>gi|26553562|ref|NP_757496.1| hypothetical protein MYPE1080 [Mycoplasma penetrans HF-2] >gi|26453568|dbj|BAC43900.1| hypothetical protein [Mycoplasma penetrans HF-2] (957 aa)
Score = 4333, Expect = 0.0e+00, Identities = 957/957 (100%), Positives = 957/957 (100%)
  Q:     1 MAFYKSNFRKKVITVSSVGVTGIGIATTAGILISYKDQIWSNEQSDQVDVPKDENVLPPSSNTGPSVPGTNGGNLNDDVVEEKQEEEVERVGTMSAAVLSEIRGIVLEFKDAEANNLKNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKNNNSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLSEGKHTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPSSSYSYAFQYVFTDLVNKQNYVEFYKANQQKILDLDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPILSKGFATDESLLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLMYLNVDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIKQFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYEDFRTGYKNLTFTTWFTKVPSVDKSKQTIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLYQGVTGFIPNSISVGGTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAWGDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLTDKQVYDKVKTYKESELYKSRDERYDIKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFSLPINIVVKYLVGKTNVNIKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSFNMEAGTTMSWFWEAAFWQ 957
           MAFYKSNFRKKVITVSSVGVTGIGIATTAGILISYKDQIWSNEQSDQVDVPKDENVLPPSSNTGPSVPGTNGGNLNDDVVEEKQEEEVERVGTMSAAVLSEIRGIVLEFKDAEANNLKNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKNNNSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLSEGKHTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPSSSYSYAFQYVFTDLVNKQNYVEFYKANQQKILDLDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPILSKGFATDESLLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLMYLNVDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIKQFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYEDFRTGYKNLTFTTWFTKVPSVDKSKQTIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLYQGVTGFIPNSISVGGTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAWGDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLTDKQVYDKVKTYKESELYKSRDERYDIKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFSLPINIVVKYLVGKTNVNIKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSFNMEAGTTMSWFWEAAFWQ
  S:     1 MAFYKSNFRKKVITVSSVGVTGIGIATTAGILISYKDQIWSNEQSDQVDVPKDENVLPPSSNTGPSVPGTNGGNLNDDVVEEKQEEEVERVGTMSAAVLSEIRGIVLEFKDAEANNLKNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKNNNSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLSEGKHTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPSSSYSYAFQYVFTDLVNKQNYVEFYKANQQKILDLDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPILSKGFATDESLLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLMYLNVDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIKQFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYEDFRTGYKNLTFTTWFTKVPSVDKSKQTIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLYQGVTGFIPNSISVGGTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAWGDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLTDKQVYDKVKTYKESELYKSRDERYDIKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFSLPINIVVKYLVGKTNVNIKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSFNMEAGTTMSWFWEAAFWQ 957
>gi|26554294|ref|NP_758228.1| hypothetical protein MYPE8400 [Mycoplasma penetrans HF-2] >gi|26454303|dbj|BAC44632.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (959 aa)
Score = 725, Expect = 4.0e-74, Identities = 232/818 (28%), Positives = 435/818 (53%)
  Q:   116 NLKNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKNNNSS----SNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLS-EGKHTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPSSSYSYAFQYVFTDLVNKQNYVEFYKANQQKILDLDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPILSKGFA-TDESLLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTD--KLNDIKGLLMYLNVDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESS----------------------VVTGLSNLIKQFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNL--SAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYEDF--RTGYKNLTFTTWFTKVPSVDKSKQTIDFEYRISFNINKKVTLN--LKPIKNLFDGNKVWDLINSF--YDLSGIGWAV------NKDWLYQGVTGFIPNSISVGGTY------ASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPI----IAWG-------DYYYSDFWRGILKNIITRDYTFS-FRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLTDKQVYDKVKTYKESEL----YKSRDERYDIKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIK---GTNFAITSHSDVLFNFSLPINIV-VKYLVGKTNVNIKLDVFAMRFQMFLPFMFYDTQTNKMIGSVS 933
           N  +SN   ++Q++ +F  N + + +  +   ++ D+  +   IW  N ++   +S+ + N   S    S     K+ +SF++ ++I   + A   + N +Y LS    + L +  ++Q L   +N  ++ + +GW++ N ++  NN+    T      S+S++F Y    L  KQNY++ Y  ++ +IL+L     K  ++  +  +Y N +D+I+ GI+IL  + SNP VK L+ K +PY TK+ V  + LPS+L P+++     +++  L+V  E K  +  +LE+ +  ++ +    I+  KP I++D  +   IK     L +   I + I  D +G +G++P S+ + + +N+D +L +   +    +                      +VT L  L+ + TT     Q  K F+V+  +   K  F  ++ ++     S ++ IL ++  +N      NI   + S++     +F R  NY++F  +  YKNLTF T F K P +DK+K+TI F+Y+I + +NKK+  +  +   KNL   + +  LI  F   DL  I  ++       K  + + +  +IP++I +G          + T  +++++ S+++   IR GT+YKLG++F +   V   D +   SIT++Y   ++   +  +     +W        D+Y+ DFW+  LKN++ RDY F+    + Q +D  +AT ETY P+LY TGF + +  + +    V  + +  K +      Y S    Y  KW +  N S  L    P +  AL   + +  Y     + + K    TN ++++  D + NF+LP+ +    Y V   +V+IK+ +  + F ++ P  FYDT +  ++   S
  S:    76 NYISSNEYGIQQNFDDFSQNYNLATHTGSESGVKNDINYFGYLIWNQNSRSFTISSIEVNNYQISDLENSKVVFDKTKVSFDLTVNILGIQDASINVLNKTYNLSANNTYQLKVSVKDQVLKSCVNNLTDEFLVGWQVDNATISFNNDSYVGTFTPTLHSFSFSFPYKVKGLTGKQNYLQLYSKHESEILNLSKNDLKNHLKTKFNSEYQNTMDYIENGIQILGILASNPTVKDLIYKSIPYATKILVAANFLPSYLSPLINDALGDSNKPFLEVIKEYKSVILQFLEEMVGSVASVAGTYIDLFKPNITSDSAEYKSIKSFFTTLALSEDIQNAIFKDIIGVDGSKPLSLVDFLYNNLDLVLKIVDPTYTPETNTNTKDTSDNSSDSSTSTTTSPIVTILKLLLSKNTT---TNQYNKFFDVL--SGPEKTEFYNAIIQLVGSTDSQISQILGLITQSNANFTTDNIVKFVSSLHAAIQEMFARNENYKNFYDKDAYKNLTFHTSFAKDPEIDKTKKTISFDYKIYYTLNKKIDFSPVIAAFKNLLTVDTISALIKQFTSTDLDSIVGSIPAVGDFAKARVIKALMQYIPDNIWIGANSNEAFYKQNKTTVSFSSSGSNIWFYPIRVGTNYKLGYQFEFNKNVKMDDPSFTQSITSNYNSKTNSVSLISVDISNSSWSLSTDIAIDFYFRDFWKNFLKNVVLRDYDFAEIFTSDQVNDQNIATIETYSPDLYTTGFALENTMSSIVTDDVLKEFEVDKNTTQVVSDYMSTGALY--KWKD-GNDSSSLYGAKPKLSDALKTSLTSKMYKLVNQESFNKMSDNTNLSVSATIDPIMNFNLPLKVYQADYGV---DVDIKIRMTTVSFNVYSPIKFYDTTSKTLVNGFS 952
>gi|26554059|ref|NP_757993.1| hypothetical protein MYPE6070 [Mycoplasma penetrans HF-2] >gi|26454067|dbj|BAC44397.1| hypothetical protein [Mycoplasma penetrans HF-2] (950 aa)
Score = 604, Expect = 4.2e-60, Identities = 224/826 (27%), Positives = 413/826 (50%)
  Q:   118 KNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKN-----NNSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLS-EGKHTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPSS-SYSYAFQYVFTDLVNKQNYVEFYKANQQKILD-LDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPILSKGFATDES-----LLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLMYLNV----DNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIK-QFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYED---FRTGYKNLTFT-TWFTKVPSVDKSKQTIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLY----QGVTGFIPNSISVG--GTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAW-----GDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLT---DKQVYDKVKT--YKESELYKSRDERYD---IKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFSLPINIVVKYLVGKTNVN--IKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSFNMEA 943
           +N N+  + Q+Y +F  NG F+ Y  +   + +D+  Y+N ++  N K + FT+ NIK+      ++S+   L KS ISFE+ +++   +L+ F IG+  + L+ +   TL IK+ +Q L P I      +YLGW L  VSV  NN+      F P++ S+S AF + F +L +KQ+Y +  +  Q+   + +     K  +++    + +   D++D    +++ I ++  V  L+ K   Y+  +  ++ I+P  ++ IL +    D S     LL+V   NK+ +   L+  L    +I+ PL+  ++  +  D     K LL Y+N     D+ I  +I  D LG   +  KS+++IV  NI+TILN    ++     +T L NL+   FT    + Q   +++ +F++K TK+ FI S+  +   + ++  L+I+  +N  +N   +  I  S  +F  G++E K++ +D   F   YKNL+FT TW T      K   T  F Y I  +I   V L++KPIK +   +    ++    +L+G+   V +  +Y    + +  ++P+    G  G   +    TY+  +  ++ +  + G D+ LG    Y   + + D  L  +I +      + ++    +A        ++Y +FW+ IL+N++ R Y  + R  +      +A    Y+ N Y T  +  +   ++     K ++D  KT  +K+       D+  +   + W N    +E +K +TP   ++    I    +S T N+     T + +    + LFNF   I   VK  VG  +V+  I  ++   +  ++ P  FYD    K+I +   +YS  +  A
  S:    85 ENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDN-PSYKLLLEYVNQFVGKDDPIRKLITGDILGVT-SSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLP-ANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGN--KATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFNA 948
>gi|26554058|ref|NP_757992.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26454066|dbj|BAC44396.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (953 aa)
Score = 600, Expect = 1.3e-59, Identities = 224/834 (26%), Positives = 412/834 (49%)
  Q:   106 VLEFKDAEANNL---KNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKNN-----NSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLSEGKH-TLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPS-SSYSYAFQYVFTDLVNKQNYVEFYKANQQKI-LDLDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPIL-----SKGFATDESLLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLM-----YLNVDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIK-QFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYED---FRTGYKNLTFTTWFTKVPSVDKSKQ--TIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLYQGVT----GFIPNSISVGGTYASMTQT--TYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPII-----AWGDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLTDKQV-----YDKVKTYKESELYKSRDERYD---IKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFS--LPINIVVKYLVGKTNVNIKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSF 939
           ++E K  E+N +   +  N   + Q+Y++F  NGDFS Y  +   + +D+  Y+N ++  N K V  T+ N+K       +S++     K+ ISFE+E  + + +L+ F IG+  + L +    TLTIKA+ Q L P I      +YLGW L  V V  NN+      F P+ +S+S AF + F DL  KQ Y +  +  Q+     ++    K  +++   ++ S   D++D    +++ I  +  V  L+ K   Y+  +  ++ I+P  ++ IL     + G +   +L++V   NK+ +   L+  L    +I+ PL+  ++  ++ D  N    L+M     ++  D+ I ++I  D LG   ++ KS+ +I+  N+DTIL     ++  +  +T L +L+   FT      +   +++ +F +   K+  I ++  +   + V   +DI+F NN   + TN Q I+ S  +F  G+FE K    D   F   YKNL+F   +   P V+K     T  F+Y +  +I+  VTL++ P+KN+        LIN   +LSG   ++ +  +Y  +      F+P++   GG          TY+ +N  ++    + G+DY LGF   Y   + + D  L  +I ++       ++ +  I     A   ++Y DFW+ I +N++ R Y  + R  +      +A   +Y+PN Y T  +  +    +   ++       K + +KE     + ++  D   + W+N D  SEV+  + P         +    ++ +  +   K   + +    + LFNFS  L   + V  +    +  I L     +  +FLP  FYD    +++ + S +YS F
  S:    71 IVESKKIESNMVLVEEKPNEYGLTQNYNDFGINGDFSKYLGDKAKIPEDILGYLNHLYYVNNKTVSITNSNLKKVSFTELDSNNKLVFNKTKISFELEAKVSSKELSDFVIGDEKFSLPKDTSLTLTIKADEQILKPTIQKHGQKFYLGWVLDKVFVSFNNKDFEILNFKPTENSFSKAFYFSFNDLSEKQTYFDLKEKYQKDFGQSINSESIKKYLEEKINRETSLYFDYMDLANNLINEIAIDQPVNKLIEKSALYLIDIITKIGIIPDGIDAILKEAITANGSSNSNTLIQVIVNNKNKILSILKSYLGSAYDIVQPLLENLETNMTAD--NSSYKLIMEYVGQFVGKDDPIRNLITGDILGVT-SQAKSLLDILWTNLDTILAKIKEATKNNPTLTSLIDLLTIIFTKDSSANEYGSIYDSMFGSDEAKQKVINAIKNLLP-ANVGEYIDILFVNNKSFDKTNFQKIIQSFANFFKGLFEYKTESTDKTSFDQRYKNLSFAKTWVNNPVVNKQNNLITTTFKYEVKASISTAVTLDMVPLKNIISQESFNTLINKIANLSGTNASLAESNIYPDLKKYLFNFLPDNFVFGGNGKDTNALIFTYSGDNEEIWFSPEKKGSDYYLGFSVGYGLNIFYDDPNLWKTIASNSNYVKGVFEASKRILLIATAKFKFWYYDFWKSIFQNVLMRSYDINSRFYISDYSTKIADYSSYNPNYYYTNLSFVNNVNNVNVNEIKTMFDLSKAENFKEENSRFTDEQVKDSNTLMWANKD--SEVVNGIMPVTNLTNLKTMKDKMFTFSDLNSNFKNLEYGLDYSFNTLFNFSTKLEFQVTVSLVSVDVHPTISLSAGLFKSNLFLPVNFYDVTNKRLVNNFSKNYSDF 946
>gi|26553859|ref|NP_757793.1| hypothetical protein MYPE4070 [Mycoplasma penetrans HF-2] >gi|26453866|dbj|BAC44197.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (978 aa)
Score = 560, Expect = 5.1e-55, Identities = 236/826 (28%), Positives = 424/826 (51%)
  Q:   116 NLKNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIKN---NNSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLSEGKH-TLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFS-PSSSYSYAFQYVFTDLVNKQNYVEFYKANQQKILDLDVAQAKTKIQDYYLQQYSNDLDF----IDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPIL-------SKGFATDESLLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLMYLN-VDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIK-QFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANY---EDFRTGYKNLTFTTWFTKVPSVDKSKQ-TIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFY-------------DLSGIGWAVNKDWLY---------------QGVTGFIPNSISVGGTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAWG---------DYY--YSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLTDKQVYDKVKTYKESELYKSRDERYDIKWSNTDNYSEVLKSLTPTVPKALTD--YIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFSLPINIVVKYLVG---------------KTNVNIKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSFNM 941
           NL +SNN  + Q+Y +F  NG F+ +  N   ++KD+  Y++ ++ +N ++V  T+VN+ N   N   +     +S ISF +   I A KL  F I N ++ LS+  H +L I+  +Q + P I   +N +YL W +   +V  NN+    + F    +S+S +F   F +L ++Q Y +     + +  +     ++  +++   Q+  ND  F    +D    ++  I  +  +  ++     Y+  + V+L+I+PS  E IL       S G A++ +LL+V  +NK  +   L+  L    +I+ P+I  ++  +  +  +  K +L Y+N ++N  +  +I   L G  +  KS++ IV DN D I++   G +  ++ +  + NLI   F     N   + +++ I  N T K NF  +L  +   S V+  + I+ ++N   N  N+  I+ SI +  NG+FE   N      +   YKN+TFT  + K  SVD +   T  FEY++SF  N +VTL+L  IK+L +      L++                ++S + +A +K  L                + +  ++P+SI + GT  +    TYTA+N  ++ +  + G++Y LGF   Y   +++ D  +V+SI N Y  G   YQ    + W          DY   Y +FW+ I++NI  +DYT+S R  +      +ATT  Y+ N Y T  T  +K+  ++     D +K     E   +           T+N + +  +L+    K L    +  +S+ +   N  +    +F   SH D  F+ +L  N+V +  V                + N+N+ L       +++ P  FYD+   K++ S + +Y+SFN+
  S:    84 NLTSSNNYGLEQNYLDFADNGSFNQFNGNSSFVEKDILGYLHSLYYSNNESVSITNVNLSNLKVNAPDNKIVFNESEISFSLSAEISAKKLTNFIIENQTFTLSQNHHYSLNIEVVDQLIKPSIQKYNNNFYLAWMVEKATVTFNNQSFEISNFVITKNSFSQSFYVQFDNLSDQQTYFDLKNKYETEFKE---NLSQNNVKELVEQKIENDTSFYFYIVDVANTLVKEIAKDEPINKIIQNATNYLLDILVKLNIIPSEFESILKEALVVNSDGTASNTTLLEVLYKNKSQLMSLLKKYLGTAYDIVYPMIENLELNMDENNAS-YKVILNYINSINNPQLKSLITGDLLGVTSSAKSLWQIVWDNFDFIISQVKGLANNNATLNSVLNLISIIFKKDATNGNFSSIYDSILANDTNKTNFTNALVGLLP-SGVSEYIKILVSDNTDFNKENLLKIVTSISNTLNGLFEYADNATIDTPYYERYKNITFTRSWVKDVSVDTTNSPTTSFEYKVSFTFNSEVTLDLAVIKSLVNQTVFNSLVDKLTGINRDALVKLVEDEVSNVKFAGSKVNLVTPAATMIDNELANIKKYLLDYVPDSIKI-GTSGNEFSLTYTADNDQIWFNPNKKGSNYYLGFSVGYDLNISYNDVGMVNSIVNKYAVGDVNYQSKYKVKWTVLTLEAIYFDYTLNYYNFWKPIIQNIFFKDYTYSSRFFLSDYSQEIATTNNYNENYYYTNLTFENKSNSVS----IDDIKNLITKE--DNNRNNSVNWNGTTENTNGINLTLSEDNKKQLFSKMFDVSSDNNNLTNSNFSSYYDFQFDSHLD--FSTTLSFNLVARGHVKINYGFSKYTWDKEFQRVNLNVNLSASLYNSKIYFPINFYDSTNKKLVTSYTKNYTSFNV 973
>gi|26553851|ref|NP_757785.1| hypothetical protein MYPE3990 [Mycoplasma penetrans HF-2] >gi|26453858|dbj|BAC44189.1| hypothetical protein [Mycoplasma penetrans HF-2] (885 aa)
Score = 114, Expect = 2.6e-03, Identities = 131/606 (21%), Positives = 258/606 (42%)
  Q:   181 SNFQLGKSTISFE--IEISIEAFKLAIFQIGNNSYKLSEGK-HTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFS-PSSSYSYAFQYVFTDLVNKQNYVEFYKANQQKILDLDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILP-------SFLEPILSKGFATDESLLKVFSENK---DDVYIYLEDNLWDLSEILIPLINEIKPGISTDKL----NDIKGLLMYL--------NVDNSIIDIIINDFLGGNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIKQFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTN----------ILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYEDFRTGYKNLTFTTWFTKVPSVDKSKQTIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLYQGVTGFIPNSISVGGTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAWGDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLY 786
           S+F    ST+SFE  ++++  +     F I N S+ +  GK  TL IKA+NQ     I   +   Y      NV+ + ++++     FS  ++ YS A Q     + +  +Y E     +    +L     KT I  Y        L  + Y   I+  + +N ++ +LL K    + K+ ++L  +        S+++ + S    + +SLL V   N     ++   L D+    S+++   I  I   +S ++L      IKGL+ +          +D + ++ +I      + T    +  +  ++ D ++N  M ++ ES+  T    +  +F  +  N     +F+ +  ++  K+   + L  M  ++AV            +  I+  +N  +N +N+Q +L  +                F +   N T    F  + S ++  + + + Y I F      + N+  + N+   +    + ++    S + + + +D            ++ +  T       T+T NN  + +  + S   Y   F   Y   + F    L +SIT+ YK G+ W+ I   I        +  +  LK  + RDY F    +++   D+      YDPN+Y
  S:   146 SDFSATDSTVSFEYLVKLTNNSSTTTSFNINNQSFYIPAGKSKTLEIKADNQNFYFGIT-KNYNNYYLNWNTNVTFKFDDQEYLFESFSFTNNDYSIAIQTSVNGITSSNSYKEI-STQEAYFNNLSEDSLKTNIDSYLSSNLELSLSMLGYLTPIVADLNTNTNLNALLTKQSENIAKLVLKLLAIEETNANYNSYVK-LFSDLLGSTDSLLTVIGNNNIAISNLIALLIDDPTISSDVIYTYIKNINGNLSDEQLVEQKESIKGLISFFVTSMGSSSTIDLNFVNKLIETVFNKSTTTLSLVSYLFTNSADDLIN--MLTTNESTKQT--YQMYFKFVGLLVNDPTKLIFDQLLSSEG-KQLLSDILNSMMGMNAVQGDNSNSLILSLVQQIVSPSNSNLNPSNLQTLLTDLV----------VPLLKFLSDSNNYTLNKTFNSI-SYNQEAKKVSYNYEIKFEFKNNFSFNINSVLNILPDS--LKMGSTSVPKSILEYMLKQD----------NKAMQMTITSGDKIVFTFTGNNEQINLSPVSSNGSYIANFNIMYKLVMRFDMPGLFNSITSFYKTGT-WHSIGNSIV-------NVLKDFLKYFLIRDYEFYGMISIK---DSSTIISDYDPNVY 745
>gi|195456812|ref|XP_002075298.1| GK17279 [Drosophila willistoni] >gi|194171383|gb|EDW86284.1| GK17279 [Drosophila willistoni] (2690 aa)
Score = 93, Expect = 7.0e-01, Identities = 26/88 (29%), Positives = 47/88 (53%)
  Q:    19 GVTGIGIATTAGILISYKDQIWSNEQSDQVDVPKDENVLPPSSNTGPSVPGTNGGNLNDDVVEEKQEEEVERVGTMSAAVLSEIRGIV 106
           G  G+G     G++ S     WS+++SD +  PK +   P S   G ++ GTNGG  +D  +  + EE  +RV + +   ++++R I+
  S:  1786 GHQGVG----GGMVTSASGHHWSDDESD-MPQPKRQRNEPVSMLGGLNMAGTNGGYTSDHTMVSEYEEADQRVWSQAHLDVADVRAIM 1868