNKWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTG------------------------ETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           ++ ++L+   +E E+   FS S+L+FGTAG+R  +G G N++N    Q+ + G+  +LL + S  +   V++ +D R ++  +A   A  LT+ GIKV+L YK   + ATPI+++ VRE    AA++ TASHNP  Y GFKVY   G QI+    + I +        ID+  T  + L+   D          + E Y++ +YR  IN +         +  ++ T  HG  +     LL   G+  +    +Q  PD  F  + NF NPE+  + D+ +   +   A+I    DPD+DR AV V R   ++  LTG+Q+G +F  Y+L  +       V +T VS+  +  IA+ ++A+  +T TGFKW+ N  M +      F+  +EEA+G    +   DKDG  A     ++   L  Q KTL D L+E++ + G +                          E    +IE +   E++   + +FA+   + I          + PA   L + LE+   V  R SGTEPK K YYE+
  S:    19 HELQQLVDSNDERELKDRFS-SRLAFGTAGLRGKVGAGPNRMNRLVIQETATGLGHYLLEQVSEASSRGVVIGYDGRPDSKQFAHDTASVLTALGIKVYLTYK---VAATPIVAFGVRELNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDSGIAAQ-------IDDATTQPLTLLP-LDQAKQQGLLIWLEEDYYQ-TYRKAINQSELLTPDSNTDISIVYTAMHGVGADMAEKLLADAGFNQVASVTEQREPDGTFP-TVNFPNPEEAGAMDMVMALGKSVGADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLLAGQ---PNALVGNTIVSSRLLRSIAKAHSAQYCQTLTGFKWLTNVAMIQESVDHPFLFAYEEALGYTVGNKVWDKDGLSALVAFSQLTGKLKAQGKTLWDKLEELYRQHGFYFNAQRSIALDPKSPPIGEKLRRNPPTEIAGKRIEVI---EDLNTSVRQFADGTTETI----------DLPASDVLIYLLEDQSRVIVRPSGTEPKLKCYYEV 532
>gi|27366998|ref|NP_762525.1| phosphomannomutase [Vibrio vulnificus CMCP6] >gi|27358566|gb|AAO07515.1|AE016810_18 Phosphomannomutase [Vibrio vulnificus CMCP6] >gi|28797563|gb|AAO46874.1| phosphomannomutase [Vibrio vulnificus] (568 aa)
Score = 513, Expect = 8.8e-50, Identities = 153/492 (31%), Positives = 263/492 (53%)
  Q:    39 KMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDT-------ITESYFEASYRCLINTNIYRQK----NFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAW--TGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRW---------NEPAQ-ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           KM EE  D++    +L FGTAG+R  +G G N++N    Q+ + G+  +L+    +     V++ +D R ++  +A   A  LT+ GIKV+L   +++  TP++++ V++    AA++ TASHNP  Y GFKVY   G QI+      I + + +        + P + L+S  D         + E Y++ +YR  +NT+   +     +  +  T  HG  +     LL   G+ +++   +Q  PD  F  + NF NPE+  + D+ +  A+   A I    DPD+DR AV VR  +  +  LTG+Q+G +F +Y+L++    K   V +T VS+  +  IA+++ A  ++T TGFKW+ N  M +  D   F+  +EEA+G    +   DKDG  A     ++   L +   TL D L++++ + G +     +++   +S    ++++ K  K    +   ++      +R+         N PA   L ++LE+   V  R SGTEPK K YYE+
  S:    28 KMTEELQDRF--RGRLEFGTAGLRGKVGSGPNRMNRLVIQETATGLGHYLIETIRDAAARGVVIGYDGRTDSKQFAHDTAAVLTALGIKVYL--THKVAPTPVVAFGVKQFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAAEIEQA------THKP-IPLMSLSDAEKHGLLVWLKEDYYQ-TYRQAMNTHPLLKSGHAVDISIAYTAMHGVGAEMAETLLADAGFTHVLSVPEQREPDGTFP-TVNFPNPEEAGAMDMVMNLAKTVDAEIACANDPDADRFAVAVRKPDGNYQMLTGDQVGALFANYLLSSVDASKQ-LVGNTIVSSRLLADIAKQHGAHYYQTLTGFKWLTNVAMTQQSDDKQFLFAYEEALGYTVGNKVWDKDGLSALVAFAQLTAHLKENGLTLWDKLEQLYRQHGFYFNAQRSIALSPDSPPIGDQLRAKPPKTIAGQKVTVIEDLKASLRYVTNGVTEAINLPASDVLIYHLEDRSRVIVRPSGTEPKLKCYYEV 534
>gi|149640674|ref|XP_001513136.1| PREDICTED: similar to Phosphoglucomutase 2 [Ornithorhynchus anatinus] (590 aa)
Score = 512, Expect = 1.1e-49, Identities = 162/508 (31%), Positives = 255/508 (50%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTP--------FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           W ++ + S   K+L+   N EE+ K F  S++ FGTAG+RA MG G +Q+N  T  Q ++G  R+L    S+     V++  D R +      +  +A + A T  S G+ V+L+  + I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++ E         D+    N  L+      I + YFE   +   + NI ++     + T+ HG     +    K+  +       +Q  PDP F      NPE+ K    LS   A+K  A ++L  DPD+DRLAV  + ++ +W   +GN++G +   +  T  K +K P        +++++ VS+  +  IA K       T TGFKW+GN   + ID+   V+  FEEAIG + S    DKDG  AAA+  E+ + L  +  +L   L  I+ E+G    +T  +        + + E +  +    N  K     EI G+R                   ++ +Q + +   N      R SGTEPK K Y E+
  S:    15 WDQNPKTSEIVKQLVADGNTEELQKCFG-SRMEFGTAGLRAAMGAGISQMNDLTIIQTTQGFCRYLEKNFSDLKKRGVVIGFDARAHPPSGGSSKRFARLAATTFISQGVPVYLF--SNITPTPWVPYTVSHLNLRAGIMVTASHNPKQDNGYKVYWDNGAQIISPHDKGIAQAIEENLEPWPKAWDDSLIDNNPLLHDPYTKINKDYFEDLKKYCFHRNINKESKVKFVHTSVHGVGHDFVQLAFKAFDFAPPHAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKVGARVILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWTFTCWK-EKNPDLTALKDVYMLASTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKSVLFAFEEAIGYMCSSYVLDKDGVSAAAITAELASFLDTKNISLSQQLKNIYVEYGYHIAKTSYFICHDQKIIKGLFEHLRNYDGKNNYPKTCGKFEISGVRDLTTGYDSSQPDKKAILPTSQSSQMITFTFANGGVATMRTSGTEPKIKYYAEL 562
>gi|15617980|ref|NP_224264.1| phosphomannomutase [Chlamydophila pneumoniae CWL029] >gi|33241392|ref|NP_876333.1| phosphomannomutase [Chlamydophila pneumoniae TW-183] >gi|4376312|gb|AAD18209.1| Phosphomannomutase [Chlamydophila pneumoniae CWL029] >gi|33235900|gb|AAP97990.1| phosphomannomutase [Chlamydophila pneumoniae TW-183] (598 aa)
Score = 512, Expect = 1.2e-49, Identities = 152/508 (29%), Positives = 260/508 (51%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID--NVYTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQKN------FPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL ++      K ++  L  +  +++  F  + L+FGT G+R+ MG GTN+IN+FT ++ ++G+ + L     +P     V+V  D R N+  +A   AK L   G +VFL++  +  A  ++S++VR       ++ TASHNP NY G+KVY  +GGQ+L     EIV++      I+   ++  PN+ LI           +EA YR  L    +Y + N        +  +  HGT    +P++LK  G+ ++ L  +Q + D +F      NPED  +  L ++       ++ +  DPD+DR+ VV     + +   GNQM  +   ++L      +   +   +V + V+T  +  IA+ Y+  +    TGFK++G ++    +  + FV G EE+ G L      DKD   A+AL  E       Q KTL D L  ++E +G +  +T S    +   ++E+++K+     + + +    +          +GI +N                L +Y      V  R SGTEPK K Y+E+
  S:    23 WLSNDCTQQDAKTILGWLDTDPAQLEDLFG-ATLTFGTGGLRSLMGIGTNRINLFTIRRTTQGLVQVLRAHLPHPGDPMRVVVGCDTRHNSIEFAQETAKVLAGNGCEVFLFQYPEPLA--LVSFTVRYERAIGGVMITASHNPPNYNGYKVYMASGGQVLPPLDQEIVAACSAVNEILSVPSIDHPNIHLIG--------KEYEALYRDTLKQLQLYPEANRISGRSLSISYSPLHGTGISLVPHVLKDWGFLSVHLVEKQAIGDGDFPTVQLPNPEDPEALTLGIEQMLANDDDLFIATDPDADRVGVVCLEDGQPYRFNGNQMASLLADHILGAWSKTRHLGEHDKLVKSLVTTEMLSAIAKHYHVDLINVGTGFKYIGEKIESWRNSTNKFVFGAEESYGCLYGTHVEDKDAIIASALIAEAALQQKLQGKTLCDALLSLYETYGYFANKTESVVFSAKTDEQEIRKKLSHLEEISSANFFSGKYQVEKFENYKQGIGFNLLSKDSYALTLPKTSMLCYYFSGGGRVIIRPSGTEPKIKFYFEM 559
>gi|194536272|ref|YP_002071432.1| putative phosphomannomutase [Vibrio cholerae RC385] >gi|150421066|gb|EDN13350.1| putative phosphomannomutase [Vibrio cholerae RC385] (567 aa)
Score = 511, Expect = 1.3e-49, Identities = 153/511 (29%), Positives = 258/511 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEIYGE 533
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +     N  V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  I  +     +   L+ +  D  +++Y +      +  +  + +   +  T  HG  +     LL   G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G            S+          DK       DI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+  +
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKNRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQAIPYLALEKAEQQGLLHWLRDEYSQTYRKTIGASPLLQHHTQPQALSLAYTAMHGVGANMAESLLADAGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTD-ARRQLVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQ-----RSIALAPNSPPVGDKLRATPPTDIAGRKVLIVEDFKLARRTFADGKTEAITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEVVAQ 538
>gi|147898787|ref|NP_001086585.1| phosphoglucomutase 2-like 1 [Xenopus laevis] >gi|49903695|gb|AAH76840.1| Pgm2l1-prov protein [Xenopus laevis] (610 aa)
Score = 509, Expect = 2.2e-49, Identities = 156/508 (30%), Positives = 256/508 (50%)
  Q:    23 WLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMN------ADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSE----ANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLT-------NKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL--GLEIKGIR-------WNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           W ++ +     K+++    +EE+   F  S++ FGTAG+RA MGPG +Q+N  T  Q ++G  R+L    S+     V++ +D R +      +  +A + A T  S GIKV+++ +  I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+       A  I  ++    T   +    +  L+     +I + YFE   +   + +I +      + T+ HG     +    ++ G+   +   +Q  PDP FT     NPE+ K    LS   AE+    I+L  DPD+DRLAV  + ++ +W   +GN++G +   ++ T       + +  K  +++++ VS+  +  IA K       T TGFKW+GN   + ID+   V+  FEEAIG +      DKDG  AA +A E+ + L  +  TL   L+ IF ++G        +         ++ E +  +   K    L    E+  +R        N+P           +Q + +   N      R SGTEPK K Y E+
  S:    23 WDKNPKTLALVKQMVADGKKEELQACFG-SRMEFGTAGLRAAMGPGISQMNDLTIIQTTQGFCRYLEKNISDLKERGVVIGYDARAHPASGGSSKRFARLAATTFVSQGIKVYMFSD--ITPTPFVPYAVTHLNLCAGIMVTASHNPKQDNGYKVYWENGAQIIPPHDSGIAQSIEKNLEPWPTAWGDTLIDDSSLLQDPYQSINKDYFEDIQKHCFHRDINKASKVKFVHTSVHGVGHKFVQSAFQAFGFSPPLPVEEQKDPDPEFTTVKYPNPEEGKGVLKLSFALAEEKGVRIILANDPDADRLAVAEKQESGEWKVFSGNELGALLGWWIFTCWKEKHQDSEAVKNVYMLASTVSSKILRAIAVKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVIAAELASYLATKNVTLTQQLNLIFNKYGYHISRNSYFICHDQKTINDLFEHLRNYNGEKAYPKLCGKFEVSSVRDLTTGYDSNQPDNKAILPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAEL 570
>gi|153214985|ref|ZP_01949744.1| phosphoglucomutase [Vibrio cholerae 1587] >gi|124114959|gb|EAY33779.1| phosphoglucomutase [Vibrio cholerae 1587] (567 aa)
Score = 509, Expect = 2.3e-49, Identities = 154/508 (30%), Positives = 255/508 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNV---YTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +  +     V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + +    Q  I  +         L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL   G+ +I    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G            S+          DK      KDI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKSRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDHAAQQAIPYLALELAEQQGLLHWLRDEYYQTYRKTIGASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADAGFTHISSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQ-----RSIALAPNSPPVGDKLRATPPKDIAGRKVLIVEDFKLARRTFADGKTEAITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|153817625|ref|ZP_01970292.1| phosphomannomutase, putative [Vibrio cholerae NCTC 8457] >gi|126511781|gb|EAZ74375.1| phosphomannomutase, putative [Vibrio cholerae NCTC 8457] (566 aa)
Score = 509, Expect = 2.4e-49, Identities = 153/508 (30%), Positives = 258/508 (50%)
  Q:    23 WLESN---RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQ-----------------ALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL  +   +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +  +     V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  I  +     +   L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL  +G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A +    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+    D      +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G       S  ++            DK      KDI G ++  +   + A+                  L ++L+    V  R SGTEPK K YYE+
  S:     8 WLARDPDPKTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKSRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQAIPYLALEQAEQQGLLHWLRDEYYQTYRKTIGASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADVGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAQLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQT--DAHLNCRNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQRSIALDP-----NSPPVGDKLRATPPKDIAGRKVLIVEDFKLARRTFADDKTETITLPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 534
>gi|194209234|ref|XP_001495708.2| PREDICTED: similar to Phosphoglucomutase-2 (Glucose phosphomutase 2) (PGM 2) [Equus caballus] (771 aa)
Score = 509, Expect = 2.5e-49, Identities = 158/519 (30%), Positives = 269/519 (51%)
  Q:    12 MHANVNPLSKAWLESNRIS---NKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRM------NADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN-KKFDKTP------FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           M   ++  +  WL+ ++ S      K+LI + N+EE+ K F  +++ FGTAG+R+ MG G + +N  T  Q ++G  R+L  + ++     V+++ D R       ++  +A + A T  S GI V+L+ +  I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+     EI  ++     P  Q   D+V   +  L+     +I + YFE   +   + ++ R+     + T  HG     +    ++  +       +Q  PDP F      NPE+ +    LS   A+K +A I+L  DPD+DRLAV  +  + +W   +GN++G +   ++ T+ K+ ++ P      +++S+ VS+  +  IA K       T TGFKW+GN   + ID+  + +  FEEAIG +      DKDG  AA ++ E+ + L  +  +L   L  I+ E+G    +   +     +  +++ E +  +    N  K     EI G+R                   ++ +Q + +   N      R SGTEPK K Y E+
  S:   170 MDPRLDQETARWLQWDKNSLTLQSVKQLIAEGNKEELQKCFG-ARMEFGTAGLRSAMGVGVSHMNDLTIIQTTQGFCRYLEKQFTDLKQRGVVISFDARAHPASGGSSRRFARLAATTFISQGIPVYLFSD--ITPTPFVPYTVSHLKLCAGIMITASHNPKEDNGYKVYWENGAQIISPHDQEISQAIEDNLEPWPQAWDDSVINGS-PLLHDPSASINKDYFEDLKKYCFHRSVNRETKLKFVHTAVHGVGHNFVQSAFRAFDFVPPAAVPEQKDPDPEFPTVKYPNPEEGEGVLTLSFALADKTKAKIILANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDPSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKNVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICYDQDTIKKLFENLRNYDGKNNYPKTCGRFEISGVRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYSEL 731
>gi|15835592|ref|NP_300116.1| phosphomannomutase [Chlamydophila pneumoniae J138] >gi|16752988|ref|NP_445261.1| phosphoglucomutase/phosphomannomutase, putative [Chlamydophila pneumoniae AR39] >gi|8163488|gb|AAF73700.1| phosphoglucomutase/phosphomannomutase, putative [Chlamydophila pneumoniae AR39] >gi|8978430|dbj|BAA98267.1| phosphomannomutase [Chlamydophila pneumoniae J138] (598 aa)
Score = 509, Expect = 2.5e-49, Identities = 152/508 (29%), Positives = 259/508 (50%)
  Q:    23 WLESNRISNKYKELI--LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP----TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIID--NVYTPNMDLISYFDDTITESYFEASYR-CLINTNIYRQKN------FPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEI---------KGIRWN-----------EPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL ++      K ++  L  +  +++  F  + L+FGT G+R+ MG GTN+IN+FT ++ ++G+ + L     +P     V+V  D R N+  +A   AK L   G +VFL++  +  A  ++S++VR       ++ TASHNP NY G+KVY  +GGQ+L     EIV++      I+   ++  PN+ LI           +EA YR  L    +Y + N        +  +  HGT    +P++LK  G+ ++ L  +Q + D +F      NPED  +  L  +       ++ +  DPD+DR+ VV     + +   GNQM  +   ++L      +   +   +V + V+T  +  IA+ Y+  +    TGFK++G ++    +  + FV G EE+ G L      DKD   A+AL  E       Q KTL D L  ++E +G +  +T S    +   ++E+++K+     + + +    +          +GI +N                L +Y      V  R SGTEPK K Y+E+
  S:    23 WLSNDCTQQDAKTILGWLDTDPAQLEDLFG-ATLTFGTGGLRSLMGIGTNRINLFTIRRTTQGLVQVLRAHLPHPGDPMRVVVGCDTRHNSIEFAQETAKVLAGNGCEVFLFQYPEPLA--LVSFTVRYERAIGGVMITASHNPPNYNGYKVYMASGGQVLPPLDQEIVAACSAVNEILSVPSIDHPNIHLIG--------KEYEALYRDTLKQLQLYPEANRISGRSLSISYSPLHGTGISLVPHVLKDWGFLSVHLVEKQAIGDGDFPTVQLPNPEDPEALTLGTEQMLANDDDLFIATDPDADRVGVVCLEDGQPYRFNGNQMASLLADHILGAWSKTRHLGEHDKLVKSLVTTEMLSAIAKHYHVDLINVGTGFKYIGEKIESWRNSTNKFVFGAEESYGCLYGTHVEDKDAIIASALIAEAALQQKLQGKTLCDALLSLYETYGYFANKTESVVFSAKTDEQEIRKKLSHLEEISSANFFSGKYQVEKFENYKQGIGFNLLSKDSYALTLPKTSMLCYYFSGGGRVIIRPSGTEPKIKFYFEM 559
>gi|154249182|ref|YP_001410007.1| phosphomannomutase [Fervidobacterium nodosum Rt17-B1] >gi|154153118|gb|ABS60350.1| Phosphomannomutase [Fervidobacterium nodosum Rt17-B1] (483 aa)
Score = 508, Expect = 2.7e-49, Identities = 148/493 (30%), Positives = 255/493 (51%)
  Q:    56 FGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSN-PTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLI---SYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVLTN--KKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           FGT GIR  M  G  + +  T    S+GVA ++  K +N   V++A+D R N++ +A + A   +  G+  +L+ E     TP++SY VR+  +D  I+ TASHNP  Y G+KVY   G Q +  E  ++++ +      ++N +   ++ +   ++    + + Y +   R +      R     V+ +  HGT +  +P LL+ +G E +I   +Q   + NF      NPED  + +L   Y  K+  ++ +  DPD+DR+ VV ++      LTGN +G++ +  ++    K       +V T VSTN +  + ++   K+F  PTGFK++G+ + K  D +DFV+GFEE+ G L  D+ RDKD   A+ L   V      ++  L++ L E++ ++G +    +++++ S+     + EKM  F+    K+I+    KG     P + L    +  M +  R SGTEPK K Y  + GE+ E     L+ L +E
  S:     4 FGTGGIRGIMREG--EFDEKTVAVASKGVANYM--KMNNLHKVLIAYDTRNNSEKFAKIAASVFSGEGLDAYLFSEPV--PTPVLSYGVRKLKMDMGIVITASHNPPEYNGYKVYTSNGVQAI-PEVTDVLAKL------VENAWNEPINAVEKYNFVSHDMLDEYVQDVARLIGE----RLDGLKVVYSPLHGTGARFVPQLLRLLGAE-VIEVKEQMEHNGNFPTVKTPNPEDDRALELLKDYMVKFNVDLGIATDPDADRVGVVFKNVR----LTGNNVGVLLSDNLIDEYRKSGKNNGMLVKTIVSTNMVVPMCKENGIKLFEVPTGFKFIGDLVEKRKD-LDFVIGFEESCGYLTGDLARDKDAVLASGLVARV-----AKKVDLLERLKELYGKYGYYFENLLNFELGSVEKSYAVYEKMKSFSIDGLKNIVDYS-KGFDGVIPNETLRLDFDYGM-IFVRPSGTEPKMKAYVMVKGESSEDTKAKLEKLSNE 472
>gi|62184966|ref|YP_219751.1| putative phosphomannomutase [Chlamydophila abortus S26/3] >gi|62148033|emb|CAH63785.1| putative phosphomannomutase [Chlamydophila abortus S26/3] (601 aa)
Score = 508, Expect = 2.9e-49, Identities = 160/508 (31%), Positives = 267/508 (52%)
  Q:    23 WLESNRISNKYKELI---LKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP------TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNF---PVILTTH---HGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANV---------------KNKDI-LGLEIK-GIRWNEPAQALE---WYLENDMWVKFRLSGTEPKFKIYYEI 530
           WL SN  + + K+ I   L  + + +++ F  + LSFGT G+R+ MG GTN+INVFT ++ ++G+A+ L  KK +P       V+V +D R N+  +A   AK L    I V L+K  +  A  ++S+++R     A ++ TASHNP  Y G+KVY  +GGQ+L     EI+ +    + I   + +   D   +F   I E Y +     +    +Y + N    P I  ++   HGT    +P +L+   +  + L  +Q +PD +F      NPED  +  L ++   + + +I +  DPD+DRL VV  H+N+ +   GNQ+  +   ++L          K   VV + V+T  +  I + Y   +    TGFK++G ++    +  + ++ G EE+ G L      DKD    +AL  E       Q KTL D + +++E  G +  +T+S   E    +  M+  ++K A +               +N D   G+ I  GI +  P   +    +Y +N   +  R SGTEPK K+Y+E+
  S:    23 WL-SNDCNEQDKDTIAELLNNDPKRLEELFGMT-LSFGTGGLRSPMGLGTNRINVFTIRRATQGLAQVL--KKHHPHSGDLIRVVVGYDTRHNSFDFAQETAKVLAGNNIHVLLFKHPEPLA--LVSFTLRAERALAGVMITASHNPPEYNGYKVYMASGGQVLPPWDQEIMHASAHIEEIA--MASSLQDPYIHF---IGEEYEQLYVETVHTLQLYPEDNRISGPAIRVSYSPLHGTGVAMIPRVLRDWNFPMVNLVEKQAIPDGDFPTVHLPNPEDPEALTLGIEQMLRNQDDIFIATDPDADRLGVVCLHENQPYRFNGNQIACLLADHILRALSARAPLGKEDKVVKSLVTTEMLSAIVKFYGGDIVNVGTGFKYIGEKIEAWRESVVRYIFGAEESYGYLYGTHVEDKDAMSTSALITEAALHQKLQGKTLRDAILDLYETHGYFMNKTLSLSFEQ-GQESLMKSHIEKLAKLDPSTMSLRGYSIHTCENYDQGTGINIPCGITYKLPLPKMAMLCYYYQNGGKIIVRPSGTEPKIKLYFEL 558
>gi|153801936|ref|ZP_01956522.1| phosphomannomutase, putative [Vibrio cholerae MZO-3] >gi|124122511|gb|EAY41254.1| phosphomannomutase, putative [Vibrio cholerae MZO-3] (567 aa)
Score = 507, Expect = 4.0e-49, Identities = 152/503 (30%), Positives = 257/503 (51%)
  Q:    28 RISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNK---KSNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE-CQTIIDNVYTPNMD---LISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANF-NPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN-EMNKHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFG-----------AWTGETVSYKIESLNWK----------EEMQEKMDKFANVKNKDILGLEIKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           +   + ++LI    + +I + F  S+L FGTAG+R  +G G N++N    Q+ + G+  +L+ +     N  V++ +D R ++  +A   A  LTS GIK +L    Q+ ATPI+++ VR     AA++ TASHNP  Y GFKVY   G QI+      I + + +  Q  +  +     +   L+ +  D   ++Y +      +  +  + +   +  T  HG  +     LL   G+ ++    +Q  PD  F  + NF NPE+  + D+ +  A+K  A++    DPD+DR AV  R  + ++  LTG+Q+G +F HY+L+     +   V +T VS++ + +IA  + A+ ++T TGFKW+ N  M +  ++  F+  +EEA+G        DKDG  A     ++   L  Q KT+ D L+ ++ + G           A     V  K+ +   K          E+ +     FA+ K + I             +  L ++L+    V  R SGTEPK K YYE+
  S:    16 KTRQELQQLIDTQQDAQIAERFQ-SRLEFGTAGLRGKVGCGPNRMNRLVIQETAAGLGHYLIAQLPDAKNRGVVIGYDGRPDSKQFAHDTASVLTSLGIKTYL--TYQVAATPIVAFGVRHFNAAAAVVVTASHNPPEYNGFKVYWENGAQIIPPHDAGIAACIDQAAQQALPYLALEEAEQQGLLHWLRDEYYQTYRKTIAASPLLQHHTKPQALSLAYTAMHGVGANMAETLLADAGFTHVSSVKEQREPDGTFP-TVNFPNPEEAGAMDMVMALAKKVGAHLACANDPDADRFAVAARKADGEYQMLTGDQVGSLFGHYLLSQTDAHRQ-LVGNTIVSSSLLSKIAAAHGARYYQTLTGFKWLTNVAMQEQTEQHQFLFAYEEALGYTIGSTVWDKDGLSALVAFAQLAAELNAQGKTVWDQLEALYRQHGLHVNAQRSIALAPNSPPVGNKLRATPPKDIAGRKVLIVEDFKLARRTFADGKTETIT---------LPTSDVLIYHLDGGARVIVRPSGTEPKLKCYYEV 535
>gi|47459098|ref|YP_015960.1| phosphomannomutase [Mycoplasma mobile 163K] >gi|47458427|gb|AAT27749.1| phosphomannomutase [Mycoplasma mobile 163K] (513 aa)
Score = 507, Expect = 4.0e-49, Identities = 144/496 (29%), Positives = 259/496 (52%)
  Q:    53 KLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK---SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM------PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMG-IIFTHYVLTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGN---EMNKHIDKMDFVVGFEEAIGSL-NSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDILGLE--IKGIRWNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDE 548
           +L FGTAG+R  +G     +N+F   ++ EG A++L ++     N  VI+  DNR  +  ++ + A  L    I V + +E  I ATPIISY+ +      AI  TASHNPK Y G K+Y+  G QIL    ++I S+        + Q +   +++     I+Y      +SY E   +  +  +     N  +  +  HGT +  +  + K +   N      Q   DP+FT++ + NPEDK+S++  +K    ++++ +L  DPD+DR+ + +   N++  L GN+   +IF + +  N+   +  +++ +FVS++   ++A + N K +   TGFK++GN   ++         +  FEE+ GSL N  +  DKD  Q+  +  ++ +    + KTL+D L++I++++G    E+ S  ++  N    ++    KF N+K  +   +E  IKG     P+  +    +N  W+  R SGTE K K Y  +  + K + ++    LK++
  S:     3 ELEFGTAGLRGILGKTKEHLNIFHVARVIEGFAKYLKSETFNWKNKIVIIGRDNRRKSREFSRLAASILAFHKINVLISRE--IIATPIISYATKYHKALGAINITASHNPKEYNGIKLYDKNGSQILPDVVDKIKSNFLNYEDYTKKQALNQFIFSIKNKYINYIPKQTLQSYEEKVLK--VGGSQKNLSNINLSFSPQHGTGAKIVKSIFKKLNV-NAFFEEAQMKNDPDFTHTKSPNPEDKSSYENVIKLGLIHKSDAVLITDPDADRVGIGILRNNEYILLNGNETATLIFNYLIEINENKLQDKYLIYSFVSSSLPKKMAIENNIKWYEVATGFKYIGNLIEQIKNESKTSKLLFAFEESYGSLINDSLAYDKDAIQSCVILAKMISFYKKKSKTLLDVLEDIYKKYGYIKSESFSINLDEKN-PLHLENIQSKFINLKFNEDFKIENFIKGKENIAPSNMIRISFQNLNWIALRPSGTEAKIKFYLYVVDKDKILVEKNWNILKEK 508
>gi|121710764|ref|XP_001272998.1| phosphoglucomutase [Aspergillus clavatus NRRL 1] >gi|119401148|gb|EAW11572.1| phosphoglucomutase [Aspergillus clavatus NRRL 1] (602 aa)
Score = 507, Expect = 4.3e-49, Identities = 152/538 (28%), Positives = 272/538 (50%)
  Q:    17 NPLSKAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKK---SNPTVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTIIDNVYTP---NMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYV---LTNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV--GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDY--LDEIFEEFGAWTGETVSYKIESLNWKEEM-----------QEKMDKFANVKNKDILGLEIKGIRWNEP-------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYGETKEICDQILKALKDEFEYMLR 554
           NP ++A +E  + S   +EL  ++ +          ++ FGTAG+R  M  G + +N  T  Q S+G+A+++ ++    ++  V++ HD R N+  +A + A   T+ GI V+ YK+  +  TP + + V      A ++ TASHNP    G+KVY   G QI      EI  S+        N +        L +    T+   Y +A +    +T        P + T  HG      P L +S+G  +  +  +Q  P+P+F   +  NPE+  + DL++K  ++    +++  DPD+DR A   +    W   TGNQ+G++   ++   L  K       V+++ VST+ ++++A+        T TGFKW+GN + + ++   + V   FEEA+G +  D+  DKDG  AAA+  +     + + + L+ Y  L ++FE+FG        ++  S +  + +           Q+ +  F  ++ +D+      G +  +P       +Q L  +L+ D+    R SGTEPK K+Y E  G ++    Q ++A+ D F  +L+
  S:    25 NPGTRAEIEQLQASGATEELEQRLRQ----------RIQFGTAGLRGRMAAGFSCMNTLTVIQASQGLAKYIKDEHPDIASNGVVIGHDARHNSASFATLAANAFTAVGIPVWYYKDPSL--TPSVPFGVTYLPAAAGVMITASHNPAQDNGYKVYFKNGAQINTPMDVEIAQSIERNLEPWPNAWNDLQVTDSLHAEALQTVLPQYTQAVWNYARSTVAQWAAPRPFVYTPLHGVGGLTFPDLCRSVGITDFAVVKEQIEPNPDFPTVSFPNPEESGALDLAMKTGDEEGKTLIIANDPDADRFAAAEKVNGSWFTFTGNQLGVLLASHLFDSLDGKDTKSRVAVLNSAVSTSMLEKMAKAKGIHFEETLTGFKWMGN-IARRLEASGYYVPFAFEEALGYMFPDVCHDKDGV-AAAMVFQAAEARW-RSQGLIPYSKLQQLFEDFGYHETLNNYFRSPSPDITKSLFQAIRSGPYQTQKSLGPFKILRWRDMTEGYDSGTQDQKPVLPVDKSSQMLTLWLDRDVRFTIRGSGTEPKVKVYIESCGASQV---QAVEAVCDTFRAVLK 575
>gi|194667808|ref|XP_583514.4| PREDICTED: phosphoglucomutase 2 [Bos taurus] (699 aa)
Score = 507, Expect = 4.3e-49, Identities = 165/516 (31%), Positives = 266/516 (51%)
  Q:    34 KELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRM------NADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTN---KKFDKTP----FVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR-------WNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--------ETKEICDQILKALKDEF 549
           K+LI   N EE+ K FS +++ FGTAG+RA MG G + +N  T  Q ++G  R+L  + S+     V+++ D R       ++  +A + A T  S GI V+L+ +  I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++     P  Q   D+V   ++ L+     +I + YFE   +   +  + ++     + T+ HG     +    K+  +      ++Q  PDP F      NPE+ K    LS   A+K +A I+L  DPD+DRLAV  +  + KW   +GN++G +   ++ T+   K  D +     +++S+ VS+  +  IA K       T TGFKW+GN   + ID+  + +  FEEAIG +      DKDG  AA +  E+ + L  +  +L   L  I+ E+G        +        +++ E +  +    N  K     EI  IR        NEP           +Q + +   N      R SGTEPK K Y E+          + K+  D+++ A+++ F
  S:   123 KQLIAAGNTEELQKCFS-ARMEFGTAGLRAAMGAGISHMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDARAHPASGGSSRRFARLAATTFISQGIPVYLFSD--ITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSVLNGSL-LLHDPSASINKDYFEDLKKYCFHRAVNKETKVKFVHTSVHGVGHSFVQSAFKAFDFVPPEAVSEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKIKAKIILANDPDADRLAVAEKQDSGKWKVFSGNELGALLGWWLFTSWKEKNQDHSALQNLYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKNVLFAFEEAIGYMCCPFVLDKDGVSAAVITAELASFLATKNLSLSQQLKAIYVEYGYHITRASYFICHDQETIKQLFENLRNYDGKSNYPKTCGRFEISHIRDLTTGYDDNEPDKKAILPTSKSSQMITFSFANGGVATMRTSGTEPKIKYYLELCAPPGNSDPEQLKKELDELVSAVEEHF 686
>gi|51893872|ref|YP_076563.1| phosphoglucomutase/phosphomannomutase family protein [Symbiobacterium thermophilum IAM 14863] >gi|51857561|dbj|BAD41719.1| phosphoglucomutase/phosphomannomutase family protein [Symbiobacterium thermophilum IAM 14863] (586 aa)
Score = 507, Expect = 4.5e-49, Identities = 149/487 (30%), Positives = 258/487 (52%)
  Q:    41 NEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT-----VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI-----IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNK----KFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMN--KHIDKMDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKM--------DKFANVK---NKDI---LGLEIKGIRWNEP-----AQALEWYLENDMWVKFRLSGTEPKFKIY 527
           +  EI+  F Y  L+FGT G+R  +G GTN+IN +  +  ++G+A  L  + + P      V++AHD+R  +  +A   A TL + G+   L++   ++ TP++S++VR+ G  A I+ TASHNP  Y G+KVY   GGQ+    A +I ++M     I     +         L+      + E+Y+ +    L++ +  ++    ++ T  HGT    +  +L+  G+  + + A+Q  PDP F   A  NPE+   ++++L+ A   R +++L  DPD+DRL V+VR +   +  LTGNQ+G I    +L ++           V+ T  ++N +  +  +Y   +  T TGFK++G ++   +     +F+ GFEE+ G L +   RDKD   AA L  +       + +TL+D L+ I++  G +     +  +   + +  ++  M          FA V      D     G+E+   R   P     A+ L +   +  +V  R SGTEPK K+Y
  S:    31 DPREIEDRF-YQMLAFGTGGLRGVIGAGTNRINRYMVRLATQGLAEAL--RATGPDALRRGVVIAHDSRRRSAEFAREAAFTLAANGVVAHLWE--GLRPTPMLSFAVRKLGAAAGIVITASHNPPEYNGYKVYWEDGGQVPPDRAGQIQAAMQAVGDIRSIRPMAEGEARTRGLLRPVPPEVDEAYY-SRLLGLVSASPTQRHALRILYTPLHGTGLVPVRTVLERAGFP-VEVVAEQAEPDPGFPTVAKPNPEEPEVYEIALRRAASGRPDLILATDPDADRLGVLVRDREGGYRALTGNQIGAILAEQILRSRAEAGTLPANGAVIKTIATSNLVASLCREYGVTLLETHTGFKFIGEKIKEFEETGSHEFLFGFEESYGYLAATFVRDKDAVMAALLVADAAAHHKAEGRTLLDALEAIWQRHGYFQEGLHNVTLPGRDGQARIRSLMAALRADPPRAFAGVPVAYRDDYAAGTGVEVATGR-TYPLQLGRAEVLHYRFADGGFVMVRPSGTEPKLKVY 545
>gi|29840108|ref|NP_829214.1| phosphoglucomutase/phosphomannomutase family protein [Chlamydophila caviae GPIC] >gi|29834456|gb|AAP05092.1| phosphoglucomutase/phosphomannomutase family protein [Chlamydophila caviae GPIC] (600 aa)
Score = 506, Expect = 4.8e-49, Identities = 160/530 (30%), Positives = 273/530 (51%)
  Q:     1 MKIFQEKNPSSMHANVNPLSK----AWLESNRISNKYKEL--ILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNP------TVIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPECQTI--IDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKN------FPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHYLTGNQMGIIFTHYVL----TNKKFDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD-FVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFA--NVKNKDILGLEI-------KGIRWNEPAQA-----------LEWYLENDMWVKFRLSGTEPKFKIYYEI 530
           MK  Q+K    +    NP++      WL S+   N  + +  +L+ N + +++ F  + L+FGT G+R+ MG GTN+INVFT ++ ++G+A+ L  KK NP       V++ +D R  +  +A   AK      I   ++K+ +  A  ++S+++R     A ++ TASHNP  Y G+KVY  +GGQ+L     EI+ +    + I  +D++  P + LI        E Y       +    +Y + N        V  +  HGT    +P +L+   +  + L  +Q +PD NF      NPED  +  L ++   K + +I +  DPD+DRL VV   +N+ +   GNQ+  +   ++L          K   VV + V+T  +  I E Y   +    TGFK++G ++     +++ +V G EE+ G L      DKD    +AL  E       Q KTL + + +++E  G +  +T+S   E    +  M+ +++K A  +     + G  +       +GI  N  +             L +Y +N   +  R SGTEPK K+Y+E+
  S:     1 MKHLQQK----IETLCNPITAKNILTWLSSDFGQNDRETIAELLENNPQHLEELFGKT-LAFGTGGLRSPMGLGTNRINVFTVRRATQGLAQVL--KKHNPHPGDPIRVVIGYDTRHCSFDFAQETAKVFAGNKIHALIFKDPEPLA--LVSFTLRSQEALAGVMITASHNPPEYNGYKVYMASGGQVLPPLDQEIIQASANVEEILVVDSLKDPYIHLIG-------EEYEALYTETVRQLQLYPEDNRISGQAIHVSYSPLHGTGVTMIPRVLRDWNFPMVKLVEKQALPDGNFPTVHLPNPEDPEALTLGIEQMIKNQDDIFIATDPDADRLGVVCLDENQPYIFNGNQIACLLADHILRAWSAQAPLGKEDKVVKSLVTTEMLSAITESYGGDIINVGTGFKYIGEKIEAWRGQLERYVFGAEESYGYLYGTHVEDKDAISTSALITEAALKQKLQGKTLREAILDLYETHGYFMNKTLSLSFEP-GQESFMKSQIEKLAVLDPSTMSLTGYPVAAFENYRQGIGINIASGTTYKLHLPKMFMLCYYYQNGGKIIVRPSGTEPKIKLYFEL 558
>gi|1657604|gb|AAC96026.1| Cps3M [Streptococcus pneumoniae] (405 aa)
Score = 503, Expect = 1.0e-48, Identities = 120/384 (31%), Positives = 215/384 (55%)
  Q:    21 KAWLESNRISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRMNADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSM-----PECQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQ--KNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPEDKASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKNKWHY-LTGNQMGIIFTHYVLTNKK----FDKTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMD--FVVGFEEA 404
           + WL    +    K+ +L M+++  +  F Y+ L FGTAG+R  +G GTN+IN++  +Q    +A+ + +K        V +A+D+R  +  +A   A+ L + GIK ++++   ++ TP +S++VR  G  A I+ TASH P  + G+KVY   GGQ+L ++A+ +   +     P    + D     +  LI    +T+  +Y E      IN ++  Q  ++  ++ T  HGT        L   G+E++ +   Q  PDP+F+  A+ NPE +A+F L+ +   +  A++++  DPD+DRL V +R  +  ++ L+GNQ+G +   Y+L   K      K   +  + VST  + +IAE Y A +F   TGFK++  ++ +  +K +  ++ GFEE+
  S:     8 QKWLNVPDLPAYLKDELLSMDDKTKEDAF-YTNLEFGTAGMRGYIGAGTNRINIYVVRQAHRSLAKLVESKGETAKKAGVAIAYDSRHFSPEFAFESAQVLAAHGIKSYVFE--SLRPTPELSFAVRHLGAFAGIMVTASHTPAPFNGYKVYGSDGGQMLPADADALTDYIRAIDNPFAVVLADLEEAKSTGLIEVIGETLDAAYLEEVKSVNINQDLIDQYGRDMQIVYTPLHGTGEMLARRALAQAGFESVQVVEAQAKPDPDFSTVASPNPESQAAFALAEELGRQVDADVLVATDPDADRLGVEIRQADGSYWNLSGNQIGALIAKYILEAHKQAGTLPKNAALAKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMFGFEES 405
>gi|169642489|gb|AAI60893.1| Pgm2 protein [Rattus norvegicus] (620 aa)
Score = 503, Expect = 1.3e-48, Identities = 169/538 (31%), Positives = 276/538 (51%)
  Q:    12 MHANVNPLSKAWLESNR---ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRM------NADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFD-------KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDKMDFVV-GFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKNKDIL-----GLEIKGIR-------WNEP-----------AQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--------ETKEICDQILKALKDEF 549
           M A ++  +  WL  +R    S   K+L+ + N+EE++K F  +++ FGTAG+RA MG G +++N  T  Q ++G  R+L  + S+     V+++ D R       ++  +A + A    S G+ V L+ +  I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI+      I  ++ E         D     +  L+     +I+  YFE   +   +  + R+     + T+ HG     +    K+          QQ  PDP F      NPE+ K    LS + A+K +A I+L  DPD+DRLAV  +  + +W   +GN++G +   ++ T+ K         K  +++S+ VS+  +  IA K       T TGFKW+GN   + ID+   V+  FEEAIG +      DKDG  AA ++ E+ + L  +  +L   L  I+ E+G +   T SY I   + +  +Q+  +   N   K+         EI  +R        N+P           +Q + +   N      R SGTEPK K Y E+          + K   D+++ A+++ F
  S:    19 MDARLDQETAQWLRWDRNPLTSESVKQLLAEGNKEELEKCFG-ARMEFGTAGLRAPMGAGISRMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDGRAHPASGGSSRRFARLAATAFISQGVPVHLFSD--ITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDRGISQAIEENLEPWPQAWDESLIDSSSLLHNPSTSISNDYFEDLKKYCFHRTVNRESQVKFVHTSVHGVGHEFVQSAFKAFDLNPPEAVPQQKDPDPEFPTVKYPNPEEGKGVLTLSFELADKIKAKIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQGQSNLKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELVSFLATKNLSLSLQLKAIYLEYG-YHITTASYFI--CHDQGTIQKLFENLRNYDGKNKYPKTCGKFEISAVRDLTTGYDSNQPDKKAVLPTSKSSQMITFTFVNGGVATMRTSGTEPKIKYYAELCAPPGNSDPEQLKRELDELVGAIEEHF 607
>gi|73951890|ref|XP_536263.2| PREDICTED: similar to phosphoglucomutase 2 [Canis familiaris] (615 aa)
Score = 502, Expect = 1.4e-48, Identities = 165/539 (30%), Positives = 274/539 (50%)
  Q:    11 SMHANVNPLSKAWLESNR---ISNKYKELILKMNEEEIDKYFSYSKLSFGTAGIRATMGPGTNQINVFTYQQMSEGVARWLLNKKSNPT---VIVAHDNRM------NADYYAMVIAKTLTSFGIKVFLYKENQIKATPIISYSVRETGVDAAIIATASHNPKNYLGFKVYNHTGGQILDSEANEIVSSMPE----CQTIIDNVYTPNMDLISYFDDTITESYFEASYRCLINTNIYRQKNFPVILTTHHGTASYDLPYLLKSIGYENIILAAQQCVPDPNFTYSANFNPED-KASFDLSLKYAEKYRANIMLGVDPDSDRLAVVVRHKN-KWHYLTGNQMGIIFTHYVLTNKKFD-------KTPFVVSTFVSTNYIDRIAEKYNAKVFRTPTGFKWVGNEMNKHIDK-MDFVVGFEEAIGSLNSDIGRDKDGFQAAALALEVYTMLYDQEKTLVDYLDEIFEEFGAWTGETVSYKIESLNWKEEMQEKMDKFANVKN--KDILGLEIKGIR------------------WNEPAQALEWYLENDMWVKFRLSGTEPKFKIYYEIYG--------ETKEICDQILKALKDEF 549
           SM   ++  +  WL  ++    S   K+LI   N+EE++K F  +++ FGTAG+RA MG G + +N  T  Q ++G  R+L  + S+     V+++ D R       N+  +A + A T  + GI V+L+  + I  TP + Y+V    + A I+ TASHNPK   G+KVY   G QI       I  ++ E         D+       L+     +I +SYFE   +   + ++ R+     + T+ HG     +    K+  +       +Q  PDP F      NPE+ K    LS   A+K +A I+L  DPD+DRLAV  +  + +W   +GN++G +   ++ T+ K         K  +++S+ VS+  +  IA K       T TGFKW+GN   + ID+  + +  FEEAIG +      DKDG  AA ++ E+ + L  +  +L   L  I+ E+G    +   +        +++ E +  +    N  K     EI GIR                   ++ +Q + +   N      R SGTEPK K Y E+          + K+  ++++ A+++ F
  S:    13 SMDPRLDQETARWLRWDKNPLTSESVKQLIADGNKEELEKCFG-ARMEFGTAGLRAAMGTGISHMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDARAHPPSGGNSRRFARLAATTFITQGIPVYLF--SGITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQITSPHDKGISRAIEENLEPWPQAWDDSLINGSPLLHDPSASINKSYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHDFVQSAFKAFDFVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKAKIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDHSALKDLYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKNVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQGTIKKLFENLRNYDGKNNYPKTCGRFEISGIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYSELCAPPGNSDPEQLKKELNELVSAIEEHF 602