>gi|26553563|ref|NP_757497.1| transcription elongation factor NusA [Mycoplasma penetrans HF-2] >gi|26453569|dbj|BAC43901.1| N-utilization substance protein A [Mycoplasma penetrans HF-2] (597 aa)
Score = 2354, Expect = 0.0e+00, Identities = 597/597 (100%), Positives = 597/597 (100%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEEVVFYESSKEKNDSQDSTPVTEEVVNDQITFKYKEEKPASETKSKKEKPAVVSSDDDDQDYEPVSLVRKDSSDIDDIGGDDPWLLRAKKENKSSKSKNYNKAPKPKKEKVSVFDELMDNTDDISVDSEIDTSELDNLELEDE 597
           MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEEVVFYESSKEKNDSQDSTPVTEEVVNDQITFKYKEEKPASETKSKKEKPAVVSSDDDDQDYEPVSLVRKDSSDIDDIGGDDPWLLRAKKENKSSKSKNYNKAPKPKKEKVSVFDELMDNTDDISVDSEIDTSELDNLELEDE
  S:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEEVVFYESSKEKNDSQDSTPVTEEVVNDQITFKYKEEKPASETKSKKEKPAVVSSDDDDQDYEPVSLVRKDSSDIDDIGGDDPWLLRAKKENKSSKSKNYNKAPKPKKEKVSVFDELMDNTDDISVDSEIDTSELDNLELEDE 597
>gi|31544317|ref|NP_852895.1| transcription elongation factor NusA [Mycoplasma gallisepticum R] >gi|31541161|gb|AAP56463.1| NusA-homolog [Mycoplasma gallisepticum R] (625 aa)
Score = 533, Expect = 4.6e-52, Identities = 140/354 (39%), Positives = 221/354 (62%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS--EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR--LVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTL---------NNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           KSFLE +  +A+ K+ SK+ I  ILK A+ ++  KE+PD  I+V++D +   +K+F+   V+D S  E+E D+  EI++ +A     + K+GD     ++I  F R + ++ +Q     L+++ N +   EW  K+  I+R  VEK +N   ++ VNLG       + + +P EELQ    Y F++ ++K +Q+K WP+I+SR+D   ++++L   I EI +GI+EIK I R+ G KTKVA+LS  P +D V   +G  G RIK I++ L         +NE IDV  +++D  + + NAC+P  I+GV++ +D +    K V I+  ++ L  LIG+ GINVRLLS +TGWSID  S+  AIED I
  S:     7 KSFLEAIQTVAETKNISKKEISTILKDAIIRACAKEDPDQRIDVMIDFDMGLLKIFKLYKVIDDSVSEEEFDEINEIHLKDALATNPTIKVGDDFLKSLSIGDFSRVVATNISQYFRQKLSELVNKQAVSEWTPKLNKIVRGTVEKDENNPNVLLVNLGGIYAYYYKRDWVPNEELQNDVEYDFVLTQIK-EQSKSWPLIVSRSDALYVKHVLTENIPEIKEGIVEIKAIQRVAGQKTKVAVLSNNPDIDPVTLILGDGGIRIKSIAANLIEHSSGVKVSNEVIDVFHWNDDVFKLIANACYPVDIIGVDVLEDSE--RDKSVDIIVEDQYLPFLIGRAGINVRLLSYMTGWSIDFKSQSAAIEDNI 370
>gi|13507893|ref|NP_109842.1| transcription elongation factor NusA [Mycoplasma pneumoniae M129] >gi|2499338|sp|P75591|NUSA_MYCPN Transcription elongation protein nusA >gi|1674384|gb|AAB96325.1| N-utilization substance protein A-like protein [Mycoplasma pneumoniae M129] (540 aa)
Score = 525, Expect = 3.6e-51, Identities = 148/410 (36%), Positives = 245/410 (59%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN------RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGW-SIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFG--GYRLNNANNKKSTSNKPGSKPNFYSGFSS--DDSIETDF 415
            L+ +  +A+ K+ + +++V  LKTAL ++Y K    +++EV +D NK  +++ +   VVD + ++ DD  E+ +SEA++L  + ++G  +   V++   +  + S    +    +N+ +   V  ++ ++VG +I A VE +D       +   VNL +TKG + + E   GE+L  G+ YLF+IKE++ +Q+  WPI LSR+D  LL +LL +   EI++G IEIK++ R  G K+KVA++S+ P VD +   +GPKGERI+ IS   N E ID+++++ED  +FLVNA  P ++VG  I  D++   S  + IV P   +  + G  GIN+RL+S LTGW S+D+ +EK A E  IEF  V+        QP+  FG    R   +NN ++ + +  S   FY+  ++  DD I  D 
  S:    12 LLQLIKNVAETKNLAIDDVVLCLKTALAQTYKKHLNYVNVEVNIDFNKGLMQIEQLFDVVDDNNEDYDDFLEMPLSEAKKLNPNLEVGGVLRKPVSLKDIKGDLISKMVLLFNQKINETAFKTVMSDFINEVGQVIEARVEDIDTNKDGGLKGYIVNLETTKGYMPKRELSKGEKLDIGKKYLFVIKEIQ-KQSSMWPITLSRSDSRLLEFLLNSNTPEIANGTIEIKKMERSPGTKSKVAVISKDPVVDPIAAILGPKGERIRGISEEFNGEIIDIVIWNEDKLKFLVNAVLPAEVVGYNILQDDERDTS--IEIVVPANQIANVFGFKGINIRLISNLTGWSSVDVYTEKDAAEQGIEFTRVN-------FQPQGIFGIKKRRDKISNNPRNNNQQLASDKVFYTSKANVVDDEIIVDL 422
>gi|147677601|ref|YP_001211816.1| transcription elongation factor NusA [Pelotomaculum thermopropionicum SI] >gi|146273698|dbj|BAF59447.1| transcription elongation factor [Pelotomaculum thermopropionicum SI] (360 aa)
Score = 496, Expect = 8.2e-48, Identities = 124/344 (36%), Positives = 202/344 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           FLE L  + +EK  + + ++  ++ AL  +Y +    L +  V +D      K++ +R V +  ED     +EI+I EA+ +  +Y  GD V +EV    F R       Q++   + +   + +YEE+ ++ G+I+   V++V+ + V + LG T+ ++  SEQIPGEE + G      I EV+ + TKG  I++SR   GLL+ LL+ E+ E+ +GI+E+K I+R  G ++K+A+ S+   VD VG  VGPKG R++ I S LN E+ID+I ++ DP +F+ ++  P K++ VEI ++E     K+  ++ P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 FLEALKDLEREKGIAVDVLLEAIEAALLSAYKRNFGSLQNARVHIDRETGEFKVYTQRTVSEHVEDP---RQEIDIKEARAINPNYAPGDIVESEVTPRDFGRIAAQTAKQVVVQRIREAERNIIYEEFANREGDIVTGIVQRVEQKNVYIELGKTEAILAPSEQIPGEEYRQGDRIKTYIVEVR-KTTKGPQILVSRTHPGLLKRLLEMEVPELQEGIVELKGIAREAGARSKIAVYSKDENVDPVGACVGPKGMRVQNIVSELNGEKIDIIKWNPDPSKFVASSLSPAKVIAVEIWEEE-----KVARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 340
>gi|145955038|ref|ZP_01804042.1| hypothetical protein CdifQ_04001448 [Clostridium difficile QCD-32g58] >gi|168696363|ref|ZP_02728640.1| transcription elongation protein [Clostridium difficile QCD-37x79] >gi|168723272|ref|ZP_02755549.1| transcription elongation protein [Clostridium difficile QCD-76w55] >gi|168730905|ref|ZP_02763182.1| transcription elongation protein [Clostridium difficile QCD-97b34] >gi|196159953|ref|ZP_03120514.1| transcription elongation protein [Clostridium difficile CIP 107932] (384 aa)
Score = 495, Expect = 1.1e-47, Identities = 133/360 (36%), Positives = 210/360 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQL 365
           F+E LD++  ++   KE +++ ++ AL  +Y K      ++ V  D +K  IK+F +RVVVD+S D  D   EI +++A+E+  +Y+LGD +  EV    F R       Q++   + +     VY E+ +K   I+  EV + +  +V VNLG  +G++ +SEQIP E  + GQ   F I EVK +  KG  I++SR+  GL++ L + E+ EI +GI++IK ++R  G +TK+A+ S    +D +G  VGPKG R+K I   L +E+ID+I Y EDP +F+  A  P K+V V+I +DE     K   ++ P+  L   IGK G N RL +KLT W IDI SE  A ++ +  E+  ++
  S:     5 FMEALDELVVDRGIDKEILIDTIEQALLTAYKKNFGSAQNVRVEFDRDKGDIKVFSQRVVVDES-DLYDTFLEIELADAREINPNYELGDIIEHEVTPKNFGRIAAQTAKQVVVQRIREAEREIVYNEFIEKENEIVTGEVARANKNVVYVNLGRIEGIMTQSEQIPFENYKAGQKIKFYILEVK-KTNKGPQIVVSRSHPGLVKRLFEEEVPEIYEGIVQIKSVAREAGSRTKMAVKSIDEKIDPIGACVGPKGLRVKNIVDELGDEKIDIIKYSEDPAEFISAALSPSKVVRVDIDEDE-----KSALVIVPDYQLSLAIGKEGQNARLAAKLTNWKIDIKSESQAEQEMLNLENSKEI 358
>gi|167037624|ref|YP_001665202.1| transcription elongation factor NusA [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856458|gb|ABY94866.1| NusA antitermination factor [Thermoanaerobacter pseudethanolicus ATCC 33223] (346 aa)
Score = 494, Expect = 1.3e-47, Identities = 122/346 (35%), Positives = 201/346 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKL 351
           F+E L+ I +EK   K+ +   ++ AL  +Y K      ++++V+D     +K++ ++ VV   E+  +D  EI++ EA+++ K Y++GD V  EV    F R    +  Q++   + +   + +YEE+  K   ++   V +VD + V +NLG  + ++  SEQIPGE   PG      I EVK + TKG  I++SR+  GL++ L + E  EI  GI+EI+ I+R  G +TK+A+ SR   VD VG  VG KG R++ + + L  E+ID++ +   P++F++NA  P K + +EI D+++    K+  ++ P+  L   IGK G N RL +KLTGW IDI SE +
  S:     5 FIEALNSICEEKGIPKDTMFEAIEAALVSAYKKNYGTSQNVKIVMDRETGDVKVYAQKTVV---EEVYNDLLEISLEEARKINKKYQIGDIVDIEVTPKNFGRIAAQNAKQVVIQRIREAERNVIYEEFLAKETEVVTGIVTRVDKKNVLINLGRVEAILGPSEQIPGETFAPGDRVKVYIVEVK-KTTKGPQILISRSHPGLVKRLFELESPEIQQGIVEIRSIAREAGSRTKMAVFSRDENVDPVGACVGYKGARVQAVVNELKGEKIDIVKWSSKPQEFIMNALSPAKALSIEILDEKE----KVARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSESM 343
>gi|20807843|ref|NP_623014.1| transcription elongation factor NusA [Thermoanaerobacter tengcongensis MB4] >gi|20516405|gb|AAM24618.1| Transcription terminator [Thermoanaerobacter tengcongensis MB4] (346 aa)
Score = 494, Expect = 1.3e-47, Identities = 120/346 (34%), Positives = 201/346 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKL 351
           F+E L+ I +EK   KE +   ++ AL  +Y K      ++++V+D     +K++ ++ VV++ ++++    EI++ +A+++ K Y++GD V  EV    F R    +  Q++   + +   + +YEE+  K   ++   V +     V +NLG  + ++  SEQIPGE   PG      I EVK + TKG  II+SR+  GL++ L + E  EI  GI+EI+ I+R  G +TK+A+ SR P VD +G  VG KG R++ + + L  E+ID++ +   P++F++NA  P K + VEI D+++    K+  ++ P+  L   IGK G N RL +KLTGW IDI SE +
  S:     5 FIEALNSICEEKGIPKETMFEAIEAALVSAYRKNYGTAQNVKIVMDRETGDVKVYAQKTVVEEVKNDL---LEISLEDARKINKKYQIGDIVDIEVTPKNFGRIAAQNAKQVVIQRIREAERNVIYEEFLAKETEVVTGIVTRAAKNNVLINLGRVEAILTPSEQIPGETFSPGDRIKVYIVEVK-KTTKGPQIIISRSHPGLVKRLFELESPEIQQGIVEIRSIAREPGSRTKMAVFSRDPNVDPIGACVGYKGSRVQAVVNELKGEKIDIVKWSSKPQEFIMNALSPAKAISVEIVDEKE----KVARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSESM 343
>gi|126698905|ref|YP_001087802.1| transcription elongation protein [Clostridium difficile 630] >gi|168714765|ref|ZP_02747042.1| transcription elongation protein [Clostridium difficile QCD-63q42] >gi|196127245|ref|ZP_03118994.1| transcription elongation protein [Clostridium difficile ATCC 43255] >gi|115250342|emb|CAJ68164.1| transcription elongation protein [Clostridium difficile 630] (384 aa)
Score = 494, Expect = 1.4e-47, Identities = 133/360 (36%), Positives = 210/360 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQL 365
           F+E LD++  ++   KE +++ ++ AL  +Y K      ++ V  D +K  IK+F +RVVVD+S D  D   EI +++A+E+  +Y+LGD +  EV    F R       Q++   + +     VY E+ +K   I+  EV + +  +V VNLG  +G++ +SEQIP E  + GQ   F I EVK +  KG  I++SR+  GL++ L + E+ EI +GI++IK ++R  G +TK+A+ S    +D +G  VGPKG R+K I   L +E+ID+I Y EDP +F+  A  P K+V V+I +DE     K   ++ P+  L   IGK G N RL +KLT W IDI SE  A ++ +  E+  ++
  S:     5 FMEALDELVVDRGIDKEILIDTIEQALLTAYKKNFGSAQNVRVEFDRDKGDIKVFSQRVVVDES-DLYDTFLEIELADAREINPNYELGDIIEHEVTPKNFGRIAAQTAKQVVVQRIREAEREIVYNEFIEKENEIVTGEVARANKNVVYVNLGRIEGIMTQSEQIPFENYKAGQKIKFYILEVK-KTNKGPQIVVSRSHPGLVKRLFEEEVPEIYEGIVQIKSVAREAGSRTKMAVRSIDEKIDPIGACVGPKGLRVKNIVDELGDEKIDIIKYSEDPAEFISAALSPSKVVRVDIDEDE-----KSALVIVPDYQLSLAIGKEGQNARLAAKLTNWKIDIKSESQAEQEMLNLENSKEI 358
>gi|196165548|ref|ZP_03126079.1| transcription elongation protein [Clostridium difficile QCD-23m63] (384 aa)
Score = 493, Expect = 1.6e-47, Identities = 133/360 (36%), Positives = 210/360 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQL 365
           F+E LD++  ++   KE +++ ++ AL  +Y K      ++ V  D +K  IK+F +RVVVD+S D  D   EI +++A+E+  +Y+LGD +  EV    F R       Q++   + +     VY E+ +K   I+  EV + +  +V VNLG  +G++ +SEQIP E  + GQ   F I EVK +  KG  I++SR+  GL++ L + E+ EI +GI++IK ++R  G +TK+A+ S    +D +G  VGPKG R+K I   L +E+ID+I Y EDP +F+  A  P K+V V+I +DE     K   ++ P+  L   IGK G N RL +KLT W IDI SE  A ++ +  E+  ++
  S:     5 FMEALDELVVDRGIDKEILIDTIEQALLTAYKKNFGSAQNVRVEFDRDKGDIKVFSQRVVVDES-DLYDTFLEIELADAREINPNYELGDIIEHEVTPKNFGRIAAQTAKQVVVQRIREAEREIVYNEFIEKENEIVTGEVARANKNVVYVNLGRIEGIMTQSEQIPFENYKAGQKIKFYILEVK-KTNKGPQIVVSRSHPGLVKRLFEEEVPEIYEGIVQIKSVAREAGSRTKMAVRSIDEKIDPIGACVGPKGLRVKNIVDELGDEKIDIIKYSEDPAEFISAALSPSKVVRVDIDEDE-----KSALVIVPDYQLSLAIGKEGQNARLAAKLTNWKIDIKSESQAEQEMLNLENSKKI 358
>gi|167040285|ref|YP_001663270.1| transcription elongation factor NusA [Thermoanaerobacter sp. X514] >gi|166854525|gb|ABY92934.1| NusA antitermination factor [Thermoanaerobacter sp. X514] (346 aa)
Score = 493, Expect = 1.6e-47, Identities = 122/346 (35%), Positives = 201/346 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKL 351
           F+E L+ I +EK   K+ +   ++ AL  +Y K      ++++V+D     +K++ ++ VV   E+  +D  EI++ EA+++ K Y++GD V  EV    F R    +  Q++   + +   + +YEE+  K   ++   V KVD + V +NLG  + ++  +EQIPGE   PG      I EVK + TKG  I++SR+  GL++ L + E  EI  GI+EI+ I+R  G +TK+A+ SR   VD VG  VG KG R++ + + L  E+ID++ +   P++F++NA  P K + +EI D+++    K+  ++ P+  L   IGK G N RL +KLTGW IDI SE +
  S:     5 FIEALNSICEEKGIPKDTMFEAIEAALVSAYKKNYGTSQNVKIVMDRETGDVKVYAQKTVV---EEVYNDLLEISLEEARKINKKYQIGDIVDIEVTPKNFGRIAAQNAKQVVIQRIREAERNVIYEEFLAKETEVVTGIVTKVDKKNVLINLGRVEAILSPAEQIPGETFAPGDRVKVYIVEVK-KTTKGPQILISRSHPGLVKRLFELESPEIQQGIVEIRSIAREAGSRTKMAVFSRDENVDPVGACVGYKGARVQAVVNELKGEKIDIVKWSSKPQEFIMNALSPAKALSIEILDEKE----KVARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSESM 343
>gi|12044993|ref|NP_072803.1| transcription elongation factor NusA [Mycoplasma genitalium G37] >gi|1352607|sp|P47387|NUSA_MYCGE Transcription elongation protein nusA >gi|3844734|gb|AAC71359.1| transcription termination factor NusA [Mycoplasma genitalium G37] >gi|166078938|gb|ABY79556.1| transcription termination factor NusA [synthetic Mycoplasma genitalium JCVI-1.0] (531 aa)
Score = 492, Expect = 2.7e-47, Identities = 130/360 (36%), Positives = 211/360 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN------RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGW-SIDIISEKLAIEDKIEFEDVS 363
           +  L  +  +AK K+ S E +V  LKTALE++Y K    +++EV ++ +K  I + +   VV    ++ DD  EI +  A ++  S +LGD +   + +      + +    I    +++ +   V  E+  +VG +I A+VE +D       +   +NL +TKG + + E   GE L+ G+ YLF+IKE++ Q +  WPI LSR+D  LL++LL +   EI +G I IK+I R  G K+K+A++S  P VD V   +GPKGE+I+ IS   N E ID++ ++ED  +FL+NA  P +++G  I  D++   S  + +V P   +  + G  G+N+RL+S LTGW S+D+ SEK A E  I+F  +S
  S:    31 QPLLAIIKNVAKTKNLSIEEVVFCLKTALEQAYKKHLNFVNVEVNINFDKGIINVEQLFNVVSDENEDYDDFLEIPLQAANKINSSLQLGDVLRKPIPLKNISSDLINKMIAIFNQKISETNFKAVMSEFSSEVGEVIEAKVEDIDTNKEGGLKGYIINLETTKGYISKRELSKGERLEIGKKYLFVIKEIQRQASL-WPITLSRSDTRLLQFLLTSNTPEIENGTIVIKKIERSPGVKSKIAVISNDPAVDPVAAILGPKGEKIRGISEEFNGEIIDIVFWNEDKLKFLINAILPAEVIGYNILQDDERDTS--IEVVVPANQIANVFGFKGVNIRLISNLTGWNSVDVYSEKDASEANIKFTRLS 394
>gi|169831086|ref|YP_001717068.1| NusA antitermination factor [Candidatus Desulforudis audaxviator MP104C] >gi|169637930|gb|ACA59436.1| NusA antitermination factor [Candidatus Desulforudis audaxviator MP104C] (359 aa)
Score = 488, Expect = 6.7e-47, Identities = 123/349 (35%), Positives = 198/349 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           FL  L  + KE+  S E ++  ++ AL  +Y +      +  V VD +    K++ +R VV + ED  D   +I++ EA+ +   Y+L DTV +E+    F R       Q++   + +   + V+EE+  + G+I+   V++++ R V + LG T+ V+  +EQIP E  +PGQ     I EVK + TKG  I++SR   GLL+ L + E+ E+  G++E+K ++R  G ++K+A+ S   G+D VG  VGPKG R++ I   LN E+IDV+ +  D  +F+ ++  P K++ VE+ +DE     KI  ++ P+  L   IGK G N RL +KLTGW IDI SE    E
  S:     5 FLAALRDLEKERSISVEVLLEAIEAALLSAYRRNFGTSHNARVQVDRHTGDCKVYARRTVVQEVEDPQD---QISLEEARAINPGYQLEDTVESEITPRNFGRIAAQTAKQVVVQRIREAERNMVFEEFASREGDIVTGVVQRIEQRNVYIELGKTEAVLPPAEQIPRENYRPGQRLKTYIVEVK-KTTKGPLILVSRTHPGLLKRLFEIEVPELHQGLVELKAVAREAGIRSKIAVYSNDEGIDPVGACVGPKGARVQAIVQELNGEKIDVVKWSPDSSKFVSSSLSPAKVIAVEVWEDE-----KIARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSESQMAE 345
>gi|138894780|ref|YP_001125233.1| transcription elongation factor NusA [Geobacillus thermodenitrificans NG80-2] >gi|196247596|ref|ZP_03146298.1| NusA antitermination factor [Geobacillus sp. G11MC16] >gi|134266293|gb|ABO66488.1| N utilization substance protein A [Geobacillus thermodenitrificans NG80-2] >gi|196212380|gb|EDY07137.1| NusA antitermination factor [Geobacillus sp. G11MC16] (383 aa)
Score = 483, Expect = 2.9e-46, Identities = 130/353 (36%), Positives = 202/353 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
            LE L  + +EK  SKE I+  ++ AL  +Y K N      V VDLN ++  I++  ++ VV   E+  D   EI++ EAQ L  +Y++GD V  EV    F R       Q++T  + +   S +Y E+ D+  +I+   V+++D R V V+LG  + ++  +EQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EIK I+R  G ++K+++ S  P VD VG  VGPKG+R++ I   L+ E+ID++ +  DP +F+ NA  P K++ V + +++     K  T++ P+  L   IGK G N RL +KLTGW IDI SE  A E  I+
  S:     5 LLEALADLMREKGISKEVIMEAIEAALVSAY-KRNFGQAQNVRVDLNMDTGTIRVLARKDVV---EEVTDPRLEISLEEAQRLNPNYQIGDVVELEVTPRDFGRIAAQTAKQVVTQRVREAERSIIYAEFVDREEDIMTGIVQRIDPRFVYVSLGKAEALLPANEQMPNETYKPHDRLKVYITKVE-KTTKGPQIFVSRTHPGLLKRLFELEVPEIYDGTVEIKSIAREAGDRSKISVHSDNPEVDPVGACVGPKGQRVQAIVDELHGEKIDIVRWSADPVEFVANALSPAKVLRVIVNEEQ-----KATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSESEAREMGID 349
>gi|94985335|ref|YP_604699.1| transcription elongation factor NusA [Deinococcus geothermalis DSM 11300] >gi|94555616|gb|ABF45530.1| NusA antitermination factor [Deinococcus geothermalis DSM 11300] (395 aa)
Score = 482, Expect = 3.8e-46, Identities = 125/351 (35%), Positives = 208/351 (59%)
  Q:     5 SFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVE-VNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           +F + L ++A+ ++ ++  ++   + +L ++Y +   PD  +EV +D     +++   R VV+K EDE   + +I++++A EL    ++G  +   V+ +KF R       Q LT  + +   + VY E+KD+ G ++ A+V + DN+    V LG+ + ++   EQIPGE+L PG      +KEV+ +  KG  I+ SRADE LL YLL+ EI E+++GI+EIK I+R  G ++KVA+ S  P VD +G  +G +G RI+ ++  L  ER+DVIL+D + + F+ NA  P K+  +E+      P ++  T+    + L   IGK G NVRL +KLTG+ ID + E  AI+D
  S:     7 NFADALREVAQARNINELQLIEAFEQSLAQAYSRNVEPDRRVEVHLDPVSGELEVLIVREVVEKVEDE---NLQISLADALELDPGVEIGMEMEFPVDREKFSRIALQAAKQTLTQKMRETERNVVYNEYKDREGQVLTAQVVRSDNKGNWFVELGAGEAILPPREQIPGEKLVPGNRVKIYLKEVR-KTPKGPTILASRADERLLEYLLRQEIPEVANGIVEIKAIAREAGQRSKVAVYSHNPNVDPIGACIGHRGNRIQAVTGELGRERVDVILWDANARDFIRNALSPAKVGLIEVR-----PDTREATVTVTPDQLSLAIGKGGQNVRLAAKLTGFKID-LRETAAIQD 349
>gi|89209759|ref|ZP_01188154.1| Transcription termination factor NusA [Halothermothrix orenii H 168] >gi|89160828|gb|EAR80481.1| Transcription termination factor NusA [Halothermothrix orenii H 168] (377 aa)
Score = 481, Expect = 5.0e-46, Identities = 132/344 (38%), Positives = 201/344 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           FL  LD I KEK  SKE ++  ++TAL  +Y KE     ++ V +  +   + ++ ++ VVD+  +E    KEI++ EAQ+L K+Y+ GD V  EV    F R       Q++   + +     +YEE+K K G II   V++  N  V ++LG T+ ++  SEQIPGE  + G+     + EV S  TKG  I++SR+  GLL+ L + E+ EI DGI+EIK ++R  GY++K+A+ S    VD VG+ VGPKG R++ +   LN E+ID+I + EDP   + NA +P K++ V + ++E +    +     P+  L   IGK G N RL +KLTGW +DI SE
  S:     5 FLHALDDIEKEKGISKEVLIEAIETALLSAYKKEFGSKENVRVHIVPDSGEVHVYSQKKVVDEVNNE---RKEISLEEAQKLNKNYEPGDIVEKEVTPANFGRIAAQTAKQVVMQRIREAERDVIYEEYKQKEGEIITGTVQRFHNNNVLIDLGRTEALLPPSEQIPGELYEMGRRIKVYVVEVAST-TKGPRILVSRSHPGLLKRLFEVEVPEIFDGIVEIKAVAREAGYRSKMAVSSYDENVDPVGSCVGPKGMRVQAVVDQLNGEKIDIIEWSEDPAILVANALNPAKVINVSLDEEEKVAEVVV-----PDFQLSLAIGKEGQNARLAAKLTGWKVDIKSE 340
>gi|171324506|ref|ZP_02913020.1| NusA antitermination factor [Geobacillus sp. WCH70] >gi|171089548|gb|EDT35876.1| NusA antitermination factor [Geobacillus sp. WCH70] (382 aa)
Score = 480, Expect = 5.9e-46, Identities = 131/353 (37%), Positives = 206/353 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
            L+ L  I +EK  SKE ++  ++ A+  +Y K N      V VDLN E+  I++F ++ VVD    E++D + EI++ EAQ +  +Y++GD +  EV    F R       Q++T  + +   S +Y E+ D+  +I+   V++VD R V V+LG T+ ++  SEQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EIK I+R  G ++K+++ S  P VD VG  VGPKG+R++ +   LN E+ID++ +  DP +F+ NA  P K++ V + +++     K  T++ P+  L   IGK G N RL +KLT W IDI SE  A E  I+
  S:     5 LLDALADIIREKGISKEVVMEAIEAAIISAY-KRNFGQAQNVRVDLNTETGTIRVFARKEVVD----EVNDPRLEISLEEAQRINPNYQIGDVLELEVTPKDFGRIAAQTAKQVVTQRVREAERSVIYAEFVDREEDIMTGIVQRVDPRFVYVSLGKTEALLPASEQMPNETYKPHDRIKVYITKVE-KTTKGPQIFVSRTHPGLLKRLFELEVPEIYDGTVEIKSIAREAGDRSKISVHSDNPEVDPVGACVGPKGQRVQAVVEELNGEKIDIVRWSADPVEFVANALSPAKVLRVIVNEEQ-----KATTVIVPDYQLSLAIGKRGQNARLAAKLTNWKIDIKSESEARELGID 349
>gi|56419795|ref|YP_147113.1| transcription elongation factor NusA [Geobacillus kaustophilus HTA426] >gi|56379637|dbj|BAD75545.1| transcription termination-antitermination factor [Geobacillus kaustophilus HTA426] (383 aa)
Score = 479, Expect = 6.8e-46, Identities = 128/353 (36%), Positives = 203/353 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
            LE L  + +EK  SKE ++  ++ A+  +Y K N      V VDLN ++  I++F ++ VV   E+  D   EI++ +AQ +  +Y++GD V  EV    F R       Q++T  + +   S +Y E+ D+  +I+   V++VD R V V+LG  + ++  +EQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EIK I+R  G ++K+++ S  P VD VG  VGP+G+R++ I   LN E+ID++ +  DP +F+ NA  P K++ V + +++     K  T++ P+  L   IGK G N RL +KLTGW IDI SE  A E  I+
  S:     5 LLEALADLMREKGISKEVVMEAIEAAIVSAY-KRNFGQAQNVRVDLNMDTGTIRVFARKDVV---EEVADPRLEISLEDAQRINPNYQIGDVVELEVTPRDFGRIAAQTAKQVVTQRVREAERSIIYAEFVDREEDIMTGIVQRVDPRFVYVSLGKAEALLPANEQMPNETYKPHDRLKVYITKVE-KTTKGPQIFVSRTHPGLLKRLFELEVPEIYDGTVEIKSIAREAGDRSKISVHSDNPEVDPVGACVGPRGQRVQAIVDELNGEKIDIVRWSADPVEFVANALSPAKVLRVIVNEEQ-----KATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSESEAREMGID 349
>gi|15806798|ref|NP_295520.1| transcription elongation factor NusA [Deinococcus radiodurans R1] >gi|6459575|gb|AAF11353.1|AE002021_2 N-utilization substance protein A [Deinococcus radiodurans R1] (401 aa)
Score = 478, Expect = 9.6e-46, Identities = 125/351 (35%), Positives = 207/351 (58%)
  Q:     5 SFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVE-VNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           +F E L ++A+ ++ ++  ++   + +L+++Y++   PD  IEV +D     +++   R VV+K EDE     +I++++A EL    ++G  +   V+ + F R       Q LT  + +   + V+ E+KD+ G ++ A+V + DN+    V LG+ + ++   EQIPGE+L PG      +KEV+ +  KG  I+ SRADE LL YLLK EI E+++GI+E+K I+R  G ++KVA+ S    VD +G  +G +G RI+ ++  L  ER+DVIL+D + ++F+ NA  P K+  +E+  D     S+  T+    + L   IGK G NVRL +KLTG+ ID + E  AI D
  S:    11 NFAEALREVAQARNINELQLIEAFEQSLQQAYVRNVEPDKRIEVHLDPQSGVLEVLIVREVVEKVEDE---HMQISLADALELDPGVEIGMEMEFPVDQEMFSRIALQAAKQTLTQKMRETERNVVFNEYKDREGQVLNAQVVRSDNKGNWFVELGAGEAILPPREQIPGEKLTPGGRVKIYLKEVR-KTPKGPTILASRADERLLDYLLKQEIPEVANGIVEVKAIAREAGQRSKVAVFSHNSNVDPIGACIGHRGNRIQAVTGELGRERVDVILWDANTREFIRNALSPAKVGPIEVQQD-----SRDATVTVTPDQLSLAIGKGGQNVRLAAKLTGFKID-LRETAAISD 353
>gi|167465394|ref|ZP_02330483.1| transcription elongation factor NusA [Paenibacillus larvae subsp. larvae BRL-230010] (365 aa)
Score = 477, Expect = 1.4e-45, Identities = 125/350 (35%), Positives = 208/350 (59%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           F+E L +I +EK  SK+ +++ ++ A+  SY K N +    V VD+N+++  I++F ++ VV   ED +D   EI+++ A+E+ ++Y+LGD V  EV    F R       Q++T  + +     +Y  + DK  +I+   V++ D R   V+LG  + V+  +E +P E+ + G      I +V++  TKG  IILSR   GLL+ L + E+ EI DG++EI+ ++R  G+++K+A+ SR   VD VG+ VGPKG R++ I + L  E+ID++ + E  ++++ NA  P K++ V I +DE     K+  ++ P+  L   IG  G N RL +KLTGW IDI SE  A ++
  S:     5 FIEALSEIEREKGISKDLLIDAIEAAMISSY-KRNFNTAQNVRVDINRQTGVIRVFARKTVV---EDVLDPRLEISLTAAREINQNYQLGDIVEIEVTPRDFGRIAAQTAKQVVTQRIREAERGLIYNAFIDKEEDIVTGIVQRQDQRSYYVDLGKVEAVLPLNEVMPTEKFKHGDRVKAYITKVENT-TKGPQIILSRTHPGLLKRLFELEVPEIFDGVVEIRSVAREAGFRSKIAVDSRNEEVDPVGSCVGPKGLRVQTIVNELRGEKIDIVRWMESTEEYVANALSPSKVLEVNIFEDE-----KMARVIVPDYQLSLAIGIKGQNARLAAKLTGWKIDIKSETQAEQE 346
>gi|109645611|ref|ZP_01369531.1| NusA antitermination factor [Desulfitobacterium hafniense DCB-2] >gi|109643560|gb|EAT53113.1| NusA antitermination factor [Desulfitobacterium hafniense DCB-2] (493 aa)
Score = 476, Expect = 1.5e-45, Identities = 145/463 (31%), Positives = 249/463 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAI---------------EDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEEVVFYESSKEKND 468
           F+E L ++ K++  S + +   ++ AL  +Y K    L ++ V +D      K+F ++ VV++ ED      ++++ EAQ++  +Y + D V  EV   +F R       Q++   + +     +Y+E+ ++ G+I+   V++ D + V V+LG  + ++   EQIPGE  QP +     + EVK + TKG  ++LSR   GL++ L + E+ EI DG++EIK +SR  G ++K+A+ SR   VD VG  VGPKG R++ I + L  E+ID++ Y  DP++F+ NA  P K+VGV        P  K+  +V P+  L   IGK G N RL +KLT W IDI SE  A+               E+  EF D ++  +    +  S++  Y  N   ++ +T            G + DD +  D + DQY+ E D+  ++++    + +  ++    + + E+ EE   Y  S +K +
  S:     5 FIEALHELEKDRGISADILFEAIEAALISAYKKNFASLQNVRVHIDRMTGEFKVFARKNVVEEVEDS---RTQVSMEEAQKIDPNYAIDDVVEYEVTPREFGRIAAQTAKQVVVQRIREAERGMIYDEYINREGDIVTGIVQRYDQKNVIVDLGKVEAILTAQEQIPGETYQPFERIKTFVVEVK-KTTKGPQVMLSRTHPGLIKRLFELEVPEIHDGLVEIKGVSREAGARSKIAVYSRDANVDPVGACVGPKGSRVQTIVTELKGEKIDIVNYSTDPEEFVANALSPAKVVGVYPK-----PNEKVALVVVPDYQLSLAIGKEGQNARLAAKLTNWKIDIKSESQALAQNLIPDKNEVQGEYEEYDEFADYAEYENYDEYEDYSEYDDYEENEDYDENAT-----------YGENYDDELVYD-ENDQYE-EFDAYQNEELPYEESEDYAATPDNGEPKAENAEENYAYTESGDKEE 461
>gi|134299807|ref|YP_001113303.1| transcription elongation factor NusA [Desulfotomaculum reducens MI-1] >gi|134052507|gb|ABO50478.1| NusA antitermination factor [Desulfotomaculum reducens MI-1] (384 aa)
Score = 474, Expect = 3.0e-45, Identities = 118/344 (34%), Positives = 205/344 (59%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           FLE L  + KEK  + + ++  ++ AL  +Y +    L +  V +D +    K++ +R VV++ ED   D  EI++ +A+++   + L D V  EV    F R       Q++   + +   + ++EE+ ++ G+I+   V++++N+ V + LG T+ ++  SEQIP E+ + G      I EV+ + TKG  I++SR   GLL+ L + E+ E+ +G++E+K I+R  GY++K+A+ S+   +D VG  VGPKG R++ I + LN E+ID+I +++DP +++ ++  P K+V VE+ +DE     K+  ++ P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 FLEALRDLEKEKGIAVDVLLEAIEAALLSAYKRNFGSLQNARVHIDRDTGDYKVYSQRAVVEEVED---DRVEISLEDARKIDPRFNLEDVVEDEVTPRNFGRIAAQTAKQVVVQRIREAERNIIFEEFSNREGDILTGIVQRIENKNVFIELGKTEAILTPSEQIPNEDYRHGDRLKTYIVEVR-KTTKGPQILVSRTHPGLLKRLFELEVPELQEGVVELKSIAREAGYRSKIAVYSKDENIDPVGACVGPKGMRVQNIVTELNGEKIDIIKWNQDPSKYVASSLSPAKVVAVEVWEDE-----KVARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 340
>gi|13357878|ref|NP_078152.1| transcription elongation factor NusA [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762445|ref|YP_001752400.1| transcription termination factor NusA [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11356991|pir||H82905 N-utilization substance protein a UU318 [imported] - Ureaplasma urealyticum >gi|6899295|gb|AAF30727.1|AE002129_3 N-utilization substance protein a [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828022|gb|ACA33284.1| transcription termination factor NusA [Ureaplasma parvum serovar 3 str. ATCC 27815] (458 aa)
Score = 473, Expect = 3.6e-45, Identities = 144/455 (31%), Positives = 249/455 (54%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS-------EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD-----NRLVEVNLG-----STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEE 456
           K K F+E     AK+ +   E + +I+K A EK+YL+ +P  + E  +DL + +I  F   VVV+         E  +DD  EI + +A+++  + ++GD +   ++ID F+         +L   + +I N +V + WK  +  +IRA+V +V+     N +  V +       T G + R ++I  E+ + G++Y FLIKEVK +Q++ WPI+LSR +  L+  +LK E+ +I +G IEIK+I+RI G+KTKVA+ + +  ++ V   VG KG  I  IS  LNNERID+I Y +D + F+ NA   +K+ G+ + ++E   G +    +  ++ L  +IG+ G N+RL++K+T W+ID+ + + A E+ I +E   + +          +  + + + N K  T+                         D+  A +DSI DD +EQ +  N     ++ K    +DE+
  S:     6 KSKEFIEYFKDTAKQNEIEFEVLSSIIKEAFEKAYLRTHPGENFETNIDLKQGTINCFRNLVVVENEKVHNEDLETCLDDAVEILLDDARKINANAQIGDLIKQHISIDNFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEVNYNKQRNEITGVKVELDDQWKTLGYLSRKDRIGDEKFKVGETYDFLIKEVK-EQSRLWPILLSRTEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLTITSISKQLNNERIDIIRYADDKRIFIANAIGLDKLKGLLVQENES--GQRSAIAIVSKDDLPSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENILYEKFDEKI----------YRSWNIESINKKNVTN-------------------------DEMLALIDSIEDDKIEQDVQLNHPLKQQEKKVVSSNDED 439
>gi|78042921|ref|YP_360589.1| transcription elongation factor NusA [Carboxydothermus hydrogenoformans Z-2901] >gi|77995036|gb|ABB13935.1| transcription termination factor NusA [Carboxydothermus hydrogenoformans Z-2901] (346 aa)
Score = 473, Expect = 3.8e-45, Identities = 126/344 (36%), Positives = 194/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           FL+ + +I K+K    E ++   + AL  +Y K    + +  V +D     +K++  + VV++ +D      EI++ EA+E      LGD +  EV    F R    +  Q++   + +   +++YEE+  + G+II   + +VD + V V+LG T+ ++   EQIPGE  + G      + EVK + +KG  IILSR   GLL+ LL+ EI E+ DG +E+K I+R  G ++K+A+ S+   VD +G  VG KG RIK I   LN E+IDV+ +  DP +F+ NA  P K+  VE+ +DE     K+  +V P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 FLQAVQEIEKQKGIPAEVLLEATEQALLSAYKKNYGINQNARVHIDRVTGEVKVYALKTVVEEVKDP---RLEISLEEAREKDPRLNLGDVLEIEVTPRNFGRIAAQNAKQVVIQRIREAERNQIYEEFSSREGDIITGIIRRVDQKNVYVDLGKTEAILPPQEQIPGENYKFGDRIKAYLVEVK-KTSKGPNIILSRTHPGLLKRLLELEIPELYDGTVELKSIAREAGSRSKIAVYSKDENVDPIGACVGNKGLRIKNIVEELNGEKIDVVKWSPDPAKFIANALSPAKVTSVEVFEDE-----KVARVVVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 340
>gi|158320557|ref|YP_001513064.1| NusA antitermination factor [Alkaliphilus oremlandii OhILAs] >gi|158140756|gb|ABW19068.1| NusA antitermination factor [Alkaliphilus oremlandii OhILAs] (345 aa)
Score = 473, Expect = 4.2e-45, Identities = 130/344 (37%), Positives = 198/344 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F E L++I K+K  SK+ +++ ++ AL  SY K N      V V++N+++  + ++ ++ + D   D IDD  EI+I +A+ +   Y +GDT  +EV    F R       Q++   + +     VY+E+ ++   II  EV +V    V ++LG T+ ++   EQIP E  + G      I EVK + TKG  I+LSR   GL++ L + E+ EI DG +EIK ISR  G + K+A+ S+ P VDAVG  VGPKG R++ I   L  E+ID+I Y ED K+F+ ++  P K++  +I +D     +K   +V P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 FTEALEQIEKDKGISKDILIDAVEAALISSY-KRNFGSSQNVRVEINRDNGEVHVYAQKKITD---DVIDDLLEIHIDDAKIVNPKYSVGDTFESEVTPKNFGRIAAQTAKQVVVQRIREAERGIVYDEFINRESEIITGEVSRVAKGNVYISLGRTEAILGPGEQIPNEVYEHGDRIKCYIVEVK-KTTKGPQILLSRTHPGLVKRLFELEVPEIHDGTVEIKSISREAGSRAKIAVDSKDPNVDAVGACVGPKGARVQTIVDELKGEKIDIIKYSEDAKEFIASSLSPAKVLLCDINND-----AKTAKVVVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 340
>gi|46198657|ref|YP_004324.1| transcription elongation factor NusA [Thermus thermophilus HB27] >gi|55980670|ref|YP_143967.1| transcription elongation factor NusA [Thermus thermophilus HB8] >gi|1352608|sp|P48514|NUSA_THET8 Transcription elongation protein nusA >gi|642364|emb|CAA88036.1| NusA protein [Thermus thermophilus] >gi|46196280|gb|AAS80697.1| N utilization substance protein A [Thermus thermophilus HB27] >gi|55772083|dbj|BAD70524.1| N utilization substance protein A (NusA) [Thermus thermophilus HB8] (387 aa)
Score = 472, Expect = 4.8e-45, Identities = 127/341 (37%), Positives = 196/341 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-----------DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-LVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSI 344
           + F+E +  +A E+  S E I+   K AL K+Y+K                +++V +D N   I   E   V    E   D DKEI ++EA +     ++GD +   +N ++  R       QILT  L +   +++Y E+KDK G ++   V +VDNR  V V LG  +  + RSEQIP E+  PGQ     +K+V  +  KG  +++SRA E LL +LLK E+ EI++GI+EIK I+R  G ++KVA+ S  P VD +G  +G KG+RI+ +S+ L  E++D+IL+ +DPK+F+ NA  P ++  +E+      P +K   +   ++     IG  G NVRL SKLTG+ I
  S:     3 REFVEAMQHLALERGVSVEEILEAFKEALRKAYIKRQKGYKKEEIDQGKGPEVDVYIDPNSGRI---EMVEVRRVVEKVEDPDKEIALAEALQYDPEVQVGDEMEFPINPEELSRMAIQDLRQILTQRLKESERNRIYNEYKDKEGQVLTGVVTRVDNRGNVFVELGRGEAYLPRSEQIPTEKYHPGQRIKVYLKKV-DKSAKGPSLLVSRAHEKLLEHLLKQEVPEIAEGIVEIKAIAREPGRRSKVAVTSHNPNVDPIGACIGHKGQRIQAVSAELGREKVDIILWSKDPKEFIRNALSPAQVGSIELD-----PEAKKARVKVTKDQHSLAIGTGGQNVRLASKLTGYDI 346
>gi|89895266|ref|YP_518753.1| hypothetical protein DSY2520 [Desulfitobacterium hafniense Y51] >gi|89334714|dbj|BAE84309.1| hypothetical protein [Desulfitobacterium hafniense Y51] (493 aa)
Score = 472, Expect = 5.1e-45, Identities = 144/463 (31%), Positives = 249/463 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAI---------------EDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEEVVFYESSKEKND 468
           F+E L ++ K++  S + +   ++ AL  +Y K    L ++ V +D      K+F ++ VV++ ED      ++++ EA+++  +Y + D V  EV   +F R       Q++   + +     +Y+E+ ++ G+I+   V++ D + V V+LG  + ++   EQIPGE  QP +     + EVK + TKG  ++LSR   GL++ L + E+ EI DG++EIK +SR  G ++K+A+ SR   VD VG  VGPKG R++ I + L  E+ID++ Y  DP++F+ NA  P K+VGV        P  K+  +V P+  L   IGK G N RL +KLT W IDI SE  A+               E+  EF D ++  +    +  S++  Y  N   ++ +T            G + DD +  D + DQY+ E D+  ++++    + +  ++    + + E+ EE   Y  S +K +
  S:     5 FIEALHELEKDRGISADILFEAIEAALISAYKKNFASLQNVRVHIDRMTGEFKVFARKNVVEEVEDA---RTQVSMEEARKIDPNYAIDDVVEYEVTPREFGRIAAQTAKQVVVQRIREAERGMIYDEYINREGDIVTGIVQRYDQKNVIVDLGKVEAILTAQEQIPGETYQPFERIKTFVVEVK-KTTKGPQVMLSRTHPGLIKRLFELEVPEIHDGLVEIKGVSREAGARSKIAVYSRDSNVDPVGACVGPKGSRVQTIVTELKGEKIDIVNYSTDPEEFVANALSPAKVVGVYPK-----PNEKVALVVVPDYQLSLAIGKEGQNARLAAKLTNWKIDIKSESQALAQNLIPDKNEVQGEYEEYDEFADYAEYENYDEYEDYSEYDDYEENEDYDENAT-----------YGENYDDELVYD-ENDQYE-EFDAYQNEELPYEESEDYAATPDNGEPKAENAEENYAYTESGDKEE 461
>gi|148657848|ref|YP_001278053.1| NusA antitermination factor [Roseiflexus sp. RS-1] >gi|148569958|gb|ABQ92103.1| NusA antitermination factor [Roseiflexus sp. RS-1] (442 aa)
Score = 468, Expect = 1.3e-44, Identities = 113/343 (32%), Positives = 195/343 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLK----ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F   + +IA E+   KE IV +++ AL  +Y +      P ++I V +D      +++ ++ VVD   D  D+  EI++  A+++K   +LG++V  E     F R       Q++   + ++    +Y E+ D+ G ++ A V+++    V + +G  + ++   EQ+  +    GQ     + E++ ++ +G  +I SRA + L+  L + E+ EI +G +EIK I+R  G +TKVA+ +R  G+D VG+ VG +G RI+ I + LN E+IDV+ +  +PK+F+ NA  P ++V V++ DDE        T++ P++ L   IGK G NVRL +KLTGW IDI S
  S:     5 FYAAISQIASERGIPKEAIVEVMEKALATAYRRTLGPNPPPMEISVRLDPVTGMARVYAEKQVVD---DVFDERFEIDLESARKIKPDVELGESVVVEATPRDFGRIAAQTAKQVILQGIKEVEREHIYGEYMDREGELVTATVQRIAKGNVILEMGKAEAILPPKEQVETDRYYHGQRLKVYLMEIR-REDRGPKLIASRAHKNLITRLFEMEVPEIYNGAVEIKSIAREPGIRTKVAVAARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWSSNPKEFIANALSPAQVVEVQLRDDE-----HAATVIVPDKQLSLAIGKEGQNVRLAAKLTGWRIDIKS 342
>gi|171920241|ref|ZP_02931610.1| transcription termination factor NusA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508804|ref|ZP_02958262.1| transcription termination factor NusA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701622|ref|ZP_02971327.1| transcription termination factor NusA [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|171902640|gb|EDT48929.1| transcription termination factor NusA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675756|gb|EDT87661.1| transcription termination factor NusA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700854|gb|EDU19136.1| transcription termination factor NusA [Ureaplasma parvum serovar 6 str. ATCC 27818] (458 aa)
Score = 466, Expect = 2.4e-44, Identities = 143/455 (31%), Positives = 248/455 (54%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS-------EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD-----NRLVEVNLG-----STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEE 456
           K K F+E     AK+ +   E + +I+K A EK+Y + +P  + E  +DL + +I  F   VVV+         E  +DD  EI + +A+++  + ++GD +   ++ID F+         +L   + +I N +V + WK  +  +IRA+V +V+     N +  V +       T G + R ++I  E+ + G++Y FLIKEVK +Q++ WPI+LSR +  L+  +LK E+ +I +G IEIK+I+RI G+KTKVA+ + +  ++ V   VG KG  I  IS  LNNERID+I Y +D + F+ NA   +K+ G+ + ++E   G +    +  ++ L  +IG+ G N+RL++K+T W+ID+ + + A E+ I +E   + +          +  + + + N K  T+                         D+  A +DSI DD +EQ +  N     ++ K    +DE+
  S:     6 KSKEFIEYFKDTAKQNEIEFEVLSSIIKEAFEKAYSRTHPGENFETNIDLKQGTINCFRNLVVVENEKVHNEDLETCLDDAVEILLDDARKINANAQIGDLIKQHISIDNFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEVNYNKQRNEITGVKVELDDQWKTLGYLSRKDRIGDEKFKVGETYDFLIKEVK-EQSRLWPILLSRTEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLTITSISKQLNNERIDIIRYADDKRIFIANAIGLDKLKGLLVQENES--GQRSAIAIVSKDDLPSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENILYEKFDEKI----------YRSWNIESINKKNVTN-------------------------DEMLALIDSIEDDKIEQDVQLNHPLKQQEKKVVSSNDED 439
>gi|114566431|ref|YP_753585.1| transcription elongation factor NusA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337366|gb|ABI68214.1| NusA antitermination factor [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (378 aa)
Score = 466, Expect = 2.5e-44, Identities = 124/344 (36%), Positives = 203/344 (59%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNK--ESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            ++ L+ I KE+   K  ++  +K+AL  +Y K+N  +   V V+ N+    +K+F ++    K  DE+ D + E+++ EAQEL    K+ D V  E     F R       Q++   L +   S +YEE+ ++ G II   +++++++ V ++LG T+G+++ S+QI GE  + GQ     I EVK+  +KG  I +SR+    LR L + E+ EI DG++EIK I+R  G ++K+A+ S    +D+VG  VGP+G R++ I S L  E+ID+I YD+DP++++ NA  P ++V V I + +     KI  ++ P+  L   IGK G N RL +KLTGW +DI SE
  S:     5 LVQALNDIEKERGIPKRALIEAIKSALSTAY-KKNFGIAQNVSVEFNEINGEVKVFSQK----KISDEVKDPRLEMSLEEAQELYPDCKVEDLVYVEATPSDFGRIAAQTAKQVVIQKLREAERSLIYEEFLEREGEIITGTIQRLESKTVYISLGRTEGIMMASDQIFGERYEVGQRIKAYIYEVKNT-SKGPNIFVSRSHPYFLRRLFEMEVPEIYDGVVEIKSIAREAGARSKIAVYSLDDKIDSVGACVGPRGLRVQNIVSELGGEKIDIIKYDKDPERYISNALSPSRVVAVNINETD-----KIARVIVPDYQLSLAIGKEGQNARLAAKLTGWKVDIRSE 340
>gi|121535260|ref|ZP_01667074.1| NusA antitermination factor [Thermosinus carboxydivorans Nor1] >gi|121306145|gb|EAX47073.1| NusA antitermination factor [Thermosinus carboxydivorans Nor1] (348 aa)
Score = 464, Expect = 3.8e-44, Identities = 115/344 (33%), Positives = 195/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F++  +++ KEK  + E + + ++ AL  +Y +      ++ V +D     I ++ ++ VV+  +D      E+++ EA+ +   Y+L D V  EV    F R       Q++   + +     +YEE+ ++  +I+   V++++ + V ++LG  + ++  SEQIPGE  + G      I EVK + TKG  I++SR   GLL+ L + E+ EI DG++E+K ++R  G ++K+A+ SR   VDAVG  VG KG R++ I + L  E+ID++ +  DP +F+ NA  P K++ VE+ + E     K+  +V P+  L   IGK G N RL +KLTGW IDI SE
  S:     6 FMQAFEQLGKEKGIAPEILFDAIEAALISAYKRNFGSAQNVRVSLDRTTGEIHVYARKTVVEVVKDP---RLEMSLEEARAIDVRYELDDVVEIEVTPKDFGRIAAQTAKQVVVQRIREAERGIIYEEFSNRESDIVTGIVQRIEQKNVYIDLGKAEAILTPSEQIPGEVYKHGDRLKTYIIEVK-KTTKGPQILVSRTHPGLLKRLFELEVPEIHDGVVELKSVAREPGMRSKIAVHSRDENVDAVGACVGHKGMRVQTIVNELRGEKIDIVKWSSDPAKFIANALSPAKVISVEVNETE-----KVSKVVVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 341
>gi|156741122|ref|YP_001431251.1| NusA antitermination factor [Roseiflexus castenholzii DSM 13941] >gi|156232450|gb|ABU57233.1| NusA antitermination factor [Roseiflexus castenholzii DSM 13941] (442 aa)
Score = 464, Expect = 3.8e-44, Identities = 114/343 (33%), Positives = 196/343 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLK----ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F   + +IA E+   KE IV +++ AL  +Y +      P ++I V +D    + +++ ++ VVD   D  D+  EI++  A+++K   +LG++V  E     F R       Q++   + ++    +Y E+ D+ G ++ A V+++    V + +G  + V+   EQ+  +    GQ     + E++ ++ +G  +I SRA + L+  L + E+ EI +G +EIK I+R  G +TKVA+ +R  G+D VG+ VG +G RI+ I + LN E+IDV+ +  +PK+F+ NA  P ++V V++ DDE        T++ P++ L   IGK G NVRL +KLTGW IDI S
  S:     5 FYAAISQIASERGIPKEAIVEVMEKALATAYRRTLGPNPPPMEISVRLDPLTGAARVYSEKQVVD---DVYDERFEIDLESARKIKPDVELGESVVVETTPKDFGRIAAQTAKQVILQGIKEVEREHIYGEYMDREGELVTATVQRMAKGNVILEMGKAEAVLPPKEQVETDRYYHGQRLKVYLMEIRREE-RGPKLIASRAHKNLITRLFEMEVPEIYNGAVEIKSIAREPGIRTKVAVAARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWSSNPKEFIANALSPAQVVEVQLRDDE-----HAATVIVPDKQLSLAIGKEGQNVRLAAKLTGWRIDIKS 342
>gi|169827165|ref|YP_001697323.1| transcription elongation protein [Lysinibacillus sphaericus C3-41] >gi|168991653|gb|ACA39193.1| Transcription elongation protein [Lysinibacillus sphaericus C3-41] (379 aa)
Score = 464, Expect = 3.9e-44, Identities = 121/349 (34%), Positives = 204/349 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L+ + ++K  S++ ++  ++ AL  +Y +  N   ++ V ++L+K SI++F ++ VV++ ED   D  +I++ +A+ +  +Y+L D V  EV    F R       Q++T  + +     +YE++ D+  +I+   VE++D R + V LG  +  +  +EQI GE   P       I +V+ + T+G  +I+SR   GLLR L + E+ EI +GI+EIK I+R  G ++K+++ +    VD VG+ VG KG R++ I + LN E+ID++ + EDP  F+ NA  P K++ V++ ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A E
  S:     5 LLDALNALEEQKGISRDVLIEAIEAALVTAYKRNFNQAQNVRVDLNLDKGSIRVFSRKDVVEEVED---DRLQISLEDAKVINPAYQLEDIVEQEVTPRNFGRIAAQTAKQVVTQRVREAERGLIYEQYVDREDDIVTGVVERLDARNIYVGLGKVEAALPVNEQIQGETYHPHDRIKVYITKVE-RTTRGPQVIVSRTHPGLLRRLFEMEVPEIYEGIVEIKSIAREAGDRSKISVYAHNEEVDPVGSCVGAKGARVQTIVNELNGEKIDIVEWSEDPVVFVANALSPSKVLDVQVNEEE-----KSTTVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDARE 345
>gi|167630355|ref|YP_001680854.1| transcription termination factor nusa [Heliobacterium modesticaldum Ice1] >gi|167593095|gb|ABZ84843.1| transcription termination factor nusa [Heliobacterium modesticaldum Ice1] (442 aa)
Score = 463, Expect = 5.5e-44, Identities = 121/356 (33%), Positives = 202/356 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFED 361
           FL  L  + +EK  SKE ++  ++ AL  +Y K    L ++ V +D +    K++ ++++V   E+  D   E+ +++AQ +  +Y++ D + TEV   +F R       Q++   + +     +YEE+ ++ G+I+   V++ +N+ V V+LG  + ++  SEQ+ GE  +        I EVK + TKG  +++SR   GLL+ L + E+ EI DG +E+K  SR  G ++K+A+ S+   VD VG  VGPKG R++ + + L  E+ID++ ++ DP +F+ NA  P K+V V+I ++E     K+  +V P+  L   IGK G N RL +KLTGW IDI SE      K  F D
  S:     5 FLTALKDLEREKGISKEILLEAIEAALISAYKKNFGSLQNVRVHIDRSTGEFKVYSRKLIV---EELTDPRVEVLLADAQRIDPNYQVNDVIETEVTPREFGRIAAQTAKQVVVQRIREAERGMIYEEFSNREGDIVTGIVQRTENKNVFVDLGKVEALLAPSEQMNGETYRHNDRIKAYIVEVK-KTTKGPQVLISRTHPGLLKRLFELEVPEIHDGTVELKAASREAGARSKIAVYSKDENVDPVGACVGPKGMRVQAVVNELKGEKIDIVKWNPDPAKFVANALSPAKVVSVDIIEEE-----KVARVVVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSESQVKTAKAAFID 352
>gi|126652571|ref|ZP_01724736.1| transcription elongation factor NusA [Bacillus sp. B14905] >gi|126590699|gb|EAZ84815.1| transcription elongation factor NusA [Bacillus sp. B14905] (379 aa)
Score = 463, Expect = 5.8e-44, Identities = 124/367 (33%), Positives = 211/367 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQ 372
            L+ L+ + ++K  S++ ++  ++ AL  +Y +  N   ++ V ++L+K SI++F ++ VV++ ED   D  +I++ +A+ +  +Y+L D V  EV    F R       Q++T  + +     +YE++ D+  +I+   VE++D R + V LG  +  +  +EQI GE  +P       I +V+ + T+G  +I+SR   GLLR L + E+ EI +GI+EIK I+R  G ++K+++ +    VD VG+ VG KG R++ I + LN E+ID++ + EDP  F+ NA  P K++ V++ ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A E  I     S  V ++  +
  S:     5 LLDALNALEEQKGISRDVLIEAIEAALVTAYKRNFNQAQNVRVDLNLDKGSIRVFSRKDVVEEVED---DRLQISLEDAKVINPAYQLEDIVEQEVTPRNFGRIAAQTAKQVVTQRVREAERGLIYEQYVDREDDIVTGVVERLDARNIYVGLGKVEAALPVNEQIQGETYRPHDRIKVYITKVE-RTTRGPQVIVSRTHPGLLRRLFEMEVPEIYEGIVEIKSIAREAGDRSKISVYAHNEEVDPVGSCVGAKGARVQTIVNELNGEKIDIVEWSEDPVVFVANALSPSKVLDVQVNEEE-----KSTTVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDARELGIYPSATSTFVPAEDEE 363
>gi|154686077|ref|YP_001421238.1| transcription elongation factor NusA [Bacillus amyloliquefaciens FZB42] >gi|154351928|gb|ABS74007.1| NusA [Bacillus amyloliquefaciens FZB42] (373 aa)
Score = 460, Expect = 1.1e-43, Identities = 121/344 (35%), Positives = 203/344 (59%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+ L  + KEK  SK+ I+  ++ AL  +Y K N +    V VDLN+E+  I++F ++ VVD+     D   EI++ +AQ +  +Y +GD V  EV    F R       Q++T  + +     +Y E+ D+  +I+   V+++D++ + V+LG  + ++  +EQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P VD VG+ VGPKG+R++ I + L  E+ID++ + +DP +F+ NA  P K++ V ++++E     K  T++ P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 LLDALTILEKEKGISKDIIIEAIEAALISAY-KRNFNQAQNVRVDLNRETGTIRVFARKDVVDEV---YDSRLEISLDDAQHIHPNYLVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFIDREEDIMTGIVQRLDSKFIYVSLGKIEALLPVNEQMPNESYKPHDRIKVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTDDPDVDPVGSCVGPKGQRVQAIVNELKGEKIDIVNWSDDPVEFVANALSPSKVLDVIVSEEE-----KATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSE 340
>gi|196237073|ref|ZP_03135862.1| NusA antitermination factor [Thermus aquaticus Y51MC23] >gi|196218813|gb|EDY13443.1| NusA antitermination factor [Thermus aquaticus Y51MC23] (385 aa)
Score = 460, Expect = 1.2e-43, Identities = 127/368 (34%), Positives = 204/368 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLF--------EKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-LVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTR 371
           + F+E L ++A E+  S E ++   K AL K+Y+K       E V +     + ++        E   V    E   D DKEI+++EA +     +LGD +   ++ +   R       Q+LT  L +   ++++ E+KDK G ++   V +VDNR  V V+LG  +  + +SEQIP E   PGQ     +K+V  +  KG  +I+SRA E LL +LLK E+ EI++GI+EIK I+R  G ++KVA+ S  P VD +G  +G KG+RI+ +S+ L  E++D+IL+ +DPK+F+ NA  P ++  +E+      P +K   +   ++     IG  G NVRL SKLTG+ I     +++  D+       +    KTR
  S:     3 REFIEALQQLALERGVSAEEVLEAFKEALRKAYIKRQKGYKKEEVEEGKGPEVDVYIDPQTGRIEMVEVRRVVEKVEDPDKEISLAEALQYDPEVQLGDEMEFPIDPEGLSRVAIQDLRQLLTQRLKESERNRIFNEYKDKEGQVLTGVVTRVDNRGNVFVDLGRGEAYLPKSEQIPTERYYPGQRLKAYLKKV-DRSAKGPSLIVSRAHEKLLEHLLKQEVPEIAEGIVEIKAIAREPGRRSKVAVTSHNPNVDPIGACIGHKGQRIQAVSAELGREKVDIILWSKDPKEFIRNALSPAQVGSIELD-----PEAKKARVKVTKDQHSLAIGTGGQNVRLASKLTGYDIHFEEAEISDLDEAIRRAAQEEAEEKTR 373
>gi|195867649|ref|ZP_03079651.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660706|gb|EDX53961.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (460 aa)
Score = 459, Expect = 1.7e-43, Identities = 126/365 (34%), Positives = 220/365 (60%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS-------EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD-----NRLVEVNLG-----STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLV 366
           K K F+E     AK+ +   E + +I+K A EK+YL+ +P  + E  ++L + +I  F   VVV+         E  +DD  EI + +A+++  + ++GDT+   + ID F+         +L   + +I N +V + WK  +  +IRA+V +++     N +  V +       T G + R ++I  E+ + G++Y F+IKEVK +Q++ WP++LSR +  L+  +LK E+ +I +G IEIK+I+RI G+KTKVA+ + +  ++ V   VG KG  I  IS  LNNERIDVI Y +D + F+ NA   +K+ G+ + ++E   G +    +  +E L  +IG+ G N+RL++K+T W+ID+ + + A E+ + +E   + +
  S:     8 KSKEFIEYFKDTAKQNEIELEVLSSIIKEAFEKTYLRTHPGENFETNINLKEGTINCFRNLVVVENEKAHNEDLETCLDDAVEILLDDARKINANAQIGDTIKQYILIDDFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEINYNKQRNEITGVKVELDDQWKTLGYLSRKDRIGDEKFKVGETYDFIIKEVK-EQSRLWPVLLSRTEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLTITSISKQLNNERIDVIRYADDKRIFIANAIGLDKLKGLLVQENES--GQRSAIAIVSKEDLPSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENVVYEKFDEKI 386
>gi|171920965|ref|ZP_02696343.2| transcription termination factor NusA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179145|ref|ZP_02964862.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024249|ref|ZP_02996946.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039435|ref|ZP_02998198.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 8] >gi|188518622|ref|ZP_03004069.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524495|ref|ZP_03004495.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530883|ref|ZP_03005166.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|171902989|gb|EDT49278.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208924|gb|EDU05967.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018911|gb|EDU56951.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997862|gb|EDU66959.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659708|gb|EDX53088.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (458 aa)
Score = 458, Expect = 1.8e-43, Identities = 126/365 (34%), Positives = 220/365 (60%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS-------EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD-----NRLVEVNLG-----STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLV 366
           K K F+E     AK+ +   E + +I+K A EK+YL+ +P  + E  ++L + +I  F   VVV+         E  +DD  EI + +A+++  + ++GDT+   + ID F+         +L   + +I N +V + WK  +  +IRA+V +++     N +  V +       T G + R ++I  E+ + G++Y F+IKEVK +Q++ WP++LSR +  L+  +LK E+ +I +G IEIK+I+RI G+KTKVA+ + +  ++ V   VG KG  I  IS  LNNERIDVI Y +D + F+ NA   +K+ G+ + ++E   G +    +  +E L  +IG+ G N+RL++K+T W+ID+ + + A E+ + +E   + +
  S:     6 KSKEFIEYFKDTAKQNEIELEVLSSIIKEAFEKTYLRTHPGENFETNINLKEGTINCFRNLVVVENEKAHNEDLETCLDDAVEILLDDARKINANAQIGDTIKQYILIDDFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEINYNKQRNEITGVKVELDDQWKTLGYLSRKDRIGDEKFKVGETYDFIIKEVK-EQSRLWPVLLSRTEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLTITSISKQLNNERIDVIRYADDKRIFIANAIGLDKLKGLLVQENES--GQRSAIAIVSKEDLPSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENVVYEKFDEKI 384
>gi|188592407|ref|ZP_03005775.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 10] (458 aa)
Score = 457, Expect = 2.6e-43, Identities = 127/365 (34%), Positives = 221/365 (60%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS-------EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD-----NRLVEVNLG-----STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLV 366
           K K F+E     AK+ +   E + +I+K A EK+YL+ +P  + E  ++L + +I  F   VVV+         E  +DD  EI + +A+++  + ++GDT+   ++ID F+         +L   + +I N +V + WK  +  +IRA+V +++     N +  V +       T G + R ++I  E+ + G++Y F+IKEVK +Q++ WP++LSR +  L+  +LK E+ +I +G IEIK+I+RI G+KTKVA+ + +  ++ V   VG KG  I  IS  LNNERIDVI Y +D + F+ NA   +K+ G+ + ++E    S I  +   +E L  +IG+ G N+RL++K+T W+ID+ + + A E+ + +E   + +
  S:     6 KSKEFIEYFKDTAKQNEIELEVLSSIIKEAFEKTYLRTHPGENFETNINLKEGTINCFRNLVVVENEKAHNEDLETCLDDAVEILLDDARKINANAQIGDTIKQYISIDDFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEINYNKQRNEITGVKVELDDQWKTLGYLSRKDRIGDEKFKVGETYDFIIKEVK-EQSRLWPVLLSRTEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLTITSISKQLNNERIDVIRYADDKRIFIANAIGLDKLKGLLVQENESDQRSAIAIV--SKEDLPSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENVVYEKFDEKI 384
>gi|150390438|ref|YP_001320487.1| NusA antitermination factor [Alkaliphilus metalliredigens QYMF] >gi|149950300|gb|ABR48828.1| NusA antitermination factor [Alkaliphilus metalliredigens QYMF] (346 aa)
Score = 456, Expect = 3.4e-43, Identities = 126/344 (36%), Positives = 193/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F+E L++I K+K  S++ + + L+ AL  SY K N    + V V++ +++  + ++ ++ VV+  ED++    EINI EA+E+  +Y L D V  +V    F R       Q++   + +     VYEE+ ++   II   V +V    V +NLG T+ ++  +EQIP E           I EVK+  TKG  I +SR   GL++ L + E+ EI DG++E+K ISR  G +TK+A+ S    VD VG  VGPKG R++ I   L  E+ID+I Y E+PK+F+ N+  P K++   +      P  K   ++ P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 FIEALEQIEKDKGISRDVLFDALEAALISSY-KRNFGSAVNVRVEMLRDTGDVHVYSQKKVVEVVEDDL---LEINIDEAKEIDPNYALDDIVEKQVTPRNFGRIAAQTAKQVVVQRIREAERGIVYEEFINRESEIITGTVSRVAKGNVYINLGKTEAILGPNEQIPNEVYNHADRIKTYIVEVKNT-TKGPQIHVSRTHPGLVKRLFELEVPEIHDGVVEVKSISREAGSRTKIAVFSIDENVDPVGACVGPKGSRVQMIVDELKGEKIDIIKYSEEPKEFISNSLSPAKVLNARVN-----PEDKTARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 340
>gi|188568596|ref|ZP_03005389.1| transcription termination factor NusA [Ureaplasma urealyticum serovar 2] (458 aa)
Score = 456, Expect = 3.5e-43, Identities = 125/365 (34%), Positives = 220/365 (60%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKS-------EDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD-----NRLVEVNLG-----STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLV 366
           K K F+E     AK+ +   E + +I+K A EK+YL+ +P  + E  ++L + +I  F   VVV+         E  +DD  EI + +A+++  + ++GDT+   ++ID F+         +L   + +I N +V + WK  +  +IRA+V +++     N +  V +       T G +   ++I  E+ + G++Y F+IKEVK +Q++ WP++LSR +  L+  +LK E+ +I +G IEIK+I+RI G+KTKVA+ + +  ++ V   VG KG  I  IS  LNNERIDVI Y +D + F+ NA   +K+ G+ + ++E   G +    +  +E L  +IG+ G N+RL++K+T W+ID+ + + A E+ + +E   + +
  S:     6 KSKEFIEYFKDTAKQNEIELEVLSSIIKEAFEKTYLRTHPGENFETNINLKEGTINCFRNLVVVENEKAHNEDLETCLDDAVEILLDDARKINANAQIGDTIKQRISIDDFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEINYNKQRNEITGVKVELDDQWKTLGYLSCKDRIGDEKFKVGETYDFIIKEVK-EQSRLWPVLLSRTEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLTITSISKQLNNERIDVIRYADDKRIFIANAIGLDKLKGLLVQENES--GQRSAIAIVSKEDLPSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENVVYEKFDEKI 384
>gi|15614979|ref|NP_243282.1| transcription elongation factor NusA [Bacillus halodurans C-125] >gi|20139215|sp|Q9KA74|NUSA_BACHD Transcription elongation protein nusA >gi|10175036|dbj|BAB06135.1| transcriptional terminator [Bacillus halodurans C-125] (382 aa)
Score = 455, Expect = 4.1e-43, Identities = 124/349 (35%), Positives = 200/349 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           F++ L  + KEK  SKE I+  ++ AL   Y K N +    V VD+N+E  SI++F ++ VV   E+  D   EI++ EA+ +  +Y++ D V  EV    F R       Q++T  + +     +Y ++ D+  +I+   V++ DNR + V+LG  + ++  SEQ+P E  +        I +V+ + TKG  I++SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P VD VG  VGPKG R++ I + L  E+ID++ + EDP +++ NA  P K+V V + ++E     K   ++ P+  L   IGK G N RL +KLTGW IDI SE  A E
  S:     5 FMDALTTLEKEKGISKEVIIEAIEAALISGY-KRNFNQAQNVRVDVNRENGSIRVFARKEVV---EEVFDARLEISLDEAKGINPNYEVDDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYADFIDREEDIMTGIVQRQDNRFIYVDLGKVEALLPLSEQMPNESYRHNDRIKAYITKVE-KTTKGPQIMISRTHPGLLKRLFELEVPEIYDGTVELKSVAREAGDRSKISVHAENPEVDPVGACVGPKGSRVQTIVNELKGEKIDIVRWSEDPVEYVANALSPSKVVKVNVNEEE-----KTTQVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSESEAQE 345
>gi|52080267|ref|YP_079058.1| transcription elongation factor NusA [Bacillus licheniformis ATCC 14580] >gi|52785644|ref|YP_091473.1| transcription elongation factor NusA [Bacillus licheniformis ATCC 14580] >gi|52003478|gb|AAU23420.1| NusA [Bacillus licheniformis ATCC 14580] >gi|52348146|gb|AAU40780.1| NusA [Bacillus licheniformis DSM 13] (372 aa)
Score = 455, Expect = 4.3e-43, Identities = 125/349 (35%), Positives = 201/349 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  + KEK  SK+ I+  ++ AL  +Y K N +    V VDLN++  SI++F ++ VVD+     D   EI+I +A  +  +Y +GD V  EV    F R       Q++T  + +     +Y E+ D+  +I+   V+++DN+ + V+LG  + ++  +EQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P +D VG  VGPKG+R++ I + L  E+ID++ +  DP +F+ NA  P K++ V I ++ED    K  T+V P+  L   IGK G N RL +KLT W IDI SE  A E
  S:     5 LLDALTVLEKEKGISKDIIIEAIEAALISAY-KRNFNQAQNVRVDLNRDTGSIRVFARKDVVDEV---YDPRLEISIEDAVNINPNYIVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFIDREEDIMTGIVQRIDNKFIYVSLGKIEALLPVAEQMPNEVYKPHDRIKVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTDNPDIDPVGACVGPKGQRVQAIVNELKGEKIDIVHWSNDPVEFVANALSPSKVLDV-IVNEED----KATTVVVPDYQLSLAIGKRGQNARLAAKLTSWKIDIKSETDARE 345
>gi|15644522|ref|NP_229574.1| transcription elongation factor NusA [Thermotoga maritima MSB8] >gi|16975175|pdb|1HH2|P Chain P, Crystal Structure Of Nusa From Thermotoga Maritima >gi|4982355|gb|AAD36840.1|AE001815_14 N utilization substance protein A [Thermotoga maritima MSB8] (344 aa)
Score = 455, Expect = 4.7e-43, Identities = 122/341 (35%), Positives = 194/341 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQ-SYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
            LE LD++ +EK  SKE ++ IL+ AL  +Y K      ++EVV+D N  +IK+++   VV++ ED      +I++ EA+++    ++G  V  E+N+  F R       Q+L   + ++   K +E++ +  G +  AEV +V     ++ +G  +  + + E IPGEE++ G    +++I  VK+  TKG  I++SR     +  L+K EI E+ +GI+EIK I+R  G +TKVA+ S  P VD +G  +G  G RI  I   L  E++DV+ + +DPKQ + NA  P  ++ VEI D E+    K   ++ P   L   IGK G N RL +KLTGW IDI
  S:     5 LLEALDQLEEEKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIKVYQLLEVVEEVEDPA---TQISLEEAKKIDPLAEVGSIVKKELNVKNFGRIAAQTAKQVLIQRIRELEKEKQFEKYSELKGTVTTAEVIRVMGEWADIRIGKLETRLPKKEWIPGEEIKAGDLVKVYIIDVVKT--TKGPKILVSRRVPEFVIGLMKLEIPEVENGIVEIKAIAREPGVRTKVAVASNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKWSDDPKQLIANALAPATVIEVEILDKEN----KAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDI 338
>gi|37926540|pdb|1L2F|A Chain A, Crystal Structure Of Nusa From Thermotoga Maritima: A Structure-Based Role Of The N-Terminal Domain (369 aa)
Score = 455, Expect = 4.9e-43, Identities = 122/341 (35%), Positives = 193/341 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQ-SYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
            LE LD++ +EK  SKE ++ IL+ AL  +Y K      ++EVV+D N  +IK+++   VV++ ED      +I++ EA+++    ++G  V  E+N+  F R       Q+L   + ++   K +E++ +  G +  AEV +V     ++ +G  +  + + E IPGEE++ G    +++I  VK+  TKG  I++SR     +  L K EI E+ +GI+EIK I+R  G +TKVA+ S  P VD +G  +G  G RI  I   L  E++DV+ + +DPKQ + NA  P  ++ VEI D E+    K   ++ P   L   IGK G N RL +KLTGW IDI
  S:    30 LLEALDQLEEEKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIKVYQLLEVVEEVEDPA---TQISLEEAKKIDPLAEVGSIVKKELNVKNFGRIAAQTAKQVLIQRIRELEKEKQFEKYSELKGTVTTAEVIRVXGEWADIRIGKLETRLPKKEWIPGEEIKAGDLVKVYIIDVVKT--TKGPKILVSRRVPEFVIGLXKLEIPEVENGIVEIKAIAREPGVRTKVAVASNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKWSDDPKQLIANALAPATVIEVEILDKEN----KAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDI 363
>gi|170288839|ref|YP_001739077.1| NusA antitermination factor [Thermotoga sp. RQ2] >gi|170176342|gb|ACB09394.1| NusA antitermination factor [Thermotoga sp. RQ2] (344 aa)
Score = 454, Expect = 5.7e-43, Identities = 121/341 (35%), Positives = 195/341 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQ-SYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
            LE LD++ +EK  SKE ++ IL+ AL  +Y K      ++EVV+D N  +I++++   VV++ ED      +I++ EA+++    ++G  V  E+N+  F R       Q+L   + ++   K +E++ +  G +  AEV +V +   ++ +G  +  + + E IPGEE++ G    +++I  VK+  TKG  I++SR     +  L+K EI E+ +GI+EIK I+R  G +TKVA+ S  P VD +G  +G  G RI  I   L  E++DV+ + +DPKQ + NA  P  ++ VEI D E+    K   ++ P   L   IGK G N RL +KLTGW IDI
  S:     5 LLEALDQLEEEKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIRVYQLLEVVEEVEDPA---TQISLEEAKKIDPLAEVGSIVKKELNVKNFGRIAAQTAKQVLIQRIRELEKEKQFEKYSELKGTVTTAEVIRVTSEWADIRIGKLETRLPKKEWIPGEEIKAGDLVKVYIIDVVKT--TKGPKILVSRRVPEFVIGLMKLEIPEVENGIVEIKAIAREPGVRTKVAVASNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKWSDDPKQLIANALAPATVIEVEILDKEN----KAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDI 338
>gi|16078723|ref|NP_389542.1| transcription elongation factor NusA [Bacillus subtilis subsp. subtilis str. 168] >gi|7404400|sp|P32727|NUSA_BACSU Transcription elongation protein nusA >gi|2634032|emb|CAB13533.1| nusA [Bacillus subtilis subsp. subtilis str. 168] (371 aa)
Score = 454, Expect = 6.6e-43, Identities = 128/349 (36%), Positives = 203/349 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  + KEK  SKE I+  ++ AL  +Y K N +    V VDLN+E  SI++F ++ VVD+  D+     EI+I EAQ +   Y +GD V  EV    F R       Q++T  + +     +Y E+ D+  +I+   V+++DN+ + V+LG  + ++  +EQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P VD VG+ VGPKG+R++ I + L  E+ID++ +  DP +F+ NA  P K++ V + ++E     K  T++ P+  L   IGK G N RL +KLTGW IDI SE  A E
  S:     5 LLDALTILEKEKGISKEIIIEAIEAALISAY-KRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQ---RLEISIEEAQGIHPEYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFIDREEDIMTGIVQRLDNKFIYVSLGKIEALLPVNEQMPNESYKPHDRIKVYITKVE-KTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTDDPDVDPVGSCVGPKGQRVQAIVNELKGEKIDIVNWSSDPVEFVANALSPSKVLDVIVNEEE-----KATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDARE 345
>gi|164688521|ref|ZP_02212549.1| hypothetical protein CLOBAR_02166 [Clostridium bartlettii DSM 16795] >gi|164602934|gb|EDQ96399.1| hypothetical protein CLOBAR_02166 [Clostridium bartlettii DSM 16795] (384 aa)
Score = 453, Expect = 7.3e-43, Identities = 123/343 (35%), Positives = 196/343 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F+E LD++ K++   KE I++ ++ AL  +Y K      ++ V VD     ++++ +R VVD+S D  D   EI +++A ++  SY+LGD +  EV   +F R       Q++   + +     VY E+ +K   I+  E+ +  ++ V VN+G  +  +  +EQIPGE  + GQ     I EVK +  KG  I++SR+  GL++ L + ++ EI +GI++IK +SR  G +TK+A+ S    +D +G  VGPKG R+K +   L  E+ID+I Y EDP +F+  A  P K+  VEI ++E     K   +V P+  L   IGK+G N RL +KLT W IDI S
  S:     5 FMEALDELEKDRGIDKEIIIDTIEQALLTAYKKNFGSAQNVRVSVDREGGEVRVYSQRRVVDES-DLYDTFLEIELADAIKIDPSYELGDIIENEVTPKEFGRIAAQTAKQVVVQRIREAEREIVYNEFIEKESEIVTGEIARATSKTVYVNVGKIEASMPENEQIPGEVYKAGQKIKVYILEVK-KTNKGPQIVVSRSHPGLVKRLFEMQVVEIFEGIVQIKSVSREAGSRTKIAVQSIDEKIDPIGACVGPKGSRVKAVVDELGGEKIDIINYSEDPAEFISAALSPSKVEKVEINEEE-----KTALVVVPDYQLSLAIGKSGQNARLAAKLTNWKIDIKS 341
>gi|47095907|ref|ZP_00233510.1| N utilization substance protein A [Listeria monocytogenes str. 1/2a F6854] >gi|153174402|ref|ZP_01929930.1| N utilization substance protein A [Listeria monocytogenes FSL N3-165] >gi|153179393|ref|ZP_01932612.1| N utilization substance protein A [Listeria monocytogenes F6900] >gi|153183684|ref|ZP_01934501.1| N utilization substance protein A [Listeria monocytogenes J0161] >gi|153190723|ref|ZP_01938086.1| N utilization substance protein A [Listeria monocytogenes J2818] >gi|153196100|ref|ZP_01940508.1| N utilization substance protein A [Listeria monocytogenes 10403S] >gi|167404317|ref|ZP_02309118.1| transcription elongation factor NusA [Listeria monocytogenes FSL J2-003] >gi|47015653|gb|EAL06583.1| N utilization substance protein A [Listeria monocytogenes str. 1/2a F6854] >gi|126943336|gb|EBA21057.1| N utilization substance protein A [Listeria monocytogenes J0161] >gi|127634382|gb|EBA23768.1| N utilization substance protein A [Listeria monocytogenes 10403S] >gi|127765707|gb|EBA26052.1| N utilization substance protein A [Listeria monocytogenes J2818] >gi|133730350|gb|EBA32048.1| N utilization substance protein A [Listeria monocytogenes FSL N3-165] >gi|133732878|gb|EBA34576.1| N utilization substance protein A [Listeria monocytogenes F6900] (372 aa)
Score = 453, Expect = 7.6e-43, Identities = 121/349 (34%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  +  +K  S+E +V  ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA +L   YK GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     5 LLDALHVLEHDKGISREVLVEAIEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKLNPVYKPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 345
>gi|16803362|ref|NP_464847.1| transcription elongation factor NusA [Listeria monocytogenes EGD-e] >gi|16410738|emb|CAC99400.1| nusA [Listeria monocytogenes] (372 aa)
Score = 453, Expect = 8.2e-43, Identities = 120/349 (34%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  +  +K  S+E +V  ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA +L   Y+ GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     5 LLDALHVLEHDKGISREVLVEAIEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKLNPVYQPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 345
>gi|192812885|ref|ZP_03041551.1| transcription termination factor NusA [Geobacillus sp. Y412MC10] >gi|192798213|gb|EDV74727.1| transcription termination factor NusA [Geobacillus sp. Y412MC10] (365 aa)
Score = 451, Expect = 1.4e-42, Identities = 114/350 (32%), Positives = 203/350 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           F+E ++++ +EK  SK+ +   ++ AL  SY K N +    V VD+N+ +  IK+F ++++VD+    +D   EI++  A+E+   +++ D    EV    F R       Q++T  + +     +Y  + DK  +I+   +++ D R + ++LG  +  +  +E +P E+ + G      I +V++  TKG  I+LSR   GLL+ L + E+ EI DG++EI+ ++R  G+++K+A+ SR   VD VG+ VGPKG R++ I + L  E+ID++ Y +  ++++ NA  P K++ V++ +DE     K+  ++ P+  L   IG  G N RL +KLTGW IDI SE  A ++
  S:     5 FIEAMNELEREKGISKDVLFEAIEAALISSY-KRNFNTAQNVRVDMNRNTGVIKVFARKLIVDEV---LDPRTEISLHAAREINPHFQIEDIAEIEVTPRDFGRIAAQTAKQVVTQRIREAERGLIYSAFIDKEDDIVTGTLQRQDLRNIYIDLGKIEAALPLTELMPNEKFKHGDRIKAYITKVENT-TKGPQIMLSRTHPGLLKRLFELEVPEIFDGVVEIRSVAREAGFRSKIAVYSRNDEVDPVGSCVGPKGLRVQTIVNELRGEKIDIVRYSDQVEEYVANALSPSKVLEVQVFEDE-----KMARVIVPDYQLSLAIGIKGQNARLAAKLTGWKIDIKSESQAEQE 346
>gi|170750127|ref|YP_001756387.1| NusA antitermination factor [Methylobacterium radiotolerans JCM 2831] >gi|170656649|gb|ACB25704.1| NusA antitermination factor [Methylobacterium radiotolerans JCM 2831] (545 aa)
Score = 451, Expect = 1.5e-42, Identities = 114/360 (31%), Positives = 202/360 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  +++ ++ A+ K+   +   + D+   +D    +++L    +VVD+ E+   D +EI + +A+       +GD +S  +    F R       Q++   + D   ++ ++E+KD++G I+   V++V+   V V+LG  +G+V R E IP E  +PG   +SYLF ++     + +G  I LSR+    +  L   E+ EI DGI+E+K ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I + ED   F+VNA  P ++V V + ++ D      + +V P++ L   IG+ G NVRL S+LTGW IDI++E    E +  EF + +Q+
  S:    11 LLQIADAVAREKVIDRSIVIDAMEEAIAKAARSRYGAETDVHAEIDPKTGALRLSRHLLVVDQVEN---DAREITLDQARRYNPGALVGDVISDTLPPFDFGRVAAQSAKQVIVQKVRDAERARQFDEYKDRIGEILNGIVKRVEYGNVIVDLGRGEGIVRRDEMIPRETFRPGDRIRSYLFDVR----SEVRGPQIFLSRSHPQFMAKLFGQEVPEIYDGIVEVKAVARDPGSRAKIAVISRDGSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSEDEATFIVNALQPAEVVKVVLDEEAD-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTEAEESERRQKEFAERTQV 363
>gi|186460898|ref|ZP_02971191.1| NusA antitermination factor [bacterium Ellin514] >gi|184202375|gb|EDT99587.1| NusA antitermination factor [bacterium Ellin514] (425 aa)
Score = 450, Expect = 1.7e-42, Identities = 123/352 (34%), Positives = 198/352 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE---KLAIEDKI 357
           FL  L+   +EK  S++ +++ ++ +L  +  K   P  ++  ++D     IK F K +V   SE  +     I++ +A+++K   +LG+ V  EV    F R  + +  Q L  ++       ++ E+KD+VG+II   V + D   V V+LG  + ++   E++P EE Q G+     +K V++    G  IILSRAD   +  L + E+SEI+DG IEIK I+R  G++TK+A+ +R   VD VG  VG +G+R+K I   LNNE++D+I ++ + K FL NA  P ++   E+ +      +K V IV  E+ L   IGK G N RL SKLTGW +DI  E   ++  E+K+
  S:     5 FLTVLEFWEREKGISRQVLISAVEESLLSAAKKAVGPARELRCIIDPKSGDIKAFAKLIV---SEKVVSKHDHISLPDAKKIKPDAQLGEEVEVEVTPAGFGRIASQYAKQSLMQHIRRAEKQLIFTEFKDRVGDIISGVVRRFDRSDVSVDLGKYEALLPNRERVPTEEYQIGERIRCYVKAVENG-PHGPEIILSRADPRFVIKLFQLEVSEINDGTIEIKGIAREPGFRTKLAVYTRDEKVDPVGACVGLRGQRVKNIVRELNNEKVDIIRWEPNIKGFLTNALAPAQLKTFEVDE-----ANKRVKIVVGEDQLSLAIGKRGQNARLSSKLTGWQVDIEPEVVHRMGFEEKV 351
>gi|16800427|ref|NP_470695.1| transcription elongation factor NusA [Listeria innocua Clip11262] >gi|16413832|emb|CAC96590.1| nusA [Listeria innocua] (372 aa)
Score = 450, Expect = 1.7e-42, Identities = 121/349 (34%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  +  +K  S+E +V  ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA +L   YK GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     5 LLDALHVLEHDKGISREVLVEAIEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKLNPVYKPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 345
>gi|56963996|ref|YP_175727.1| transcription elongation factor NusA [Bacillus clausii KSM-K16] >gi|56910239|dbj|BAD64766.1| transcriptional elongation protein [Bacillus clausii KSM-K16] (368 aa)
Score = 449, Expect = 2.4e-42, Identities = 123/349 (35%), Positives = 196/349 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           F+E L  +  +K   KE I+  ++ AL   Y K N      V VD+N++  SI++F ++VVV   E+  D   EI+ +EAQ +   Y++ D V  EV    F R       Q++T  + +     +Y ++ D+  +I+   V++ D+R + V+LG  + ++  SEQ+P E  +        I +V+ + TKG  I++SR   GLL+ L + E+ EI DG +EIK +SR  G ++K+A+ S  P VD+VG  VG +G+R++ I   L  E+ID++ + EDP  ++ NA  P K++ V +     + G K+  ++ P+  L   IGK G N RL +KLTGW IDI SE  A E
  S:     5 FMEALSTLEADKGIKKEVIIEAIEAALISGY-KRNFGQAQNVRVDVNRDNGSIRVFARKVVV---EEVFDKRLEISEAEAQRINPHYEVDDIVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYSDFIDREEDIMNGIVQRQDHRFIYVDLGKVEALLPLSEQMPNETYKHNDRIKAYITKVE-KTTKGPQILISRTHPGLLKRLFELEVPEIYDGTVEIKSVSREAGDRSKIAVHSDNPEVDSVGACVGQRGQRVQTIVDELKGEKIDIVEWSEDPVVYVANALSPAKVMKVNV-----LEGEKMTQVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSESEARE 345
>gi|49316|emb|CAA79231.1| ORF2 [Bacillus subtilis] (371 aa)
Score = 448, Expect = 2.7e-42, Identities = 127/349 (36%), Positives = 203/349 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  + KEK  SKE I+  ++ AL  +Y K N +    V VDLN+E  SI++F ++ VVD+  D+     EI+I EAQ +   Y +GD V  EV    F R       +++T  + +     +Y E+ D+  +I+   V+++DN+ + V+LG  + ++  +EQ+P E  +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P VD VG+ VGPKG+R++ I + L  E+ID++ +  DP +F+ NA  P K++ V + ++E     K  T++ P+  L   IGK G N RL +KLTGW IDI SE  A E
  S:     5 LLDALTILEKEKGISKEIIIEAIEAALISAY-KRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQ---RLEISIEEAQGIHPEYMVGDVVEIEVTPKDFGRIAAQTANEVVTQRVREAERGVIYSEFIDREEDIMTGIVQRLDNKFIYVSLGKIEALLPVNEQMPNESYKPHDRIKVYITKVE-KTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTDDPDVDPVGSCVGPKGQRVQAIVNELKGEKIDIVNWSSDPVEFVANALSPSKVLDVIVNEEE-----KATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDARE 345
>gi|153166697|ref|ZP_01927220.1| N utilization substance protein A [Listeria monocytogenes FSL N1-017] >gi|153202163|ref|ZP_01943792.1| N utilization substance protein A [Listeria monocytogenes HPB2262] >gi|167453949|ref|ZP_02320172.1| transcription elongation factor NusA [Listeria monocytogenes FSL J2-064] >gi|133727457|gb|EBA29155.1| N utilization substance protein A [Listeria monocytogenes FSL N1-017] >gi|133735446|gb|EBA37144.1| N utilization substance protein A [Listeria monocytogenes HPB2262] (372 aa)
Score = 448, Expect = 2.9e-42, Identities = 121/349 (34%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  +  +K  S+E +V  ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA +L   YK GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     5 LLDALHVLEHDKGISREVLVEAIEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKLNPVYKPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 345
>gi|160913530|ref|ZP_02076221.1| hypothetical protein EUBDOL_00006 [Eubacterium dolichum DSM 3991] >gi|158434082|gb|EDP12371.1| hypothetical protein EUBDOL_00006 [Eubacterium dolichum DSM 3991] (548 aa)
Score = 448, Expect = 3.0e-42, Identities = 129/363 (35%), Positives = 208/363 (57%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
           MK+  F+  +  I  ++  SKE +V+ L+ AL K++ K  E PD  + V VD     IK+F++R VV+  ED   D+ EI++++A+ + ++ +LGD V  EVNI  F R        ++   + +     VYEE+ DKV  +I   VE V+ +   VN+G T  ++ +++QIP E  + G     +I EV +++TKG  +++SRAD  L++ L + E+ EI  GIIEIK I+R  G +TK+A+ S    +D +G  +GP+G R++ I   L  E+ID+  + +D  + + NA  P +++ V I ++    G   + +V P+  L   IGK G N RL  KLTG  IDI SE    E  I+++D +
  S:     1 MKLNDFMTAMQAIESDRQLSKEIVVDALQEALSKAFRKHIEIPDALVRVAVDDENGEIKVFQQRAVVETVED---DELEISLNDAKRINEALELGDVVEEEVNIADFGRAAVILAKNVMKQKIREAEKLAVYEEYCDKVEEMIFGTVESVEEKFCVVNIGKTLAIMPKNQQIPNETYREGSMIRVVISEV-NKETKGAQVLVSRADATLVKRLFEKEVPEIYQGIIEIKAIAREAGERTKMAVYSHNENIDPIGACIGPRGTRVQVIIDELKGEKIDIFEWSDDVSELIKNALSPAEVLAV-IPNEARKDG---LLVVVPDNQLSLAIGKRGKNARLAVKLTGHKIDIKSESDINEMGIDWKDAA 357
>gi|148270198|ref|YP_001244658.1| transcription elongation factor NusA [Thermotoga petrophila RKU-1] >gi|147735742|gb|ABQ47082.1| NusA antitermination factor [Thermotoga petrophila RKU-1] (344 aa)
Score = 448, Expect = 3.0e-42, Identities = 122/341 (35%), Positives = 193/341 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQ-SYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
            LE LD++ +EK  SKE ++ IL+ AL  +Y K      ++EVV+D N  +IK+++   VV++ ED      +I+I EA+++    ++G  V  E+N+  F R       Q+L   + ++   K +E++ +  G +  AEV +V     ++ +G  +  + + E IP EE++ G    +++I  VK+  TKG  I++SR     +  L+K EI E+ +GI+EIK I+R  G +TKVA+ S  P VD +G  +G  G RI  I   L  E++DV+ + +DPKQ + NA  P  ++ VEI D E+    K   ++ P   L   IGK G N RL +KLTGW IDI
  S:     5 LLEALDQLEEEKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIKVYQLLEVVEEVEDPA---TQISIEEAKKVDPLAEVGSVVKKELNVKNFGRIAAQTAKQVLIQRIRELEKEKQFEKYSELKGTVTTAEVIRVTGEWADIRIGKLETRLPKKEWIPDEEIEAGDLVKVYIIDVVKT--TKGPKILVSRRVPEFVIGLMKLEIPEVENGIVEIKAIAREPGVRTKVAVSSNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKWSDDPKQLIANALAPATVIEVEILDKEN----KAARVIVPPTQLSLAIGKGGQNARLAAKLTGWKIDI 338
>gi|167756908|ref|ZP_02429035.1| hypothetical protein CLORAM_02457 [Clostridium ramosum DSM 1402] >gi|167703083|gb|EDS17662.1| hypothetical protein CLORAM_02457 [Clostridium ramosum DSM 1402] (448 aa)
Score = 448, Expect = 3.0e-42, Identities = 124/354 (35%), Positives = 200/354 (56%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE--NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           M  K F++ L+ + +EK   K+  + +LK ++ K+Y K   NPD ++ V ++      +LFE R VVD  +DE   D E+++ EAQ +  +Y++GD V TE +I+   R       Q+    + +     +Y E+ DK  +II   V++V+++   VN+G T   +  ++QIPGE+L  GQ     + +V  + TKG  I++SR +   ++ L + E+ E+ DG +EIK +SR  G ++KVA+ +    +D +G+ VGPKG R+K +   LN E ID+IL+  DP  F+ NA  P  +  V I ++     +    +V P++ L   IGK G N RL  +LTGW IDI S   A+E
  S:     1 MASKKFMDALNLLIEEKGIEKDVFLEMLKESIGKAYKKNYLNPDANVRVEINEKTGKFRLFELRTVVDDLDDE---DIELSLEEAQAINPNYQIGDVVETEADIEHIGRLAAIQTKQLFRQKIRETEKETLYNEFADKKDDIITGIVDRVEDKFAIVNIGKTGAFLASNQQIPGEKLNEGQHLKVYVSDV-DRGTKGTHIVVSRTEPSFVKRLFELEVPEVYDGTVEIKAVSREPGERSKVAVYTSNENIDPIGSCVGPKGSRVKNVVDELNGEMIDIILWSSDPVVFISNALSPSDVKWVSINEE-----NHSALVVVPDDQLSLAIGKRGQNARLAVRLTGWKIDIKSVSEAVE 347
>gi|46907548|ref|YP_013937.1| transcription elongation factor NusA [Listeria monocytogenes str. 4b F2365] >gi|46880816|gb|AAT04114.1| N utilization substance protein A [Listeria monocytogenes str. 4b F2365] (372 aa)
Score = 448, Expect = 3.1e-42, Identities = 121/349 (34%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  +  +K  S+E +V  ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA +L   YK GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     5 LLDALHVLEHDKGISREVLVEAIEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKLNPVYKPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 345
>gi|169191233|ref|ZP_02851099.1| NusA antitermination factor [Paenibacillus sp. JDR-2] >gi|169002147|gb|EDS49044.1| NusA antitermination factor [Paenibacillus sp. JDR-2] (365 aa)
Score = 448, Expect = 3.1e-42, Identities = 119/350 (34%), Positives = 200/350 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           F+E L +I ++K  +KE ++  ++ AL  SY K N +    V VD+N+ S  IK++ ++ VVD+    +D   EI +  ++E+   Y+L D    EV    F R       Q++T  + +     +Y  + DK  +I+   V++ D R + V+LG  + V+  +E +P ++ + G      I +V++  TKG  IILSR   GLL+ L + E+ EI DG++EI+ ++R  G+++K+A+ SR   VD VG+ VGPKG R++ I + L  E+ID++ + E  ++++ NA  P K++ V + + E     K+  ++ P+  L   IG  G N RL +KLTGW IDI SE  A ++
  S:     5 FIEALSEIERDKGIAKEVLLEAIEAALISSY-KRNFNAAQNVRVDINRHSGVIKVYARKTVVDEV---LDPRLEITVDASREINPHYQLDDIADIEVTPRDFGRIAAQTAKQVVTQRIREAERGLIYNAFIDKEEDIVNGIVQRQDTRNLFVDLGKVEAVLPLTELMPTDKFKHGDRVKSYITKVENT-TKGPQIILSRTHPGLLKRLFELEVPEIYDGVVEIRSVAREAGFRSKIAVYSRNEEVDPVGSCVGPKGMRVQTIVNELTGEKIDIVRWSESVEEYVANALSPSKVLEVIVFEQE-----KMARVIVPDYQLSLAIGIKGQNARLAAKLTGWKIDIKSETQAEQE 346
>gi|163706053|ref|ZP_02124039.1| NusA antitermination factor [Methylobacterium nodulans ORS 2060] >gi|162428575|gb|EDQ39224.1| NusA antitermination factor [Methylobacterium nodulans ORS 2060] (536 aa)
Score = 448, Expect = 3.3e-42, Identities = 109/344 (31%), Positives = 195/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D    +++L    +VVD+ E+   D +EI++  A+    + ++GD ++  +    F R       Q++   + D    + YEE+KD++G I+   V++V+   V V+LG  +G+V R E IP E  +PG   ++YLF ++    ++ +G  I LSR+    +  L   E+ EI DGI+E+K ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I + +D   F+VNA  P ++V V + ++ D      + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    11 LLQIADAVAREKVIDRSIVIGAMEEAIAKAARSRYGAETDVHAEIDPRTGALRLSRHMLVVDQVEN---DAREIDLETARRHNPAAQVGDVIADTLPPFDFGRVAAQSAKQVIVQKVRDAERDRQYEEYKDRIGEIVNGLVKRVEYGNVIVDLGRGEGIVRRDESIPRETFRPGDRIRAYLFDVR----REVRGPQIFLSRSHPQFMAKLFAQEVPEIYDGIVEVKAVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDQATFIVNALQPAEVVKVVLDEEAD-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 346
>gi|116872753|ref|YP_849534.1| transcription elongation factor NusA [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741631|emb|CAK20755.1| nusA [Listeria welshimeri serovar 6b str. SLCC5334] (372 aa)
Score = 448, Expect = 3.4e-42, Identities = 120/349 (34%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  +  +K  S+E +V  ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA ++   YK GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     5 LLDALHVLEHDKGISREVLVEAIEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKINPVYKPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 345
>gi|188582066|ref|YP_001925511.1| NusA antitermination factor [Methylobacterium populi BJ001] >gi|179345564|gb|ACB80976.1| NusA antitermination factor [Methylobacterium populi BJ001] (560 aa)
Score = 447, Expect = 4.2e-42, Identities = 114/360 (31%), Positives = 202/360 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   ++ ++  ++ A+ K+   +   + D+   +D    +++L    +VVD+ E+   D +EI + +A+       +GD +S  +    F R       Q++   + D   ++ Y+E+KD++G I+   V++V+   V V+LG  +G+V R E IP E  +PG   ++YLF ++     + +G  I LSR+    +  L   E+ EI DGI+E+K ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I + ED   F+VNA  P ++V V + ++ D      + +V P++ L   IG+ G NVRL S+LTGW IDI++E    E +  EF + +Q+
  S:    11 LLQIADAVAREKVIDRQIVIEAMEEAIAKAARSRYGAETDVHAEIDPKSGALRLSRHLLVVDQVEN---DAREITLDQARRYNPGALVGDVISDTLPPFDFGRVAAQSAKQVIVQKVRDAERARQYDEYKDRIGEILNGVVKRVEYGNVIVDLGRGEGIVRRDEMIPRETFRPGDRIRAYLFDVR----SEVRGPQIFLSRSHPQFMAKLFGQEVPEIYDGIVEVKAVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSEDQATFIVNALQPAEVVKVVLDEEAD-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTEAEESERRQKEFAERTQV 363
>gi|187600967|ref|ZP_02987197.1| NusA antitermination factor [Chloroflexus sp. Y-400-fl] >gi|187486795|gb|EDU24766.1| NusA antitermination factor [Chloroflexus sp. Y-400-fl] (442 aa)
Score = 446, Expect = 5.2e-42, Identities = 118/343 (34%), Positives = 195/343 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSY---LKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRL--VEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F   + +IA E+   KE I+++++ AL  +Y   L  NP   I+VVV L+  S   +++ ++ VVD+  DE     EI++  A+ +K   ++G+ V  E     F R       Q++   + DI  + +Y E++D+ G ++ A V++ +     V + LG  + ++   EQ+  +    GQ     + EVK  + +G  +I SRA + L+  L + E+ EI +G +EIK I+R  G +TKVA+ +R  G+D VG+ VG +G RI+ I + LN E+IDV+ +  DP++++ NA  P ++V V + D E         ++ P++ L   IGK G NVRL +KLTGW IDI S
  S:     5 FYAAITQIASERGIPKEAIIDVMERALVSAYRRLLGPNPPA-IDVVVKLDPVSGVARVYAEKQVVDEVYDE---RFEIDLEAARRIKPDAQIGEAVLVESTPRDFGRIAAQTAKQVVLQGIKDIERNYIYSEFEDREGELLTATVQRNNGPRGNVILELGKAEAIIPPKEQVANDRYYHGQRLKVYLMEVKKDE-RGPRLIASRAHKNLILRLFEMEVPEIYNGAVEIKSIAREPGLRTKVAVAARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWSSDPREYIANALSPAQVVEVHLNDHE-----HTALVIVPDKQLSLAIGKEGQNVRLAAKLTGWRIDIKS 344
>gi|156449471|ref|ZP_02055854.1| NusA antitermination factor [Methylobacterium chloromethanicum CM4] >gi|156192008|gb|EDO24194.1| NusA antitermination factor [Methylobacterium chloromethanicum CM4] (545 aa)
Score = 446, Expect = 5.5e-42, Identities = 109/344 (31%), Positives = 194/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK   ++ ++  ++ A+ K+   +   + D+   +D    +++L    +VVD+ E+   D +EI + +A+       +GD +S  +    F R       Q++   + D   ++ Y+E+KD++G I+   V++V+   V V+LG  +G+V R E IP E  +PG   ++YLF ++     + +G  I LSR+    +  L   E+ EI DGI+E+K ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I + ED   F+VNA  P ++V V + ++ D      + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    11 LLQIAEAVAREKVIDRQIVIEAMEEAIAKAARSRYGAETDVHAEIDTKSGALRLSRHLLVVDQVEN---DAREITLDQARRYNPGALIGDVISDTLPPFDFGRVAAQSAKQVIVQKVRDAERARQYDEYKDRIGEILNGVVKRVEYGNVIVDLGRGEGIVRRDEMIPRETFRPGDRIRAYLFDVR----SEVRGPQIFLSRSHPQFMAKLFGQEVPEIYDGIVEVKAVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSEDQATFIVNALQPAEVVKVVLDEEAD-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 346
>gi|163852118|ref|YP_001640161.1| transcription termination factor NusA [Methylobacterium extorquens PA1] >gi|163663723|gb|ABY31090.1| transcription termination factor NusA [Methylobacterium extorquens PA1] (545 aa)
Score = 446, Expect = 5.5e-42, Identities = 109/344 (31%), Positives = 194/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK   ++ ++  ++ A+ K+   +   + D+   +D    +++L    +VVD+ E+   D +EI + +A+       +GD +S  +    F R       Q++   + D   ++ Y+E+KD++G I+   V++V+   V V+LG  +G+V R E IP E  +PG   ++YLF ++     + +G  I LSR+    +  L   E+ EI DGI+E+K ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I + ED   F+VNA  P ++V V + ++ D      + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    11 LLQIAEAVAREKVIDRQIVIEAMEEAIAKAARSRYGAETDVHAEIDTKSGALRLSRHLLVVDQVEN---DAREITLDQARRYNPGALIGDVISDTLPPFDFGRVAAQSAKQVIVQKVRDAERARQYDEYKDRIGEILNGVVKRVEYGNVIVDLGRGEGIVRRDEMIPRETFRPGDRIRAYLFDVR----SEVRGPQIFLSRSHPQFMAKLFGQEVPEIYDGIVEVKAVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSEDQATFIVNALQPAEVVKVVLDEEAD-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 346
>gi|116495058|ref|YP_806792.1| transcription elongation factor NusA [Lactobacillus casei ATCC 334] >gi|191638561|ref|YP_001987727.1| Transcription elongation protein NusA (Transcription termination-antitermination factor NusA) [Lactobacillus casei] >gi|116105208|gb|ABJ70350.1| Transcription elongation factor [Lactobacillus casei ATCC 334] >gi|190712863|emb|CAQ66869.1| Transcription elongation protein NusA (Transcription termination-antitermination factor NusA) [Lactobacillus casei BL23] (417 aa)
Score = 444, Expect = 9.5e-42, Identities = 116/362 (32%), Positives = 201/362 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQL 365
           K  ++ LD + +EK   KE ++  L+ AL  +Y +  N   +++V  D  +  I ++  + V D+     D   E+++ EA  + K+Y++GD +  EV    F R       Q++   + +   S VY+E+      I++  VE+ DNR + VNLG  + V+ R +Q+P E+ +        + +V++  +KG  + +SR   GL++ L + E+ EI DG +EI  I+R  G +TK+A+ S    VDAVGT VGP+G R++ + + L+ E +DV+ ++EDP  ++ NA +P +++ V+  D+ +    +  T++ P+  L   IGK G N RL +KLTG+ IDI  E      ++EF D  +L
  S:     3 KEMIQALDALEQEKGVKKEVVIEALEAALVSAYKRNYNQAQNVDVEFDPKQGDIHIYAVKEVTDEV---FDSRLEVSLKEALAINKAYEIGDQIKFEVTPKDFGRIAAQTAKQVIMQRVREAERSIVYDEYSQYEDEILQGVVERRDNRFIYVNLGKIEAVLGRQDQMPNEKYEAHDRIKVYVTKVENT-SKGPQVFVSRTHPGLVKRLFEQEVPEIFDGTVEIVNIAREAGDRTKIAVRSTNDAVDAVGTTVGPRGARVQAVVNELSGENMDVVQWEEDPADYIANALNPAQVIAVQFNDEAN---DRSATVIVPDYQLSLAIGKKGQNARLAAKLTGYKIDIKPES-----EVEFVDDDEL 353
>gi|118046941|ref|ZP_01515585.1| transcription termination factor NusA [Chloroflexus aggregans DSM 9485] >gi|117996523|gb|EAV10720.1| transcription termination factor NusA [Chloroflexus aggregans DSM 9485] (442 aa)
Score = 444, Expect = 9.7e-42, Identities = 117/343 (34%), Positives = 200/343 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSY---LKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD----NRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F   + +IA E+   KE I+++++ AL  +Y   L  NP   +EV V L+  S   +++ ++ VVD+  DE     EI+++ A+++K   ++G+TV  E     F R       Q++   + +I  S +Y E++D+ G ++ A V++ +    N ++E+  G  + ++   EQ+  +    GQ    L+ EVK +  +G  +I SRA + L+  L + E+ EI +G +EIK ++R  G +TKVA+ +R  G+D VG+ VG +G RI+ I + LN E+IDV+ +  DP++++ NA  P ++V V + D +         ++ P++ L   IGK G NVRL +KLTGW IDI S
  S:     5 FYAAITQIASERGIPKEAIIDVMERALVSAYKRLLGPNPPA-VEVTVKLDPVSGMARVYAEKQVVDEVYDE---RFEIDLNSARQIKPDVQIGETVLVESTPRDFGRIAAQTAKQVVLQGIKEIERSYIYSEFEDREGELVTATVQRNNGPRGNVILEI--GKAEAIIPPKEQVANDRYYHGQRLKVLLLEVK-KDDRGPRLIASRAHKNLINRLFEMEVPEIYNGSVEIKSVAREPGLRTKVAVAARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWSSDPREYIANALSPAQVVEVHLHDHD-----HTALVIVPDKQLSLAIGKEGQNVRLAAKLTGWRIDIKS 344
>gi|163848555|ref|YP_001636599.1| transcription termination factor NusA [Chloroflexus aurantiacus J-10-fl] >gi|163669844|gb|ABY36210.1| transcription termination factor NusA [Chloroflexus aurantiacus J-10-fl] (442 aa)
Score = 444, Expect = 9.8e-42, Identities = 118/343 (34%), Positives = 194/343 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSY---LKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRL--VEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F   + +IA E+   KE I+++++ AL  +Y   L  NP   I+VVV L+  S   +++ ++ VVD+  DE     EI++  A+ +K   ++G+ V  E     F R       Q++   + DI  + +Y E++D+ G ++ A V++ +     V + LG  + ++   EQ+  +    GQ     + EVK  + +G  +I SRA + L+  L + E+ EI +G +EIK I+R  G +TKVA+ +R  G+D VG+ VG +G RI+ I + LN E+IDV+ +  DP++++ NA  P ++V V + D E         ++ P++ L   IGK G NVRL  KLTGW IDI S
  S:     5 FYAAITQIASERGIPKEAIIDVMERALVSAYRRLLGPNPPA-IDVVVKLDPVSGVARVYAEKQVVDEVYDE---RFEIDLEAARRIKPDAQIGEAVLVESTPRDFGRIAAQTAKQVVLQGIKDIERNYIYSEFEDREGELLTATVQRNNGPRGNVILELGKAEAIIPPKEQVANDRYYHGQRLKVYLMEVKKDE-RGPRLIASRAHKNLILRLFEMEVPEIYNGAVEIKSIAREPGLRTKVAVAARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWSSDPREYIANALSPAQVVEVHLNDHE-----HTALVIVPDKQLSLAIGKEGQNVRLAEKLTGWRIDIKS 344
>gi|159897005|ref|YP_001543252.1| NusA antitermination factor [Herpetosiphon aurantiacus ATCC 23779] >gi|159890044|gb|ABX03124.1| NusA antitermination factor [Herpetosiphon aurantiacus ATCC 23779] (444 aa)
Score = 442, Expect = 1.6e-41, Identities = 110/343 (32%), Positives = 196/343 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTAL---EKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           F   + +IA E+   +E++ ++++ AL    + YL  NP  +D+++ ++ N   I+++ ++ VVD+    +DD  EI+I +A+ ++   ++G+TV  E   D F R       Q++   + ++    +Y E+ D+ G I+ A V++     V + +G  + ++ + EQI  +  + GQ     + E +    +G  ++ SR  + L++ L + E+ EI +G +EIK I+R  G ++KVA+ +R  G+D VG+ VG +G RI+ I + LN E+IDV+ +  D + F+ NA  P ++V V + +     G K  T+V P++ L   IGK G NVRL +KL GW IDI S
  S:     5 FYAAISQIAAERGIPRESVQDVVEQALISAYRRYLGSNPPPVDVKIELEPNTGRIRVYAEKQVVDEV---MDDRFEIDIEDARNVRADVEIGETVYVESTPDDFGRIAAQTAKQVVLQRIKEVERDHIYGEYFDREGEIVTATVQRTAKGNVILEVGRAEAILPQKEQISHDNYRHGQRLKVYLMEARRDDPRGPRLVASRTHKDLIKRLFEMEVPEIYNGTVEIKSIAREPGLRSKVAVHARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWGADMRVFIANALSPAQVVEVHLDE-----GEKTATVVVPDKQLSLAIGKEGQNVRLAAKLVGWRIDIKS 343
>gi|154249422|ref|YP_001410247.1| transcription elongation factor NusA [Fervidobacterium nodosum Rt17-B1] >gi|154153358|gb|ABS60590.1| NusA antitermination factor [Fervidobacterium nodosum Rt17-B1] (344 aa)
Score = 441, Expect = 1.8e-41, Identities = 121/346 (34%), Positives = 192/346 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           M     LE L ++ +EK  S +  + IL+ AL  +Y  +  + ++E+V++     I+ ++   VV+K E+E   + +I++ +A ++K    +GD V  ++NI +  R       Q+L   + +I   K YE++ + VG ++ AEV KV    +++ +G  +  + + E IPGEE +        ++EVK  + KG  II++R D   +  LLK E+ EI  GIIEI +I R  G +TK+A++S  P VD VG+ +GP+G RI  I   L  E+ID+I +  DPK+ + NA  P  ++ VEI D E    SK   ++     L   IGK G N RL +KLTGW IDI
  S:     1 MNSPMLLEALRELEREKGISVDESIEILEKALMSAYKNKTGERNVEIVINKLSGEIEAYQILEVVEKVENE---NIQISLEDALKIKPDATIGDIVKRKMNIKRLGRFAIQVAKQVLIQKIREIEKEKQYEKYAELVGRVVTAEVLKVTPEWLDIRIGKLETHLPKKEWIPGEEFEQSDLIKVYVREVKKDK-KGPKIIVTRIDNEFVVGLLKLEVPEIESGIIEIVKIVREPGVRTKIAVISHDPKVDPVGSCIGPEGSRIAPILKELKIEKIDIIKWSNDPKELIANALLPASVIDVEILDYE----SKASRVLVSPNQLSLAIGKAGQNARLAAKLTGWKIDI 338
>gi|168142536|ref|ZP_02585765.1| transcription elongation factor NusA [Bacillus cereus G9842] (368 aa)
Score = 441, Expect = 1.9e-41, Identities = 121/358 (33%), Positives = 202/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N E  +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R++++   L  E+ID++ +  DP +++ NA  P ++V V + +DE     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNPEVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVHAENIDVDPVGSCVGPKGQRVQRVVDELKGEKIDIVRWSNDPVEYVANALSPSQVVKVLVDEDE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|167940438|ref|ZP_02527513.1| transcription elongation factor NusA [Bacillus cereus AH1134] >gi|168138554|ref|ZP_02581783.1| transcription elongation factor NusA [Bacillus cereus B4264] (368 aa)
Score = 441, Expect = 1.9e-41, Identities = 121/358 (33%), Positives = 202/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N E  +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R+++I   L  E+ID++ +  DP +++ NA  P ++V V + ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNPEVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVYAENTDVDPVGSCVGPKGQRVQRIVDELKGEKIDIVRWSNDPVEYVANALSPSQVVKVLVDEEE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|152976182|ref|YP_001375699.1| transcription elongation factor NusA [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024934|gb|ABS22704.1| NusA antitermination factor [Bacillus cereus subsp. cytotoxis NVH 391-98] (366 aa)
Score = 441, Expect = 2.0e-41, Identities = 117/347 (33%), Positives = 197/347 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N E  +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R+++I   L  E+ID++ +  DP +++ NA  P ++V V + ++E     K  T++ P+  L   IGK G N RL +KLTGW IDI SE  A
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNPEVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQNGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVYAENIDVDPVGSCVGPKGQRVQRIVDELKGEKIDIVRWSNDPVEYVANALSPSQVVSVLVNEEE-----KATTVIVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDA 343
>gi|75760860|ref|ZP_00740874.1| N utilization substance protein A [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491644|gb|EAO54846.1| N utilization substance protein A [Bacillus thuringiensis serovar israelensis ATCC 35646] (368 aa)
Score = 441, Expect = 2.1e-41, Identities = 121/358 (33%), Positives = 202/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N E  +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R++++   L  E+ID++ +  DP +++ NA  P ++V V + +DE     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNTEVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVHAENIDVDPVGSCVGPKGQRVQRVVDELKGEKIDIVRWSNDPVEYVANALSPSQVVKVLVDEDE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|170740831|ref|YP_001769486.1| NusA antitermination factor [Methylobacterium sp. 4-46] >gi|168195105|gb|ACA17052.1| NusA antitermination factor [Methylobacterium sp. 4-46] (544 aa)
Score = 441, Expect = 2.2e-41, Identities = 107/344 (31%), Positives = 194/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D    +++L    +VV++ E+   D +EI++  A+    + ++GD ++  +    F R       Q++   + D    + YEE+KD++G I+   V++V+     V+LG  +G+V R E IP E  +PG   ++YLF ++    ++ +G  I LSR+    +  L   E+ EI DGI+E+K ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I + +D   F+VNA  P ++V V + ++ D      + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    11 LLQIADAVAREKVIDRSIVIGAMEEAIAKAARSRYGAETDVHAEIDPRTGALRLSRHLLVVEQVEN---DAREIDLETARRHNPAAQIGDVIADTLPPFDFGRVAAQSAKQVIVQKVRDAERDRQYEEYKDRIGEIVNGLVKRVEYGNTIVDLGRGEGIVRRDESIPRETFRPGDRIRAYLFDVR----REVRGPQIFLSRSHPQFMAKLFAQEVPEIYDGIVEVKAVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDQATFIVNALQPAEVVKVVLDEEAD-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 346
>gi|168187910|ref|ZP_02622545.1| transcription termination factor NusA [Clostridium botulinum C str. Eklund] >gi|169294236|gb|EDS76369.1| transcription termination factor NusA [Clostridium botulinum C str. Eklund] (348 aa)
Score = 439, Expect = 3.3e-41, Identities = 124/344 (36%), Positives = 196/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-----DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F+E L +I KEK   +E + + ++ AL  +Y K    +     +++V +D     I ++ ++    K E+E     EI++ +A+E+   Y++GD V  EV    F R       Q++   + +     +Y+E+  K  +II   V + D   V V+L  T+ V+  +EQ+PGEE    Q     I EVK+  TKG  +++SR   GL++ L + E+ EI  GI+EIK I+R  G +TK+A+ S    VDA G  VGPKG R++ I + L NE+ID+I +D++P++++ NA  P +++ V+I D+     +K   IV  +  L   IGK G NVRL +KLTGW IDI SE
  S:     5 FIEALREIVKEKGIGEELLFDTVEDALVSAYKKNYAKVGGNSQNVKVTIDRENGEIHVYAQK----KIEEEPSGVNEISLEDAREIDSRYQMGDIVDLEVTPKSFGRIAAQTAKQVVIQRIKEAERKVIYDEFIAKEFDIITGTVIRKDKGNVFVDLEKTEAVLGPNEQMPGEEYNFNQKLKLYIVEVKNT-TKGPQVVVSRTHPGLVKRLFELEVPEIYAGIVEIKSIAREAGSRTKIAVYSNDENVDATGACVGPKGMRVQNIVTELKNEKIDIIKWDKEPEKYIANALSPARVLSVDIDDE-----NKSAKIVVEDNQLSLAIGKEGQNVRLAAKLTGWKIDIKSE 343
>gi|90961545|ref|YP_535461.1| transcription elongation factor NusA [Lactobacillus salivarius UCC118] >gi|90820739|gb|ABD99378.1| N utilization substance protein A [Lactobacillus salivarius UCC118] (375 aa)
Score = 439, Expect = 3.5e-41, Identities = 128/367 (34%), Positives = 201/367 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE------DKIEFEDVSQLVSSKT 370
           K  L  L+ +  EK   KE ++  L+ AL  +Y +      ++EV  D    +I ++  + VV++     D   EI++  A E+ ++Y++GDT+  EV    F R       Q++   +       +Y E+      I+  EVE+ DN+ V VNLG  + V+ R +QIPGEE +        I +V++  +KG  + +SR+   LLR L + EI EI DG +EI  ISR  G + KVA+ S   GVD VGT VGP+GER++ I + L  E +D++ + EDP +++ NA +P K++ V   D+ +       T+V P++ L   IGK G N RL ++LTG+ IDI SE  A +      D  + +D  QL+S  +
  S:     3 KELLNALNALEVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYAVKEVVNEV---YDSQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTGEVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKVYIYKVENT-SKGPQVFVSRSHPDLLRRLFEQEIPEIFDGTVEIVSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPAEYIANALNPAKVLDVRFDDENE----HACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNVEADNNDIDDEDQLMSDSS 368
>gi|169350438|ref|ZP_02867376.1| hypothetical protein CLOSPI_01206 [Clostridium spiroforme DSM 1552] >gi|169292758|gb|EDS74891.1| hypothetical protein CLOSPI_01206 [Clostridium spiroforme DSM 1552] (432 aa)
Score = 438, Expect = 4.5e-41, Identities = 119/350 (34%), Positives = 198/350 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           F+E L+ + +EK   K+  + +LK ++ K+Y K   + D  V V++N+++   +LFE R VVD  EDE  +       EAQ +   YK+GD V TE +++   R       Q+    + +     +Y E+ DK  +II   V++V+++   VN+G T   +  ++QIPGE+L+ GQ     + +V  + TKG  I++SR +   ++ L + E+ E+ DG +EIK +SR  G ++K+A+ +    +D +G+ VGPKG R+K +   LN E ID+I++  DP +F+ NA  P ++  V I + +         ++ P++ L   IGK G N RL  +LTGW IDI S   A+E+
  S:     6 FMEALNLLIEEKGIEKDVFLEMLKESIAKAYKKNYLNSDANVRVEINEKTGKFRLFELRTVVDDLEDEDLELSL---EEAQAINPFYKIGDVVETEADVEHIGRLAAIQTKQLFRQKIRETEKETLYNEFADKKDDIITGIVDRVEDKFAIVNIGKTGAFLALNQQIPGEKLKEGQHLKVYVCDV-DRGTKGTHIVVSRTEPNFVKRLFELEVPEVFDGTVEIKAVSREPGERSKIAVYASNENIDPIGSCVGPKGSRVKNVVDELNGEMIDIIIWSNDPVEFISNALSPSEVKYVSINEKD-----HSALVIVPDDQLSLAIGKRGQNARLAVRLTGWKIDIKSVSEALEN 348
>gi|163941553|ref|YP_001646437.1| transcription elongation factor NusA [Bacillus weihenstephanensis KBAB4] >gi|163863750|gb|ABY44809.1| NusA antitermination factor [Bacillus weihenstephanensis KBAB4] (368 aa)
Score = 437, Expect = 5.4e-41, Identities = 120/358 (33%), Positives = 201/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N E  +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R++++   L  E+ID++ +  DP +++ NA  P ++V V + + E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNPEVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVYAENIDVDPVGSCVGPKGQRVQRVVDELKGEKIDIVRWSNDPVEYVANALSPSQVVKVLVDEAE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|30263819|ref|NP_846196.1| transcription elongation factor NusA [Bacillus anthracis str. Ames] >gi|42782904|ref|NP_980151.1| transcription elongation factor NusA [Bacillus cereus ATCC 10987] >gi|47529243|ref|YP_020592.1| transcription elongation factor NusA [Bacillus anthracis str. 'Ames Ancestor'] >gi|47569093|ref|ZP_00239782.1| transcription termination factor nusA [Bacillus cereus G9241] >gi|49186666|ref|YP_029918.1| transcription elongation factor NusA [Bacillus anthracis str. Sterne] >gi|49479412|ref|YP_037877.1| transcription elongation factor NusA [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141674|ref|YP_085157.1| transcription elongation factor NusA [Bacillus cereus E33L] >gi|65321143|ref|ZP_00394102.1| COG0195: Transcription elongation factor [Bacillus anthracis str. A2012] >gi|118479036|ref|YP_896187.1| transcription elongation factor NusA [Bacillus thuringiensis str. Al Hakam] >gi|165872619|ref|ZP_02217250.1| N utilization substance protein A [Bacillus anthracis str. A0488] >gi|166986132|ref|ZP_02257387.1| transcription elongation factor NusA [Bacillus cereus AH187] >gi|166994469|ref|ZP_02260929.1| transcription elongation factor NusA [Bacillus cereus AH820] >gi|167639787|ref|ZP_02398056.1| N utilization substance protein A [Bacillus anthracis str. A0193] >gi|168164211|ref|ZP_02599444.1| transcription elongation factor NusA [Bacillus cereus H3081.97] >gi|170706870|ref|ZP_02897328.1| N utilization substance protein A [Bacillus anthracis str. A0389] >gi|177652046|ref|ZP_02934592.1| N utilization substance protein A [Bacillus anthracis str. A0174] >gi|190568469|ref|ZP_03021376.1| N utilization substance protein A [Bacillus anthracis Tsiankovskii-I] >gi|196042176|ref|ZP_03109459.1| N utilization substance protein A [Bacillus cereus NVH0597-99] >gi|196044653|ref|ZP_03111888.1| N utilization substance protein A [Bacillus cereus 03BB108] >gi|30258463|gb|AAP27682.1| N utilization substance protein A [Bacillus anthracis str. Ames] >gi|42738831|gb|AAS42759.1| N utilization substance protein A [Bacillus cereus ATCC 10987] >gi|47504391|gb|AAT33067.1| N utilization substance protein A [Bacillus anthracis str. 'Ames Ancestor'] >gi|47554255|gb|EAL12617.1| transcription termination factor nusA [Bacillus cereus G9241] >gi|49180593|gb|AAT55969.1| N utilization substance protein A [Bacillus anthracis str. Sterne] >gi|49330968|gb|AAT61614.1| N utilization substance protein A [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975143|gb|AAU16693.1| N utilization substance protein A [Bacillus cereus E33L] >gi|118418261|gb|ABK86680.1| N utilization substance protein A [Bacillus thuringiensis str. Al Hakam] >gi|164711651|gb|EDR17197.1| N utilization substance protein A [Bacillus anthracis str. A0488] >gi|167512188|gb|EDR87565.1| N utilization substance protein A [Bacillus anthracis str. A0193] >gi|170128288|gb|EDS97157.1| N utilization substance protein A [Bacillus anthracis str. A0389] >gi|172082415|gb|EDT67480.1| N utilization substance protein A [Bacillus anthracis str. A0174] >gi|190560473|gb|EDV14451.1| N utilization substance protein A [Bacillus anthracis Tsiankovskii-I] >gi|196024688|gb|EDX63360.1| N utilization substance protein A [Bacillus cereus 03BB108] >gi|196027028|gb|EDX65652.1| N utilization substance protein A [Bacillus cereus NVH0597-99] (368 aa)
Score = 437, Expect = 5.6e-41, Identities = 117/358 (32%), Positives = 201/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y +  N   ++ V  +    +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R+++I   L  E+ID++ +  DP +++ NA  P ++V V + ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAYKRNFNQAQNVRVSFNPQVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVHAENIDVDPVGSCVGPKGQRVQRIVDELKGEKIDIVRWSNDPVEYVANALSPSQVVKVLVDEEE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|30021905|ref|NP_833536.1| transcription elongation factor NusA [Bacillus cereus ATCC 14579] >gi|29897461|gb|AAP10737.1| N utilization substance protein A [Bacillus cereus ATCC 14579] (368 aa)
Score = 436, Expect = 7.0e-41, Identities = 120/358 (33%), Positives = 201/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N E  +I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R+++I   L  E+I ++ +  DP +++ NA  P ++V V + ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNPEVGTIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVYAENTDVDPVGSCVGPKGQRVQRIVDELKGEKIAIVRWSNDPVEYVANALSPSQVVKVLVDEEE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|194014307|ref|ZP_03052924.1| transcription termination factor NusA [Bacillus pumilus ATCC 7061] >gi|194013333|gb|EDW22898.1| transcription termination factor NusA [Bacillus pumilus ATCC 7061] (371 aa)
Score = 436, Expect = 7.3e-41, Identities = 124/349 (35%), Positives = 203/349 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  + KEK  SKE I+  ++ AL  +Y K N +    V VDLN+E+  I++F ++ VVD+     D   EI++ +A  +  +Y +GD V  EV    F R       Q++T  + +     +Y E+ D+  +I+   V+++D++ + V+LG  + ++  +EQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P VD VG+ VGPKG+R++ I + L  E+ID++ +  DP +F+ NA  P K++ V I ++ED    K  T++ P+  L   IGK G N RL +KLT W IDI SE  A E
  S:     5 LLDALTVLEKEKGISKEIIIEAIEAALISAY-KRNFNQAQNVRVDLNRETGTIRVFARKDVVDEV---YDSRLEISVDDAANMNPNYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYTEFIDREEDIMTGIVQRIDSKFIYVSLGKIEALLPVNEQMPNEDYKPHDRIKVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTDDPDVDPVGSCVGPKGQRVQAIVNELKGEKIDIVHWSNDPVEFVANALSPSKVLDV-IVNEED----KATTVIVPDYQLSLAIGKRGQNARLAAKLTSWKIDIKSETDARE 345
>gi|118443498|ref|YP_878211.1| transcription elongation factor NusA [Clostridium novyi NT] >gi|118133954|gb|ABK60998.1| transcription termination factor NusA [Clostridium novyi NT] (348 aa)
Score = 436, Expect = 8.0e-41, Identities = 122/344 (35%), Positives = 196/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-----DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F+E L +I KEK   ++ + + ++ AL  +Y K    +     +++V +D     I ++ ++    K E+E     EI++ +A+E+   Y++GD V  EV    F R       Q++   + +     VY+E+  K  +II   V + D   V V+L  T+ V+  +EQ+PGEE    Q     I EVK+  TKG  +++SR   GL++ L + E+ EI  G++E+K I+R  G +TK+A+ S    VDA G  VGPKG R++ I + L NE+ID+I +D++P++++ NA  P +++ V+I D+     +K   IV  +  L   IGK G NVRL +KLTGW IDI SE
  S:     5 FIEALREIVKEKGIGEQLLFDTVEDALVSAYKKNYAKVGGNSQNVKVTIDRENGEIHVYAQK----KIEEEPSGVNEISLEDAREIDSRYQMGDIVDLEVTPKSFGRIAAQTAKQVVIQRIKEAERKVVYDEFIAKEFDIITGTVIRKDKGNVFVDLEKTEAVLGPNEQMPGEEYNFNQKLKLYIVEVKNT-TKGPQVVVSRTHPGLVKRLFELEVPEIYAGVVEVKSIAREAGSRTKIAVYSNDENVDATGACVGPKGMRVQNIVTELKNEKIDIIKWDKEPEKYIANALSPARVLSVDIDDE-----NKSAKIVVEDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSE 343
>gi|89098596|ref|ZP_01171478.1| transcription elongation factor NusA [Bacillus sp. NRRL B-14911] >gi|89086558|gb|EAR65677.1| transcription elongation factor NusA [Bacillus sp. NRRL B-14911] (394 aa)
Score = 435, Expect = 8.5e-41, Identities = 117/352 (33%), Positives = 198/352 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
            L+ L  + KEK  S++ I+  ++ AL  +Y +  N   ++ + ++L   ++++F ++ VV   E   D   EI++ EA+ +  +Y++ D V  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D + + V+LG  + ++  +EQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EIK +SR  G ++K+++ +    VD VG+ VGPKG R++ + + L  E+ID++ +  DP  F+ NA  P K++ V I ++ED    K  T++ P+  L   IGK G N RL +KLTGW IDI SE  A E  I
  S:     5 LLDALTLLEKEKGISRDIIIEAIEAALISAYRRNFNQAQNVRIDLNLGSGTMRVFARKEVV---EQVFDPRLEISLDEAKGINPNYQVEDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYSEFIDREEDIMTGIVQRQDPKFIYVSLGKIEAILPANEQMPNEQYKPHDRIKVFITKVE-KTTKGPQIFVSRTHPGLLKRLFEIEVPEIYDGTVEIKSVSREAGDRSKISVHADNSEVDPVGSCVGPKGTRVQAVVNELKGEKIDIVKWSPDPVVFVANALSPSKVLDV-IVNEED----KATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETEARESGI 348
>gi|157692343|ref|YP_001486805.1| transcription elongation factor NusA [Bacillus pumilus SAFR-032] >gi|157681101|gb|ABV62245.1| transcription elongation factor NusA [Bacillus pumilus SAFR-032] (371 aa)
Score = 435, Expect = 9.9e-41, Identities = 124/349 (35%), Positives = 203/349 (58%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            L+ L  + KEK  SKE I+  ++ AL  +Y K N +    V VDLN+E+  I++F ++ VVD+     D   EI++ +A  +  +Y +GD V  EV    F R       Q++T  + +     +Y E+ D+  +I+   V+++D++ + V+LG  + ++  +EQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +E+K ++R  G ++K+++ +  P VD VG+ VGPKG+R++ I + L  E+ID++ +  DP +F+ NA  P K++ V I ++ED    K  T++ P+  L   IGK G N RL +KLT W IDI SE  A E
  S:     5 LLDALTVLEKEKGISKEIIIEAIEAALISAY-KRNFNQAQNVRVDLNRETGTIRVFARKDVVDEV---YDSRLEISVDDAANINPNYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYTEFIDREEDIMTGIVQRIDSKFIYVSLGKIEALLPVNEQMPNEDYKPHDRIKVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTDDPDVDPVGSCVGPKGQRVQAIVNELKGEKIDIVHWSNDPVEFVANALSPSKVLDV-IVNEED----KATTVIVPDYQLSLAIGKRGQNARLAAKLTSWKIDIKSETDARE 345
>gi|116629468|ref|YP_814640.1| transcription elongation factor NusA [Lactobacillus gasseri ATCC 33323] >gi|116095050|gb|ABJ60202.1| Transcription elongation factor [Lactobacillus gasseri ATCC 33323] (423 aa)
Score = 435, Expect = 1.0e-40, Identities = 136/416 (32%), Positives = 222/416 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNK--PGSKPNFYSGFSSDDSIETDFDIDQ 419
           K  +E    + KEK   +E IV+ +K AL  +Y K  N   ++EVV D  K + K+   + VVD+ +D      E+++ +A E+ ++Y++GD +  EV    F R       Q++   L +     +  E+      I+   VE+ DNR V V +G+ + V+  ++Q+PGE   P      L+  V S  +KG  I +SR    L++ L + E+ E+ DG +EI  I+R  G +TK+A+ S  P +D VGT VGPKG R++ I + L  E IDV+ Y+E+P  F+ NA +P +++ V+ + D+D    K   ++ P+  L   IGK G NVRL ++LTG+ IDI  E      ++EF D S+    +T Q         ++N    +ST+ +    S  +F +G   D +++ D D D+
  S:    20 KEMVEAFATLEKEKGIKQEIIVDAIKAALVAAYKKNYNQAQNVEVVFDEKKGNFKVNAIKTVVDEVQDS---RLEVSLKDALEINRAYEVGDEIRFEVTPKDFGRLAAQTAKQVIMQRLREAEREHIISEYSQYKDEIVTGTVERRDNRFVYVKIGNVEAVMTHNDQLPGENYNPQDKVRVLVTRVGSD-SKGAQITVSRTAPDLVKRLFEQEVPEVYDGTVEIVSIAREAGDRTKIAVKSNDPDIDPVGTLVGPKGTRVQNIVNELGGENIDVVKYEENPSDFIANALNPAEVIAVQFSGDDD---DKNALVIVPDYQLSLAIGKRGQNVRLAARLTGYKIDIKPES-----QVEFVD-SEGDDVETDQ---DIDDSNVSNEEATESTAEQLEEDSSEDFPNGEDVDSALDDDADKDE 422
>gi|51892657|ref|YP_075348.1| transcription elongation factor NusA [Symbiobacterium thermophilum IAM 14863] >gi|51856346|dbj|BAD40504.1| transcriptional termination-antitermination factor [Symbiobacterium thermophilum IAM 14863] (360 aa)
Score = 435, Expect = 1.0e-40, Identities = 118/346 (34%), Positives = 187/346 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGV---VLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           LE LD + +E+  S+E ++  ++ AL  +Y +      ++ V  D      +++ ++ +V   E+  D   ++++ EA+    S +LGD    EV    F R       Q++   + +     +YEE+  + G I+   V++ D +   V L   +GV   +  +EQIPGE     Q     + EVK + TKG  I +SR   GLL+ L + E+ EI DG +EIK I+R  G ++K+A+++R P VD VG  VG KG+R++ I   L  E+IDV+ +  DP+ F+  A  P K+  V + D+E    S+I  ++ P+  L   IGK G N RL +KLTGW IDI SE  A
  S:     6 LEALDDLVRERGISREVLIEAIEAALISAYRRNFGSAQNVRVFFDDKTGEYRVYAQKEIV---EEVTDPRLQVSLEEARMKNPSLQLGDVFEVEVTPRDFGRIAAQTAKQVVVQRIREAERGMIYEEYSSREGEIVTGLVQRQDPKTRTVYLELARGVEAVLTANEQIPGERYVENQRIKAYVIEVK-RTTKGPAIAVSRTHPGLLKRLFELEVPEIHDGTVEIKGIAREAGSRSKIAVMARDPNVDPVGACVGQKGQRVQNIVDELQGEKIDVVEWSPDPEVFVAKALSPAKVTQV-VCDEE----SRIARVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSESQA 346
>gi|167635811|ref|ZP_02394120.1| N utilization substance protein A [Bacillus anthracis str. A0442] >gi|170687901|ref|ZP_02879115.1| N utilization substance protein A [Bacillus anthracis str. A0465] >gi|167528768|gb|EDR91526.1| N utilization substance protein A [Bacillus anthracis str. A0442] >gi|170668217|gb|EDT18966.1| N utilization substance protein A [Bacillus anthracis str. A0465] (368 aa)
Score = 434, Expect = 1.3e-40, Identities = 120/358 (33%), Positives = 201/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
            L+ L  +  EK  SK+ I++ ++ AL  +Y K N +    V V  N +   I++  ++ VVD   +  D   EI++ EA+++  +Y+ GD +  EV    F R       Q++T  + +     +Y E+ D+  +I+   V++ D R + V+LG  + ++  SEQ+P E+ +P       I +V+ + TKG  I +SR   GLL+ L + E+ EI DG +EI+ ++R  G ++K+++ +    VD VG+ VGPKG+R+++I   L  E+ID++ +  DP +++ NA  P ++V V + ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A +  I  E+ S
  S:     5 LLDALLVLESEKGISKDIIIDAIEAALISAY-KRNFNQAQNVRVSFNPQVGIIQVLARKDVVD---NVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVTQRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYVSLGKVEALLPVSEQMPNEQYKPHDRIRVFITKVE-KTTKGPQIYVSRTHPGLLKRLFEMEVPEIYDGTVEIRSVAREAGDRSKISVHAENIDVDPVGSCVGPKGQRVQRIVDELKGEKIDIVRWSNDPVEYVANALSPSQVVKVLVDEEE-----KATTVVVPDHQLSLAIGKRGQNARLAAKLTGWKIDIKSESDAKQLGIVTEEDS 354
>gi|146297077|ref|YP_001180848.1| NusA antitermination factor [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410653|gb|ABP67657.1| NusA antitermination factor [Caldicellulosiruptor saccharolyticus DSM 8903] (356 aa)
Score = 434, Expect = 1.3e-40, Identities = 114/343 (33%), Positives = 201/343 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSY-----LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD--NRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPII-LSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           +     +D++ +E    +E I ++L++AL  +Y     +K+    +++V +D  K  +K+FE + VV+  +D+ +   EI++ +A+++ K Y++GD V+ EV I  F R+      Q +   + +   + ++E++  K+ NI+   ++++D  N +VE+  G  + ++   EQIPGEE +PG    F + +VK    +  PI+ LSR    L++ L++ E+ EI +GIIEIK I+R  G ++KVA+ S    VD VG  +G KG RI+ +   L +E+ID++ +  D  +F+ NA  P ++V +++   E     K   ++ P + L   IGK G N RL +KLTGW IDI
  S:    11 QELFSAIDELEREYKIEREYIYSVLESALLTAYKQVRGIKDKNLSNVKVSIDPEKGDVKIFEYKKVVENVKDKRN---EISVEDARKIDKRYQVGDIVAIEVPISDFSRKAAMTVRQTVIGKIREKKRNIIFEDYSAKIDNIVTGVIQRIDKKNVIVEIEGGKVEAILPMEEQIPGEEYKPGTMMKFYLVDVKIPPKEKEPIVYLSRTHPNLIKRLMENEVPEIQEGIIEIKGIAREAGSRSKVAVYSNSLKVDPVGACIGEKGIRIQNVLKYLGSEKIDIVRWSSDIGEFIKNALSPAEVVHIDLNLVE-----KKAFVLVPNDQLSLAIGKGGQNARLAAKLTGWKIDI 353
>gi|167212182|ref|ZP_02282489.1| transcription elongation factor NusA [Listeria monocytogenes LO28] (349 aa)
Score = 433, Expect = 1.6e-40, Identities = 114/327 (34%), Positives = 181/327 (55%)
  Q:    28 LKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           ++ AL  +Y +   D    V VDLN E  SI++  ++  V   E   D   EI++ EA +L   Y+ GD V  EV    F R       Q++T  + +     +Y+E+ D+  +I+   VE+ D+R + VNLG  + ++ ++EQ+P E           + +V+ + TKG  I +SR   GLL+ L + E+ EI DG++EIK ++R  G ++K+++ +    VD VG  VGPKG R++ I + L  E+ID++ + EDP  F+ NA  P K++ V + +       +  T++ P+  L   IGK G N RL +KLTGW IDI SE +A E
  S:     4 IEAALTSAYKRNFKDAQ-NVRVDLNMENGSIRVLARKEAV---EQVFDSRLEISMEEAHKLNPVYQPGDVVELEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYDEFIDREDDIMTGIVERQDSRFIYVNLGKIEAILSQNEQMPNETYHAHDRIKVYLTKVE-KTTKGPQIFVSRTHPGLLKRLFEMEVPEIYDGVVEIKSVAREAGDRSKISVYTANEEVDPVGACVGPKGARVQTIVNELKGEKIDIVEWSEDPFTFVANALSPSKVLDVIVNE-----ADQATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETVATE 322
>gi|116492653|ref|YP_804388.1| transcription elongation factor [Pediococcus pentosaceus ATCC 25745] >gi|116102803|gb|ABJ67946.1| Transcription elongation factor [Pediococcus pentosaceus ATCC 25745] (362 aa)
Score = 433, Expect = 1.7e-40, Identities = 114/346 (32%), Positives = 190/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  +  LD + KEK   KE IV  L+ AL  ++ +      ++EV  +  K  I ++  + VV++ ED   D  E+++++A  + ++Y+L D +  EV    F R       Q++   + +     +YE++      I+  EV   DNR V V+LG  + V+ +S+QIPGE+ +P       I +V++   KG  I  SR D GLL+ L + E+ E+ DG +EI  I+R  G + K+A+ S  P +DAVGT VG KG+R++ I + L+ E +D+I + EDP +++ NA  P +++ V   ++++        ++ P+  L   IG+ G N RL +KL  + IDI SE
  S:     3 KEMITALDILEKEKGIKKEVIVEALEAALVSAFKRNYGQAQNVEVEFNDRKGDIHVYAVKKVVEEVED---DQLEVSLADALMINRAYELDDEIRFEVTPKNFGRIAAQTAKQVIMQRVREAERGVIYEKYGQYEDEIVTGEVSHRDNRYVYVDLGGVEAVMAKSDQIPGEQYEPHDHIKVYITKVENN-GKGPQIFASRTDSGLLKRLFEQEVPEVYDGTVEIMSIAREAGDRAKIAVRSNDPDIDAVGTCVGAKGQRVQTIVNELHGENMDIIEWKEDPAEYIANALKPSEVIDVLFNEEDE----NYCMVIVPDYQLSLAIGRRGQNARLAAKLVNFKIDIKSE 341
>gi|28378676|ref|NP_785568.1| transcription elongation factor NusA [Lactobacillus plantarum WCFS1] >gi|28271512|emb|CAD64417.1| transcription termination-antitermination factor NusA [Lactobacillus plantarum WCFS1] (405 aa)
Score = 433, Expect = 1.7e-40, Identities = 123/349 (35%), Positives = 192/349 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           K  L  LD +  EK   KE ++  L+ AL  +Y +      ++EV  D  K +I ++  + VV   ED  D   E+++ +A  + ++Y++GD +  EV    F R       Q++   + +     +Y+E+      I+  EVE+ DNR V V+LG  + V+ RS+Q+PGE  +        + +V++  TKG  + +SR    LL+ L + E+ EI DGI+EI  I+R  G + KVA+ S  P VD VGT VGPKG+R++ I + L+ E +D++ +  D   F+ NA +P +++ V I D E+  G    T+V P+  L   IGK G N RL +KLTG+ IDI SE  A
  S:     3 KELLGALDTLESEKGIKKEVVIEALEAALVSAYKRNYGQAQNVEVDFDQIKGNIHVYAVKEVV---EDVFDSRLEVSLQDALAINRAYEIGDDIRFEVTPKNFGRIAAQTAKQVIMQRVREAERGIIYDEYSQYENEIVTGEVERQDNRFVYVSLGKVEAVMGRSDQLPGEVYRIHDKIKVYVSKVENA-TKGPQVFVSRTAPDLLKRLFEQEVPEIFDGIVEIVSIAREAGDRAKVAVRSNNPNVDPVGTCVGPKGQRVQTIVNELHGENMDIVEWTYDQAVFIANALNPAEVLDV-IFDPENERG---CTVVVPDYQLSLAIGKRGQNARLAAKLTGFKIDIKSETEA 344
>gi|161507684|ref|YP_001577638.1| transcription elongation factor NusA [Lactobacillus helveticus DPC 4571] >gi|160348673|gb|ABX27347.1| transcription termination-antitermination factor [Lactobacillus helveticus DPC 4571] (393 aa)
Score = 432, Expect = 2.3e-40, Identities = 120/373 (32%), Positives = 202/373 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQ 376
           K  LE    + K K   ++ IV+ +K AL  +Y K  N   ++EV  D  + + K+   + VVD+ +D   D  E+++ +A  + ++Y++GD +  EV    F R       Q++   L +   S + +E+      ++   VE+ DNR V V +G+ + ++ + +Q+P E   P      L+  V S  +KG  I++SR    +++ L + E+ EI DG +EI  I+R  G +TK+A+ S  P +D VGT VG KG R++ + + L  E IDV+ Y+EDP  F+ NA +P +++ V+  DDE+    K   ++ P+  L   IGK G NVRL ++LTG+ IDI  E      ++EF D     S+K+ +  ++
  S:     3 KEMLEAFATLEKTKGIKQDVIVDAIKAALVAAYKKNYNQAQNVEVDFDERRGNFKVMAVKTVVDEVQD---DRLEVSLKDALAINRAYEVGDEIRFEVTPKNFGRIAAQTAKQVIMQRLREAERSHIIDEYSQYEDELVTGTVERRDNRFVYVKIGNVEAIMPQCDQMPNEVYNPQDQIRVLVTHVGSD-SKGAQIVVSRTAPDVVKRLFEQEVPEIYDGTVEIVSIAREAGDRTKMAVKSNDPNIDPVGTCVGQKGARVQNVVNELGGENIDVVKYEEDPSDFIANALNPAEVIAVQFGDDEE---EKSALVIVPDYQLSLAIGKKGQNVRLAARLTGYKIDIRPES-----EVEFVDEKSDDSAKSTETTAE 364
>gi|169824466|ref|YP_001692077.1| transcription terminator [Finegoldia magna ATCC 29328] >gi|167831271|dbj|BAG08187.1| transcription terminator [Finegoldia magna ATCC 29328] (422 aa)
Score = 432, Expect = 2.3e-40, Identities = 122/341 (35%), Positives = 193/341 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLK-------ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           F++ LD++ K K   +E + + L+ AL KSY K       EN +  +EV ++ +   + L+  + VV+  ED+   + EI++ EA+ +K  Y LGD +  E+    F R        I+   L D     +Y E+ D+   II   V++V+  +V ++LG  +G++  SEQI  EE  P +     IKEVK+  TKG  IILSR D  L++ L + E+ EI+DG +EI  ++R  G +TK+A+ S    VD VG+ VG  G R+K I   LN E++D++++ +D K F+ N+  P +++   I + +     KI  ++  E+ L   IGK G N RL +KLT W IDI
  S:     5 FIKALDELEKSKKIPREVVFDALEKALIKSYEKNFDYQDHENEESSVEVNINRDNGKVNLYAIKTVVESVEDK---NTEISLEEAKAIKHKYDLGDKIKIEITPKNFGRIAAQTARNIVIQKLKDAERDNIYNEFIDREKEIITGTVQRVERGIVYIDLGRVEGIIPVSEQIKTEEYIPNKRLKLFIKEVKNT-TKGAQIILSRTDNSLIKRLFELEVPEINDGTVEIFSVAREPGSRTKIAVFSNDENVDPVGSCVGFSGTRVKSIVDELNGEKLDIVIWSKDIKTFISNSLSPSEVIATFIDEAQ-----KICRVIVSEDQLSLAIGKEGQNARLAAKLTNWKIDI 343
>gi|163796764|ref|ZP_02190722.1| Transcription elongation factor [alpha proteobacterium BAL199] >gi|159178018|gb|EDP62565.1| Transcription elongation factor [alpha proteobacterium BAL199] (517 aa)
Score = 431, Expect = 2.8e-40, Identities = 109/340 (32%), Positives = 187/340 (55%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           D +A++K   +E ++  ++ A++K+   K  PD DI   +D     I L     VV++ EDEI    +I +++AQ++  + ++G  +S  +    F R       Q++   + +    + YEE+KD+ G II   V++V+   V V +   + ++ R   +P E  + G      I++V+S+  +G  I LSR     +R L + E+ E+ DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + +DP  F+VNA  P ++  V + +D     +  + +V P+E L   IG+ G NVRL S LTGW IDI++E+
  S:    16 DVVARDKGIDREEVLIAMEQAIQKAGRSKYGPDHDIRATIDRRTGEISLKRCTTVVEEIEDEI---SQITLAQAQKIDPALEIGSVISEPLPPIDFGRIAAQTAKQVIVQKVREFERQRQYEEYKDRSGEIINGSVKRVEYGNVTVEIQRAEAILRRDRLLPRETFRQGDRIRAYIEDVRSE-PRGPQIFLSRTHPEFMRQLFRQEVPEVYDGIIEIKAVARDPGSRAKIAVISYDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSDDPATFVVNALAPAEVSKVVLHED-----AGRIEVVVPDEQLSLAIGRRGQNVRLASMLTGWDIDILTEQ 347
>gi|81428862|ref|YP_395862.1| transcription elongation factor NusA [Lactobacillus sakei subsp. sakei 23K] >gi|78610504|emb|CAI55555.1| Transcription elongation protein NusA (Transcription termination-antitermination factor NusA) [Lactobacillus sakei subsp. sakei 23K] (405 aa)
Score = 430, Expect = 3.5e-40, Identities = 118/363 (32%), Positives = 198/363 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE-KLAIEDKIEFEDVSQLV 366
           K  L  LD + +EK   KE ++  L+ AL  +Y +      ++EV  D  K +I ++  + V D+     D   E++  +A E+ K+Y++GDT+  EV    F R       Q++   + +   S +Y E+      I++  VE+ DN+ + VNLG  + V+ + +QIP E           + +V++  TKG  + +SR    L++ L + E+ EI DG +EI  I+R  G +TK+A+ S  P VD VGT VGPKG+R++ + + L+ E +D++ ++EDP  ++ NA +P +++ V+  D  +       T++ P+  L   IGK G N RL +KLTG+ IDI  E ++   D  + ED S +V
  S:     3 KEMLGALDALEQEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDQKKGNIHVYAVKEVTDEV---FDSRLEVSYQDALEINKAYEVGDTIRFEVTPKDFGRIAAQTAKQVIMQRVREAERSIIYNEYSQYENEIMQGIVERRDNKFIYVNLGKIEAVLSKQDQIPNEVYNAHDRIKVYVSKVENT-TKGPQVFVSRTHPDLVKRLFEQEVPEIYDGTVEIVSIAREAGDRTKMAVRSTDPNVDPVGTCVGPKGQRVQLVVNELHGENMDIVKWEEDPSDYIANALNPAEVIAVQFNDGNE----HTCTVIVPDYQLSLAIGKKGQNARLAAKLTGYKIDIKPESEVEFVDGDDSEDESAVV 359
>gi|69246862|ref|ZP_00604154.1| Transcription termination factor NusA [Enterococcus faecium DO] >gi|68195043|gb|EAN09506.1| Transcription termination factor NusA [Enterococcus faecium DO] (391 aa)
Score = 430, Expect = 3.5e-40, Identities = 118/346 (34%), Positives = 194/346 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  LD +  EK  SKE +++ L+ AL  +Y +      ++EV  D  K  I ++    V + +E+ +D   E+++ +A  +  +Y++GDT+  EV    F R       Q++   + +   + +Y E+     +I++  VE+ D R + VNLG  + V+ + +Q+P E  QP       +  V++  +KG  + +SR+   LLR L + E+ E+ DGI+EI  I+R  G ++KVA+ S  P +DAVGT VGPKG+R++ I + L  E +D++ ++EDP  F+ NA +P ++  +++  DE  P  K  T+V P+  L   IGK G N RL +KLT   IDI SE
  S:     3 KEMLNALDALEAEKGISKEIVIDALEAALVSAYKRHYGQAQNVEVEFDQKKGKIHVY---AVKEVTEEVMDSQLEVSLKDALLINPAYEIGDTIRFEVTPKDFGRIAAQTAKQVILQRVREAERTIIYNEFSAYEKDIMQGIVERQDKRYIYVNLGKIEAVLSKQDQMPNEFYQPHDRIKVYVSRVENT-SKGPQVFVSRSHPDLLRRLFEQEVPEVYDGIVEIVSIAREAGDRSKVAVRSNDPNIDAVGTCVGPKGQRVQAIVNELKGENMDIVEWNEDPAVFIANALNPAQV--MDVIFDETNP--KACTVVVPDYQLSLAIGKRGQNARLAAKLTNHKIDIKSE 341
>gi|77919153|ref|YP_356968.1| transcription elongation factor NusA [Pelobacter carbinolicus DSM 2380] >gi|77545236|gb|ABA88798.1| NusA antitermination factor [Pelobacter carbinolicus DSM 2380] (406 aa)
Score = 430, Expect = 3.9e-40, Identities = 115/345 (33%), Positives = 195/345 (56%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           ++++ KEK   +  +V  L++A L  +  K     D+E   +     ++LFE   VVD+    +D  KEI++ EA+E+ +  ++GD++  ++    F R       Q++   + +    K+Y E+KD+VG ++   V + +   + V+LG  +G++   EQ+P E  + G     LI EVK   TKG  IILSR   GL+  L + E+ EI++GI+EIK ++R  G +TK+A+ S  P VD VG  VG +G R++ + S L  E+ID++ +  D  +F+  +  P ++  + + +DE     + + ++ P++ L   IGK G NVRL ++LTGW+IDI SE  A E
  S:     9 IEQVVKEKGIDRGVLVEALESAVLSAANKKYRNTRDLEAHFNDGLGEVELFEFVTVVDEV---VDSYKEIDLEEAREIDEEVEVGDSLGMKIESGNFSRIAAQTAKQVIIQKVREAEREKIYNEFKDRVGELVNGIVRRYERGDLIVDLGLAEGLLPHREQVPRENYRQGDRARVLISEVKIS-TKGPQIILSRTHPGLVASLFQFEVPEIAEGIVEIKAVAREAGSRTKIAVASYDPDVDPVGACVGMRGSRVQNVVSELRGEKIDIVPWSPDVGRFVCASLAPAEVTRIYLDNDE-----QALEVIVPDDQLSLAIGKKGQNVRLAARLTGWNIDIKSETRAAE 345
>gi|23099050|ref|NP_692516.1| transcription elongation factor NusA [Oceanobacillus iheyensis HTE831] >gi|22777278|dbj|BAC13551.1| transcriptional termination-antitermination factor [Oceanobacillus iheyensis HTE831] (364 aa)
Score = 429, Expect = 4.4e-40, Identities = 116/350 (33%), Positives = 201/350 (57%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKL--FEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
             + ++ +AKEK   K+ ++  L+ AL  +Y K+N      V V+LN+E+ K+  + ++ VVD+ ED     +EI + EA+++  +Y++ D +  EV    F R       Q++T  + +     ++ E+ D+  +++   +++ D R V VNLG  +  +  SEQ+P E+          + +V++  +KG  I +SR+  GLL+ L + E+ EI DG +EIK ++R  G ++K+++ +  P +D VG+ VG +G+R++ I + L  E+ID++ + EDP  ++ NA  P K+V V + ++E     K  T+V P+  L   IGK G N RL +KLTGW IDI SE  A E+
  S:     5 LFDAIENLAKEKGIDKDILMEALEAALISAY-KKNFKSASNVRVELNEETGKMAVYARKTVVDEIEDV---QQEIPLDEAKKIDPNYEVDDVIEVEVTPKDFGRIAAQAAKQVVTQRVREAERGVIFSEYVDREEDVMTGIIQRKDPRFVYVNLGKIEAKLAESEQMPTEDYHVHDRLKVFVTKVENT-SKGPQIFISRSHPGLLKRLFEMEVPEIYDGTVEIKSVAREAGDRSKISVYAPDPEIDPVGSCVGQRGQRVQAIVTELKGEKIDIVQWSEDPVVYVSNALSPSKVVKVSVNEEE-----KSTTVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSESEAREE 346
>gi|28210959|ref|NP_781903.1| transcription elongation factor NusA [Clostridium tetani E88] >gi|28203398|gb|AAO35840.1| N utilization substance protein A [Clostridium tetani E88] (361 aa)
Score = 429, Expect = 4.7e-40, Identities = 125/345 (36%), Positives = 197/345 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK---ENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           + F+  L +I KEK  S E + N ++ AL  +Y K   +       V V +N+E+  I ++ ++ VV++ EDE +   EI + +A+ +   Y+L D V  EV  +KF R       Q++   + +     VY E+ +K  +II   V + D   V +NLG  + V+  +EQ+PGEE          I EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK ISR  G +TK+A+ S    VD++G  VGPKG R++ I + L NE+ID+I + + P +F+ NA  P +++ V++ ++     SK   ++  +  L   IGK G NVRL +KLTGW IDI S
  S:     3 EEFIVALKEIVKEKGISAELLFNTIEDALVAAYKKNYSKQGATSQHVNVSMNRETGEIHVYSRKNVVEEVEDEFN---EIFVEDAKTIDPRYELEDIVDIEVTPEKFGRVAAQAAKQVVVQRIKEEERRIVYNEFIEKECDIITGNVIRKDKTNVFINLGKIEAVLGPNEQMPGEEYNFNDKLKLYIVEVKNT-TKGAQVVVSRTHPGLVKRLFELEVPEIYNGIVEIKSISREAGSRTKIAVHSNDENVDSMGACVGPKGTRVQNIVNELKNEKIDIIKWSKLPDEFISNALSPARVLKVDVDEE-----SKSAKVLVEDNQLSLAIGKEGQNVRLAAKLTGWKIDIKS 343
>gi|163791587|ref|ZP_02185988.1| transcription elongation factor NusA [Carnobacterium sp. AT7] >gi|159873136|gb|EDP67239.1| transcription elongation factor NusA [Carnobacterium sp. AT7] (425 aa)
Score = 429, Expect = 5.0e-40, Identities = 121/346 (34%), Positives = 191/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL--DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  L+ + +EK   KE ++  L+ AL  +Y K N D   ++EV  DL K +I ++  + V D      D   E+ + EA EL K+Y+LGD +  EV    F R       Q++   + +   + +Y E+     +I++  VE+ D+R + VNLG  + V+ + EQIP E  +P       + +V++  +KG  I +SR+   LL+ L + E+ EI DG++EI  I+R  G + KVA+ SR   +D VGT VGPKG+R++ I + L  E +D++ +D DP  ++ NA +P ++V V   +      +    +V P+  L   IGK G N RL +KLTG+ IDI SE
  S:     3 KEMLNALNALEQEKGIPKEFVIEALEVALISAY-KRNYDQAQNVEVEFDLKKGNIHVYSVKEVADVV---YDSRLEVGLEEALELNKAYELGDKIRFEVTPKDFGRIAAQTAKQVIMQRVREAERNIIYNEFIAYENDIMQGIVERQDHRYIYVNLGKIEAVLSKQEQIPNEVYKPHDRIKVYVTKVENT-SKGPQIFVSRSHPDLLKRLFEQEVPEIYDGVVEIVSIAREAGDRAKVAVRSREENIDPVGTCVGPKGQRVQAIVNELKGENMDIVEWDADPATYIGNALNPAQVVSVTFNE-----AAGSCLVVVPDYQLSLAIGKRGQNARLAAKLTGYKIDIKSE 340
>gi|42519362|ref|NP_965292.1| transcription elongation factor NusA [Lactobacillus johnsonii NCC 533] >gi|41583650|gb|AAS09258.1| N utilization substance protein A-like protein [Lactobacillus johnsonii NCC 533] (406 aa)
Score = 427, Expect = 8.2e-40, Identities = 119/346 (34%), Positives = 190/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  +E    + KEK   +E IV+ +K AL  +Y K  N   ++EVV D  K + K+   + VVD+ +D      E+++ +A E+ ++Y++GD +  EV    F R       Q++   L +     +  E+      I+   VE+ DNR V V +G+ + V+  ++Q+PGE   P      L+  V S  +KG  I +SR    L++ L + E+ E+ DG +EI  I+R  G +TK+A+ S    +D VGT VGPKG R++ I + L  E IDV+ Y+++P  F+ NA +P +++ V+ + DED    K   ++ P+  L   IGK G NVRL ++LTG+ IDI  E
  S:     3 KEMVEAFATLEKEKGIKQEVIVDAIKAALVAAYKKNYNQAQNVEVVFDEKKGNFKVNAIKTVVDEVQDS---RLEVSLKDALEINRAYEVGDEIRFEVTPKDFGRLAAQTAKQVIMQRLREAEREHIISEYSQYKDEIVTGTVERRDNRFVYVKIGNVEAVMPHNDQLPGETYNPQDKVRVLVTRVGSD-SKGAQITVSRTAPDLVKRLFEQEVPEVYDGTVEIVSIAREAGDRTKIAVKSNDSDIDPVGTLVGPKGARVQNIVNELGGENIDVVKYEDNPSDFIANALNPAEVIAVQFSGDED---DKNALVIVPDYQLSLAIGKRGQNVRLAARLTGYKIDIKPE 342
>gi|42523053|ref|NP_968433.1| transcription elongation factor NusA [Bdellovibrio bacteriovorus HD100] >gi|39575258|emb|CAE79426.1| N utilization substance protein A [Bdellovibrio bacteriovorus HD100] (462 aa)
Score = 427, Expect = 8.7e-40, Identities = 117/343 (34%), Positives = 189/343 (55%)
  Q:    10 LDKIAKEKDTSKENIVN-ILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           +D++ K+K   K+ +++ I +  L  +  K     +IE   + +   ++LFE + VV + E  ID++ EI + EAQ+L  + +L D++  ++      R       QI+   + D   + ++ E++++ G I      +V+   + V+LG T+  +   EQIPGE+ +PG      + EV+ Q T+G  II+SRADE  L  L + E+ EI DG++EI   +R  G + K+A+ S+   VD VG  VG KG R++ I   L  E+ID++ +DED  +F  NA  P +I  V + D      ++ + IV P+  L   IGK G NVRL +KLT W +DIISE  A
  S:    13 IDQVGKDKGIDKQVVIDAITQGMLVAARKKYGTYREIEAAYNEDTGEVELFEFKEVVPR-EKYIDEEVEIPLDEAQKLDPNVQLDDSIGIKMEASDLGRIAAQTAKQIIMQKVRDAERNIIFNEFEERKGEIASGIARRVEKGAIVVDLGRTEAYIPPREQIPGEQYKPGDRIQGYLSEVR-QTTRGPQIIMSRADERYLMKLFEMEVPEIYDGVVEIMAAAREPGQRAKIAVRSKDNSVDPVGACVGMKGSRVQNIVQELRGEKIDIVPWDEDITRFACNALAPAEISRVFLDD-----ANREMEIVVPDSQLSLAIGKRGQNVRLAAKLTTWKLDIISESSA 349
>gi|57234284|ref|YP_181708.1| transcription elongation factor NusA [Dehalococcoides ethenogenes 195] >gi|57224732|gb|AAW39789.1| N utilization substance protein A [Dehalococcoides ethenogenes 195] (491 aa)
Score = 426, Expect = 1.0e-39, Identities = 115/368 (31%), Positives = 208/368 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN--PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQP 373
           FL  + +++ EK+  KE ++  +++AL  +Y KE+  P+ +I V +D     +K+  +++VV+K     D  +E+ + EA+ LK   K+GD +  E       R       Q++   L++  N+ +++E+  K G+ +   V++++ + + V++G  + ++  SEQ  GE  + GQ     + +V ++  KG  +I+SR+  GL+R L + E+ E+ + ++EIK ++R  G ++KVA+ +  PG+D VG  VG +G RI+ I S LN E+IDV+ +D +   F+ N+  P ++  V + + E     K   +V P+  L   IGK G NVRL  KLTGW IDI   K A ++++E  + +     +T +P
  S:     5 FLLAITQLSAEKNLPKEVVLATVESALVSAYRKESFAPNQNIAVKIDQLTGKVKVMAEKLVVEKV---TDSRQEMRLLEAKRLKADAKIGDLMMVEDTPADAGRIAAQTAKQVILQRLHEAENTAIFDEYASKAGDTLVGVVQRIEPKQITVDIGRVEAIMPASEQAYGERYRAGQRIKVYVVDV-AKTAKGPAVIVSRSHPGLVRRLFEMEVPEVFNQLVEIKAVAREAGSRSKVAVGALQPGIDPVGCCVGLRGIRIQNIVSELNGEKIDVVAWDSEIANFIANSLSPAQVTKVILNEAE-----KSAIVVIPDRQLSLGIGKEGQNVRLAVKLTGWRIDI---KSASDEEVERAEETARKQGETEKP 362
>gi|182678035|ref|YP_001832181.1| NusA antitermination factor [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633918|gb|ACB94692.1| NusA antitermination factor [Beijerinckia indica subsp. indica ATCC 9039] (538 aa)
Score = 425, Expect = 1.2e-39, Identities = 106/344 (30%), Positives = 196/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   ++ ++  ++ A++K+  +     + EV  ++N ++ ++   R++     DEID+D  +I ++EA++   + +LGD ++  +    F R       Q++   + +    + Y+E+KD++G+I+   V++V+   V ++LG  +  + R E IP E  +PG      + +V+ +Q +G  I LSR     +  L + E+ EI DG+IE+K ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++V V + +D     S  + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKSIDRQIVLASMEDAIQKA-ARSRYGQETEVRAEINPKTGEIRFSRLL--HVVDEIDNDAVQITLAEARKKNPAAELGDWIAETLPPFDFGRIAAQSAKQVIVQKVREAERDRQYQEYKDRIGDIVNGVVKRVEYGNVIIDLGRGEATIRRDEMIPREVFRPGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMAKLFRQEVPEIYDGVIEVKAVARDPGSRAKIAVISRDTSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDAATFIVNALQPAEVVKVVLDED-----SARIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 345
>gi|83589895|ref|YP_429904.1| NusA antitermination factor [Moorella thermoacetica ATCC 39073] >gi|83572809|gb|ABC19361.1| NusA antitermination factor [Moorella thermoacetica ATCC 39073] (362 aa)
Score = 425, Expect = 1.3e-39, Identities = 109/347 (31%), Positives = 197/347 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           F++ L  + +EK  + + ++  ++ AL  +Y K    L   V VD+ +++  IK+  +R VV   E+  D  +EI++ EA+ +   Y+LGD V  EV    F R       Q++   + +     +YEE+  +  +++   V++ + + + ++LG  + ++L SEQ PGE  + G+     + EV+ +  KG  I++SR   GL++ L + E+ EI DGI+EIK ++R  G ++K+A+ SR   VD VG+ VGPKG R++ +   L  E++D+I + +DP  ++ N+  P +++ V + ++     +K+  ++ P+  L   IGK G N RL +++TGW IDI  E  A
  S:     5 FIQALRDLEREKGINADILLEAIEAALISAYKKNFGSLQ-NVRVDIQRDTGEIKVLAQRQVV---EEVTDPRQEISLEEARAINSKYELGDIVEKEVTPRDFGRIAAQTAKQVVVQRIREAERGLIYEEFIGRENDLVTGVVQRQEGKNIILDLGRAEAILLPSEQSPGETYRQGERLKVYVLEVR-KTNKGPQILVSRTHPGLIKRLFELEVPEIHDGIVEIKGVAREPGARSKIAVHSRDEKVDPVGSCVGPKGARVQAVVQELRGEKVDIIKWSDDPAVYVANSLSPARVLDVTVDEE-----NKVSQVIVPDNQLSLAIGKEGQNARLAARITGWKIDIKPESEA 343
>gi|85860522|ref|YP_462724.1| transcription elongation factor NusA [Syntrophus aciditrophicus SB] >gi|85723613|gb|ABC78556.1| transcription elongation factor [Syntrophus aciditrophicus SB] (420 aa)
Score = 425, Expect = 1.3e-39, Identities = 113/342 (33%), Positives = 194/342 (56%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEA-QELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKL 351
           ++++ K++   K  I+  L+TA+  +  K+    +DIE   +     I++F+ + VV+K    +D D +I+I  A ++L +  + GD++  +++   F R       QI+   + D     VY+E+KD+ G ++   V++ +   + VNLG  +GV+  SEQI  E  + G      I EVK + +KG  IILSR     L+ L + E+ EI++G+IE+  ++R  G + K+A+ ++   +D VG  VG +G R++ +   L  E+ID+I Y EDP Q++++A  P K+  V + ++E       + +V P++ L   IGKNG NVRL  KLTGW ID+ SE +
  S:     9 IEQMGKDRGLDKSVIIEALETAMLTAARKKLGAHVDIEAHYNDELGEIEVFQFKTVVEKV---VDPDMQISIEAAHRDLDEEAEPGDSLGMKIDASTFGRIAVQTAKQIIVQRVKDAERDNVYDEYKDRKGELVNGFVQRFEAGSIIVNLGRAEGVIPVSEQIHREVYKRGDRIRSYICEVK-KVSKGPQIILSRTHPNFLKALFEVEVPEIAEGLIEVLGVAREPGKRAKIAVRTKDKDIDPVGACVGMRGARVQSVVQELRGEKIDIIPYSEDPSQYVISALSPAKVSHVTVYENE-----HAMEVVVPDDQLSLAIGKNGQNVRLAVKLTGWKIDVKSESV 343
>gi|160880908|ref|YP_001559876.1| NusA antitermination factor [Clostridium phytofermentans ISDg] >gi|160429574|gb|ABX43137.1| NusA antitermination factor [Clostridium phytofermentans ISDg] (354 aa)
Score = 425, Expect = 1.5e-39, Identities = 115/346 (33%), Positives = 192/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEA--QELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  +E L++I KEKD SKE +++ ++ +L  +        D I+V +D    ++ +F +RVVV++ +D +    EI+++EA  +  K  Y+LGD V  EV    F R       Q++   + +     ++ ++  +  +I+   V++     V +NLG    V++ +EQI GE  +P       + EVK   TKG  I +SR    L++ L + E++E+ +GI+EIK ISR  G +TK+A+ S  P VD VG  VG  G R+  I + L  E+ID++ + +DP + + NA  P K+V V++++     G     ++ P+  L   IG+ G N RL ++LTG+ IDI SE
  S:     5 KELIEALNQIEKEKDISKEVLLDAMENSLVAACKNHFGKADNIKVYIDRTTGAVSVFAERVVVEQVQDPV---LEISLAEATMKFPKGKYELGDIVQVEVTPKNFGRIAAQKAKQVVVQKIREEERKVLFNQYYGREKDIVTGIVQRYVGNNVSINLGKVDAVLMENEQIKGEHFRPTDRIKLYVLEVKDT-TKGPKITVSRTHPELVKRLFEAEVTEVKEGIVEIKSISREAGDRTKMAVSSNDPNVDPVGACVGLNGARVNAIVNELGGEKIDIVNWSDDPAELIENALSPAKVVSVDVSE-----GEMSAKVIVPDYQLSLAIGRQGQNARLAARLTGYKIDIKSE 344
>gi|172057849|ref|YP_001814309.1| NusA antitermination factor [Exiguobacterium sibiricum 255-15] >gi|171990370|gb|ACB61292.1| NusA antitermination factor [Exiguobacterium sibiricum 255-15] (375 aa)
Score = 425, Expect = 1.5e-39, Identities = 118/367 (32%), Positives = 201/367 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQ-QTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQ 372
            LE +++IAKEK+  K  I++ L+ AL  +Y +        V V+ ++++  I++F  + VV++       ++++++ EA E+  +Y+LGD    EV    F R       QI+T  + +    ++Y  + D+   I+   VE+ D R + VNL   + V+   EQ+P E     +     + +V    +  G  I++SR   GLL+ L + E+ EI+ G +E+K ++R  G ++K+A+ S    +D VG  VG KG R+++I + LN E+ID++ Y +DPK+++ NA  P ++V V + +      +K   +V P+  L   IGK G N RL +KLTGW IDI SE  A  + +E +DV   V   T +
  S:     5 LLEAIEQIAKEKEIDKNIIIDALEQALISAYRRNFGKESEAVKVEFDQQTGDIRVFALKEVVERLTQP---EEQLSLEEAHEIDPTYELGDFHKVEVTPGDFGRVAAQTAKQIVTQKMREAERERIYNHFADREDEIMTGMVERQDARNLYVNLEGIEAVLTTHEQMPNERFGIREYIKVYVTKVDPMVKGSGASILVSRTHPGLLKRLFEIEVPEIASGEVEVKSVAREAGDRSKIAVAS--DEIDPVGACVGQKGARVQRIVNELNGEKIDIVRYSDDPKEYVANALSPAQVVAVYVNEP-----AKATIVVVPDFQLSLAIGKRGQNARLAAKLTGWKIDIKSESEA--ESMELKDVFMKVEPATAE 362
>gi|158523046|ref|YP_001530916.1| transcription elongation factor NusA [Desulfococcus oleovorans Hxd3] >gi|158511872|gb|ABW68839.1| NusA antitermination factor [Desulfococcus oleovorans Hxd3] (475 aa)
Score = 425, Expect = 1.5e-39, Identities = 115/351 (32%), Positives = 195/351 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKL 351
           M I+     +++++++K   ++ +V  L+ A++ +  K     +DIE + D +   I++F+ + VV+  +D    D +I   E + L    +LGD++  +++   F R       Q++   + +   S VY+ + +K G II   V +++   V VN+G  + ++   EQIPGE  + G      + +V  ++T G  IILSRA    +  L KTE+ EIS+GII IK I+R  G +TK+A++S    +D VG  VG +G RI+ +   L  E+ID++ ++ DP +F+ NA  P +I  V I +D     +  + I+ P+ES    IG+ G NVRL SKLTGW +D+ SE +
  S:     1 MIIQDVKRVVEQVSRDKGIDRDTLVKALEEAIKSAARKRYGAAIDIETMYDEDTGEIEIFQFKEVVETVQDP---DLQITFVEGRALDPECELGDSLGVKMDTQSFGRIAAQSAKQVIIQKMREAERSAVYKNFVEKEGEIINGIVSRMERGNVIVNIGEAEAILNSREQIPGEGYRRGDRVRANVMKVL-EETAGPQIILSRAHPDFVVNLFKTEVPEISEGIITIKAIAREAGGRTKIAVVSNDMDIDPVGACVGVRGNRIQNVVKELKGEKIDIVPWNPDPAKFVCNALSPAEIARVIIDED-----NAAMEIIVPDESHSLAIGRRGQNVRLASKLTGWHLDVQSESI 343
>gi|29375840|ref|NP_814994.1| transcription elongation factor NusA [Enterococcus faecalis V583] >gi|29343302|gb|AAO81064.1| N utilization substance protein A [Enterococcus faecalis V583] (399 aa)
Score = 424, Expect = 1.8e-39, Identities = 115/346 (33%), Positives = 193/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  LD +  EK   K+ ++  L+ AL  +Y +      ++EV  +  K +I ++    V + +E+  D   E+++ +A  L  +Y++GD +  EV    F R       Q++   + +   + +Y E+ +   +I++  VE+ D R + VNLG  + V+ + +Q+P E  QP       +  V++  +KG  + +SR+   LL+ L + EI E+ DGI+EI  ++R  G ++KVA+ S  P +D VGT VGPKG+R++ I + L  E +D++ ++EDP  ++ NA +P +++ V I D E+   SK  T+V P+  L   IGK G N RL +KLTG  IDI SE
  S:     3 KEMLNALDVLEAEKGIPKDTVIEALQAALVSAYKRHYGQASNVEVEFEPKKGNIHVY---AVKEVTEEVFDSQLEVSLKDAVALNGAYEIGDKIRFEVTPKDFGRIAAQTAKQVILQRVREAERTIIYNEFSEYENDIMQGIVERQDRRYIYVNLGKIEAVLSKQDQMPNEFYQPHDRIKVYVSRVENT-SKGPQVFVSRSHPDLLKRLFEQEIPEVYDGIVEIVSVAREAGDRSKVAVRSTDPNIDPVGTCVGPKGQRVQAIVNELKGENMDIVEWNEDPAIYISNALNPAQVLDV-IFDPEN---SKACTVVVPDYQLSLAIGKRGQNARLAAKLTGHKIDIKSE 341
>gi|153954053|ref|YP_001394818.1| transcription elongation factor NusA [Clostridium kluyveri DSM 555] >gi|146346934|gb|EDK33470.1| NusA [Clostridium kluyveri DSM 555] (355 aa)
Score = 424, Expect = 1.9e-39, Identities = 120/346 (34%), Positives = 201/346 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN-----PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           + F+E L +I KEK  S++ +   ++ AL  +Y K        + +++V ++     I ++ ++ +VD   + +DD  EI++ +A+E+  +Y +GD V+ EV   KF R       Q++   + +     +Y ++ +K  +II   V + D   + VNLG T+ ++  +EQIPGE+          I EVK+  TKG  I++SR   GL++ L + E+ E+ DG ++IK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L +E+ID+I + + P++++ NA  P K+  +++T DE+I   K   IV  +  L   IGK G NVRL +KLTGW IDI S+
  S:     3 QEFIEALKEIVKEKGISEDLLFTTIEDALVAAYKKNYIGHGISNQNVKVTMNRENGEIHVYSQKSIVD---NVVDDVSEISLEDAKEIDSNYDMGDIVNIEVTPRKFGRVAAQAAKQVVIQRIKEEERRIIYNDFVEKEDDIITGTVIRKDKNNILVNLGKTEAILGPNEQIPGEKYNFNDKLKLYIVEVKNT-TKGAQIVISRTHPGLIKRLFELEVPEVFDGTVDIKSIAREAGSRTKIAVHSNDENVDPMGACVGPKGVRVQNIVNELKSEKIDIIKWSKLPEEYIANALSPAKV--LDVTLDEEI---KFAQIVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSK 344
>gi|187605328|ref|ZP_02991526.1| NusA antitermination factor [Exiguobacterium sp. AT1b] >gi|187482574|gb|EDU20580.1| NusA antitermination factor [Exiguobacterium sp. AT1b] (387 aa)
Score = 423, Expect = 2.2e-39, Identities = 119/344 (34%), Positives = 191/344 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE--NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNL-GSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQ-QTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L  +D+IAKEK   K  I++ L+ AL  +Y +   NP+  ++V  D     I+++    VV++       D+++++ EA E+  +Y+LGD    EV    F R       Q++T  + +    ++Y  + DK   I+   VE+ D R + + L  + + V+  +EQ+P E  Q        + +V S  +  G  I +SR   GLLR L + E+ EIS+G +++  +SR  G ++K+A+ S +  VD VG  VGPKG+R++ I   LN E+ID++ + EDPK+F+ NA  P ++V V + +      +K  T+V P+  L   IGK G N RL +KLTGW IDI SE
  S:     5 LLTTIDQIAKEKGIDKNIIIDALEQALISAYRRNVANPNEHVKVEFDQVTGDIRVYALLEVVERLTQP---DQQLSLEEAHEIDPNYELGDFHKEEVTPSDFGRVAAMTAKQVVTQKMREAERERIYNHFADKEDEIMTGIVERFDPRNLYIGLENNIEAVLTPNEQMPNESYQIHDRIKVYVTKVDSTTKGSGAAIQVSRTHPGLLRRLFELEVPEISNGTVDVMSVSREAGDRSKIAVHSDI--VDPVGACVGPKGQRVQTIVDELNGEKIDIVRWSEDPKEFVRNALSPAQVVAVYVNEP-----AKSTTVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSE 342
>gi|163762559|ref|ZP_02169624.1| Transcription elongation factor-like protein [Bacillus selenitireducens MLS10] >gi|160357298|gb|EDP83946.1| Transcription elongation factor-like protein [Bacillus selenitireducens MLS10] (396 aa)
Score = 423, Expect = 2.2e-39, Identities = 119/352 (33%), Positives = 200/352 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           F++ L  I K+K   KE I+  ++ AL   Y K N +    V VD+++ES  I++F ++ VV   E+  D   EI+  EA+ +   Y++ D V  EV    F R       Q++T  + +     +Y ++ D+  +I+   V++ D+R + V+LG  + ++  +EQ+P E  +        I +V+ + TKG  I++SR+  GLL+ L + E+ EI DG +E+K +SR  G ++K+++ +    +D VG+ VG +G+R++ I   L  E+ID++ + EDPK ++ NA  P K+V V + +++     K+ T++ P+  L   IGK G N RL +KLTGW IDI SE  A E  I
  S:     5 FMDALASIEKDKGIDKEIILEAIEQALITGY-KRNFNSAQNVRVDIDRESGQIRVFARKTVV---EEVFDARLEISQEEAKGINPHYEVDDIVEIEVTPRDFGRIAAQTAKQVVTQRVREAERGIIYSDFIDREEDIMTGIVQRQDHRFIYVDLGKVEALMPLNEQMPNETYRHNDRIKAFITKVE-KTTKGPQIMISRSHPGLLKRLFELEVPEIYDGTVEVKSVSREAGERSKISVHAEDEDIDPVGSCVGQRGQRVQTIVDELKGEKIDIVRWSEDPKVYVSNALSPSKVVDVLVNEEQ-----KMTTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSESEAEESGI 348
>gi|154485019|ref|ZP_02027467.1| hypothetical protein EUBVEN_02737 [Eubacterium ventriosum ATCC 27560] >gi|149733972|gb|EDM50091.1| hypothetical protein EUBVEN_02737 [Eubacterium ventriosum ATCC 27560] (408 aa)
Score = 423, Expect = 2.6e-39, Identities = 119/356 (33%), Positives = 196/356 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEF 359
           K  +E L+ + KEKD SKE++   ++  L  +Y    N   ++ V +D       ++ ++ VV   E+ +D   EI++ +A+ +K +Y+LGD V+ E+    F R  T      +   + +     +YE++ +K  +I+   V++++ + + VNLG    V++  EQ  GE  +P +     I EVK    +G  I++SR   GL++ L + E++EI DG +EIK I+R  G +TK+A+ S    VDAVG  VG  G R+  +   L +E+ID++ + E+P   + NA  P K+V V + D    P +K   +V P+  L   IGK G N RL +KLTG+ IDI SE  A E+ I++
  S:     3 KELIEALNILEKEKDISKESLFEAIENNLVVAYKNNFNKADNVTVTMDRETGDFHIYSQKEVV---EEVMDPVTEISLEDARSIKGTYELGDIVNIEIQSKDFGRIATQSAKNGILQKIREEERKSLYEQYFEKQDDIVTGIVQRINGKNISVNLGKVDTVLMEKEQAKGEHFRPTERIKLYITEVKDN-GRGPRIVVSRTHPGLVKRLFEQEVTEIQDGTVEIKSIAREAGSRTKMAVWSNNEDVDAVGACVGVNGARVNAVVDELRDEKIDIVNWSENPAILIENALSPSKVVAV-LAD----PDNKEALVVVPDFQLSLAIGKEGQNARLAAKLTGFKIDIKSESQAKEEGIQY 350
>gi|108804247|ref|YP_644184.1| NusA antitermination factor [Rubrobacter xylanophilus DSM 9941] >gi|108765490|gb|ABG04372.1| NusA antitermination factor [Rubrobacter xylanophilus DSM 9941] (381 aa)
Score = 423, Expect = 2.7e-39, Identities = 94/249 (37%), Positives = 148/249 (59%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQS---YLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAI 353
           F R   S   Q     LN++ N ++ +E+ +++G+++   V++   R+  ++LG  + ++  SEQ+PGE  + GQ    YL  IKE      +G  II+SR  EGLLR L + E+ EI DG++EIK ++R  G ++KVA+ S  PG+D VG  VGP+G R++ + S L NE+ID+I +D DP +F+  A  P ++  V + ++E     K   ++ P++ L   IG+ G N RL  KLT W IDI  E  A+
  S:    72 FTRIAASLMRQNFMQRLNEVHNQQLVKEYGERIGDVVTGIVQQAHRRMTIIDLGRVEALLPASEQVPGERYENGQRLKVYLLDIKEAG----RGPSIIVSRRHEGLLRGLFELEVPEIYDGLVEIKAVAREAGLRSKVAVWSNEPGIDPVGACVGPRGSRVRAVVSELRNEKIDIIQWDPDPARFIAKALSPARVREVYLDEEE-----KQAEVIVPDDQLSLAIGREGQNARLAVKLTDWKIDIKPESQAV 314
>gi|150021290|ref|YP_001306644.1| transcription elongation factor NusA [Thermosipho melanesiensis BI429] >gi|149793811|gb|ABR31259.1| NusA antitermination factor [Thermosipho melanesiensis BI429] (344 aa)
Score = 422, Expect = 3.0e-39, Identities = 112/341 (32%), Positives = 191/341 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           FL+ L+++ +EK    + I+ I++ AL  +Y K+   + ++E+ ++     I+L++   VVDK E E     +I++ +A ++  + K+GDT+   +N+ KF R       Q+L   + +I   K +E++ +  G I  AEV ++     ++ +G  +  + + E IPGE ++P  S + +  +   +  KG  I+++R +E  ++ LL+ E+ EI   ++EI +I R  G +TKVA+ S  P VD VG  +G +G RI  I   L  E++D+I + +DPK+ + +A  P  +V VEI D    P +K   I+ P   L   IGK G N RL +KLTGW IDI
  S:     5 FLQALEQLEEEKGIKVDEIIPIIEKALVSAYKKDFGGEKNVEITINRQTGEIELYQLLEVVDKVEKET---TQISLEDALKISSNAKIGDTIRKRINVKKFGRIAAQTAKQVLIQRIREIEKEKQFEKYSELAGKITTAEVIRITKEWADIRIGKLETRLPKKEWIPGETIEPA-SLIKVYVKDVKKDKKGPKILVTRINEEFIKGLLELEVPEIESKVVEIVKIVREPGIRTKVAVKSNNPKVDPVGACIGEEGVRIAAILRELKGEKLDIIKWSDDPKELIASALQPANVVEVEILD----PENKASRIIVPPTQLSLAIGKGGQNARLAAKLTGWKIDI 338
>gi|114571580|ref|YP_758260.1| transcription elongation factor NusA [Maricaulis maris MCS10] >gi|114342042|gb|ABI67322.1| NusA antitermination factor [Maricaulis maris MCS10] (572 aa)
Score = 422, Expect = 3.0e-39, Identities = 115/353 (32%), Positives = 204/353 (57%)
  Q:    13 IAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           +A EK   +  ++  ++ A++K+    Y  EN   DI   +D     + L     VV++ E+   D +E+ +++A+++ K+ ++G   S E+   +F R  +    Q++T  + +    + +EE+KD+VG II   V++V+   V ++LG  + ++ R++ IP E LQ  +     I +V+ ++ +G  I LSRA    +  L   E+ E+ +GIIEI  ++R  G + K+A++S    +D VG  VG +G R++ + S L  E+ID+I + +DP  F+VNA  P ++  V + D+ED    + + +V P+E L   IG+ G NVRL S+LTGWSIDI++E+   E +  EF + +Q+
  S:    19 VAAEKSIDESIVIEAIEEAIQKAARSRYGAEN---DIRAKIDPKTGELSLTRNMTVVEEVEN---DSQELTLADAKKIDKTAEIGTVFSDELPPIEFGRVASQTAKQVITQKVREAERQRQFEEYKDRVGEIISGIVKRVEYGNVIIDLGRAEAIIRRADGIPRENLQNNERVRAYIYDVR-EEVRGPQIFLSRAHPDFMAALFAQEVPEVYEGIIEIPSVARDPGSRAKIAVISNDGSIDPVGACVGMRGSRVQAVVSELAGEKIDIIPWSDDPATFIVNALQPAEVAKV-VLDEED----QRIEVVVPDEQLSLAIGRRGQNVRLASQLTGWSIDILTEEEESERRQKEFAERTQI 364
>gi|117927003|ref|YP_867620.1| NusA antitermination factor [Magnetococcus sp. MC-1] >gi|117610759|gb|ABK46214.1| NusA antitermination factor [Magnetococcus sp. MC-1] (506 aa)
Score = 422, Expect = 3.4e-39, Identities = 110/344 (31%), Positives = 191/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDE---IDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+  D++A+EK   ++ ++  +++A++ +  K+   + +I+   D      +L + R VVD  +DE    D+D  I++ +A  +      GD ++ ++   +F R       Q++   + D    +++EE+ D+ G ++   V++V+   + V+LG T G +   EQ+P E  +PG      IKEV+ + T+G  IILSR    ++  L + E+ EI DGI+EIK ++R  G+++K+A+ S    VD VG  VG +G R++ + + L  ERID+I +  DP  F+ NA  P      E+         + + +V  E +L   IG+ G NVRL S+LTGW IDII+E+
  S:     6 LQVADQVAREKGIDRKVVIEAMESAIQTASRKKYGANKNIQARFDPKSGEFQLNQLREVVDLDQDEDLDFDEDIHISLEKALTMNPEAVPGDFIAEQLPPMEFGRIAAQTAKQVIVQKVRDAERERIFEEYADRQGEMVNGLVKRVERNNIHVDLGRTSGFLPHEEQLPREHYRPGDRIRAFIKEVR-EVTRGPQIILSRTHPQMVVRLFEMEVPEIYDGIVEIKAVARDPGHRSKIAVRSNDAHVDPVGACVGMRGSRVQSVVTELQGERIDIIEWSHDPAVFVCNALAP-----AEVVKVVVDEEDRNIKVVVDETALSLAIGRRGQNVRLASELTGWRIDIITEQ 347
>gi|188588167|ref|YP_001920615.1| transcription termination factor NusA [Clostridium botulinum E3 str. Alaska E43] >gi|188498448|gb|ACD51584.1| transcription termination factor NusA [Clostridium botulinum E3 str. Alaska E43] (384 aa)
Score = 420, Expect = 5.0e-39, Identities = 119/346 (34%), Positives = 203/346 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIE---VVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           + F+  L +I KEK  S++ +   ++ A+  +Y K   +L+     V + +N+E+  I ++ +++VVD+  DE+    EI++ EA+ +   Y++ D V  EV    F R       Q++T  + +   + +Y E+K+K  +II   + + D  +V V+LG  +G++  +EQ+  E+ +  +     I EVK+  +KG  + +SR   GL++ L + E+ EI +G++EIK ISR  G ++K+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I + +DP +F+ NA  P K++  E+ ++     SK   IV  ++ L   IGK G NVRL +KLT W IDI S+
  S:     3 EEFVGALKEIVKEKGISEDLLFTTIEDAMVAAYKKNYANLNTSAQNVKISINRENGEIHVYAQKMVVDEVYDEV---TEISLEEAKAINPKYEVDDIVDLEVTPKNFGRVAAQLAKQVVTQRIKEAERNIIYSEYKEKEFDIITGTILRKDKGMVFVSLGKIEGIIGPNEQMSNEDYRFNEMLKLYIVEVKNT-SKGAQVHVSRTHPGLVKRLFELEVPEIFNGVVEIKSISREAGSRSKIAVYSNDEEVDAMGACVGPKGVRVQNIVNELKNEKIDIIKWSKDPAEFISNALSPAKVINAEVNEE-----SKSAKIVVADDQLSLAIGKEGQNVRLAAKLTNWKIDIKSK 344
>gi|187934771|ref|YP_001885468.1| transcription termination factor NusA [Clostridium botulinum B str. Eklund 17B] >gi|187722924|gb|ACD24145.1| transcription termination factor NusA [Clostridium botulinum B str. Eklund 17B] (384 aa)
Score = 420, Expect = 5.2e-39, Identities = 119/346 (34%), Positives = 204/346 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIE---VVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           + F+  L +I KEK  S++ +   ++ A+  +Y K   +L+     V + +N+E+  I ++ +++VVD+  DE+    EI++ EA+ +   Y++ D V  EV    F R       Q++T  + +   + +Y E+K+K  +II   + + D  +V V+LG  +G++  +EQ+  E+ +  +     I EVK+  +KG  + +SR   GL++ L + E+ EI +G++EIK ISR  G ++K+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I +++DP +F+ NA  P K++  E+ ++     SK   IV  ++ L   IGK G NVRL +KLT W IDI S+
  S:     3 EEFVGALKEIVKEKGISEDLLFTTIEDAMVAAYKKNYANLNTSAQNVKISINRENGEIHVYAQKMVVDEVYDEV---TEISLEEAKAINPKYEVDDIVDLEVTPKNFGRVAAQLAKQVVTQRIKEAERNIIYSEYKEKEFDIITGTILRKDKGMVFVSLGKIEGIIGPNEQMSNEDYRFNEKLKLYIVEVKNT-SKGAQVHVSRTHPGLVKRLFELEVPEIFNGVVEIKSISREAGSRSKIAVYSNDEEVDAMGACVGPKGIRVQNIVNELKNEKIDIIKWNKDPAEFISNALSPAKVISAEVNEE-----SKSAKIVVADDQLSLAIGKEGQNVRLAAKLTNWKIDIKSK 344
>gi|165976050|ref|YP_001651643.1| transcription elongation factor NusA [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149948|ref|YP_001968473.1| transcription elongation protein NusA [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165876151|gb|ABY69199.1| transcription termination-antitermination factor, N utilization substance protein A [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915079|gb|ACE61331.1| transcription elongation protein NusA [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (493 aa)
Score = 419, Expect = 6.9e-39, Identities = 110/345 (31%), Positives = 199/345 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+TAL  S  K+   D+D+ VV+D      + F + +VV++  +     +EI++  AQ    S +LGD V  EV+   F+R       Q+++  + +   +KV E+++ ++  II A V+KV+   + ++LG+  + V++R + +P E  +PG     ++  +K + +KG  + L+RA   +L  L K E+ EI + +IEIK  SR  G + K+A+ S    +D VG  VG +G R++ IS+ L  ER+D++L+D++P QF++NA  P ++  + + +D+       + I    ++L + IG+NG NVRL ++LTGW++++++
  S:     3 KEILLAAEAVSNEKLLPKEAIFEALETALAISTKKKKEMDIDVRVVIDRKTGDFQTFRRWIVVEQVHNMT---REISLEAAQYENPSVQLGDIVEDEVDSIPFDRITMQTARQVISTKIREAERNKVIEQFRSQLNTIITATVKKVNREQIILDLGNQAEAVIVREDMLPRENFRPGDRVRGVLYAIKPE-SKGPQLFLTRAKPVMLEELFKLEVPEIGEDVIEIKGASRDPGSRAKIAVKSHDKRIDPVGACVGMRGARVQAISNELGGERVDIVLWDDNPAQFVINAMAPAEVSAIVVDEDK-----HAMDIAVEGKNLAQAIGRNGQNVRLATQLTGWTLNVMT 340
>gi|32033691|ref|ZP_00133986.1| COG0195: Transcription elongation factor [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208120|ref|YP_001053345.1| transcription elongation factor NusA [Actinobacillus pleuropneumoniae L20] >gi|126096912|gb|ABN73740.1| transcription elongation protein NusA [Actinobacillus pleuropneumoniae L20] (493 aa)
Score = 418, Expect = 8.0e-39, Identities = 110/345 (31%), Positives = 199/345 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+TAL  S  K+   D+D+ VV+D      + F + +VV++  +     +EI++  AQ    S +LGD V  EV+   F+R       Q+++  + +   +KV E+++ ++  II A V+KV+   + ++LG+  + V++R + +P E  +PG     ++  +K + +KG  + L+RA   +L  L K E+ EI + +IEIK  SR  G + K+A+ S    +D VG  VG +G R++ IS+ L  ER+D++L+D++P QF++NA  P ++  + + +D+       + I    ++L + IG+NG NVRL ++LTGW++++++
  S:     3 KEILLAAEAVSNEKLLPKEAIFEALETALAISTKKKKEMDIDVRVVIDRKTGDFQTFRRWIVVEQVHNMT---REISLDAAQYENPSVQLGDIVEDEVDSIPFDRITMQTARQVISTKIREAERNKVIEQFRSQLNTIITATVKKVNREQIILDLGNQAEAVIVREDMLPRENFRPGDRVRGVLYAIKPE-SKGPQLFLTRAKPVMLEELFKLEVPEIGEDVIEIKGASRDPGSRAKIAVKSHDKRIDPVGACVGMRGARVQAISNELGGERVDIVLWDDNPAQFVINAMAPAEVSAIVVDEDK-----HAMDIAVEGKNLAQAIGRNGQNVRLATQLTGWTLNVMT 340
>gi|171913143|ref|ZP_02928613.1| transcription elongation factor NusA [Verrucomicrobium spinosum DSM 4136] (417 aa)
Score = 418, Expect = 8.2e-39, Identities = 112/336 (33%), Positives = 185/336 (55%)
  Q:    15 KEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           KEK   +  +V+ L++AL  +  K   P  ++ + +D +K SI+ F + +V D  E+  +   ++++  A++LK   + GD V  EV    F R       Q     L +   + +Y+E+KD+ G+++   + + D   V V+LG  +G++   E++P E+   G    F +K V+   ++G  IILSR+    +R L + E+SEI+D  +EI  I+R  GY+TKVA+ S    VD VG  VG +G R+K I   LNNE++D+I + +D  +F   A  P KI+ +++ +D      K V +   EE L K IG+ G N RL S+L G+  D++ EK
  S:    14 KEKGIDRSKMVDALQSALLAASKKSIGPARELRIEIDPDKGSIRAFARLLVSDTVENPFE---QLSVKHARKLKADAQPGDEVDIEVTPKDFGRIAAQTAKQTWMQRLREAEKANLYDEFKDRTGDVVSGTIRRFDKSDVVVDLGKFEGIMTSRERVPTEDYTSGDRMRFYVKAVEKSTSRGPEIILSRSHPNFVRRLFEFEVSEIADRTVEIVSIAREAGYRTKVAVHSADDKVDPVGACVGLRGARVKNIVRELNNEKVDIIRWSKDVAEFTKEALKPIKILSIKVDEDH-----KRVLLTVSEEELSKAIGRKGQNARLTSRLIGY--DLVIEK 340
>gi|160947563|ref|ZP_02094730.1| hypothetical protein PEPMIC_01498 [Peptostreptococcus micros ATCC 33270] >gi|158446697|gb|EDP23692.1| hypothetical protein PEPMIC_01498 [Peptostreptococcus micros ATCC 33270] (378 aa)
Score = 418, Expect = 8.5e-39, Identities = 116/341 (34%), Positives = 188/341 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           FL  LD+I +EK  SKE I + L+ AL KSY K   + + +++ ++     ++LF  + VV+  ED I    EI++ +A+ +   Y LGD VS ++    F R        I+   + D     +Y +++DK   +I  +++++D   + +NLG  + +V   EQI  E  + G+   F +KEVK+   KG  ++LSR+D   +  L + E+ EI DG +EI+ I+R  G +TK+A+ S+   VD VG  VG K  R+  I   L  E+ID+I+Y ++ K++L N+  P +++ V   + E+        I+ P+  L   IGK G N RL +KLT W IDI
  S:    14 FLRALDEIEREKGVSKEIIFDSLEKALLKSYEKNFGEYENVKININRTTGKVELFAIKTVVEVVEDNI---TEISLDDAKAISTKYSLGDEVSIKLKTMDFGRVAAQTARNIVIQKIKDAEREVIYNDFQDKERELISGQIQRIDRNNLFINLGKLEAIVTPPEQIKSEVYRVGERLKFYVKEVKNT-PKGAQVLLSRSDVNFVLKLFELEVPEILDGTVEIQSIAREPGSRTKIAVFSKNDDVDPVGACVGYKRSRVSSIIKELKGEKIDIIVYSKNVKEYLSNSLSPSEVIAVFTNESEN-----RARIIVPDSQLSLAIGKEGQNARLAAKLTNWRIDI 346
>gi|118590498|ref|ZP_01547900.1| transcription elongation factor NusA [Stappia aggregata IAM 12614] >gi|118436961|gb|EAV43600.1| transcription elongation factor NusA [Stappia aggregata IAM 12614] (551 aa)
Score = 417, Expect = 1.1e-38, Identities = 121/426 (28%), Positives = 222/426 (52%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDD 431
            L+  D +A+EK   +  ++N ++ A++K+  +     + EV  ++N ++ ++  +R+  VVD  E+   D   I++ +AQ       +GD ++  +    F R       Q++   + +    + YEE+KD+VG ++   V++ +   V V+LG  +G+V R E IP E  + G     +I +V+ +Q +G  I LSR     +  L   E+ EI DG+IEIK ++R  G + K+A++S+   +D VG  VG +G R++ +   L  E+ID+I ++E+   F+VNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW+IDI++E+   + +  EF + SQL                     + +  +     + +   GF  D ++E       Y AEL++  D++
  S:    10 LLQIADAVAREKSIDRMIVINAMEDAIQKA-ARSRYGTETEVRAEINPKTGEIRLQRLLQVVDSVENVSTD---ISLEDAQARNPEASIGDFIAEPLPPLDFGRIAAQSAKQVIVQKVREAERDRQYEEFKDRVGEVVNGVVKRAEYGNVIVDLGRGEGIVRRDELIPREIFRTGDRIRAIIYDVRREQ-RGPQIFLSRTHPQFMAKLFAQEVPEIYDGVIEIKSVARDPGSRAKIAVISKDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWNEEAATFIVNALQPAEVAKVVLDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWAIDIMTEQEESDRRQKEFLERSQLFMEALNVDEMVGQLLATEGFTSVEEVAYVELDEISMIEGFDDDTAVEIQARARDYLAELEAKLDEE 428
>gi|78222794|ref|YP_384541.1| transcription elongation factor NusA [Geobacter metallireducens GS-15] >gi|78194049|gb|ABB31816.1| NusA antitermination factor [Geobacter metallireducens GS-15] (381 aa)
Score = 417, Expect = 1.2e-38, Identities = 118/364 (32%), Positives = 195/364 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE-DKIEFEDVSQLVSSKTRQP 373
           +D+I KEK   ++ +V  L+ A L  +  K     D+E   +     ++LFE   VVD+    +D  KEI++ EA+E+    ++GD++  +++   F R       Q++   + +     ++ E+KD++G +I   V + +   + V+LG  + ++   EQ P E  + G     LI +++    KG  IILSR   G+L  L + E+ EI++GI+EIK + R  G ++K+A+ S    VD VG  VG +G R++ + S L  E+ID+I + EDP +F  NA  P  +  V I ++     +K + I+  ++ L   IGK G NVRL +KLTGW IDI SE  A E + +EF           ++P
  S:    11 IDQIVKEKGIDRDIVVEALEQAVLSAANKKYRNTRDLEAHYNPEVGEVELFEFVTVVDEV---MDSYKEIDLEEAREIDPDVEVGDSLGMKMDASGFTRIAAQTAKQVIIQKVREAERETIFNEFKDRIGELINGVVRRFEKGDLVVDLGRAEALLSNKEQAPREVYRQGDRIKALIMDIR-MTPKGPQIILSRTHPGVLAKLFEAEVPEIAEGIVEIKSVVREPGSRSKIAVYSHDSDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWSEDPARFACNALQPAAVSKVYIDEE-----NKALEIIVADDQLSLAIGKKGQNVRLAAKLTGWRIDIKSETRAAEAELLEFSSYDGATEEAPQEP 367
>gi|163812296|ref|ZP_02203971.1| NusA antitermination factor [Dehalococcoides sp. VS] >gi|157404037|gb|EDO70082.1| NusA antitermination factor [Dehalococcoides sp. VS] (487 aa)
Score = 417, Expect = 1.2e-38, Identities = 111/343 (32%), Positives = 195/343 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN--PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           FL  + +++ EK+  KE ++  +++AL  +Y KE+  P+ +I V +D     +K+  ++ VV+K    ID  +E+ + EA+  K   K+GD +  E       R       Q++   L++  N+ +++E+  K G+ +   V++++ + + V++G  + ++  SEQ  GE  + GQ     + +V ++  KG  +I+SR+  GL+R L + E+ E+ + ++EIK ++R  G ++KVA+ +  PG+D VG  VG +G RI+ I S LN E+IDV+ +D +   F+ N+  P ++  V + + E     K   +V P+  L   IGK G NVRL  KLTGW IDI S
  S:     5 FLLAITQLSAEKNLPKEVVLATVESALVSAYRKESFAPNQNITVKIDPLTGKVKVMAEKQVVEKV---IDSRQEMRLLEAKRQKADAKIGDLMMVEDTPADAGRIAAQTAKQVILQRLHEAENTAIFDEYASKAGDTLVGVVQRIEPKQITVDIGRVEAIMPASEQAYGERYRAGQRIKVYVVDV-AKTAKGPAVIVSRSHPGLVRRLFEMEVPEVFNQLVEIKAVAREAGSRSKVAVGALQPGIDPVGCCVGLRGIRIQNIVSELNGEKIDVVAWDNEIATFIANSLSPAQVTKVILNEAE-----KSAIVVIPDRQLSLGIGKEGQNVRLAVKLTGWRIDIKS 340
>gi|90420533|ref|ZP_01228440.1| transcription termination/elongation factor nusA [Aurantimonas sp. SI85-9A1] >gi|90335261|gb|EAS49014.1| transcription termination/elongation factor nusA [Aurantimonas sp. SI85-9A1] (537 aa)
Score = 416, Expect = 1.5e-38, Identities = 109/345 (31%), Positives = 191/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  D +A+EK   +E ++  +  A++K+  +     +  + VD+N+++ ++  +R+  VVD+ ED    + +I +  A++     + GD ++ ++    F R       Q++   + D    + Y+E+KD+VG I+   V++V+   V V+LG  +G++ R EQIP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII IK ++R  G + K+A+ S    VD VG  VG +G R++ +   L  E+ID+I +  D   FLVNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW IDI++E+
  S:    10 LLQIADAVAREKSIDREIVIGAMADAIQKA-ARSRYGQETNIRVDINQKTGEMKLQRLLEVVDEVEDP---NTQIYLDLARDKNPDAEPGDFIAEQLPPMDFGRIAAQSAKQVIVQKVRDAERDRQYDEYKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEQIPRELFRYGDRVRAFVYDVRREQ-RGPQIFLSRTHPQFMAKLFTMEVPEIYDGIITIKAVARDPGSRAKIAVTSSDSSVDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPDAASFLVNALQPAEVAKVVLDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTEQ 346
>gi|148322470|gb|EDK87720.1| N utilization substance protein A [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (357 aa)
Score = 416, Expect = 1.6e-38, Identities = 117/343 (34%), Positives = 204/343 (59%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRL-VEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWP-IILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           K+FLE LD++ +EK  SKE+++  ++ AL  +Y K    D ++EVVVD     IK+F  +++V+ +++ +D +KEI++ +A+++KK  K+GDT+  EVN + F R    +  QI+   + +     ++ ++K++  +I+   + ++DNR  + + +   + ++  +EQ   +  + G+     +  V  ++T  +P I++SR +EGLL+ L + EI EI+ GIIEIK ++R  G + KVA+ S VP +D VG  +G +G RIK I   LN ERID++ +    ++F+     P  +  V I +D    G+  V +   + SL   IGKNG N RL ++LTG  +DI
  S:     7 KNFLEALDELEREKGISKESVLEAIELALLAAYKKNYGEDENVEVVVDRENGDIKVFASKIIVN-TDELLDPNKEISLEDAKQIKKRIKVGDTLKFEVNCEDFRRNAVQNGKQIVIQKVREAEREHIFNKFKEREDSIVTGIIRRIDNRKNIFIEIDGIELILPPAEQSVSDVYRVGERIKVYVLSV--EKTNKFPKILISRKNEGLLKKLFEIEIPEITSGIIEIKSVAREAGSRAKVAVYSEVPNIDTVGACIGQRGARIKNIVDELNGERIDIVEWKPVVEEFVSAVLSPAVVSNVTILED----GTARVLVAPSQLSLA--IGKNGQNARLAARLTGMRVDI 343
>gi|160902006|ref|YP_001567587.1| transcription elongation factor NusA [Petrotoga mobilis SJ95] >gi|160359650|gb|ABX31264.1| NusA antitermination factor [Petrotoga mobilis SJ95] (341 aa)
Score = 416, Expect = 1.6e-38, Identities = 110/346 (31%), Positives = 200/346 (57%)
  Q:     5 SFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFA-QILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           + LE LD + ++K  S++++V+I+  +++ +Y K     ++E+ +D N   + +++   VV+  E+     +EI++ EA+++    ++G+ V  ++N+ K  RR+ +  A Q++  NL ++    +++++      I  AE+ KV +  +++ +G  +  +   E IPGE  + G+     IK +++  +KG  I++SR    L+  LL + + EI +GII+I +I R  G +TKVA++S +PGVD VG  +G KG RI ++   L NE++D+I Y EDPK F+ +A  P ++  + + +DE     K   +  PE  L   +GK G   RL +K+TGW IDI S K
  S:     4 NLLEALDALERDKGISRDSLVDIIAKSIKSAYKKNYGAKNVEIEIDKNLTKLNVYQLWKVVETVENP---KEEISLEEAKKINPKIEIGEMVRKKINLKKDFRRVAAQTAKQVILQNLKELEKKNLFDKYVALKNRISTAEIIKVSDEYIDIRIGKLETKLPMKETIPGETFKSGELVKVYIKNIQNT-SKGPKIMVSRTVPELITELLSSIVPEIEEGIIKIVKIVREPGIRTKVAVVSSMPGVDPVGACIGEKGSRISELLKELKNEKVDIIEYSEDPKIFIKHALAPAEVKNIILNEDE-----KTAFVYVPENQLSLAVGKGGQTARLAAKITGWKIDIHSLK 341
>gi|154254057|ref|YP_001414881.1| NusA antitermination factor [Parvibaculum lavamentivorans DS-1] >gi|154158007|gb|ABS65224.1| NusA antitermination factor [Parvibaculum lavamentivorans DS-1] (536 aa)
Score = 415, Expect = 1.8e-38, Identities = 112/344 (32%), Positives = 187/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+    Y  EN   +I   ++     I+L     VVD  E+   D  +I++  AQ    + +LGD +  E+    F R       Q++   + D    + Y+E+KD++G I+   V++V+   V V+LG  + +V R E +P E  + G      I +V+ +Q +G  I LSR+    +  L   E+ EI DGIIEIK ++R  G + K+A+LS    +D VG  VG +G R++ + + L  E+ID+I +  D   F+VN   P ++V V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKSIDREVVIEAMAEAIQKAARSRYGAEN---EIRARINPQTGEIRLVRLLEVVDTVEN---DAVQIDLKSAQRRNPAAQLGDLIEDELPPVDFGRIAAQTAKQVIVQKVRDAERERQYDEYKDRIGEIVNGIVKRVEYGNVIVDLGRGEAIVRRDELLPRETFRNGDRVRAYIYDVRREQ-RGPQIFLSRSHPQFMAKLFAQEVPEIYDGIIEIKAVARDPGSRAKIAVLSNDSSIDPVGACVGMRGSRVQAVVNELQGEKIDIIQWSPDAATFIVNGLAPAEVVKVVLDED-----AQRIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 345
>gi|15639877|ref|NP_219327.1| transcription elongation factor NusA [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026115|ref|YP_001933887.1| N utilization substance protein A [Treponema pallidum subsp. pallidum SS14] >gi|3323210|gb|AAC65849.1| N utilization substance protein A (nusA) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018690|gb|ACD71308.1| N utilization substance protein A [Treponema pallidum subsp. pallidum SS14] (485 aa)
Score = 415, Expect = 1.9e-38, Identities = 112/342 (32%), Positives = 187/342 (54%)
  Q:     8 ENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQ-QTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           +++ K A+EK   ++    I++  L+ +Y K     D   VV   +E + ++ ++ VV++  D +    E+++S A EL  +  L   V  E+  + F+R       Q +T    +I    +Y E+K K G II    ++  N  + V+LG  +G++ +S Q+P ++ +       L++EV+   ++    +ILSR D   ++ LL  E+ EI DGI+E+ +I R  GY+TK+A+ SR   VD VG  VGP+G RI+ +   LN+E+IDV+ Y  DP  F+ NA  P +++ V + D+E      IV     E  L   IGK G+NVRL ++L  W+ID+ +E
  S:     7 DDIRKYAQEKGLDEDFAFKIVEQTLKAAY-KTTFKTDENAVVTFGEERVCIYARKRVVEEVYDRV---SEVDLSTALELDPTTSLDSEVLVELESEDFKRGSVQAAVQRITELSREIQKDALYAEYKSKEGEIIVGYYQRARNEHIYVDLGKVEGLMPKSHQLPQDDYRQNDRIKSLVREVRKHPKSSVVQLILSRTDSAFVKELLAVEVPEIYDGIVEVAKIVREPGYRTKIAVTSRRDDVDPVGACVGPRGIRIRMVIKELNDEKIDVLEYSPDPVIFIKNALSPAEVLNVVVLDEEKRSALAIVA----ESQLSIAIGKQGLNVRLANRLVDWNIDVKTE 341
>gi|162139854|ref|YP_619194.2| transcription elongation factor NusA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (406 aa)
Score = 415, Expect = 1.9e-38, Identities = 120/369 (32%), Positives = 204/369 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLN--KESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVV-LRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE-KLAIEDKIEFEDVSQLVSSKTRQ 372
           K  LE  D + K K   ++ IV  +K AL  +  K+N  L   V +D N  K   K+   + VVD+ +D   D  E+++ +A  + ++Y++GDT+  EV    F R   +   Q++   L +  N+ +  E+      ++   VE+ DNR V VN+G+ + V+ ++ + IPGE   P      L+ +V +   KG  I +SR    +++   + E+ EI DG +EI  I+R  G +TK+A+ S  P +D VGT VGP+G R++ + + L  E ID++ Y+EDP  ++ NA +P +++ V+  D++D    +   ++ P+  L   IGK G NVRL ++LTG+ IDI  E ++   D+ E ED +++   +  Q
  S:     3 KEMLEAFDVLEKTKGIKQDVIVEAMKAALAAA-YKKNYGLAENVEIDFNEKKGDFKVMALKTVVDEVQD---DRVEVSLKDALAINRAYEVGDTIKFEVTPKNFGRTAAATAKQVVMQRLREAENAHIVNEYSQYEDELVTGTVERTDNRFVYVNIGNVEAVMDIKCDTIPGEHYNPQDRVRVLVTKVGAD-GKGAQIRVSRTAPDVVKRFFEQEVPEIFDGTVEIMSIAREAGERTKIAVKSNDPNIDPVGTCVGPRGSRVQNVVNALGGENIDIVQYEEDPSDYIANALNPAEVIAVQFEDEDD---ERKAFVIVPDYQLSLAIGKKGQNVRLAARLTGYKIDIRPESEVEFVDESEVEDETEVAEDQDLQ 367
>gi|116514302|ref|YP_813208.1| transcription elongation factor NusA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093617|gb|ABJ58770.1| Transcription elongation factor [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (406 aa)
Score = 415, Expect = 2.0e-38, Identities = 120/369 (32%), Positives = 204/369 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLN--KESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVV-LRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE-KLAIEDKIEFEDVSQLVSSKTRQ 372
           K  LE  D + K K   ++ IV  +K AL  +  K+N  L   V +D N  K   K+   + VVD+ +D   D  E+++ +A  + ++Y++GDT+  EV    F R   +   Q++   L +  N+ +  E+      ++   VE+ DNR V VN+G+ + V+ ++ + IPGE   P      L+ +V +   KG  I +SR    +++   + E+ EI DG +EI  I+R  G +TK+A+ S  P +D VGT VGP+G R++ + + L  E ID++ Y+EDP  ++ NA +P +++ V+  D++D    +   ++ P+  L   IGK G NVRL ++LTG+ IDI  E ++   D+ E ED +++   +  Q
  S:     3 KEMLEAFDVLEKTKGIKQDVIVEAMKAALAAA-YKKNYGLAENVEIDFNEKKGDFKVMALKTVVDEVQD---DRVEVSLKDALAINRAYEVGDTIKFEVTPKNFGRTAAATAKQVVMQRLREAENAHIVNEYSQYEDELVTGTVERTDNRFVYVNIGNVEAVMDIKCDTIPGEHYNPQDRVRVLVTKVGAD-GKGAQIRVSRTAPDVVKRFFEQEVPEIFDGTVEIMSIAREAGERTKIAVKSNDPNIDPVGTCVGPRGSRVQNVVNALGGENIDIVQYEEDPSDYIANALNPAEVIAVQFEDEDD---KRKAFVIVPDYQLSLAIGKKGQNVRLAARLTGYKIDIRPESEVEFVDESEVEDETEVAEDQDLQ 367
>gi|126728006|ref|ZP_01743822.1| transcription elongation factor NusA [Sagittula stellata E-37] >gi|126710971|gb|EBA10021.1| transcription elongation factor NusA [Sagittula stellata E-37] (538 aa)
Score = 415, Expect = 2.2e-38, Identities = 116/360 (32%), Positives = 200/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV+  E E +   E+ + +A++     K+GDT   EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G  + ++ R+E+I  E  +PG      +K+V+ ++T+G  I LSR     +R L K E+ EI DGIIE+K ++R  G + K+A++S   G+D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    ++ + +V P+E L   IG+ G NVRL S+LTG  IDI++E+   + +  EFE+ +QL
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVVEDEELE-NYQAELTVQQAKQYMADPKVGDTFVEEVPPVELGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGRGEAILRRNEKIGRESYRPGDRIRCYVKDVR-RETRGPQIFLSRTAPEFMRELFKMEVPEIYDGIIEVKAVARDPGSRAKIAVISYDNGIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDVPTFLVNALQPAEVSKV-VLDEE----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGLDIDIMTEEEESKRRQKEFEERTQL 365
>gi|19705318|ref|NP_602813.1| transcription elongation factor NusA [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713289|gb|AAL94112.1| N utilization substance protein A [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (357 aa)
Score = 415, Expect = 2.2e-38, Identities = 118/343 (34%), Positives = 204/343 (59%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRL-VEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWP-IILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           K+FLE LD++ +EK  SKE+++  ++ AL  +Y K    D ++EV+VD     IK+F  +++V+ ++D +D +KEI++ +A+++KK  K+GDT+  EVN + F R    +  QI+   + +     ++ ++K++  +I+   + ++DNR  + + +   + ++  +EQ   +  + G+     I  V  ++T  +P I++SR +EGLL+ L + EI EI+ GIIEIK ++R  G + KVA+ S VP +D VG  +G +G RIK I   LN ERID++ +    ++F+     P  +  V I +D    G+  V +   + SL   IGKNG N RL ++LTG  +DI
  S:     7 KNFLEALDELEREKGISKESVLEAIELALLAAYKKNYGEDENVEVIVDRENGDIKVFASKIIVN-ADDLLDPNKEISLEDAKKIKKRVKVGDTLKFEVNCEDFRRNAVQNGKQIVIQKVREAEREHIFNKFKEREDSIVTGIIRRIDNRKNIFIEIDGIELILPPAEQSISDVYRVGERIKVYILSV--EKTNKFPKILISRKNEGLLKKLFEIEIPEITSGIIEIKSVAREAGSRAKVAVYSEVPNIDTVGACIGQRGARIKNIVDELNGERIDIVEWKPVIEEFVSAVLSPAVVSNVTILED----GTARVLVEPSQLSLA--IGKNGQNARLAARLTGMRVDI 343
>gi|15895075|ref|NP_348424.1| transcription elongation factor NusA [Clostridium acetobutylicum ATCC 824] >gi|15024772|gb|AAK79764.1|AE007689_2 Transcription terminator NusA [Clostridium acetobutylicum ATCC 824] (353 aa)
Score = 414, Expect = 2.6e-38, Identities = 121/346 (34%), Positives = 197/346 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEV---VVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           + F++ L +I +EK  S+E + + ++ AL  +Y K    L   V    V +N+E+  I ++ ++ VV + ED I    EI++ +A+ +   Y+L D V  E+    F R       Q++   + +   S +Y+E+ +K  +II   V + D   + ++LG  + ++  SEQIPGE+          I EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK ISR  G +TK+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I + + P++F+ N+  P K++ V I +D     +K    +  +  L   IGK G NVRL +KLT W IDI S+
  S:     3 QEFIQALKEIVEEKGISEELLFSTIEDALVAAYKKNYAKLTENVHNVRVSMNRENGEIHVYSQKKVVQEIEDSI---CEISLDDAKSIDPKYQLDDIVDIEITPKSFGRVAAQAAKQVVIQRIKEAERSLLYDEFSEKEFDIITGTVLRKDKGNILIDLGRIEAILGPSEQIPGEDYIYNSKIKLYIVEVKNT-TKGAQVVISRTHPGLVKRLFELEVPEIYNGIVEIKGISREAGSRTKIAVYSHDENVDAMGACVGPKGMRVQNIVNELKNEKIDIIKWSKLPEEFISNSLSPAKVLDVYIDED-----TKSARAIVEDNQLSLAIGKEGQNVRLAAKLTEWKIDIKSK 344
>gi|153092741|gb|EDN73784.1| N utilization substance A [Mannheimia haemolytica PHL213] (498 aa)
Score = 414, Expect = 2.9e-38, Identities = 120/365 (32%), Positives = 208/365 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK-ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVNLGST----KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQLVSS 368
           K  L   + ++ EK   KE I   L+TAL  +  K  + D+D+ VVVD      + F +  VV+   +     +EI++  AQ    + +LGD +  EV   +F R     F Q++   + +   +K+ +E++  +G II A V+KV  DN  +E+   S     + V++R + IP E  +PG     ++ E+K + +KG  + ++RA   +L  L K E+ EI +G+IEIK  +R VG + K+A+ +    +D VG  VG +G R++ IS+ L  ER+D++L+DE+P QF++NA  P  +  + I D+     +  + I    ++L + IG+NG NVRL ++LTGW++++++ E+L  + + E   V  L++S
  S:     3 KEILLAAEAVSNEKQLPKEAIFEALETALTIATKKSRDLDIDVRVVVDRKTGDFQTFRRWAVVENVNNMT---REISLEAAQFEDPNVQLGDFIEDEVESIEFGRVAIQTFGQVVKTKIREAEKTKIIDEFRSDLGKIILATVKKVTRDNIFLELQGKSEDIKGEAVIVREDMIPRENFRPGDRVRGVLYEIKPE-SKGPQLFVTRAKPVMLEELFKLEVPEIGEGVIEIKGSARDVGSRAKIAVKTHDKRIDPVGACVGMRGARVQAISNELGGERVDIVLWDENPAQFVINAMAPADVSSIVINDE-----THSMDIAVEAKNLAQAIGRNGQNVRLATQLTGWALNVMTVEELTKKSEEEDGKVINLLTS 366
>gi|118726345|ref|ZP_01574972.1| NusA antitermination factor [Clostridium cellulolyticum H10] >gi|118664224|gb|EAV70859.1| NusA antitermination factor [Clostridium cellulolyticum H10] (388 aa)
Score = 414, Expect = 2.9e-38, Identities = 124/340 (36%), Positives = 193/340 (56%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           L+++ KEK   KE I+  ++ AL  +Y K     ++++V +D     +K+F  R V +  + E  D   I+I EA +L  +  +GD V +EV    F R       Q++   L +     +Y+E+ +K  +I+   +++++ R V V+LG T+ V+  +EQ PGEE +  +     I EVK + TKG  I+LSR   GL++ L + E+ EI DG +EIK ISR  G +TK+A+ S+   VD VG  VG KG R++ I   L  E+ID+I +  DPK ++ ++  P K+V V++ ++E     K   +V P+  L   IGK G N RL +KLTGW IDI SE
  S:    15 LEQLEKEKGIKKEIIIEAIEAALISAYKKNFGSAMNVKVNIDRVTGDVKVFALRKVAEDPDVEAMD---ISIGEAAKLNPTLDIGDYVESEVTPRSFGRIAAQTAKQVVVQKLREAERGIIYDEFYNKESDIVTGIIQRIEKRNVIVDLGKTEAVLGSTEQTPGEEYRFNERLKSYIVEVK-KTTKGPQIMLSRTHPGLVKRLFELEVPEIHDGTVEIKSISREPGSRTKLAVYSKDENVDPVGACVGQKGTRVQAIVDELRGEKIDIIKWSNDPKDYISSSLSPAKVVRVDVDEEE-----KSAKVVVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE 346
>gi|166030876|ref|ZP_02233705.1| hypothetical protein DORFOR_00556 [Dorea formicigenerans ATCC 27755] >gi|166029143|gb|EDR47900.1| hypothetical protein DORFOR_00556 [Dorea formicigenerans ATCC 27755] (401 aa)
Score = 413, Expect = 3.3e-38, Identities = 116/349 (33%), Positives = 195/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            LE L+ + KEK+ SKE +++ ++ +L  +        D I+V++D +    +LF ++ VV+  ED ++   +I++ EA +L   Y LGD V   +    F R  T +   ++   + +     VY+++ +K  +I+   V++   + V +NLG    ++  +EQ+ GE  +P +     + EVK+  TKG  I++SR    L++ L ++E++E+ DGI+EIK I+R  G +TK+A+ S  P VD VG  VG  G R+  I + L  E+ID+I + ++P   + NA  P K++ V    DE     K  +++ P+  L   IGK G N RL ++LTG+ IDI SE  AIE
  S:     5 LLEALNILEKEKEISKETLLDAIENSLLNACKNHFGKADNIKVIMDHDTCDYQLFAEKTVVETVEDPLE---QISLDEASQLDGHYDLGDIVRVPIESKSFGRIATQNAKNLILQKIREEERKVVYDQYFEKEKDIVTGIVQRYVGKNVSINLGKADAMLTENEQVKGEVFKPTERIKLYVVEVKNT-TKGPKILVSRTHPELVKRLFESEVTEVRDGIVEIKSIAREAGSRTKIAVWSNDPDVDPVGACVGMNGARVNAIVNELRGEKIDIINWSDNPAILIENALSPAKVISVMADPDE-----KKASVIVPDYQLSLAIGKEGQNARLAARLTGYKIDIKSETQAIE 345
>gi|15963990|ref|NP_384343.1| transcription elongation factor NusA [Sinorhizobium meliloti 1021] >gi|15073166|emb|CAC41674.1| Probable N utilization substance protein A [Sinorhizobium meliloti 1021] (542 aa)
Score = 413, Expect = 3.9e-38, Identities = 114/360 (31%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +E ++  +  A++K+   +   + +I   ++     I+L     VV+K+ED      +I I  A++     KLGD ++  +    F R       Q++   + +    + Y+E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII+IK ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I +  DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E+   E +  EF + +QL
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKAARSRYGSESNIRADINPKTGEIRLQRLLEVVEKAEDY---STQIPIELARDRNPDAKLGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENMRYGDRVRAFVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQIKSVARDPGSRAKIAVVSNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPDPASFIVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQKEFNERTQL 362
>gi|73662811|ref|YP_301592.1| transcription elongation factor NusA [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495326|dbj|BAE18647.1| transcription termination-antitermination factor [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (397 aa)
Score = 412, Expect = 4.0e-38, Identities = 122/349 (34%), Positives = 195/349 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           M     L   + + KEK   +E +++ ++ AL  +Y K+N D    V V+LN +  S K+  ++ VV   E+ +DD +EI++  A     +Y++GD    +V    F R       Q +   L D     +Y+E+ DK  +I+   +++VD+R V VNLG T+ V+  +E+ P E   P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S  P +DAVG  VG KG R++ +   L  E+ID++ ++EDPK F+ NA  P +++ V +    D P    V +V P+  L   IGK G N RL +KLTGW IDI SE
  S:     1 MSSNELLLATEYLEKEKKIPREVLIDAIEAALITAY-KKNYDSARTVRVELNMDQGSFKVIARKEVV---EESMDDREEISLDTALVKNPAYEIGDIYEEDVTPSDFGRVGAQAAKQAVMQRLRDAEREILYDEFIDKEDDIVTGLIDRVDHRYVYVNLGRTEAVLSEAERSPNESYIPNERIRVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIFDGTVIVKSVAREAGDRSKISVHSDNPDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQVLQVIV----DEPNQSTVVVV-PDYQLSLAIGKRGQNARLAAKLTGWKIDIKSE 341
>gi|103423295|emb|CAI98136.1| Transcription elongation factor NusA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (402 aa)
Score = 412, Expect = 4.3e-38, Identities = 104/329 (31%), Positives = 185/329 (56%)
  Q:    44 DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVV-LRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE-KLAIEDKIEFEDVSQLVSSKTRQ 372
           ++E+  +  K   K+   + VVD+ +D   D  E+++ +A  + ++Y++GDT+  EV    F R   +   Q++   L +  N+ +  E+      ++   VE+ DNR V VN+G+ + V+ ++ + IPGE   P      L+ +V +   KG  I +SR    +++   + E+ EI DG +EI  I+R  G +TK+A+ S  P +D VGT VGP+G R++ + + L  E ID++ Y+EDP  ++ NA +P +++ V+  D++D    +   ++ P+  L   IGK G NVRL ++LTG+ IDI  E ++   D+ E ED +++   +  Q
  S:    40 NVEIDFNEKKGDFKVMALKTVVDEVQD---DRVEVSLKDALAINRAYEVGDTIKFEVTPKNFGRTAAATAKQVVMQRLREAENAHIVNEYSQYEDELVTGTVERTDNRFVYVNIGNVEAVMDIKCDTIPGEHYNPQDRVRVLVTKVGAD-GKGAQIRVSRTAPDVVKRFFEQEVPEIFDGTVEIMSIAREAGERTKIAVKSNDPNIDPVGTCVGPRGSRVQNVVNALGGENIDIVQYEEDPSDYIANALNPAEVIAVQFEDEDD---ERKAFVIVPDYQLSLAIGKKGQNVRLAARLTGYKIDIRPESEVEFVDESEVEDETEVAEDQDLQ 363
>gi|150398625|ref|YP_001329092.1| transcription elongation factor NusA [Sinorhizobium medicae WSM419] >gi|150030140|gb|ABR62257.1| NusA antitermination factor [Sinorhizobium medicae WSM419] (552 aa)
Score = 412, Expect = 5.1e-38, Identities = 113/360 (31%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +E ++  +  A++K+   +   + +I   ++     I+L     VV+K+ED      +I I  A++     KLGD ++  +    F R       Q++   + +    + Y+E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DG+I+IK ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I +  DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E+   E +  EF + +QL
  S:    20 LLQIADAVAREKVIDREIVLAAMADAIQKAARSRYGSESNIRADINPKTGEIRLQRLLEVVEKAEDY---STQIPIELARDRNPDAKLGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENMRYGDRVRAFVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGVIQIKSVARDPGSRAKIAVVSNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPDPASFIVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQKEFNERTQL 372
>gi|58337537|ref|YP_194122.1| transcription elongation factor NusA [Lactobacillus acidophilus NCFM] >gi|58254854|gb|AAV43091.1| transcription termination-antitermination factor [Lactobacillus acidophilus NCFM] (389 aa)
Score = 411, Expect = 5.4e-38, Identities = 113/346 (32%), Positives = 188/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  LE    + K K   ++ IV+ +K AL  +Y K  N   ++EV  D  K + K+   + VVD+ +D   D  E+++ +A  + ++Y++GD +  EV    F R       Q++   L +   + + +E+      ++   VE+ DNR V V +G+ + V+   +Q+P E   P      L+  V S  +KG  I +SR    +++ L + E+ EI DG +EI  I+R  G +TK+A+ S  P +D VGT VG KG R++ + + L  E ID++ Y+EDP  ++ NA +P +++ V+  +DE+    K   ++ P+  L   IGK G NVRL ++LTG+ IDI  E
  S:     3 KEMLEAFATLEKNKGIEQDVIVDAIKAALVAAYKKNYNQAQNVEVDFDERKGNFKVMAVKTVVDEVQD---DRLEVSLKDALAINRAYEVGDEIRFEVTPKNFGRIAAQTAKQVIMQRLREAERNHIIDEYSQYEDELVTGTVERRDNRFVYVKIGNVEAVMPHRDQMPNEVYNPQDQIRVLVTHVGSD-SKGAQITVSRTAPDMVKRLFEQEVPEIYDGTVEIVSIAREAGDRTKMAVKSNDPNIDPVGTCVGQKGARVQNVVNELGGENIDIVKYEEDPSDYIANALNPAEVIAVQFGEDEE---EKSALVIVPDYQLSLAIGKKGQNVRLAARLTGYKIDIRPE 342
>gi|163867513|ref|YP_001608712.1| transcription elongation factor NusA [Bartonella tribocorum CIP 105476] >gi|161017159|emb|CAK00717.1| transcription elongation protein [Bartonella tribocorum CIP 105476] (543 aa)
Score = 411, Expect = 5.9e-38, Identities = 116/359 (32%), Positives = 198/359 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           L+  D +A+EK   +E +++ +  A++K+   +   + +I   ++     IKL     +VD  ED      EI +S+A + ++  K+GD  +  +    F R       Q++   + D    + YEE+K+KVG II   V++V+   V V+LG  + +V R E IP E  + G      + +V  ++T+G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  + + +D     ++ + ++ P++ L   IG+ G NVRL S+LTGW+IDI++EK   E++  EF + S+L
  S:    11 LQIADAVAREKSIDREIVISAMADAIQKAARSRYGQETNIRAEINSKTGEIKLQRLLKIVDVVEDYT---TEIALSDALKCQEEAKIGDFFADLLPPMDFGRIAAQSAKQVIVQKVRDAERDQQYEEFKNKVGEIISGTVKRVEYGNVIVDLGRGEAIVRRDELIPRESFRYGDRIRAFVNDVH-RETRGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPDAATFVVNALQPAEVSKIILDED-----AERIEVIVPDDQLSLAIGRRGQNVRLASQLTGWNIDILTEKEESENRQKEFTERSKL 362
>gi|182703944|ref|ZP_02956358.1| NusA antitermination factor [Methylocella silvestris BL2] >gi|172067015|gb|EDT53137.1| NusA antitermination factor [Methylocella silvestris BL2] (532 aa)
Score = 411, Expect = 5.9e-38, Identities = 103/344 (29%), Positives = 193/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   ++ +++ ++ A++K+  +     + EV  ++N ++  I+     +VVD+ E+   D   I + +A++   + ++GD ++  +    F R       Q++   + +    + Y+E+KD++G+I+   V++V+   V ++LG  +  + R E IP E  +PG      + +V+ +Q +G  I LSR     +  L + E+ EI D II++K ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++V V + +D     S  + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKSIDRQIVLSSMEDAIQKA-ARSRYGQETEVRAEINPKTGEIRFSRLLLVVDQIEN---DAIHITLEDARKKNPAAQVGDWIAETLPPFDFGRIAAQSAKQVIVQKVREAERDRQYQEYKDRIGDIVNGVVKRVEYGYVIIDLGRGEATIRRDEMIPREMFRPGDRARAYVYDVRREQ-RGPQIFLSRTHPQFMAKLFQQEVPEIYDNIIQVKAVARDPGSRAKIAVISRDASIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDAATFIVNALQPAEVVKVVLDED-----SARIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 345
>gi|73748752|ref|YP_307991.1| transcription elongation factor NusA [Dehalococcoides sp. CBDB1] >gi|147669518|ref|YP_001214336.1| transcription elongation factor NusA [Dehalococcoides sp. BAV1] >gi|73660468|emb|CAI83075.1| N utilization substance protein A [Dehalococcoides sp. CBDB1] >gi|146270466|gb|ABQ17458.1| NusA antitermination factor [Dehalococcoides sp. BAV1] (491 aa)
Score = 411, Expect = 6.0e-38, Identities = 112/358 (31%), Positives = 203/358 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN--PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
           FL  + +++ EK+  KE ++  +++AL  +Y KE+  P+ +I V +D     +K+  ++ VV+K    ID  +E+ + EA+ LK   K+GD +  E       R       Q++   L++  N+ +++E+  K G+ +   V++++ + + V++G  + ++  +EQ  GE  + GQ     + +V ++  KG  +I+SR+  GL+R L + E+ E+ + ++EIK ++R  G ++KVA+ +  PG+D VG  VG +G RI+ I S LN E+IDV+ +  +   F+ N+  P ++  V + + E     +   +V P+  L   IGK G NVRL  KLTGW IDI   K A ++ +E  +V+
  S:     5 FLLAITQLSAEKNLPKEVVLATVESALVSAYRKESFAPNQNITVKIDQLTGKVKVMAEKQVVEKV---IDSRQEMRLLEAKRLKADAKIGDLMMVEDTPADAGRIAAQTAKQVILQRLHEAENTAIFDEYASKAGDTLVGVVQRIEPKQITVDIGRVEAIMPANEQAYGERYRAGQRIKVYVVDV-AKTAKGPSVIVSRSHPGLVRRLFEMEVPEVFNQLVEIKAVAREAGSRSKVAVGALQPGIDPVGCCVGLRGIRIQNIVSELNGEKIDVVAWSSEIASFIANSLSPAQVTKVILNEAE-----RSAIVVIPDRQLSLGIGKEGQNVRLAVKLTGWRIDI---KSASDEDVERAEVA 352
>gi|170787847|gb|EDT28891.1| transcription elongation factor NusA [Oligotropha carboxidovorans OM5] (541 aa)
Score = 410, Expect = 8.3e-38, Identities = 107/360 (29%), Positives = 199/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV+  E+  +   +I++ +A+    + ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G I+   V++V+   V V+LG  + +V R E +P E L+ G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    11 LLQIADAVAREKSIDRSIVIAAMEDAIAKAARARYGSETDVHAEIDSKKGELRLSRHMLVVETVENPAN---QISLEDAKRANPTAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGEIVNGIVKRVEYGSVIVDLGRGEAIVRRDEMLPREALRNGDRIRAYIFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVISRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVAKVVIDEDRE-----RIEVVVPDTQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENSTRV 363
>gi|153855238|ref|ZP_01996404.1| hypothetical protein DORLON_02418 [Dorea longicatena DSM 13814] >gi|149752237|gb|EDM62168.1| hypothetical protein DORLON_02418 [Dorea longicatena DSM 13814] (399 aa)
Score = 410, Expect = 8.7e-38, Identities = 112/349 (32%), Positives = 198/349 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            LE L+ + KEKD SKE +++ ++ +L  +        D I+++++      +L+ ++ VV++ ED+++   +I++ +A+E+   ++LGD V   +    F R  T +   ++   + +     VY+++ +K  +I+   V++   + V +NLG    ++  +EQ+ GE  +P +     I EVK+  TKG  I++SR    L++ L ++E++E+ DGI+EIK I+R  G +TK+A+ S  P VD VG  VG  G R+  I + L  E+ID+I + ++P   + NA  P K++ V    DE     K  +++ P+  L   IGK G N RL ++LTG+ IDI +E  AIE
  S:     5 LLEALNILEKEKDISKETLLDAIENSLMNACKNHFGKTDNIKLIMNKETCEYQLYAEKTVVEEVEDKLE---QISLEDAKEIDSKFELGDIVHIPIESKSFGRIATQNAKNLILQKIREEERKVVYDQYFEKEKDIVTGIVQRYVGKNVSINLGKADAMLTENEQVKGEVFKPTERIKLYIVEVKNT-TKGPKILVSRTHPELVKRLFESEVTEVKDGIVEIKSIAREAGSRTKIAVWSNDPDVDPVGACVGMNGARVNAIVNELRGEKIDIINWSDNPAILIENALSPAKVISVMADPDE-----KTASVIVPDYQLSLAIGKEGQNARLAARLTGYKIDIKNETQAIE 345
>gi|70726649|ref|YP_253563.1| transcription elongation factor NusA [Staphylococcus haemolyticus JCSC1435] >gi|68447373|dbj|BAE04957.1| transcription termination-antitermination factor [Staphylococcus haemolyticus JCSC1435] (410 aa)
Score = 410, Expect = 8.7e-38, Identities = 120/349 (34%), Positives = 195/349 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           M     L   + + KEK   +E +++ ++ AL  +Y K+N D    V V+LN +  + K+  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     +Y E+ DK  +I+   +++VD+R V VNLG  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S  P +DAVG  VG KG R++ +   L  E+ID++ ++EDPK F+ NA  P ++  +E+  DED   ++   +V P+  L   IGK G N RL +KLTGW IDI SE
  S:     1 MASNELLLATEYLEKEKKIPREVLIDAIEAALITAY-KKNYDSARNVRVELNMDEGTFKVIARKEVV---EEVFDDRDEVDLSTALVKNPAYEVGDIYEEDVTPKDFGRVGAQAAKQAVMQRLRDAEREILYTEFIDKEDDILTGVIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVYSDNPDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVRNALSPSQV--LEVIVDED---NQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSE 341
>gi|13474627|ref|NP_106196.1| transcription elongation factor NusA [Mesorhizobium loti MAFF303099] >gi|14025381|dbj|BAB51982.1| N utilization substance protein A [Mesorhizobium loti MAFF303099] (531 aa)
Score = 409, Expect = 9.3e-38, Identities = 107/344 (31%), Positives = 185/344 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   K  ++  +  A++K+   +   + +I   ++ N   +KL     VV+K +D      +I IS A+E     +LGD ++ ++    F R       Q++   + +    + Y+E+KD++G I+   V++V+   V V+LG  + ++ R E IP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I +      F+VNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKSIDKSIVIAAMADAIQKAARSRYGQETNIRADINPNTGEMKLQRLMEVVEKVDDYA---TQIAISSARERNPDAQLGDFIAEQLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRIGEIVNGTVKRVEYGNVIVDLGRGEAIIRRDELIPRENYKYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMAKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPSAASFIVNALQPAEVAKVVLDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTE 345
>gi|167772658|ref|ZP_02444711.1| hypothetical protein ANACOL_04039 [Anaerotruncus colihominis DSM 17241] >gi|167665136|gb|EDS09266.1| hypothetical protein ANACOL_04039 [Anaerotruncus colihominis DSM 17241] (358 aa)
Score = 409, Expect = 9.4e-38, Identities = 112/344 (32%), Positives = 180/344 (52%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLF--EKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRL--VEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F E L  + KEK   +  +   + TA+  + ++ +     + VVD+N ++ + +   ++ VVD   D +D  +EI   EA +      LGD V   ++  +F R        ++   + +    +++ E+  +  +I+ A V + D     V + LG ++ V+ + EQ+PGEE   G      + +V + + KG  I++SR   GL++ L + E+ EI DG IE+K ISR  G +TK+A+ S    VD VG  +GPKG+R+  I   L  E+IDV+ Y  DP +F+  A  P  +V VE+  D    G+K   +  P+  L   IG  G N RL +KLTGW IDI  E
  S:    14 FFEALALMEKEKGIPRSLLAEKIATAIGNA-IRRDMGASEDSVVDINPDTGRFYVAMRKTVVD---DLLDPAQEILPEEAVKYDSGATLGDIVEIPLDTKQFGRIAAQTAKHVIRQGIREAERGQLFAEFSSRQHDIVTATVLRTDQVRGNVTLELGKSEAVLPKGEQVPGEEYADGARIKVYVVDVVNGE-KGPRIMISRTHPGLVKRLFEMEVPEIFDGTIEVKSISREAGSRTKIAVWSNDENVDPVGACIGPKGQRVSAIVEELGGEKIDVVRYSADPAEFIAAALSPADVVSVEVDPD----GAKSCRVSVPDHQLSLAIGNKGQNARLAAKLTGWKIDIKPE 352
>gi|28899231|ref|NP_798836.1| transcription elongation factor NusA [Vibrio parahaemolyticus RIMD 2210633] >gi|153838305|ref|ZP_01990972.1| transcription elongation factor NusA [Vibrio parahaemolyticus AQ3810] >gi|28807455|dbj|BAC60720.1| N utilization substance protein A [Vibrio parahaemolyticus RIMD 2210633] >gi|149748294|gb|EDM59153.1| transcription elongation factor NusA [Vibrio parahaemolyticus AQ3810] (495 aa)
Score = 409, Expect = 1.0e-37, Identities = 104/345 (30%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  S  K+   ++D+ V +D        + + +VVD+ E      KEI++  AQ    S +LGD V  E+    F+R  T    Q++   + +   +++ E++ D  G++I   V+KV+   + ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI++ IIE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVAEAVSNEKAVPRERIFEALEIALATSTKKKYEIEIDVRVAIDRKTGEFVTYRRWLVVDQVESPT---KEISLEAAQYEDDSVELGDYVEDEIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLITGVVKKVNRDTIVLDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLEELFRVEVPEIAEEIIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|39996686|ref|NP_952637.1| transcription elongation factor NusA [Geobacter sulfurreducens PCA] >gi|39983567|gb|AAR34960.1| N utilization substance protein A [Geobacter sulfurreducens PCA] (385 aa)
Score = 408, Expect = 1.2e-37, Identities = 111/348 (31%), Positives = 187/348 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           +D+I KEK   +  +V  L+ A L  +  K     D+E   +     ++LFE   VVD+ +D     KEI++ EA+E+    ++GD++  +++   F R       Q++   + +     ++ E+KD++G ++   V + +   + ++LG  + V+   EQ P E  + G     LI +++    KG  I+LSR   G+L  L + E+ EI++GI+EIK + R  G + K+A+ S    VD VG  VG +G R++ + S L  E+ID+I + +D  +F  NA  P  +  V I D+     ++ + I+  ++ L   IGK G NVRL +KLTGW IDI SE  A E ++
  S:    11 IDQIVKEKGIDRHIVVEALEQAVLTAANKKFRNTRDLEAHYNPEVGEVELFEFVTVVDEVQDSY---KEIDMEEAREIDPDVEVGDSLGMKLDASGFTRIAAQTAKQVIIQKVREAERETIFNEFKDRIGELVTGVVRRFEKGDLVIDLGRAEAVLSHKEQAPREVYRQGDRVKTLITDIR-MTPKGPQIVLSRTHPGVLAKLFEAEVPEIAEGIVEIKAVVREPGSRAKIAVYSHDSDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWSDDAARFACNALQPAVVSKVYIDDE-----NRSMEIIVADDQLSLAIGKKGQNVRLAAKLTGWRIDIKSETTAAEAEL 350
>gi|91228266|ref|ZP_01262202.1| transcription elongation factor NusA [Vibrio alginolyticus 12G01] >gi|194539560|ref|YP_002074608.1| transcription termination factor NusA domain protein [Vibrio sp. Ex25] >gi|91188143|gb|EAS74445.1| transcription elongation factor NusA [Vibrio alginolyticus 12G01] >gi|151938115|gb|EDN56956.1| transcription termination factor NusA domain protein [Vibrio sp. Ex25] (495 aa)
Score = 408, Expect = 1.4e-37, Identities = 104/345 (30%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  S  K+   ++D+ V +D        + + +VVD  E+     KEI++  AQ    S +LGD V  E+    F+R  T    Q++   + +   +++ E++ D  G++I   V+KV+   + ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI++ IIE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVAEAVSNEKAVPRERIFEALEIALATSTKKKYEIEIDVRVAIDRKTGEFVTYRRWLVVDDVENPT---KEISLEAAQYEDDSIELGDYVEDEIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLITGVVKKVNRDTIVLDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIAEDIIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|117928724|ref|YP_873275.1| transcription elongation factor NusA [Acidothermus cellulolyticus 11B] >gi|117649187|gb|ABK53289.1| NusA antitermination factor [Acidothermus cellulolyticus 11B] (348 aa)
Score = 408, Expect = 1.4e-37, Identities = 106/337 (31%), Positives = 176/337 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEI-----DDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV-DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           L  + +EKD S + +V  ++TAL  +Y +                       RVV+D+   E+     + D E N+   +E   + +             F R       Q++   L D  +   + E+  + G+++   +++  D+R V VNLG  +GV+  +EQ+PGE    G+     +  V  +  +G  I LSR   GL+R L   E+ EI+DG +EI  ++R  G++TK+A+ S+VPG++A G  +GP G+R++ + + L+ E+ID+I Y +DP  F+ NA  P ++  VEI D    P +K   ++ P+  L   IG+ G N RL ++LTGW IDI
  S:     8 LRSLEREKDISFDLLVQAIETALLTAYQRTEGAYP---------------RARVVLDRKTGEVTVLAAETDAEGNV--IREFDHTPQ------------DFNRIAAMTAKQVILQRLRDAEHELTFGEYAGREGDVVGGIIQQQHDSRNVYVNLGKVEGVLPVTEQVPGERYVHGERIRCYVLSVH-KGIRGPQITLSRTHPGLVRKLFALEVPEIADGSVEIVALAREAGHRTKIAVRSKVPGLNAKGACIGPLGQRVRAVMAELHGEKIDIIDYSDDPATFVANALSPARVTSVEIVD----PVTKSARVIVPDYQLSLAIGREGQNARLAARLTGWRIDI 316
>gi|187735458|ref|YP_001877570.1| NusA antitermination factor [Akkermansia muciniphila ATCC BAA-835] >gi|187425510|gb|ACD04789.1| NusA antitermination factor [Akkermansia muciniphila ATCC BAA-835] (431 aa)
Score = 408, Expect = 1.4e-37, Identities = 112/337 (33%), Positives = 184/337 (54%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD----IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           +D   +EK  S+E I+  L++A   +Y K  P       +   ++++K  +++F    VV   E+  D   +I +S A +L K+  L D + T +    F R       Q +   L D     +Y+E+KD+ G+++   + + +   + V+LG  +GV+   E++P E+   G    F + EV+++  +G  +ILSR+   L+R L ++E+ EI D  +EI  I+R  GY+TKVA++S    VD VG  VG +G R+K I   LNNE++D++ + EDP  F+  A  P  +   EIT DE+    KI  IV  ++ L K IG+ G N RL S+L GW + +
  S:     9 IDYYEREKGLSREKILLALESAFLSAYRKMVPGSGSINYLRAEINVDKGKVRIFADLEVV-PDEEYSDKFNQIPLSLAVKLDKNAVLHDLLPTNITPKGFGRIAVQTARQTMLQKLLDAEKEMLYDEFKDRAGDLVTGTIRRFEKGDIFVDLGKFEGVMTSRERVPNEDYSVGDRMRFYVVEVRTE-ARGPEVILSRSHPNLVRRLFESEVVEIGDQTVEIHGIAREAGYRTKVAVISHDDKVDPVGACVGMRGARVKNIVRELNNEKVDILEWTEDPVTFVREALSP--VEPREITVDEE--ARKIFVIVQDDKDLSKAIGRRGQNARLTSRLMGWDVQV 343
>gi|188586067|ref|YP_001917612.1| NusA antitermination factor [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350754|gb|ACB85024.1| NusA antitermination factor [Natranaerobius thermophilus JW/NM-WN-LF] (380 aa)
Score = 408, Expect = 1.5e-37, Identities = 121/347 (34%), Positives = 197/347 (56%)
  Q:    15 KEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAI---EDKIEFED 361
           ++K  +K+ +   ++ AL  +Y K N D D  V V + +E+  ++++ ++ VV++ E+     ++I++ EA+++   Y++ D V  EV    F R       Q++   + +     +YEE+ DK  +II   V++++ + V ++LG  + ++   EQ+  +E   G      + EVK + TK   IILSR   GL++ LL+ E+ EI DG +EIK I+R  GY++KVA+ SR   VD VG+ VG KG RI+ I   L  E IDVI +  DP  F+ N+  P K++ V++ D++D    +   +V P+  L   IGK G N RL +KLT W IDI+SE       E  +E ED
  S:    14 RDKGINKDILFEAIEAALISAY-KRNFDSDKNVRVHMERETGDVRVYHQKQVVEEVENP---KEQISLEEARKISPGYEVDDLVEEEVTPKNFGRIAAQTAKQVVIQRIREAERELIYEEYVDKQDDIINGIVQRIEQKNVIIDLGKVEAILPPQEQMDTDEYNQGDRIKAYVVEVK-KTTKEPQIILSRTHPGLIKRLLELEVPEIYDGTVEIKGIAREAGYRSKVAVYSRHEEVDPVGSCVGNKGSRIQSIVDELKGENIDVITWSSDPVVFISNSLSPSKVLEVKVLDEQD----QKARVVVPDHQLSLAIGKEGQNARLAAKLTNWKIDILSESQLAEKGESSVEVED 356
>gi|169334799|ref|ZP_02861992.1| hypothetical protein ANASTE_01205 [Anaerofustis stercorihominis DSM 17244] >gi|169257537|gb|EDS71503.1| hypothetical protein ANASTE_01205 [Anaerofustis stercorihominis DSM 17244] (394 aa)
Score = 407, Expect = 1.6e-37, Identities = 132/355 (37%), Positives = 214/355 (60%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNL-----NDISNSKVYEEWKDKVGNIIRAEVE-----------KVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           K F+E LD+I K K   KE I+  ++ AL  +Y K++   ++++VV++N+ S  I  F  + +V++ EDE   D+EI++ EA  L KS  LG ++ T ++   F R  T +  Q++   L     N ISN+ + ++ +   G I R E +           K  NR++ ++LG  +G++    Q+  E   PG      + +V     KG  IILSR   GL+R L + E++EISDGI+EIK ISR  G ++K+A+ +    +D VGT +GPKG RI+ + + + +E+ID+I Y EDP +++ NA  P  ++ V+I   E+  G     +V  +  L   IGK+G NVRL ++LTGW IDI S K +++++I+
  S:    14 KDFIEALDEINKTKGIDKEEIIVAVEQALVAAY-KKDTRTNVDLVVNINRVSGAIDAFYSKQIVEEVEDE---DREISLHEALVLDKSAVLGASMVTHIDPKGFGRIATQNAKQLIIQKLKESERNIISNTFMKKKDEMVTGVIQREEYKEMRKMVHGEPIKEQNRIIHIDLGKAEGIMNSQNQVRSEHYHPGMRLKVYVSDV-ILTPKGPQIILSRTHPGLIRRLFEEEVAEISDGIVEIKSISREAGSRSKMAVYTADDQIDPVGTCIGPKGFRIQNVLNEIGDEKIDIIKYSEDPVEYIKNALAPADVLRVDILQTEEEDGKNSAAVVVDDSQLSLAIGKDGQNVRLAARLTGWKIDIKS-KSSVQEEIK 380
>gi|49475029|ref|YP_033070.1| transcription elongation factor NusA [Bartonella henselae str. Houston-1] >gi|49237834|emb|CAF27029.1| N utilization substance protein A [Bartonella henselae str. Houston-1] (528 aa)
Score = 407, Expect = 1.6e-37, Identities = 114/359 (31%), Positives = 196/359 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           L+  D +A+EK   +E +++ +  A++K+   +   + +I   ++     IKL     +VD  ED      EI +S+A + +   K+GD  +  +    F R       Q++   + D    + YEE+K+K+G II   V++V+   V V+LG  + +V R E IP E  + G      + +V  ++ +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V + +D     ++ + ++ P++ L   IG+ G NVRL S+LTGW+IDI++E+   E++  EF + S+L
  S:    11 LQIADAVAREKSIDREIVISAMADAIQKAARSRYGQETNIRAEINSKTGEIKLQRLLKIVDIIEDYT---SEITLSDALKRQADAKVGDFFADLLPPMDFGRIAAQSAKQVIVQKVRDAEREQQYEEFKNKIGEIISGTVKRVEYGNVIVDLGRGEAIVRRDELIPRESFRYGDRIRAFVHDVH-REPRGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPDAATFIVNALQPAEVSKVVLDED-----AERIEVIVPDDQLSLAIGRRGQNVRLASQLTGWNIDILTEQEESENRQKEFTERSKL 362
>gi|33152524|ref|NP_873877.1| transcription elongation factor NusA [Haemophilus ducreyi 35000HP] >gi|33148747|gb|AAP96266.1| transcription termination-antitermination factor nusA, N utilization substance protein A [Haemophilus ducreyi 35000HP] (493 aa)
Score = 407, Expect = 1.7e-37, Identities = 106/345 (30%), Positives = 200/345 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+TAL  S  K+   D+DI VV++      + F + ++V++  +     +EI+++ AQ    + +LGD V  E+    F+R       Q+++  + +   +KV E+++ ++  I+ A V+KV+   + ++LG+  + V++R + +P E  +PG     ++  +K + +KG  + ++RA   +L  L K E+ EI + +IEIK  SR  G ++K+A+ S    +D VG  VG +G R++ IS+ L  ER+D++L+D++P QF++NA  P ++  + + +D+       + I    ++L + IG+NG NVRL ++LTGWS+++++
  S:     3 KEILLAAEAVSNEKLLPKEAIFEALETALAISTKKKKGIDIDIRVVINRKTGEFQTFRRWLIVEQVHNMT---REISLAAAQYEDPNVQLGDFVEDEIESIPFDRITMQTARQVISTKIREAERNKVIEQFRTQLNCIVTATVKKVNREQIILDLGNQAEAVIIREDMLPRENFRPGDRIRGVLYAIKPE-SKGPQLFVTRAKPVMLEVLFKLEVPEIGEEVIEIKGASRDAGSRSKIAVKSNDKRIDPVGACVGMRGARVQAISNELGGERVDIVLWDDNPAQFVINAMSPAEVSHIVVDEDK-----HAMDIAVETKNLAQAIGRNGQNVRLATQLTGWSLNVMT 340
>gi|154244252|ref|YP_001415210.1| transcription elongation factor NusA [Xanthobacter autotrophicus Py2] >gi|154158337|gb|ABS65553.1| NusA antitermination factor [Xanthobacter autotrophicus Py2] (531 aa)
Score = 407, Expect = 1.8e-37, Identities = 102/345 (29%), Positives = 190/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  D +A+EK   +  ++  ++ A+ K+   +   + DI   ++     ++L    +VVD+ E+      EI +  A+    + ++GDT++  +    F R       Q++   + +    + Y+E+KD++G+++   V++V+   V V+LG  +G++ R E +P E ++ G      + +V+ ++ +G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+A++SR   VD VG  VG +G R++ + + L  E+ID+I ++ D   F+VNA  P ++V V + +D +      + +V P+  L   IG+ G NVRL ++LTGW IDI++E+
  S:    11 LLQIADAVAREKSIDRSIVIAAMEDAIAKAARSRYGQETDIHADINAKTGELRLARHLLVVDEVENTA---TEITLDGARRHNPAAQVGDTIADTLPPFDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRIGDVVNGLVKRVEYGNVVVDLGRGEGILRRDELLPRETVKTGDRIRAYVYDVR-REPRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIAVISRDQSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNPDIATFIVNALAPAEVVKVVLDEDRE-----RIEVVVPDAQLSLAIGRRGQNVRLATQLTGWDIDIMTEQ 347
>gi|167758065|ref|ZP_02430192.1| hypothetical protein CLOSCI_00403 [Clostridium scindens ATCC 35704] >gi|167663962|gb|EDS08092.1| hypothetical protein CLOSCI_00403 [Clostridium scindens ATCC 35704] (398 aa)
Score = 407, Expect = 1.8e-37, Identities = 112/349 (32%), Positives = 196/349 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            LE L+ + +EKD SKE +++ ++ +L  +        D I++++D      +LF ++ VV+  ED+++   +I++ +A+E+   Y+LGD V   +    F R  T +   ++   + +     VY+++ +K  +I+   V++   + + +NLG    ++  +EQ+ GE  +P +     + EVK+  TKG  I++SR    L++ L ++E+ E+ +GI+EIK I+R  G +TK+A+ S  P VD VG  VG  G R+  I + L  E+ID+I + ++P   + NA  P K++ V    DE     K  +++ P+  L   IGK G N RL ++LTG+ IDI SE  AIE
  S:     5 LLEALNILEEEKDISKETLLDAIENSLLNACKNHFGKADNIKLIMDRTTCDYQLFAEKTVVEDVEDKLE---QISLEDAKEIDSQYELGDIVQIPIESKSFGRIATQNAKNLILQKIREEERKVVYDQYFEKEKDIVTGIVQRYVGKNISINLGKADAMLTENEQVKGEVFKPTERIKLYVVEVKNT-TKGPKILVSRTHPELVKRLFESEVIEVKEGIVEIKSIAREAGSRTKIAVWSNDPDVDPVGACVGMNGARVNAIVNELRGEKIDIINWSDNPAILIENALSPAKVISVMADPDE-----KAASVIVPDYQLSLAIGKEGQNARLAARLTGYKIDIKSETQAIE 345
>gi|86742245|ref|YP_482645.1| NusA antitermination factor [Frankia sp. CcI3] >gi|86569107|gb|ABD12916.1| NusA antitermination factor [Frankia sp. CcI3] (365 aa)
Score = 407, Expect = 1.9e-37, Identities = 100/340 (29%), Positives = 171/340 (50%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDK----VGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           L  I +EKD + + +V  ++TAL  +Y        D  VV+D     + +  +    D +  E DD                              F R  T    Q++   L +      Y ++ D+    V  +++   ++  +R+V VNLG+ +GV+  +EQ+PGE L+ G      +  V ++   G  + LSR    L++ L + E+ E++DG +E+  I+R  G+++K+A+ SRV GV+  G  +GP G R++ + + L  E+ID++ +  DP  F+ +A  P ++  VE+TD    P S+   +V P+  L   IG+ G N RL ++LTGW IDI S+
  S:     8 LRGIEREKDIAFDTLVQAMETALLTAYHHTAGSAQDARVVIDRTTGDVSVLAREQGPDGTSREYDDTPA--------------------------DFGRIATMTAKQVIMQRLREAQQEVTYGQYADREHEIVSGVVQHHEQRAGSRVVLVNLGTVEGVLPPAEQVPGERLEHGDRIKCYVVHV-ARGPHGPTVTLSRTHPELVKGLFRLEVPEVADGTVELAAIAREAGHRSKIAVRSRVAGVNPKGACIGPMGSRVRAVMAELRGEKIDIVDWSADPATFVGSALSPARVARVEVTD----PASRSARVVVPDYQLSLAIGREGQNARLAARLTGWRIDIHSD 321
>gi|157363142|ref|YP_001469909.1| transcription elongation factor NusA [Thermotoga lettingae TMO] >gi|157313746|gb|ABV32845.1| NusA antitermination factor [Thermotoga lettingae TMO] (344 aa)
Score = 406, Expect = 2.1e-37, Identities = 112/341 (32%), Positives = 183/341 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
            L+ LD++ +EK  SK+ I+ IL+ AL  +Y K      +++V +D     I+LF+   VV++ ED +    ++++ EA++     + G  +  ++++  F R       Q+L   + ++   + YE +    G++I  EV +V +   ++ +G  +  + + E I GE +  G+     ++ V  +  KG  I++SRA    +  LLK EI EI + I++IK I R  G +TKVA++S  P VD VG  +G  G RI  I   L  E++D+  + +DP+Q +VNA  P  +  VEI D E     K V ++ P   L   IGK G N RL +KLTGW IDI
  S:     5 LLDALDQLEEEKGISKDEIIEILEKALVSAYKKNFGTAKNVDVKIDRMTGDIQLFQVFDVVEEVEDPL---TQMSVEEARKADPLAESGKKIFKKISVKNFGRIAAQTAKQVLIQRIRELEKERQYEHYSTLAGSVITVEVIRVTSDWADIRVGKIETRLPKREWISGESISAGELIKVYVQSV-VKDKKGPKIMVSRAVPEFVAGLLKLEIPEIENDIVQIKAIVREPGVRTKVAVVSTNPQVDPVGACIGEGGSRISAILRELKGEKVDIFRWTDDPRQLIVNALAPASVTSVEILDFE----RKAVRVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDI 338
>gi|121602814|ref|YP_989501.1| transcription elongation factor NusA [Bartonella bacilliformis KC583] >gi|120614991|gb|ABM45592.1| transcription elongation protein nusA [Bartonella bacilliformis KC583] (537 aa)
Score = 406, Expect = 2.2e-37, Identities = 116/359 (32%), Positives = 196/359 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           L+  D +A+EK   +E +++ +  A++K+   +   + +I   ++     IKL     +VD  ED      EI++S+A + +   K+GD +   +    F R       Q++   + D   +  +EE+K+KVG II   V++V+   V V+LG  + VV R E IP E    G      + +V  ++ +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW+IDI++E+   E++  EF + S+L
  S:    11 LQIADAVAREKSIDREIVISAMADAIQKAARSRYGQETNIRAEINSKTGEIKLQRLLQIVDIVEDYT---TEISLSDALKHQADAKIGDFIFDLLPSMDFGRIAAQSAKQVIVQKVRDAERNHQFEEFKNKVGEIISGTVKRVEYGNVIVDLGRGEAVVRRDELIPCESFHYGDRIRAFVNDVH-REPRGPQIFLSRTHPQFMAKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPDAATFVVNALQPAEVSKVILDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWNIDILTEQEESENRQKEFTERSKL 362
>gi|182417570|ref|ZP_02948895.1| transcription termination factor NusA [Clostridium butyricum 5521] >gi|182378583|gb|EDT76111.1| transcription termination factor NusA [Clostridium butyricum 5521] (384 aa)
Score = 406, Expect = 2.2e-37, Identities = 121/346 (34%), Positives = 203/346 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-----IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           + F+  L ++ KEK   ++ I   ++ AL  +Y K   +++     ++V +D     I+++ ++VVVD+  D+     EI+I EA+ +   Y++ D V  EV    F R       Q++T  + +   + +Y+E+K++  +II   + + D  +V VNLG  +GV+  +EQIPGEE +  +     I EVK+  +KG  I +SR   GL++ L + E+ EI +G++E+K ISR  G ++K+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I + +DP +F+ N+  P K++ VE+ ++     +K   +V  +  L   IGK G NVRL +KLT W IDI S+
  S:     3 EEFVGALRELVKEKGICEDLIFTTIQDALVAAYKKNYANVNTNAQNVKVNIDRETGEIRVYAQKVVVDEVYDD---VTEISIEEAKVVSPKYEVDDIVDLEVTPKNFGRVAAQLAKQVVTQRIKEAERNIIYDEYKEQEFDIITGTILRKDKGMVFVNLGKLEGVIGPNEQIPGEEYKFNEKLKLYIVEVKNG-SKGPQIHVSRTHPGLVKRLFELEVPEIFEGVVEVKSISREAGSRSKIAVYSNDEEVDAMGACVGPKGVRVQNIVNELKNEKIDIIKWSKDPAEFIANSLSPAKVLSVEVDEE-----NKTAKVVVDDNQLSLAIGKEGQNVRLAAKLTNWKIDIKSK 344
>gi|95929628|ref|ZP_01312370.1| NusA antitermination factor [Desulfuromonas acetoxidans DSM 684] >gi|95134325|gb|EAT15982.1| NusA antitermination factor [Desulfuromonas acetoxidans DSM 684] (388 aa)
Score = 406, Expect = 2.3e-37, Identities = 113/345 (32%), Positives = 186/345 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           +D++ K+K   ++ +V  L++A L  +  K     ++E   +  +  ++LFE   VVD+ +D     KEI++ EA+E+    + GD++  +++   F R       Q++   + +     VY E+KD+VG ++   V + +   + V+LG  + ++   EQ+P E  +        I EVK    KG  IILSR    L+  L KTE+ EIS+GI+EI   SR  G + K+A++S  P VD VG  VG +G R++ + S L  E+ID+I +  D  +F  +A  P  +  V + ++E     + + I+ P++ L   IGK G NVRL ++L GW IDI SE  A E
  S:     9 IDQVVKDKGVDRDILVEALESAVLSAANKKYRNTRELEAHYNTEQGEVELFEFVTVVDEVQDSY---KEIDLEEAREIDPDVECGDSLGMKMDSGSFSRIAAQTAKQVIIQKVREAEREGVYNEFKDRVGELVNGIVRRYERGDLIVDLGRAEALLPHREQVPRENYRQADRVRAYIAEVK-MSPKGPQIILSRTHPSLVIELFKTEVPEISEGIVEIVSCSREPGSRAKIAVVSHDPDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWTPDMARFACSALAPADVSRVYVDNEE-----QAMEIIVPDDQLSLAIGKKGQNVRLAARLIGWKIDIKSETRAAE 345
>gi|190889787|ref|YP_001976329.1| N-utilization substance protein (transcription elongation factor) [Rhizobium etli CIAT 652] >gi|190695066|gb|ACE89151.1| N-utilization substance protein (transcription elongation factor) [Rhizobium etli CIAT 652] (533 aa)
Score = 405, Expect = 3.0e-37, Identities = 106/344 (30%), Positives = 191/344 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R+  VVDK+ED      +I +  A++      LGD ++  +    F R       Q++   + +    + ++E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII++K ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + +DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKA-ARSRYGTESNIRADINPKTGEIRLQRLLEVVDKAEDY---STQIPLELARDRNPDAALGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENVRYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDPATFVVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTE 345
>gi|49473872|ref|YP_031914.1| transcription elongation factor NusA [Bartonella quintana str. Toulouse] >gi|49239375|emb|CAF25708.1| N utilization substance protein A [Bartonella quintana str. Toulouse] (543 aa)
Score = 405, Expect = 3.2e-37, Identities = 116/359 (32%), Positives = 197/359 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           L+  D +A+EK   +E +++ +  A++K+   +   + +I   ++     IKL     +VD  ED      EI +S+A + +   K+GD  +  +    F R       Q++   ++D    + YEE+K+K+G II   V++V+   V V+LG  + +V R E IP E    G      + +V  ++ +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V +  DED+   + + ++ P++ L   IG+ G NVRL S+LTGW+IDI++E+   E++  EF + S+L
  S:    11 LQIADAVAREKSIDREIVISAMADAIQKAARSRYGQETNIHAEINSKTGEIKLQRLLKIVDIVEDYT---TEITLSDALKRQADAKIGDFFADLLPPMDFGRIAAQSAKQVIVQKVHDAERDQQYEEFKNKIGEIISGTVKRVEYGNVIVDLGRGEAIVRRDELIPRESFHYGDRIRAFVSDVH-REPRGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPDAATFIVNALQPAEVSKVVL--DEDV---ERIEVIVPDDQLSLAIGRRGQNVRLASQLTGWNIDILTEQEESENRQKEFTERSKL 362
>gi|156975664|ref|YP_001446571.1| transcription elongation factor NusA [Vibrio harveyi ATCC BAA-1116] >gi|156527258|gb|ABU72344.1| hypothetical protein VIBHAR_03397 [Vibrio harveyi ATCC BAA-1116] (495 aa)
Score = 404, Expect = 3.4e-37, Identities = 104/345 (30%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  S  K+   ++D+ V +D      + F + +VV   ED  +  KEI++  AQ      +LGD V  ++    F+R  T    Q++   + +   +++ E++ D  G++I   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI++ IIE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVAEAVSNEKAVPRERIFEALEIALATSTKKKYEIEIDVRVAIDRKTGEFETFRRWLVV---EDVENPTKEISLEAAQYEDADIQLGDFVEDDIPSVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLITGVVKKVNRETVVLDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIAEEIIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|86355778|ref|YP_467670.1| transcription elongation factor NusA [Rhizobium etli CFN 42] >gi|86279880|gb|ABC88943.1| N-utilization substance protein A [Rhizobium etli CFN 42] (533 aa)
Score = 404, Expect = 3.7e-37, Identities = 106/344 (30%), Positives = 191/344 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R+  VVDK+ED      +I +  A++      LGD ++  +    F R       Q++   + +    + ++E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII++K ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + +DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKA-ARSRYGTESNIRADINPKTGEIRLQRLLEVVDKAEDY---STQIPLELARDRNPDAALGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENVRYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDPATFVVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTE 345
>gi|121587876|ref|ZP_01677633.1| N utilization substance protein A [Vibrio cholerae 2740-80] >gi|153215844|ref|ZP_01950176.1| N utilization substance protein A [Vibrio cholerae 1587] >gi|121547912|gb|EAX57996.1| N utilization substance protein A [Vibrio cholerae 2740-80] >gi|124114561|gb|EAY33381.1| N utilization substance protein A [Vibrio cholerae 1587] (495 aa)
Score = 404, Expect = 3.9e-37, Identities = 101/345 (29%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  S  K+   ++D+ V +D    + + F + +VV+  E      KEI+   A    +S +LGD +  ++    F+R  T    Q++   + +   +++ E++ D  G ++   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALETALATSTKKKYEIEIDVRVAIDRKTGAFETFRRWLVVENVEHPT---KEISFEAASFDDESVQLGDYIEDQIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGELVTGVVKKVNRETVILDLGNNAEAVILREDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIGEELIELKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIMDED-----AHSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|149202949|ref|ZP_01879920.1| transcription elongation factor NusA [Roseovarius sp. TM1035] >gi|149143495|gb|EDM31531.1| transcription elongation factor NusA [Roseovarius sp. TM1035] (540 aa)
Score = 404, Expect = 4.0e-37, Identities = 116/360 (32%), Positives = 197/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D      K    R VV+    E +   E+ +++A++     K+GDT   EV   +  R       Q++   + +    + +EE+KD++G II   V++ +   V V++G  + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR D   +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V I +D     ++ + +V PEE L   IG+ G NVRL S+LTG  IDI++E    E +  EFE+ ++L
  S:    11 LLQTAEAVAREKMIDPALVVEAMEESLARAAKSRYGSEMDIRVNIDRKTGRAKFTRVRTVVEDEAVE-NYQAEMTVAQAKQYLDDPKVGDTYVEEVPPVEMGRIAAQSAKQVILQKVREAERDRQFEEFKDRLGTIINGVVKREEYGNVIVDVGRGEAILRRNEKIGREAYRPNDRVRCYIKDVRREQ-RGPQIFLSRTDPQFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQATFLVNALQPAEVSKVVIDED-----AQRIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEAEDSERRQKEFEERTKL 365
>gi|153826517|ref|ZP_01979184.1| N utilization substance protein A [Vibrio cholerae MZO-2] >gi|149739697|gb|EDM53904.1| N utilization substance protein A [Vibrio cholerae MZO-2] (495 aa)
Score = 404, Expect = 4.1e-37, Identities = 102/345 (29%), Positives = 193/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  S  K+   ++D+ V +D    + + F + +VV+  E      KEI+   A     S +LGD V  ++    F+R  T    Q++   + +   +++ E++ D  G ++   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALETALATSTKKKYEIEIDVRVAIDRKTGAFETFRRWLVVENVEHPT---KEISFEAASFDDDSVQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGELVTGVVKKVNRETVILDLGNNAEAVILREDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIGEELIELKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIMDED-----AHSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|169196133|ref|ZP_02855487.1| NusA antitermination factor [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169090876|gb|EDS69586.1| NusA antitermination factor [Rhizobium leguminosarum bv. trifolii WSM2304] (535 aa)
Score = 403, Expect = 4.4e-37, Identities = 106/344 (30%), Positives = 191/344 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R+  VVDK+ED      +I +  A++      LGD ++  +    F R       Q++   + +    + ++E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII++K ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + +DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKA-ARSRYGTESNIRADINPKTGEIRLQRLLEVVDKAEDY---STQIPLELARDRNPDAALGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENVRYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDPATFVVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTE 345
>gi|85712989|ref|ZP_01044027.1| transcription elongation factor NusA [Idiomarina baltica OS145] >gi|85693158|gb|EAQ31118.1| transcription elongation factor NusA [Idiomarina baltica OS145] (497 aa)
Score = 403, Expect = 4.6e-37, Identities = 97/345 (28%), Positives = 199/345 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L++AL  +  K+ + D+D+ + +D        F + +VV+ ++  ++   +EI++S AQ    S +LGD V  ++   +F+R  T    Q++   + +   ++V +E++D+VG ++   V++ +   V ++LG+  + ++ R E +P E ++PG     L+ +V+ +  +G  + ++R+    L  L + E+ EI + +IE+K  +R  G + K+A+ S    +D VG  VG +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I    ++L + IGK+G NVRL S+L+GW++++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALESALAHATKKKYDGDIDVRIDIDRATGEFDTFRRWLVVEDTDTGLEHPYREISLSAAQYEDPSLQLGDYVEEQIESIQFDRITTQTAKQVIVQKVREAERAQVVDEYRDQVGELVTGTVKRANREHVILDLGNNAEAIIYREEMLPRESVRPGDRVRGLLYDVRPE-ARGAQLFVTRSRPEFLMELFRIEVPEIGEEMIELKGAARDPGSRAKIAVKSNDRRIDPVGACVGMRGARVQAVSGELGGERVDIVLWDDNPAQFVINAMAPAEVASIVVDED-----AHTMDIAVAADNLAQAIGKSGQNVRLASQLSGWTLNVMT 344
>gi|15887443|ref|NP_353124.1| transcription elongation factor NusA [Agrobacterium tumefaciens str. C58] >gi|15154956|gb|AAK85909.1| N-utilization substance protein A [Agrobacterium tumefaciens str. C58] (538 aa)
Score = 403, Expect = 5.3e-37, Identities = 107/345 (31%), Positives = 193/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R+  VV+ +ED      +I +  A++     KLGD ++  +    F R       Q++   + +    + Y+E+KD++G I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII+IK ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + ++P  F+VNA  P ++  V + D+E    S+ + +V P+E L   IG+ G NVRL S+LTGW IDI++E+
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKA-ARSRYGSETNIRADINSKTGEIRLQRLLEVVEAAEDY---STQIPLELARDRNPDAKLGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRIGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENMRYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQIKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQEPASFIVNALQPAEVAKV-VLDEE----SERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTEQ 346
>gi|116333944|ref|YP_795471.1| transcription elongation factor NusA [Lactobacillus brevis ATCC 367] >gi|116099291|gb|ABJ64440.1| Transcription elongation factor [Lactobacillus brevis ATCC 367] (401 aa)
Score = 403, Expect = 5.4e-37, Identities = 115/349 (32%), Positives = 186/349 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDL--DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           K  L  LD +  EK   K+ +++ L+ AL  +Y K N D   ++EV  D  K  I ++  + VVD+     D   E+ + EA  + K Y+LGD +  EV    F R       Q++   + +   + +Y ++      I+  EVE+ D+R V V+LG  + V+ R +Q+P E  +        +  V++  TKG  + +SR    LL+ L + E+ EI DG +EI  I+R  G + KVA+ S  P +D VGT+VGP+G+R++ I + L  E +D++ + +D  +F+ NA +P +++ V      D    +   ++ P+  L   IGK G N RL +KLTG+ IDI SE  A
  S:     3 KELLGALDVLETEKGIDKQVVIDALEAALVSAY-KRNYDQAQNVEVEFDQRKGDIHVYAVKKVVDQV---YDSRLEVGLDEALTINKGYELGDDIKFEVTPKNFGRIAAQTAKQVILQRVREAERNIIYNQYSQYENEIVTGEVERQDSRFVYVSLGKVEAVMGRQDQMPNETYRIHDRVKVYVTRVENA-TKGPQVFVSRTHADLLKRLFEQEVPEIYDGTVEIMAIAREAGDRAKVAVRSNNPDIDPVGTSVGPRGQRVQTIVNELGGENMDIVEWTDDEAKFIANALNPAEVLDVIF----DPNNERACEVIVPDYQLSLAIGKRGQNARLAAKLTGYKIDIKSESEA 344
>gi|15640662|ref|NP_230291.1| transcription elongation factor NusA [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121728410|ref|ZP_01681438.1| N utilization substance protein A [Vibrio cholerae V52] >gi|147674353|ref|YP_001216136.1| transcription elongation factor NusA [Vibrio cholerae O395] >gi|153801994|ref|ZP_01956580.1| N utilization substance protein A [Vibrio cholerae MZO-3] >gi|153818700|ref|ZP_01971367.1| N utilization substance protein A [Vibrio cholerae NCTC 8457] >gi|153822531|ref|ZP_01975198.1| N utilization substance protein A [Vibrio cholerae B33] >gi|153829178|ref|ZP_01981845.1| N utilization substance protein A [Vibrio cholerae 623-39] >gi|194531816|ref|YP_002067257.1| N utilization substance protein A [Vibrio cholerae MO10] >gi|9655078|gb|AAF93808.1| N utilization substance protein A [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121629344|gb|EAX61776.1| N utilization substance protein A [Vibrio cholerae V52] >gi|124122453|gb|EAY41196.1| N utilization substance protein A [Vibrio cholerae MZO-3] >gi|125617770|gb|EAZ46324.1| N utilization substance protein A [Vibrio cholerae MO10] >gi|126510780|gb|EAZ73374.1| N utilization substance protein A [Vibrio cholerae NCTC 8457] >gi|126519949|gb|EAZ77172.1| N utilization substance protein A [Vibrio cholerae B33] >gi|146316236|gb|ABQ20775.1| N utilization substance protein A [Vibrio cholerae O395] >gi|148875367|gb|EDL73502.1| N utilization substance protein A [Vibrio cholerae 623-39] (495 aa)
Score = 403, Expect = 5.6e-37, Identities = 101/345 (29%), Positives = 193/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  S  K+   ++D+ V +D    + + F + +VV+  E      KEI+   A     S +LGD +  ++    F+R  T    Q++   + +   +++ E++ D  G ++   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALETALATSTKKKYEIEIDVRVAIDRKTGAFETFRRWLVVENVEHPT---KEISFEAASFDDDSVQLGDYIEDQIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGELVTGVVKKVNRETVILDLGNNAEAVILREDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIGEELIELKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIMDED-----AHSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|83815918|ref|YP_445895.1| transcription elongation factor NusA [Salinibacter ruber DSM 13855] >gi|83757312|gb|ABC45425.1| N utilization substance protein A [Salinibacter ruber DSM 13855] (546 aa)
Score = 402, Expect = 6.4e-37, Identities = 110/370 (29%), Positives = 198/370 (53%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKEN----IVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKT 370
           M+ +  + +  +IA+ KD  ++     + ++ +  L K Y     D   E++ +  +  I++   + VV   E E D   EI  SEA+++   + +GD V+  +++ +F RR      Q     + DI   +VY+E+ + +G+I+  E+ +V      +    T+ V+ R EQIPG+  + G     ++KEV+        +++SR     +  L + E+ E+ DGI+EIK+++RI G + KVA+ S    VD VG  VG KG RI  +   L++E IDV+ + +DP++ +  A  P +   V +  DED P +++     P + + + IGK G+N++L S+LTG+ ID+  E  A E+ I+ E     ++ +T
  S:     1 MRSEDLISSFGEIARSKDMDRDTLQIIVEDVFRAMLRKRY---GSDEAFEIIFNPKQGDIQILHIQEVVGDWEVE-DPVTEIKESEAKKIDDGFAVGDEVAGGLDVSEFGRRAVMTARQTFRQRIRDIEKEQVYQEYTELIGDIVVGEIYQVRRHETLLMHEDTELVLPRDEQIPGDHYRKGNMLRTVVKEVRRDAGSDPQVVVSRTSPVFMERLFEVEVPEVHDGIVEIKKVARIPGDRAKVAVESHDEKVDPVGACVGVKGVRINAVVRELSDENIDVMQWSDDPQELIARALSPAEPTNVSLNQDEDPPRARVEV---PADEVSQAIGKRGVNIKLASQLTGYEIDVYREIPADEEDIDIEQFGDELTEET 367
>gi|160932906|ref|ZP_02080295.1| hypothetical protein CLOLEP_01747 [Clostridium leptum DSM 753] >gi|156867980|gb|EDO61352.1| hypothetical protein CLOLEP_01747 [Clostridium leptum DSM 753] (361 aa)
Score = 402, Expect = 6.8e-37, Identities = 105/343 (30%), Positives = 194/343 (56%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR--LVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            E L  + KE+    + +++ +K A+  +  K + + + + ++++N ++   +++ ++ VV++ ED+    +EI++ +A+E+  +  +G+ V  +++  +F R        I+   + D    ++ +E++ +   ++ A VE++D R     + +G  + V+ +SEQ+ GEEL+ G      + +VK  + KG   ++SR    L++ L +TE+ EI DG +EIK +SR  G +TK+A+ S+ P VDAVG  +G +G R+  + + L  E+ID+I Y EDP +F+  A  P  ++ VE+  D    G K   +  P+  L   IG  G N RL +KLTGW IDI  E
  S:     6 FEALSLLEKERGIPVDFMLDKIKKAILTA-CKSSYNGNDDAIINMNPDTGVFEVYLQKTVVEEVEDK---GREISLLDAREIDPNTAVGEKVGVQLDTKQFGRIAAQTARNIIRQGIRDGERGQMMQEFQSRHQELVTATVERIDPRSGAATLKIGKAEAVLPKSEQVGGEELREGDHVKVYVVDVKETE-KGPRAMISRTHPDLVKRLFETEVPEIYDGTVEIKSVSREAGSRTKLAVWSKDPNVDAVGACIGARGARVGNVVNELGGEKIDIIEYSEDPAKFIAAALSPADVLSVEVDPD----GMKACQVTVPDHQLSLAIGNKGQNARLAAKLTGWKIDIKPE 343
>gi|125973509|ref|YP_001037419.1| NusA antitermination factor [Clostridium thermocellum ATCC 27405] >gi|125713734|gb|ABN52226.1| NusA antitermination factor [Clostridium thermocellum ATCC 27405] (404 aa)
Score = 402, Expect = 6.8e-37, Identities = 112/352 (31%), Positives = 197/352 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE---KLAIEDKI 357
            +  L+++ KEK   K+ ++  ++ AL  +Y +      +++V +D      K++  + V    ++E+    EI+I  A+++   ++  D V  EV   KF R       Q++   + +     +Y E+ +K G I+   V++++ + V ++LG  + ++  SEQIPGEE +        I EVK + TKG  I++SR   G+++ L + E+ EI +GI+EIK I+R  G +TK+A+ S+   VD VG  VG KG R++ +   L  E+ID+I +  +P++++ ++  P K++ V+I ++E     K   +  P+  L   IGK G N RL +KLTGW IDI SE   + AIE ++
  S:     5 LIHALEQLEKEKGIDKDTLIEAIEAALISAYKRSFGSSQNVKVSIDRETGDFKVYALKKVTANPQNEL---LEISIENAKKINPDFEENDIVEIEVTPRKFGRIAAQTAKQVVVQRIREAERGIIYNEFSNKEGEIVTGVVQRIERKNVIIDLGKAEAILAPSEQIPGEEYKFNDRIKTYIIEVK-KTTKGPQILVSRTHPGIIKRLFELEVPEIYEGIVEIKSIAREPGSRTKIAVYSKDENVDPVGACVGQKGTRVQAVVDELRGEKIDIIKWSSNPEEYISSSLSPAKVIRVDINEEE-----KSAKVTVPDFQLSLAIGKEGQNARLAAKLTGWKIDIKSESQLRAAIEQQL 351
>gi|27365056|ref|NP_760584.1| transcription elongation factor NusA [Vibrio vulnificus CMCP6] >gi|37680893|ref|NP_935502.1| transcription elongation factor NusA [Vibrio vulnificus YJ016] >gi|27361202|gb|AAO10111.1|AE016802_154 Transcription pausing L factor [Vibrio vulnificus CMCP6] >gi|37199642|dbj|BAC95473.1| n utilization substance protein A [Vibrio vulnificus YJ016] (495 aa)
Score = 402, Expect = 7.3e-37, Identities = 103/345 (29%), Positives = 193/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  S  K+   ++D+ V +D        F + +VVD+ E+     KEI+   A    +S +LGD +  E+    F+R  T    Q++   + +   +++ E++ D  G+++   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI++ IIE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I     +L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILAVAEAVSNEKAVPRERIFEALEIALATSTKKKYEIEIDVRVAIDRKTGEFVTFRRWLVVDEVENPT---KEISFEAANYDDESVQLGDFIEEEIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLVTGVVKKVNRETVVLDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIAEEIIELKGAARDPGSRAKIAVKTNDRRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEAGNLAQAIGRNGQNVRLASQLTGWELNVMT 340
>gi|110636252|ref|YP_676460.1| transcription elongation factor NusA [Mesorhizobium sp. BNC1] >gi|110287236|gb|ABG65295.1| NusA antitermination factor [Mesorhizobium sp. BNC1] (534 aa)
Score = 402, Expect = 7.3e-37, Identities = 103/345 (29%), Positives = 192/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  D +A+EK   K  ++  +  A++K+  +     +  +  D+N ++ ++  +R++ +  E+  +  ++I+I +A+      + GD ++ ++    F R       Q++   + +    + YEE+KD+VG I+   V++V+   V V+LG  +G++ R E IP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++E+   F+VNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW IDI++E+
  S:    10 LLQIADAVAREKSIDKTIVIQAMADAIQKA-ARSRYGQETNIRADINAQTGEMKLQRLM-EVVENVEEPARQISIVDARTRNPDAQAGDFIAEQLPPMDFGRIAAQSAKQVIVQKVREAERDRQYEEYKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDELIPRESFKYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMAKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVISHDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWNENAASFIVNALQPAEVSKVVLDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTEE 346
>gi|163802303|ref|ZP_02196197.1| transcription elongation factor NusA [Vibrio campbellii AND4] >gi|159173832|gb|EDP58646.1| transcription elongation factor NusA [Vibrio campbellii AND4] (495 aa)
Score = 401, Expect = 7.5e-37, Identities = 104/345 (30%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  S  K+   ++D+ V +D      + F + +VV+  E+     KEI+I  AQ      +LGD V  ++    F+R  T    Q++   + +   +++ E++ D  G++I   V+KV+   V ++LG+  + V+LR +Q+P E L+PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI++ IIE+K  +R  G + K+A+ +     D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVAEAVSNEKAVPRERIFEALEIALATSTKKKYEIEIDVRVAIDRKTGEFETFRRWLVVENVENPT---KEISIEAAQYEDADAQLGDFVEDDIPSVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLITGVVKKVNRETVVLDLGNNAEAVILRDDQLPRENLRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIAEEIIELKGAARDPGSRAKIAVKTNDKRTDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|83945005|ref|ZP_00957371.1| transcription elongation factor NusA [Oceanicaulis alexandrii HTCC2633] >gi|83851787|gb|EAP89642.1| transcription elongation factor NusA [Oceanicaulis alexandrii HTCC2633] (578 aa)
Score = 401, Expect = 8.2e-37, Identities = 104/338 (30%), Positives = 194/338 (57%)
  Q:    13 IAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           +A+EK   +  ++  ++ A++K+   +   +LDI   ++     ++L  +  VV++ E+E     +I + EA++     ++G     E+   +F R  +    Q++T  + +    + + E+KD++G I+   V++V+   V ++LG  +G++ RS+ IP E LQ        I +V+ ++T+G  I LSRA    +  L   E+ E+ +G+IEI R++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ DP  F+VNA  P ++  V + DDE    ++ + +V P++ L   IG+ G NVRL S+LTGW+IDI++E+
  S:    19 VAQEKMIDESIVLEAIEEAIQKAARSRYGAELDIHCKINPKTGEMRLTSRTTVVEEVENEA---HQITLDEAKKRDPEAEIGSFYEEELPPIEFGRVASQTAKQVITQKVREAERKRQFNEYKDRIGEIVNGIVKRVEYGNVIIDLGKAEGIIRRSDGIPRESLQVNDRVRAYIYDVR-EETRGPQIFLSRAHPDFMAALFAQEVPEVYEGVIEIPRVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVNELAGEKIDIIPWNPDPATFIVNALQPAEVAKV-VLDDE----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWAIDILTEE 348
>gi|126734454|ref|ZP_01750201.1| transcription termination factor NusA, putative [Roseobacter sp. CCS2] >gi|126717320|gb|EBA14184.1| transcription termination factor NusA, putative [Roseobacter sp. CCS2] (538 aa)
Score = 401, Expect = 8.5e-37, Identities = 112/345 (32%), Positives = 189/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK+     +V  ++ +L ++   +   ++DI V +D           R VV++ E E +   E  +++A+E  +  ++G     EV   +  R       Q++   + +    K YEE+KD+ G II A V++ +   V V++G+ + V+ R+E+I  E  +P       IKEV+ +Q +G  I LSR     +  L K E+ EI +GIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKNIEPGLVVEAMEESLARAAKSRYGAEMDIRVAIDRKTGKATFTRVRTVVEEEELE-NYQAEFTVAQAKEYMEDPEVGQQFIEEVPPVELGRIAAQSAKQVILQKVREAERDKQYEEFKDRAGTIINALVKREEYGNVIVDVGAGEAVLRRNEKIGREAYRPNDRIRCFIKEVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYEGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDMPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEE 349
>gi|85710531|ref|ZP_01041595.1| transcription elongation factor NusA [Erythrobacter sp. NAP1] >gi|85687709|gb|EAQ27714.1| transcription elongation factor NusA [Erythrobacter sp. NAP1] (547 aa)
Score = 401, Expect = 8.5e-37, Identities = 121/355 (34%), Positives = 194/355 (54%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI-EFEDVSQL 365
           + +A EK   K  ++  ++ A++KS    Y  EN   DI   +D N   + L+    VV++ ED     K++++ +AQ+L+    +GD +   +      R       Q++   + D    + +EE+KD+ G II   ++ V+   V VNLG  +GV+ R +QIP E  + G+    LI +V+ +  +G  I LSRA    +R L   E+ EI DGIIEIK  +R  G + K+ ++S    +D VG  VG KG R++ +   L  E+ID+I + ED   F+VNA  P  +  V + D+ED      + +V P++ L   IG+ G NVRL S+LTG  IDI++E+ A E +  EF + S++
  S:    17 NSVASEKMIDKTIVIEAMEEAIQKSARNRYGAEN---DIRAKLDPNTGDLTLWRVVEVVEEVEDYF---KQVDLKQAQKLQDGASVGDFIVDPLPPVDLGRIDAQSAKQVIFQKVRDAERERQFEEFKDRAGEIITGVIKSVEFGHVIVNLGRAEGVIRRDQQIPREAARVGERVRALITKVE-RNNRGPQIFLSRAAPDFMRKLFAQEVPEIYDGIIEIKAAARDPGSRAKIGVISHDSSIDPVGACVGMKGSRVQAVVQELQGEKIDIIPWSEDTATFVVNALQPATVARV-VLDEED----GRIEVVVPDDQLSLAIGRRGQNVRLASQLTGHQIDIMTEEEASEKRSKEFAERSKM 364
>gi|27467860|ref|NP_764497.1| transcription elongation factor NusA [Staphylococcus epidermidis ATCC 12228] >gi|27315405|gb|AAO04539.1|AE016747_36 transcription termination-antitermination factor [Staphylococcus epidermidis ATCC 12228] (407 aa)
Score = 401, Expect = 8.6e-37, Identities = 123/357 (34%), Positives = 198/357 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           M     L   + + KEK   +E +++ ++ AL  +Y K+N D    V V+LN +  S ++  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     +Y+E+ DK  +I+   +++VD+R V VNLG  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S  P +DAVG  VG KG R++ +   L  E+ID++ +DEDPK F+ NA  P +++ V I D+E+    +   +V P+  L   IGK G N RL +KLT W IDI SE  A E  I
  S:     1 MSSNELLLATEYLEKEKKIPREVLIDAIEAALITAY-KKNYDSARNVRVELNMDEGSFRVIARKEVV---EEVFDDRDEVDLSTALVKNPAYEVGDIYEQDVTPKDFGRVGAQAAKQAVMQRLRDAEREILYDEFIDKEEDILTGVIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVYSDNPDIDAVGACVGSKGARVEAVVEELGGEKIDIVQWDEDPKVFVRNALSPSQVLEV-IVDEEN----QSTVVVVPDYQLSLAIGKRGQNARLAAKLTSWKIDIKSESDAREAGI 349
>gi|163757748|ref|ZP_02164837.1| transcription elongation factor NusA [Hoeflea phototrophica DFL-43] >gi|162285250|gb|EDQ35532.1| transcription elongation factor NusA [Hoeflea phototrophica DFL-43] (550 aa)
Score = 400, Expect = 1.0e-36, Identities = 108/360 (30%), Positives = 193/360 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +E ++  +  A++K+   +   + +I   ++     IKL     VV+ +ED      +I +  A++     +LGD ++  +    F R       Q++   + +    + ++E+KD++G ++   V++V+   V V+LG  +G+V R E IP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGIIEI+ ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I +   P  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E+   + +  EF + +QL
  S:    14 LLQIADAVAREKSIDREIVIAAMADAIQKAARSRYGSESNIRADINAKTGEIKLQRLLEVVEHAEDY---STQIPLMLARDRNPDAQLGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRIGEVVNGTVKRVEYGNVIVDLGRGEGIVRRDETIPREAFRYGDRIRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIEIRSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPSPATFIVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDILTEEEESQRRQKEFNERTQL 366
>gi|17988250|ref|NP_540884.1| transcription elongation factor NusA [Brucella melitensis 16M] >gi|23503011|ref|NP_699138.1| transcription elongation factor NusA [Brucella suis 1330] >gi|62291000|ref|YP_222793.1| transcription elongation factor NusA [Brucella abortus bv. 1 str. 9-941] >gi|82700909|ref|YP_415483.1| transcription elongation factor NusA [Brucella melitensis biovar Abortus 2308] >gi|148559551|ref|YP_001259957.1| transcription elongation factor NusA [Brucella ovis ATCC 25840] >gi|161620071|ref|YP_001593958.1| transcription elongation factor NusA [Brucella canis ATCC 23365] >gi|189025212|ref|YP_001935980.1| Ribosomal protein S1 [Brucella abortus S19] >gi|17984018|gb|AAL53148.1| N UTILIZATION SUBSTANCE PROTEIN A [Brucella melitensis 16M] >gi|23349051|gb|AAN31053.1| N utilization substance protein A [Brucella suis 1330] >gi|62197132|gb|AAX75432.1| MusA, N utilization substance protein A [Brucella abortus biovar 1 str. 9-941] >gi|82617010|emb|CAJ12119.1| Ribosomal protein S1:RNA binding S1:KH domain:KH domain, type 1 [Brucella melitensis biovar Abortus 2308] >gi|148370808|gb|ABQ60787.1| N utilization substance protein A [Brucella ovis ATCC 25840] >gi|161336882|gb|ABX63187.1| transcription termination factor NusA [Brucella canis ATCC 23365] >gi|189020784|gb|ACD73506.1| Ribosomal protein S1 [Brucella abortus S19] (537 aa)
Score = 400, Expect = 1.0e-36, Identities = 113/360 (31%), Positives = 194/360 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N +S  IKL     VV+  ED      +I++  A++     ++GD ++ ++    F R       Q++   + +    + Y+E+KD+VG I+   V++V+   V V+LG  + +V R E IP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V + +D     ++ + +V P + L   IG+ G NVRL S+LTGW IDI++E    E +  EF + S L
  S:    10 LLQIADAVAREKSIDREIVLAAMADAIQKA-ARSRYGQESNIRADINAKSGEIKLQRLLEVVENVEDYA---TQISLFMARDRNPDAQVGDFIADQLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRVGEIVNGTVKRVEYGNVIVDLGRGEAIVRRDELIPREAFRYGDRIRAYVYDVRREQ-RGPQIFLSRTHPQFMAKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDASIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPDAASFIVNALQPAEVAKVVLDED-----AERIEVVVPNDQLSLAIGRRGQNVRLASQLTGWDIDILTEDEESERRQKEFAERSNL 362
>gi|116249893|ref|YP_765731.1| transcription elongation factor NusA [Rhizobium leguminosarum bv. viciae 3841] >gi|115254541|emb|CAK05615.1| putative transcription elongation protein (N utilization substance protein A) (L factor) [Rhizobium leguminosarum bv. viciae 3841] (533 aa)
Score = 400, Expect = 1.1e-36, Identities = 105/344 (30%), Positives = 191/344 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R+  VV+K+ED      +I +  A++      LGD ++  +    F R       Q++   + +    + ++E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII++K ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + +DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKA-ARSRYGTESNIRADINPKTGEIRLQRLLEVVEKAEDY---STQIPLELARDRNPDAALGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENVRYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDPATFVVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTE 345
>gi|91974715|ref|YP_567374.1| transcription elongation factor NusA [Rhodopseudomonas palustris BisB5] >gi|91681171|gb|ABE37473.1| NusA antitermination factor [Rhodopseudomonas palustris BisB5] (540 aa)
Score = 400, Expect = 1.1e-36, Identities = 108/360 (30%), Positives = 199/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VVDK E+  +   +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y E+KD++G+++   V++V+   V V+LG  + +V R E +P E  + G      I +V+ ++T+G  I LSR     +  L + E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E    E +  +FE+ +++
  S:    10 LLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYGSETDVHAEIDAKKGELRLSRHMLVVDKVENAAN---QISLKDAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDVVNGVVKRVEYGSVIVDLGRGEAIVRRDEMLPRESFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMAKLFQQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTETEESERRQADFENSTRV 364
>gi|56460077|ref|YP_155358.1| transcription elongation factor NusA [Idiomarina loihiensis L2TR] >gi|56179087|gb|AAV81809.1| Transcription elongation factor NusA [Idiomarina loihiensis L2TR] (499 aa)
Score = 400, Expect = 1.2e-36, Identities = 99/346 (28%), Positives = 202/346 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L   + ++ EK   +E I   L++AL  +  K+  D DIEV +D+++ +     F + +VV+ ++  ++   +EI++S AQ    S + GD V  +++  +F+R  T    Q++   + +   ++V +E++++VG ++   V++ +   V ++LG+  + ++ R E +P E ++PG     L+ +V+ +  +G  + +SR +   L  L + E+ EI + +IE++  +R  G + K+A+ S    +D VG  VG +G R++ +S  L  ER+D++L+D++P Q+++NA  P ++  + + +D     +  + I    ++L + IGK G NVRL S+LTGW++++++E
  S:     3 KEILLVAEAVSNEKAVPREKIFEALESALAHA-TKKKYDGDIEVRIDIDRTTGEFDTFRRWLVVEDTDSGLEHPYREISLSAAQYEDPSVQAGDYVEEQIDSIQFDRITTQTAKQVIVQKVREAERAQVVDEYREQVGEMVSGIVKRANREHVILDLGNNAEAIIYRDEMLPRESVRPGDRIRGLLYDVRPE-ARGAQLFVSRTNPNFLLELFRIEVPEIGEEMIELRGAARDPGSRAKIAVKSNDKRIDPVGACVGMRGARVQAVSGELGGERVDIVLWDDNPAQYVINAMAPAEVASIVVDED-----AHTMDIAVAADNLAQAIGKGGQNVRLASQLTGWTLNVMTE 345
>gi|160940464|ref|ZP_02087809.1| hypothetical protein CLOBOL_05354 [Clostridium bolteae ATCC BAA-613] >gi|158437044|gb|EDP14811.1| hypothetical protein CLOBOL_05354 [Clostridium bolteae ATCC BAA-613] (394 aa)
Score = 400, Expect = 1.2e-36, Identities = 114/351 (32%), Positives = 195/351 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIV----NILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           K  LE ++ + KEK+ SK+ ++    N L TA +  + K +   +++V V+ N     ++ ++ VV+  ED   D  E+++++A+ L   Y++GDTV   ++  KF R  T +   ++   + +     +Y E+  K  +++   V++   R V +NLG    ++  SEQ+ GE  +P +     + EVK    KG  + +SR    L++ L ++E++E+ DG +EIK I+R  G +TK+A+ S    VD VG  VG  G R+  I S L  E+ID+I +D++P   + NA  P K++ V + D+E+    +   ++ P+  L   IGK G N RL ++LTG+ IDI SE  A E
  S:     9 KELLEAMEVLEKEKNISKDTLIEAIENSLLTACKNHFGKAD---NVKVTVNPNTCDFAVYAEKAVVENVED---DCLEMSLADAKMLNPKYEIGDTVQIPLDSKKFGRIATQNAKNVILQKIREEERKALYNEYYMKEKDVMTGVVQRYLGRNVSINLGRVDAILNESEQVKGETFRPTERVKVYVIEVKDT-PKGPRVSVSRTHPDLVKRLFESEVAEVRDGTVEIKAIAREAGSRTKIAVKSNDANVDPVGACVGLNGSRVNSIVSELKGEKIDIINWDDNPAYLIENALSPAKVICV-VADEEE----REAQVIVPDYQLSLAIGKEGQNARLAARLTGFKIDIKSETQARE 351
>gi|118470868|ref|YP_886962.1| transcription elongation factor NusA [Mycobacterium smegmatis str. MC2 155] >gi|118172155|gb|ABK73051.1| transcription termination factor NusA [Mycobacterium smegmatis str. MC2 155] (343 aa)
Score = 399, Expect = 1.4e-36, Identities = 94/251 (37%), Positives = 148/251 (58%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           F R   +   Q++   L D  N KVY E+    G+I+   +++ D R     LV V +GS    ++GV+  +EQ+PGE  + G      +  V ++  +   I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ SRVPG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D+      +   ++ P+  L   IGK G N RL ++LTGW IDI S+   + D
  S:    79 FGRIAATTARQVILQRLRDAENEKVYGEFAAHEGDIVAGVIQR-DARANARGLVVVRMGSETKGSEGVIPAAEQVPGERYEHGDRVRCYVVGV-TRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDE----AGRAARVIVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSDAAPVGD 332
>gi|150016083|ref|YP_001308337.1| transcription elongation factor NusA [Clostridium beijerinckii NCIMB 8052] >gi|149902548|gb|ABR33381.1| NusA antitermination factor [Clostridium beijerinckii NCIMB 8052] (398 aa)
Score = 399, Expect = 1.4e-36, Identities = 115/346 (33%), Positives = 199/346 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-----IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           + F+  L ++ KEK   ++ +   ++ A+  +Y K   + +     ++V +D     I ++ ++ VVD+  D++    EI++ EA+EL    ++ D +S EV    F R       Q++T  + +   + +Y+E+K+K  +II   + + D  +V VNLG  +G++  +EQIP EE +  +     I EVK+   KG  I +SR   GL++ L + E+ EI +G++EIK ISR  G ++K+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + ++P++F+ N+  P K++ V + ++     +K   +V  +  L   IGK G NVRL +KLT W IDI S+
  S:     3 EEFVGALKELVKEKGICEDLLFTTIQDAMVAAYKKNYANANTNAQNVKVNIDRETGEIHVYAQKTVVDEVYDDV---TEISLEEAKELNPKSEVDDIISLEVTPKNFGRVAAQLAKQVVTQRIKEAERTIIYDEYKEKEFDIITGTILRKDKGIVFVNLGKLEGIIGPNEQIPNEEYKFNEKLKLYIVEVKNGN-KGPQIHVSRTHPGLVKRLFELEVPEIFEGVVEIKSISREAGSRSKIAVYSNDEEVDPMGACVGPKGVRVQSIVNELKNEKIDIIKWSKNPEEFIANSLSPAKVLSVAVDEN-----NKSAKVVVDDNQLSLAIGKEGQNVRLAAKLTNWKIDIKSK 344
>gi|167359421|ref|ZP_02294060.1| NusA antitermination factor [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167073708|gb|EDR77545.1| NusA antitermination factor [Rhizobium leguminosarum bv. trifolii WSM1325] (533 aa)
Score = 399, Expect = 1.5e-36, Identities = 105/344 (30%), Positives = 191/344 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV--VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R+  VV+K+ED      +I +  A++      LGD ++  +    F R       Q++   + +    + ++E+KD+VG I+   V++V+   V V+LG  +G++ R E IP E ++ G      + +V+ +Q +G  I LSR     +  L   E+ EI DGII++K ++R  G + K+A++S    +D VG  VG +G R++ +   L  E+ID+I + +DP  F+VNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKVIDREIVLAAMADAIQKA-ARSRYGTESNIRADINPKTGEIRLQRLLEVVEKAEDY---STQIPLELARDRNPDAALGDFIADPLPPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENVRYGDRVRAYVYDVRREQ-RGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDPATFVVNALQPAEVAKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTE 345
>gi|94986976|ref|YP_594909.1| transcription elongation factor NusA [Lawsonia intracellularis PHE/MN1-00] >gi|94731225|emb|CAJ54588.1| transcription elongation factor [Lawsonia intracellularis PHE/MN1-00] (440 aa)
Score = 399, Expect = 1.5e-36, Identities = 104/340 (30%), Positives = 191/340 (56%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           LD+I+K+K   ++ +V+ L+ A+  S ++   D LD+EV  + +   I++++ ++VV++  D I    +++I+EA+    S +L D +   + ++   R       Q++   + D     +YEE+KD++G I+   V++ D     +NLG T+ ++ + EQIP E  + G     LI +V+ ++ +G  +I+SRA    +  L + E+ E+ DG ++I  ++R  G + KV +LSR   VD VG  VG +G RI+ I   L+ ERID++++  +   +  NA  P  I  + + + E+     ++ +  P++ L   IG+ G NV+L +KL GW IDI +E
  S:     9 LDQISKDKGLDRDMLVDTLEDAVRTSVIRRYGDNLDVEVSYNDDTGEIEVYQFKIVVEEVTDPI---TQLSITEAKTHDPSAQLDDEMGFRLKVEDLGRIAAQSAKQVIIQRMRDAEQEIIYEEYKDRIGEIVSGIVQRRDKGGWIINLGRTEALLPKDEQIPKEHYKRGDRVQGLIIDVR-KEGRGPQVIISRAHRDYMAALFRREVPEVDDGTVQIMGVARDPGSRAKVTVLSRERDVDPVGACVGVRGSRIQNIVQELHGERIDIVIWSPEITTYARNALAPAIISRITVDETEN-----LLEVTVPDDQLTSAIGRKGQNVKLAAKLLGWKIDIFTE 340
>gi|57866748|ref|YP_188415.1| transcription elongation factor NusA [Staphylococcus epidermidis RP62A] >gi|57637406|gb|AAW54194.1| N utilization substance protein A, putative [Staphylococcus epidermidis RP62A] (407 aa)
Score = 398, Expect = 1.7e-36, Identities = 122/357 (34%), Positives = 197/357 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           M     L   + + KEK   +E +++ ++ AL  +Y K+N D    V V+LN +  S ++  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     +Y+E+ DK  +I+   +++VD+R V VN G  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S  P +DAVG  VG KG R++ +   L  E+ID++ +DEDPK F+ NA  P +++ V I D+E+    +   +V P+  L   IGK G N RL +KLT W IDI SE  A E  I
  S:     1 MSSNELLLATEYLEKEKKIPREVLIDAIEAALITAY-KKNYDSARNVRVELNMDEGSFRVIARKEVV---EEVFDDRDEVDLSTALVKNPAYEVGDIYEQDVTPKDFGRVGAQAAKQAVMQRLRDAEREILYDEFIDKEEDILTGVIDRVDHRYVYVNFGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVYSDNPDIDAVGACVGSKGARVEAVVEELGGEKIDIVQWDEDPKVFVRNALSPSQVLEV-IVDEEN----QSTVVVVPDYQLSLAIGKRGQNARLAAKLTSWKIDIKSESDAREAGI 349
>gi|114799070|ref|YP_758846.1| transcription termination factor NusA [Hyphomonas neptunium ATCC 15444] >gi|114739244|gb|ABI77369.1| transcription termination factor NusA [Hyphomonas neptunium ATCC 15444] (592 aa)
Score = 398, Expect = 1.8e-36, Identities = 111/353 (31%), Positives = 192/353 (54%)
  Q:    13 IAKEKDTSKENIVNILKTALEKSY-LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED-KIEFEDVSQL 365
           +A+EK   +  ++  ++ A+EK+   K   + DI   +D       L+  + VVD    E D+ K++ +SEA+ +  +   G  +  E+    F R       Q++T  + D    + Y E+KD+VG I+   V++V+   V V+LG  +G++ R++ IP E  QP    ++YL+ +    S++ KG  I LSRA    +R L   E+ E+ +G+I+IK  +R  G + K+ ++S    +D VG  VG +G R++ +   L+ E+ID+I +  D   F+VN   P ++  V + +DE     + V +V  ++     IG+ G NVRL S+LTGW ID+I+E    E  + EF++ + L
  S:    20 VAEEKSIDQRIVIEAMQEAIEKAAKAKYGQEHDIRAKIDPATGEQTLWRIQTVVDDETFE-DEAKQLRLSEAKRIDATLVAGSELKEELPPFDFGRVAAQTAKQVITQKVRDAERERQYNEYKDRVGEIVSGIVKRVEYGHVIVDLGRAEGIIRRNDGIPRENFQPNDRVRAYLYKV----SREVKGPQIFLSRAAPDFMRKLFAQEVPEVYEGVIQIKACARDPGSRAKIGVISNDSSIDPVGACVGMRGARVQAVVGELSGEKIDIIPWSFDAATFIVNGLQPAEVSKVVLDEDE-----RRVEVVVADDQFPLAIGRRGQNVRLASQLTGWQIDLITESADSERYQKEFQERTDL 367
>gi|153008085|ref|YP_001369300.1| transcription elongation factor NusA [Ochrobactrum anthropi ATCC 49188] >gi|151559973|gb|ABS13471.1| NusA antitermination factor [Ochrobactrum anthropi ATCC 49188] (535 aa)
Score = 398, Expect = 1.8e-36, Identities = 108/344 (31%), Positives = 186/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N +S  IKL     VV+  ED      +I++  A++     ++GD ++ ++    F R       Q++   + +    + Y+E+KD+VG I+   V++V+   V V+LG  + +V R E IP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ +   L  E+ID+I +  D   F+VNA  P ++  V + +D     ++ + +V P + L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKSIDREIVLAAMADAIQKA-ARSRYGQESNIRADINAKSGEIKLQRLLEVVEHVEDYA---TQISLFTARDRNPDAQVGDFIADQLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRVGEIVNGTVKRVEYGNVIVDLGRGEAIVRRDELIPREAFRYGDRIRAYVYDVRREQ-RGPQIFLSRTHPSFMAKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDASIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPDAASFIVNALQPAEVAKVVLDED-----AERIEVVVPNDQLSLAIGRRGQNVRLASQLTGWDIDILTE 345
>gi|157827030|ref|YP_001496094.1| transcription elongation factor NusA [Rickettsia bellii OSU 85-389] >gi|157802334|gb|ABV79057.1| transcription elongation factor NusA [Rickettsia bellii OSU 85-389] (500 aa)
Score = 398, Expect = 1.9e-36, Identities = 109/344 (31%), Positives = 199/344 (57%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     VV+  ED +    +I+I+EA +     K+   +   +      R       Q++T  + +    K Y ++KD+ G +I   V++++   + V+L   + ++ R +QI GE  + G      +++V+  +TKG  I LSRAD+ +L  L + E++EI +G IEIK ++R  G K K+A+ +   G+D +G+ VG KG R++ I++ LN E+ID+IL++ D  QF++NA  P +I+ + I +D+     + V +V  +E+    IG+ G NVRL +KLTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEVLISTVEQAVQVAGRKKYGNEYNIKAQINRKTGEINLLRVLKVVENVEDYL---TQISITEALQKDPEAKIDGEIYEYLPSIDHARVAAQAAKQVITQRIIEAEREKQYHDFKDRKGEVINGVVKRIEYGDIIVDLNRAEAIIKREQQIKGENFKVGDRVKAYVQDVR-HETKGPQIFLSRADDRMLAKLFELEVTEIYEGGIEIKAVARDPGSKAKIAVFASENGIDPIGSCVGIKGNRVRAITNELNGEKIDIILWNRDVAQFIINALAPAEILKILIDEDK-----RKVEVVVSQENQSLAIGRRGQNVRLAAKLTGWNIDIMTEE 345
>gi|163839410|ref|YP_001623815.1| transcription elongation factor [Renibacterium salmoninarum ATCC 33209] >gi|162952886|gb|ABY22401.1| transcription elongation factor [Renibacterium salmoninarum ATCC 33209] (330 aa)
Score = 398, Expect = 2.1e-36, Identities = 89/248 (35%), Positives = 147/248 (59%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN-RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           F R   S   QI+   L D+ +  V  E++ K G ++  ++++  N  +V+VNLG+ +GV+  +EQ PGE    G      + +V   Q KG  I LSR+  GL+R L + E+ EI+D  +EI  ++R  G++TK+A+ +  PG++A G  +G  G R++ + + LN+E+ID++ + EDP  F+ ++  P ++  V ITD+     ++   ++ P+  L   IGK G N RL +KLTGW IDIIS+ +A
  S:    79 FGRIAASTARQIILQRLRDVEDENVLGEFRGKEGELVSGQIQQGHNPNMVQVNLGTVEGVLPPTEQSPGERYPHGSRIRAFVVDVHRGQ-KGPSITLSRSHPGLVRKLFELEVPEIADKSVEIVALAREAGHRTKIAVKAHRPGINAKGACIGEMGSRVRAVMTELNDEKIDIVDFSEDPATFIASSLSPSRVNSVTITDE----ATRSARVIVPDYQLSLAIGKEGQNARLAAKLTGWRIDIISDAVA 322
>gi|146283631|ref|YP_001173784.1| transcription elongation factor NusA [Pseudomonas stutzeri A1501] >gi|145571836|gb|ABP80942.1| N utilization substance protein A [Pseudomonas stutzeri A1501] (493 aa)
Score = 398, Expect = 2.1e-36, Identities = 105/346 (30%), Positives = 190/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K    D+D+ V ++ +  S + F +  VVD    E D   ++ + +AQE     KLGD    ++   +F R       Q++   + +   ++V E ++D+VG II   V+KV    V V+LG+    +L R + I  E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  +  ER+D++L+DE+P QF++NA  P ++  + + +D     +  + I   E++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPASVIFEALELALATATKKRYEDDVDLRVEINRHNGSYETFRRWTVVDDEHFE-DPAHQLALDQAQERNPDAKLGDVFEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVEAYRDRVGEIISGTVKKVTRDSVIVDLGNNAEALLAREDIIARETFRVGARVRALLKEIRTEN-RGPQLILSRTAPQMLIELFRIEVPEIAEGLIEVMGASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGEIGGERVDIVLWDENPAQFVINAMAPAEVAAIIVDED-----AHAMDIAVAEDNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|85705698|ref|ZP_01036795.1| transcription elongation factor NusA [Roseovarius sp. 217] >gi|85669688|gb|EAQ24552.1| transcription elongation factor NusA [Roseovarius sp. 217] (539 aa)
Score = 397, Expect = 2.2e-36, Identities = 116/360 (32%), Positives = 198/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D      K    R VV  ++D +++   E+ + +A++     K+GD    EV   +  R       Q++   + +    + +EE+KD+VG II   V++ +   V V++G  + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR D   +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V I +D     ++ + +V PEE L   IG+ G NVRL S+LTG  IDI++E    E +  EFE+ ++L
  S:    11 LLQTAEAVAREKMIDPALVVEAMEESLARAAKSRYGSEMDIRVEIDRKTGRAKFTRVRTVV--ADDALENYQAEMTVEQAKQFLDDPKVGDAFVEEVPPVEMGRIAAQSAKQVILQKVREAERDRQFEEFKDRVGTIINGVVKREEYGNVIVDVGRGEAILRRNEKIGREAYRPNDRVRCYIKDVRREQ-RGPQIFLSRTDPQFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDSSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQATFLVNALQPAEVSKVVIDED-----AQRIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEAEDSERRQKEFEERTKL 365
>gi|91205427|ref|YP_537782.1| transcription elongation factor NusA [Rickettsia bellii RML369-C] >gi|91068971|gb|ABE04693.1| N utilization substance protein A, transcription termination factor NusA [Rickettsia bellii RML369-C] (500 aa)
Score = 397, Expect = 2.4e-36, Identities = 109/344 (31%), Positives = 199/344 (57%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     VV+  ED +    +I+I+EA +     K+   +   +      R       Q++T  + +    K Y ++KD+ G +I   V++++   + V+L   + ++ R +QI GE  + G      +++V+  +TKG  I LSRAD+ +L  L + E++EI +G IEIK ++R  G K K+A+ +   G+D +G+ VG KG R++ I++ LN E+ID+IL++ D  QF++NA  P +I+ + I +D+     + V +V  +E+    IG+ G NVRL +KLTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEVLISTVEQAVQVAVRKKYGNEYNIKAQINRKTGEINLLRVLKVVENVEDYL---TQISITEALQKDPEAKIDGEIYEYLPSIDHARVAAQAAKQVITQRIIEAEREKQYHDFKDRKGEVINGVVKRIEYGDIIVDLNRAEAIIKREQQIKGENFKVGDRVKAYVQDVR-HETKGPQIFLSRADDRMLAKLFELEVTEIYEGGIEIKAVARDPGSKAKIAVFASENGIDPIGSCVGIKGNRVRAITNELNGEKIDIILWNRDVAQFIINALAPAEILKILIDEDK-----RKVEVVVSQENQSLAIGRRGQNVRLAAKLTGWNIDIMTEE 345
>gi|196229760|ref|ZP_03128624.1| NusA antitermination factor [Chthoniobacter flavus Ellin428] >gi|196226086|gb|EDY20592.1| NusA antitermination factor [Chthoniobacter flavus Ellin428] (421 aa)
Score = 397, Expect = 2.4e-36, Identities = 113/355 (31%), Positives = 185/355 (52%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           M     L  LD   ++K   +E ++  +  A+  +  K   P  D+ V +D     +K++ K +VV+K E++ D   EI +  A++ K   +LG+ +   V    F R       Q +   +       +Y+E+KD+ G I+   V + +   V V+LG  + V+   E++  E+   G      +  V++   +G  II+SR+    +R L +TE+SEI+D  +EIK I+R  G++TK+A+ S    VD VG  VG +G R+K I   LNNE++D+I +  D K+F++ A  P K+  V + + +     K + I   E+ L   IGK G N RL S+LTGW I+I  +K  IED
  S:     1 MMNSEILAGLDFFERDKGIKREVLLEAINNAVLAAARKAVGPAKDLRVDIDPKSGEMKVYAKLIVVEKVENKHD---EIKLDLAKKFKNDVQLGEELEVPVTPRDFGRIAAQTAKQAMMQRIRQAEKEMIYDEFKDRAGEIVSGTVRRFERLDVVVDLGKFEAVMPNKERVQTEDYNVGDRIRAYVVAVQNG-ARGPEIIISRSHPNFVRRLFETEVSEIADRTVEIKGIAREAGHRTKIAVWSANDKVDPVGACVGMRGARVKNIVRELNNEKVDIIRWSSDTKEFVLEALKPAKVKSVTLDESK-----KNILIKVDEDQLSLAIGKRGQNARLTSRLTGWDINIEQDKSVIED 347
>gi|149189795|ref|ZP_01868076.1| transcription elongation factor NusA [Vibrio shilonii AK1] >gi|148836444|gb|EDL53400.1| transcription elongation factor NusA [Vibrio shilonii AK1] (495 aa)
Score = 397, Expect = 2.4e-36, Identities = 100/345 (28%), Positives = 198/345 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  S  K++  ++D+ V +D      + F + + V++ E      KEI+I  AQ   +S ++GD V  E++   F+R  T    Q++   + +   +++ E++ D  G+++   V+KV+   + ++LG+  + V+LR +Q+P E  +PG     L+ +V + + +G+ + ++R+   +L  L + E+ EI++ +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATSTKKKHEIEIDVRVAIDRKTGEFETFRRWMAVEEVEFPT---KEISIEAAQFDDESIQVGDFVEEEIDSVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLVTGVVKKVNRDTIILDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYKV-APEARGFQLFITRSKPEMLAELFRVEVPEIAEELIELKGAARDPGSRAKIAVKTNDRRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|148259243|ref|YP_001233370.1| transcription elongation factor NusA [Acidiphilium cryptum JF-5] >gi|146400924|gb|ABQ29451.1| NusA antitermination factor [Acidiphilium cryptum JF-5] (506 aa)
Score = 397, Expect = 2.5e-36, Identities = 106/338 (31%), Positives = 182/338 (53%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           D +A+EK   +E ++  ++ A++K+   K   + DI   +D     ++L      V+  E+E   + +I I  A++ K   ++G  +   +    F R       Q++   + +    + Y+E+KD+VG II   V++ +   + V+LG ++ ++ R E IP E L  G      I +V+ ++ +G  I LSR   G L  L   E+ EI +GIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +  +P  F+VNA  P ++  V + D+E    +  V +V P+  L   IG+ G NVRL S+LT W IDI++
  S:    17 DAVAREKQIDREEVLEAMEQAIQKAGRAKYGHEKDIRATIDRKTGDVRLSRWTEAVETVENE---ETQIPIHIARKFKPDIEVGGHLVDPLPPIDFGRIAAQTAKQVIVQRVREYERKRQYDEYKDRVGEIITGVVKRTEYGNLMVDLGRSEALLRRDETIPRENLHNGDRVRAFIYDVR-EEPRGPQIFLSRTHPGFLAKLFAQEVPEIYEGIIEIKAVARDPGSRAKMAVISRDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPNPATFVVNALAPAEVSKV-VLDEE----AGKVEVVVPDTQLSLAIGRRGQNVRLASQLTRWDIDILT 346
>gi|103486103|ref|YP_615664.1| transcription elongation factor NusA [Sphingopyxis alaskensis RB2256] >gi|98976180|gb|ABF52331.1| NusA antitermination factor [Sphingopyxis alaskensis RB2256] (548 aa)
Score = 397, Expect = 2.8e-36, Identities = 114/346 (32%), Positives = 187/346 (54%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK 356
           + +A EK   K  ++  ++ A++++    Y  EN   DI   +D     ++L+    VV+  ED     K+++++  Q+L+K  ++GD +   +      R       Q++   + +    + Y+E+KD+ G II   V+ V+   + VNLG  +GV+ R +QIP E ++ G     LI  V+S+ T+G  I LSRA    ++ L   E+ EI DGIIEIK  +R  G + K+ ++S    +D VG  VG KG R++ +   L  E+ID+I + ED   F+VNA  P  +  V I +D+       + +V P++ L   IG+ G NVRL S+LTG  IDI++E  A E +
  S:    17 NSVASEKMIDKAIVIEAIEEAIQRAARARYGAEN---DIRAKLDPQTGDLRLWRVVEVVETVEDYF---KQVDLAAGQKLQKDARIGDFIVDPLPAVDLGRIDAQSAKQVIFQKVREADRERQYQEFKDRAGEIITGVVKSVEFGHIVVNLGRAEGVIRRDQQIPRELMRVGDRVRALILSVRSE-TRGPQIFLSRAHPDFMKKLFAQEVPEIYDGIIEIKAAARDPGSRAKIGVISYDSSIDPVGACVGMKGSRVQAVVQELQGEKIDIIPWSEDTATFVVNALQPATVQRVVIDEDDG-----RIEVVVPDDQLSLAIGRRGQNVRLASQLTGKQIDIMTEADASEKR 354
>gi|83595108|ref|YP_428860.1| transcription elongation factor NusA [Rhodospirillum rubrum ATCC 11170] >gi|83578022|gb|ABC24573.1| NusA antitermination factor [Rhodospirillum rubrum ATCC 11170] (516 aa)
Score = 396, Expect = 3.6e-36, Identities = 108/339 (31%), Positives = 183/339 (53%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           D +A++K   +E +   ++ A++K+   K   + DI   +D     I+L      ++  E+  ++  +I ++ A+  K   +LG+ +   +    F R       Q++   + D    + + E+KD++G II   V++V+   V V++G  + ++ R E IP E  + G      I +V+ Q+ +G  I LSR  E  +  L   E+ EI DGIIEIK ++R  G + K+A+LS    +D VG  VG +G R++ + + L  E+ID+I +  DP  F+VNA  P ++  V + D+E    +  + +V P+E L   IG+ G NVRL SKLTGW IDI++E
  S:    17 DTVARDKSIEREEVFAAMEQAIQKAGRSKYGHEHDIRARIDRKTGEIRLAR---YIEVVEEVENEFTQITLAGAKRKKADIELGEFLVDPLPPIDFGRIAAQTAKQVIVQKVRDAERERQFAEYKDRLGEIINGLVKRVEFGNVIVDMGRAEALLRRDEVIPREHFKNGDRIRAYIMDVR-QEPRGPQIFLSRTHEQFMAKLFAQEVPEIYDGIIEIKSVARDPGSRAKIAVLSNDHAIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWATDPATFVVNALAPAEVAKV-VLDEE----ANRIEVVVPDEQLSLAIGRRGQNVRLASKLTGWDIDILTE 347
>gi|46578925|ref|YP_009733.1| transcription elongation factor NusA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603474|ref|YP_967874.1| transcription elongation factor NusA [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46448337|gb|AAS94992.1| N utilization substance protein A [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563703|gb|ABM29447.1| NusA antitermination factor [Desulfovibrio vulgaris subsp. vulgaris DP4] (428 aa)
Score = 395, Expect = 3.8e-36, Identities = 104/340 (30%), Positives = 194/340 (57%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           +D+I+K+K   ++ +V  L+ A+  S +++  D DI+V V  N ES  I++++ ++VV + +DE +D +  I + EA++   S ++ D +   + ++   R       Q++   + D     +Y+E+KD+ G II   +++ D     +NLG T+ ++ + EQIP E  + G     +I EV+ ++ +G  +I+SR+    +  L + E+ E+ DG ++I  ++R  G + KVA+LSR   VD VG  VG +G RI+ +   L  ERID++++  +   +  NA  P  I  + + ++E+     ++ ++ P++ L   IG+ G NV+L +KL GW IDI +E
  S:     9 IDQISKDKGLERDMLVATLEEAVRTSVVRKYGD-DIDVEVSYNDESGEIEVYQFKIVVAELDDEDEDGNAHIVLEEARKHDPSVQIDDEMGFRLKVEDLGRIAAQSAKQVIIQRMRDAEQELIYDEFKDRRGEIISGIIQRRDKAGWIINLGRTEALLPKEEQIPREHYKRGDRVQAIIIEVR-KEGRGPQVIVSRSHRDYMAALFRREVPEVDDGTVQIMGVARDPGSRAKVAVLSRERDVDPVGACVGIRGSRIQNVVQELRGERIDIVVWSPEIATYARNALSPAVISRIVVDEEEN-----LLEVIVPDDQLTNAIGRKGQNVKLAAKLLGWKIDIYTE 344
>gi|49483429|ref|YP_040653.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus MRSA252] >gi|82750867|ref|YP_416608.1| transcription elongation factor NusA [Staphylococcus aureus RF122] >gi|49241558|emb|CAG40244.1| putative N utilization substance protein A [Staphylococcus aureus subsp. aureus MRSA252] >gi|82656398|emb|CAI80817.1| transcription termination-antitermination factor [Staphylococcus aureus RF122] (391 aa)
Score = 395, Expect = 3.9e-36, Identities = 120/357 (33%), Positives = 196/357 (54%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           M     L   + + KEK   +  +++ ++ AL  +Y K+N D    V V+LN +  + K+  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     ++EE+ DK  +I+   +++VD+R V VNLG  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S    +DAVG  VG KG R++ +   L  E+ID++ ++EDPK F+ NA  P ++  +E+  DE    ++   +V P+  L   IGK G N RL +KLTGW IDI SE  A E  I
  S:     1 MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAY-KKNYDSARNVRVELNMDQGTFKVIARKDVV---EEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLRDAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFSENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQV--LEVIVDET---NQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGI 349
>gi|67158743|ref|ZP_00419604.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Azotobacter vinelandii AvOP] >gi|67084616|gb|EAM04098.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Azotobacter vinelandii AvOP] (493 aa)
Score = 395, Expect = 4.0e-36, Identities = 104/346 (30%), Positives = 198/346 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDD--KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D D+++ V +N++S     F +  VV   ED++ ++   E+ + EA+E K   ++GD +  ++   +F R       Q++   + +   ++V + ++++VG II   V+KV    V V+LG+    +L R + IP E  + G     L+KE++ +  +G  +ILSR   G+L  L + E+ EI++G+IE+K  SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + +   +++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPAGVIFEALELALATATKKRYED-DVDLRVQINRQSGAYDTFRRWTVV---EDDLLENPAAELTLDEARERKPDVRVGDVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDVYRERVGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIIPRETFRVGARVRALLKEIRPEN-RGPQLILSRTAPGMLIELFRIEVPEIAEGLIEVKAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMAPAEVAAIIVDED-----AHAMDVAVADDNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|161170254|gb|ABX59224.1| transcription elongation factor [uncultured marine bacterium EB000_55B11] (542 aa)
Score = 395, Expect = 4.1e-36, Identities = 119/360 (33%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-----NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK    + ++     A+E+SY K        +LDI   +D     +++   RVVV+ +E E +   E+ + EA+  K+   +GD +  ++    F R       Q++   + +    + YEE+KD+ G II   V++V+   V V++G  + V  R + +  E  + G      IKEV+S+  +G  + LSR     +  L K E+ EI DGIIEIK ++R  G + K+ ++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTG  IDI++E    E +  EFE+ SQL
  S:    11 LLQIADSVAREKMIDPDLVLQ----AMEESYAKAAKSKYGAELDIRAFIDRKSGELEMTRVRVVVEGTEAE-NMYTEMTVEEAKAHKEEPSVGDLIIDKLPPMDFGRIGAQSAKQVILQKVREAERDRQYEEFKDRQGEIINGLVKRVEYGNVIVDVGRGEAVCRRDQLVNREMFRNGDRIRAFIKEVRSEM-RGPQVFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIGVISFDNSIDPVGACVGMRGSRVQAVVNELGGEKIDIIPWNEDAPTFLVNALQPAEVTKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGLDIDIMTETDESERRQKEFEERSQL 365
>gi|126724629|ref|ZP_01740472.1| transcription elongation factor NusA [Rhodobacterales bacterium HTCC2150] >gi|126705793|gb|EBA04883.1| transcription elongation factor NusA [Rhodobacterales bacterium HTCC2150] (534 aa)
Score = 395, Expect = 4.1e-36, Identities = 107/344 (31%), Positives = 187/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSY-LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK      ++  ++ +L ++   +   ++DI V +D           R VV++ E+      E  + EA+  K   ++GD V+ EV   +  R       Q++   + +    + +EE++D+ G II   V++ +   V V++G  +GV+ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DGII+IK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    ++ + +V P+E L   IG+ G NVRL S+LTG  IDI++E
  S:    11 LLQTAEAVAREKMIDPSLVIEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVVEEVENY---QAEFTVEEAKPYKADAEVGDEVTDEVPPVEMGRIAAQSAKQVILQKIREAERDRQFEEFQDRAGTIINGVVKREEYGNVIVDVGRGEGVLRRNEKIGRESYRPNDRIRCFIKDVR-REARGPQIFLSRTAPEFMAELFKMEVPEIYDGIIDIKAVARDPGSRAKIAVISHDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDAPTFLVNALQPAEVSKV-VLDEE----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGLDIDILTE 346
>gi|114769758|ref|ZP_01447368.1| transcription elongation factor NusA [alpha proteobacterium HTCC2255] >gi|114549463|gb|EAU52345.1| transcription elongation factor NusA [alpha proteobacterium HTCC2255] (542 aa)
Score = 395, Expect = 4.1e-36, Identities = 119/360 (33%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-----NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK    + ++     A+E+SY K        +LDI   +D     +++   RVVV+ +E E +   E+ + EA+  K+   +GD +  ++    F R       Q++   + +    + YEE+KD+ G II   V++V+   V V++G  + V  R + +  E  + G      IKEV+S+  +G  + LSR     +  L K E+ EI DGIIEIK ++R  G + K+ ++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTG  IDI++E    E +  EFE+ SQL
  S:    11 LLQIADSVAREKMIDPDLVLQ----AMEESYAKAAKSKYGAELDIRAFIDRKSGELEMTRVRVVVEGTEAE-NMYTEMTVEEAKAHKEEPSVGDLIIDKLPPMDFGRIGAQSAKQVILQKVREAERDRQYEEFKDRQGEIINGLVKRVEYGNVIVDVGRGEAVCRRDQLVNREMFRNGDRIRAFIKEVRSEM-RGPQVFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIGVISFDNSIDPVGACVGMRGSRVQAVVNELGGEKIDIIPWNEDAPTFLVNALQPAEVTKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGLDIDIMTETDESERRQKEFEERSQL 365
>gi|134102374|ref|YP_001108035.1| transcription elongation factor NusA [Saccharopolyspora erythraea NRRL 2338] >gi|133914997|emb|CAM05110.1| putative transcriptional termination/antitermination factor [Saccharopolyspora erythraea NRRL 2338] (352 aa)
Score = 395, Expect = 4.3e-36, Identities = 90/245 (36%), Positives = 142/245 (57%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVE---KVDNR-LVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   +   Q++   L D  + + + E+  K G I+   ++   K ++R +V V +G ++GV+  +EQ+PGE  + G      +  V S+  +G  I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ S V GV+A G  +GP G R++ + S L  E+ID+I Y +DP  F+ NA  P K+V VE+ D+     +K   +V P+  L   IGK G N RL ++LTGW IDI S+
  S:    79 FGRIAATTARQVILQRLRDAEHERTFGEFSTKEGEILGGVIQRDAKANSRGMVIVQVGDSEGVIPAAEQVPGERYEHGMRIKCYVVGV-SRSARGPQITLSRTHPNLVRRLFALEVPEIADGTVEIPAVAREAGHRSKIAVRSTVGGVNAKGACIGPMGARVRNVMSELGGEKIDIIDYSDDPATFVGNALSPAKVVSVEVVDER----AKTARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSD 322
>gi|170754323|ref|YP_001781964.1| N utilization substance protein A [Clostridium botulinum B1 str. Okra] >gi|169119535|gb|ACA43371.1| N utilization substance protein A [Clostridium botulinum B1 str. Okra] (457 aa)
Score = 395, Expect = 4.5e-36, Identities = 141/480 (29%), Positives = 248/480 (51%)
  Q:     4 KSFLENLDKIAKEKDTSKE----NIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRLNNANNKKSTSNKPGSKPNFYSGFSSDDSIETDFDIDQYKAELDSITDDDVEQLLNTNTNSSSRKNKKQIEDDEEVVFYESSKEKNDSQDSTPVTEEVVNDQ 483
           + F+E L +I KEK  S +     I + L TA +K+Y K+    + ++V+++     IK++ ++      +   ++ +EI++ +A+E+  +Y+L D ++ EV   KF R       Q++   + +     VY E+ +K  +I+   V + D   + +N+G ++ V+  +EQIPGE+ +  +     + EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + + P + + NA  P K++ V I D+E+    K   +V  +  L   IGK G NVRL +KLTGW IDI                      K++    + G   L+ A ++K   NK   K +        DSI  D   +  +    S ++++V+  L      +     K+ + ++++  +E   EK  S D+    EE+  D+
  S:     3 QEFVEALREIVKEKGISADLLFTTIEDALVTAYKKNYAKQGGSTNNVKVIMNRENGEIKVYAQK---KVVDFVEEEVEEISLEDAKEIDPNYELEDIINIEVTPKKFGRIAAQAAKQVVIQRIKEEERRIVYNEYIEKEEDILTGTVLRKDKGNILINVGKSEAVLGPNEQIPGEQFRFNEKIKLYVVEVKNT-TKGPQVLISRTHPGLVKRLFELEVPEIYNGIVEIKSIAREAGSRTKIAVYSNDEAVDPMGACVGPKGVRVQNIVNELKNEKIDIIKWSKFPDELICNALSPAKVIDVTIVDEEN----KAARVVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDI----------------------KSKSQAEKEGRLNLSEAKDEKILENKKEDKEDKIDSHEEMDSIVEDTKENIKEEISVSESNEEVDSGLEKTMEEAFNTEDKENKLEKDINLFEDDDEK-PSIDTEKAIEEIFKDE 456
>gi|57651836|ref|YP_186142.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus COL] >gi|87160356|ref|YP_493856.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus USA300] >gi|88194976|ref|YP_499776.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221388|ref|YP_001332210.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509432|ref|YP_001575091.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727925|ref|ZP_02760202.1| transcription termination-antitermination factor [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57286022|gb|AAW38116.1| N utilization substance protein A, putative [Staphylococcus aureus subsp. aureus COL] >gi|87126330|gb|ABD20844.1| transcription termination factor NusA [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202534|gb|ABD30344.1| transcription termination-antitermination factor, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374188|dbj|BAF67448.1| transcription termination-antitermination factor [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368241|gb|ABX29212.1| N utilization substance A [Staphylococcus aureus subsp. aureus USA300_TCH1516] (391 aa)
Score = 395, Expect = 4.8e-36, Identities = 120/357 (33%), Positives = 196/357 (54%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           M     L   + + KEK   +  +++ ++ AL  +Y K+N D    V V+LN +  + K+  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     ++EE+ DK  +I+   +++VD+R V VNLG  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S    +DAVG  VG KG R++ +   L  E+ID++ ++EDPK F+ NA  P ++  +E+  DE    ++   +V P+  L   IGK G N RL +KLTGW IDI SE  A E  I
  S:     1 MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAY-KKNYDSARNVRVELNMDQGTFKVIARKDVV---EEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLRDAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFSENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQV--LEVIVDET---NQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGI 349
>gi|15924256|ref|NP_371790.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus Mu50] >gi|15926849|ref|NP_374382.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus N315] >gi|148267756|ref|YP_001246699.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus JH9] >gi|150393815|ref|YP_001316490.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus JH1] >gi|156979587|ref|YP_001441846.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus Mu3] >gi|13701066|dbj|BAB42361.1| transcription termination-antitermination factor [Staphylococcus aureus subsp. aureus N315] >gi|14247036|dbj|BAB57428.1| transcription termination-antitermination factor [Staphylococcus aureus subsp. aureus Mu50] >gi|147740825|gb|ABQ49123.1| NusA antitermination factor [Staphylococcus aureus subsp. aureus JH9] >gi|149946267|gb|ABR52203.1| transcription termination factor NusA [Staphylococcus aureus subsp. aureus JH1] >gi|156721722|dbj|BAF78139.1| transcription termination-antitermination factor [Staphylococcus aureus subsp. aureus Mu3] (391 aa)
Score = 395, Expect = 4.8e-36, Identities = 120/357 (33%), Positives = 196/357 (54%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           M     L   + + KEK   +  +++ ++ AL  +Y K+N D    V V+LN +  + K+  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     ++EE+ DK  +I+   +++VD+R V VNLG  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S    +DAVG  VG KG R++ +   L  E+ID++ ++EDPK F+ NA  P ++  +E+  DE    ++   +V P+  L   IGK G N RL +KLTGW IDI SE  A E  I
  S:     1 MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAY-KKNYDSARNVRVELNMDQGTFKVIARKDVV---EEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLRDAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFSENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQV--LEVIVDET---NQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGI 349
>gi|120403303|ref|YP_953132.1| transcription elongation factor NusA [Mycobacterium vanbaalenii PYR-1] >gi|119956121|gb|ABM13126.1| NusA antitermination factor [Mycobacterium vanbaalenii PYR-1] (333 aa)
Score = 395, Expect = 4.8e-36, Identities = 111/349 (31%), Positives = 184/349 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSE-DEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           L  I  +K  S + +V+ +K+AL  +Y   E  + D  + +D    ++K+  ++   D +   E DD  E                           F R   +   Q++   L D  N K Y E+  + G+I+   +++ D R     LV V +GS    ++GV+  +EQ+PGE  + G      +  V ++  +   I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ +R PG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D+     ++   ++ P+  L   IGK G N RL ++LTGW IDI S+  A E  +E
  S:     4 LHAIEADKGISVDVVVDTIKSALLTAYRHTEGHEADAHIDIDRKTGAVKVIARQTDEDGNVLHEWDDTPE--------------------------GFGRIAATTARQVILQRLRDAENEKNYGEFSAREGDIVAGVIQR-DARANARGLVVVRMGSETKGSEGVIPAAEQVPGERYEHGDRLRCYVVGV-TRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVATRAPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPARFVANALSPAKVVSVTVIDE----AARAARVIVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSDDAAKEGAVE 331
>gi|153814921|ref|ZP_01967589.1| hypothetical protein RUMTOR_01136 [Ruminococcus torques ATCC 27756] >gi|145847952|gb|EDK24870.1| hypothetical protein RUMTOR_01136 [Ruminococcus torques ATCC 27756] (404 aa)
Score = 394, Expect = 5.3e-36, Identities = 107/349 (30%), Positives = 192/349 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            +E L  + KEK+ SK+ +++ ++ +L  +        D I+V++D +     ++ ++ VV++ ED      EI++ EA++L  + ++GD     V+  +F R  T +   ++   + +     V++++ +K  +I+   V++   + + +NLG    ++  +EQ+ GE  +P +     + EVK+   KG  I++SR    L++ L + E++E+ DG +EIK I+R  G +TK+A+ S  P VD VG  VG  G R+  +   L  E+ID+I +DE+P   + N+  P K++ V        P  KI +++ P+  L   IGK G N RL ++LTG+ IDI SE  AIE
  S:     5 LMEALTILEKEKNISKDVMMDAIENSLISACKNHFGTSDNIKVIMDRDTCDYAVYAEKNVVEEVEDPA---LEISLEEAEKLDSALQVGDIAQIPVHSKEFGRIATQNAKNLILQKIREEERKVVFDQYFEKEKDIVTGVVQRYVGKNISINLGRADAMLTENEQVKGEHFKPTERIKLYVVEVKNT-PKGPKILVSRTHPELVKRLFEAEVAEVRDGTVEIKSIAREAGSRTKMAVWSNDPNVDPVGACVGMNGARVNAVVQELRGEKIDIINWDENPALLIENSLSPAKVISVMAD-----PEEKIASVIVPDYQLSLAIGKEGQNARLAARLTGYKIDIKSETQAIE 345
>gi|21282878|ref|NP_645966.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus MW2] >gi|49486105|ref|YP_043326.1| transcription elongation factor NusA [Staphylococcus aureus subsp. aureus MSSA476] >gi|21204317|dbj|BAB95014.1| transcription termination-antitermination factor [Staphylococcus aureus subsp. aureus MW2] >gi|49244548|emb|CAG42977.1| putative N utilization substance protein A [Staphylococcus aureus subsp. aureus MSSA476] (391 aa)
Score = 394, Expect = 5.6e-36, Identities = 120/357 (33%), Positives = 196/357 (54%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKE--SIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           M     L   + + KEK   +  +++ ++ AL  +Y K+N D    V V+LN +  + K+  ++ VV   E+  DD  E+++S A     +Y++GD    +V    F R       Q +   L D     ++EE+ DK  +I+   +++VD+R V VNLG  + V+  +E+ P E+  P +     + +V+ Q TKG  I +SR+  GLL+ L + E+ EI DG + +K ++R  G ++K+++ S    +DAVG  VG KG R++ +   L  E+ID++ ++EDPK F+ NA  P ++  +E+  DE    ++   +V P+  L   IGK G N RL +KLTGW IDI SE  A E  I
  S:     1 MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAY-KKNYDSARNVRVELNMDQGTFKVIARKDVV---EEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLRDAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIKVYVNKVE-QTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFSENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQV--LEVIVDET---NQSTIVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGI 349
>gi|92115662|ref|YP_575391.1| transcription elongation factor NusA [Nitrobacter hamburgensis X14] >gi|91798556|gb|ABE60931.1| NusA antitermination factor [Nitrobacter hamburgensis X14] (536 aa)
Score = 394, Expect = 5.9e-36, Identities = 107/360 (29%), Positives = 198/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +      ++L    +VVD+ E+  +   +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V V+LG  + VV R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    11 LLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYGSETDVHAEIHPKTGQLQLTRHMLVVDEIENAAN---QISLKDAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGIVKRVEYGSVIVDLGRGEAVVRRDEMLPREVFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMVKLFTQEVPEIYDGIVEIKAVARDPGSRAKIGVISRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVAKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENATRM 365
>gi|152991227|ref|YP_001356949.1| transcription elongation factor NusA [Nitratiruptor sp. SB155-2] >gi|151423088|dbj|BAF70592.1| transcription termination factor NusA [Nitratiruptor sp. SB155-2] (371 aa)
Score = 394, Expect = 6.2e-36, Identities = 112/345 (32%), Positives = 187/345 (54%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKE--INISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD---NRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDII 347
           ++  ++ +D IA EK    E +   ++ A E +  K    DL+ E  +D + +SIK+F+K +VV+  ++    + E  I +SEA+E+  + ++GD +   V  +K  R         +  ++  +   +++E++K ++G II   V +VD   N  VE++    KG++ +  +I GE  +PG     ++K V   +  G  + LSR     L  LLK E+ EI DG++ I++++RI G + KVA+ S  P +D VG  VG +G RI  +S  L  E ID I Y   P+ F+  +  P  I  V+I  D+ I       +  P +   K IGK+GIN+RL S LTG+ I++I
  S:     1 MEKIVDIIDSIAHEKGLPVEQVKEAIQKAFENTAKKVLGEDLEFEAEIDPDTKSIKVFQKILVVEDGDERATQEPERYITLSEAKEIDPNVEVGDELRYPVEFEKLGRTAAMRLHNEIEFHIQRLMEQQLFEKYKQRIGTIISGTVTRVDEEENTYVEID--EVKGILPKRYRIKGEFFKPGDVVKAILKRVVFDKINGIYLELSRTTPKFLEELLKLEVPEIKDGLVTIEKVARIPGERAKVAVNSHSPKIDPVGACVGVRGVRINAVSKELRGENIDCIEYSPIPEIFVARSLSPAIITSVKIEGDKAI-------VTLPSDQKSKAIGKSGINIRLASMLTGYEIELI 342
>gi|196156568|ref|YP_002126057.1| transcription elongation factor NusA [Alteromonas macleodii 'Deep ecotype'] >gi|88773375|gb|EAR04641.1| transcription elongation factor NusA [Alteromonas macleodii 'Deep ecotype'] >gi|196112347|gb|ACG66063.1| transcription elongation factor NusA [Alteromonas macleodii 'Deep ecotype'] (498 aa)
Score = 394, Expect = 6.2e-36, Identities = 98/345 (28%), Positives = 192/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ A+  +  K+N  ++++ V +D        F + +V+   +++ +   EI IS AQ  +   +LGD V  ++   KF+R  T    Q++   + +    ++  E++DKVG ++   V+KV+   + ++LG+  +GV+ R + +P E  +PG     L+  ++ +  +G  + +SR    +L  L + E+ EI++  +EIK  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ER+D++L+DE+P QF++NA  P ++  + + +D     S  + +    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILLVAEAVSNEKQVPREKIFEALEFAIASATKKKNEGEIEVRVSIDRTSGDFDTFRRWLVIPDDQEQENPFAEITISAAQIDEPEIQLGDYVEEQIESIKFDRITTQTAKQVIVQKVREAERQQMIAEYEDKVGELVTGTVKKVNRDNIIIDLGNNAEGVIYRDDMLPRETFRPGDRVRGLLYVIRPE-ARGAQLFISRTHPDMLVELFRLEVPEIAEETLEIKSAARDPGSRAKIAVKTNDKRLDPVGACVGMRGSRVQAVSGELGGERVDIVLWDENPAQFVINAMAPAEVASIVVDED-----SNNMDVAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 343
>gi|90422002|ref|YP_530372.1| transcription elongation factor NusA [Rhodopseudomonas palustris BisB18] >gi|90104016|gb|ABD86053.1| NusA antitermination factor [Rhodopseudomonas palustris BisB18] (541 aa)
Score = 393, Expect = 6.4e-36, Identities = 107/360 (29%), Positives = 198/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV++ E+      +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V V+LG  + +V R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E    E +  +FE+ +++
  S:    11 LLQIADAVAREKSIDRSIVIAAMEDAIAKAARARYGSETDVHAEIDAKKGELRLSRHMLVVEEVENS---SNQISLKDAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIVRRDEMLPREVFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVISRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTETEESERRQADFENSTRV 365
>gi|88860547|ref|ZP_01135185.1| transcription elongation factor NusA [Pseudoalteromonas tunicata D2] >gi|88817745|gb|EAR27562.1| transcription elongation factor NusA [Pseudoalteromonas tunicata D2] (498 aa)
Score = 393, Expect = 6.7e-36, Identities = 101/345 (29%), Positives = 191/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+ AL  +  K+ + D+D+ V +D    +   F +  +V+  E  +++  +EI I  A     + KLGD +  ++   KF+R  T    Q++   + +   + + E ++D+ G ++   V+K     + ++LG+  + V+ R + +P E  +PG     L+  VK +  +G  + ++R+   +L  L + E+ EI + +IEI+  +R  G + K+A+ S    +D VG  VG +G R++ +S+ L  ERID++LYD++P QF++NA  P ++  + + +D     S+ + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPKEKIFEALEFALATATKKKHDGDIDVRVCIDRKTGAYDTFRRWQIVEDREGGLENPYREITIEAAVYDDPNAKLGDFIEEQIESIKFDRITTQTAKQVIVQKVREAERALIVEAYQDQEGEMVTGVVKKASREAIVLDLGNNAEAVIYRDDMLPRENFRPGDRIRGLLYSVKPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEMIEIRGAARDPGSRAKIAVKSNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLYDDNPAQFVINAMAPAEVASIVMDED-----SRSMDIAVESDNLAQAIGRNGQNVRLASQLTGWELNVMT 344
>gi|85714177|ref|ZP_01045166.1| transcription elongation factor NusA [Nitrobacter sp. Nb-311A] >gi|85699303|gb|EAQ37171.1| transcription elongation factor NusA [Nitrobacter sp. Nb-311A] (535 aa)
Score = 393, Expect = 6.7e-36, Identities = 106/360 (29%), Positives = 198/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +      ++L    +VVD+ E+  +   +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V V+LG  + V+ R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    11 LLQIADAVAREKSIDRSIVIAAMEDAIAKAARARYGSETDVHAEIHPKTGQLQLTRHMLVVDQVENAAN---QISLKDAQRANPGAQVGDTIADTLPPLEYGRISAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGIVKRVEYGSVIVDLGRGEAVIRRDEMLPREVFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMVKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVAKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENATRM 365
>gi|84500726|ref|ZP_00998975.1| transcription elongation factor NusA [Oceanicola batsensis HTCC2597] >gi|84391679|gb|EAQ04011.1| transcription elongation factor NusA [Oceanicola batsensis HTCC2597] (536 aa)
Score = 393, Expect = 6.7e-36, Identities = 112/360 (31%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV+  E E +   E+ + +A++     ++GDT + EV      R       Q++   + +    + YEE+KD+ G II   V++ +   + V++G  + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR D   +  L K E+ EI +GIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    ++ + +V PEE L   IG+ G NVRL S+LT   IDI++ E+ +   + EFE+ ++L
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVVEDEELE-NYQAEMTVEQARQYMADPQVGDTFTEEVPPVDMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGVVKREEYGNIIVDVGRGEAILRRNEKIGRESYRPNDRIRCYIKDVRREQ-RGPQIFLSRTDPQFMAELFKMEVPEIYEGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVTKV-VLDEE----AERIEVVVPEEQLSLAIGRRGQNVRLASQLTALDIDIMTEEEESARRQKEFEERTKL 365
>gi|27375896|ref|NP_767425.1| transcription elongation factor NusA [Bradyrhizobium japonicum USDA 110] >gi|27349034|dbj|BAC46050.1| N-utilization substance protein A [Bradyrhizobium japonicum USDA 110] (536 aa)
Score = 393, Expect = 6.8e-36, Identities = 107/360 (29%), Positives = 199/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV+K E+      +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V V+LG  + ++ R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    10 LLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYGSETDVHAEIDPKKGELRLSRHMLVVEKVENH---SNQISLVDAQRANPGAQVGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIIRRDEMLPREVFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVISRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENSTRV 364
>gi|167751252|ref|ZP_02423379.1| hypothetical protein EUBSIR_02238 [Eubacterium siraeum DSM 15702] >gi|167655759|gb|EDR99888.1| hypothetical protein EUBSIR_02238 [Eubacterium siraeum DSM 15702] (370 aa)
Score = 393, Expect = 6.9e-36, Identities = 112/344 (32%), Positives = 184/344 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQ-ELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRL--VEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPII-LSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
             E L  +AKEK      ++  ++TAL  +  KE P   +I+  +D+ K    +  ++ V  + ED   D  +I++ EA+   ++  + GD V+ +++   F R       Q++   L +I   ++  +W       +   V K + R     VNL   +  + RSEQIPGE L+PG      +  V +   +  P++ +SR ++ L++ L ++E+ EI DG +EIK ISR  G ++KVA++S  P VDA+G  +GP  +RI K+ + L  E++DV+ Y E P++F+  A  P  ++ VEI D    P  K  T + P+  L   IG  G N +L +KLTG+ IDI  E
  S:     9 LFEALTLLAKEKGIDPAVLIEKIQTALVIAIKKEYPRSENIKFDIDIAKGKFDVAIQKEVAAEVED---DANQISMEEAKTHTRRKLEYGDIVAIKLDTQHFGRIAAQTAKQVIKQGLKEIEREQLVAQWGGLQDEAVTVTVLKTEPRTGNATVNLNGNEVPLFRSEQIPGEVLRPGDMVKVYVSGVSATDHR--PMLKISRVNKELVKRLFESEVPEIYDGTVEIKAISREAGSRSKVAVISNNPDVDALGACIGPGRQRISKVCAELGGEKMDVVFYSEKPEEFIAQALKPSDVIRVEIPD----PEVKACTAIVPDNQLSLAIGNKGQNAKLAAKLTGFKIDIRPE 348
>gi|110601936|ref|ZP_01390095.1| transcription termination factor NusA [Geobacter sp. FRC-32] >gi|110547345|gb|EAT60612.1| transcription termination factor NusA [Geobacter sp. FRC-32] (380 aa)
Score = 393, Expect = 7.1e-36, Identities = 110/348 (31%), Positives = 186/348 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           +D+I KEK   K+ ++  L+ A L  +  K     D+E   +     ++LFE   VVD+ +D     KEI++ EA+E+    ++GD++  +++   F R       Q++   + +     ++ E++++ G +I   V + +   + V+LG  + ++   EQ P E  + G     LI E++   TKG  I+LSR    +L  L + E+ EI++GI+E+K + R  G + K+A+ S    VD VG  VG +G R++ + S L  E+ID+I + ED  +F  NA  P  +  V + +D     ++ + IV  ++ L   IGK G NVRL +KLTGW IDI SE    E ++
  S:    11 IDQIVKEKGIDKDVVLEALEQAVLTAANKKFRNTRDLEAHYNPEIGEVELFEFVTVVDEVQDSY---KEIDLDEAREIDPEVEVGDSLGMKMDASGFSRIAAQTAKQVIIQKVREAERETIFNEFQERQGEVINGVVRRFEKGDLVVDLGRAEALLSHKEQAPREVYRQGDRVKALITEIR-MTTKGPQILLSRTHPMMLAKLFEAEVPEIAEGIVEVKNVVREPGSRAKIAVYSHDSDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWSEDVARFACNALAPAVVSKVYVDED-----NRAMEIVVADDQLSLAIGKRGQNVRLAAKLTGWRIDIKSETRVAEAEL 350
>gi|89067479|ref|ZP_01154992.1| transcription elongation factor NusA [Oceanicola granulosus HTCC2516] >gi|89047048|gb|EAR53102.1| transcription elongation factor NusA [Oceanicola granulosus HTCC2516] (542 aa)
Score = 393, Expect = 7.2e-36, Identities = 114/360 (31%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV+  E E +   E+ + +A++     K+GD    E+   +  R       Q++   + +    K YEE+KD+ G II A V++ +   V V++G+ + V+ R+E+I  E  +PG      IK+V+ +Q +G  I LSR     +  L K E+ EI +GIIEIK ++R  G + K+ ++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + +D     ++ + +V PEE L   IG+ G NVRL S+LTG  IDI++E+   + +  EFE+ ++L
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVSIDRRTGRATFTRVRTVVEDEELE-NYQAELTVEQAKQYLDDPKVGDQYIEEIPPVELGRIAAQSAKQVILQKVREAERDKQYEEFKDRAGTIINALVKREEYGNVIVDVGAGEAVLRRNEKIGRESYRPGDRIRCYIKDVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYEGIIEIKAVARDPGSRAKIGVVSYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDMPTFLVNALQPAEVSKVVLDED-----AERIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEEEESKRRQAEFEERTKL 365
>gi|163844176|ref|YP_001628581.1| transcription elongation factor NusA [Brucella suis ATCC 23445] >gi|163674899|gb|ABY39010.1| transcription termination factor NusA [Brucella suis ATCC 23445] (537 aa)
Score = 392, Expect = 8.3e-36, Identities = 112/360 (31%), Positives = 193/360 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N +S  IKL     VV+  ED      +I++  A++     ++GD ++ ++    F R       Q++   + +    + Y+E+KD+VG I+   V++V+   V V+LG  + +V R E IP E  + G      + +V+ +Q +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +      F+VNA  P ++  V + +D     ++ + +V P + L   IG+ G NVRL S+LTGW IDI++E    E +  EF + S L
  S:    10 LLQIADAVAREKSIDREIVLAAMADAIQKA-ARSRYGQESNIRADINAKSGEIKLQRLLEVVENVEDYA---TQISLFMARDRNPDAQVGDFIADQLPPMDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRVGEIVNGTVKRVEYGNVIVDLGRGEAIVRRDELIPREAFRYGDRIRAYVYDVRREQ-RGPQIFLSRTHPQFMAKLFTMEVPEIYDGIIEIKSVARDPGSRAKIAVVSRDASIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPVAASFIVNALQPAEVTKVVLDED-----AERIEVVVPNDQLSLAIGRRGQNVRLASQLTGWDIDILTEDEESERRQKEFAERSNL 362
>gi|55820434|ref|YP_138876.1| transcription elongation factor NusA [Streptococcus thermophilus LMG 18311] >gi|55822318|ref|YP_140759.1| transcription elongation factor NusA [Streptococcus thermophilus CNRZ1066] >gi|55736419|gb|AAV60061.1| transcription termination-antitermination factor [Streptococcus thermophilus LMG 18311] >gi|55738303|gb|AAV61944.1| transcription termination-antitermination factor [Streptococcus thermophilus CNRZ1066] (395 aa)
Score = 392, Expect = 8.3e-36, Identities = 118/345 (34%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK  +KE+I++ +  +L+ +Y K         VV+ N+++   ++F  R VVD+     D   EI++ +A  +  +Y+LGD +  E ++D+F R       Q +   +        Y E+K   G I++  VE+ D R + VNLG+ +  + R +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  +               E IDVI + EDP +F+ NA  P ++  V   +D+    SK  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     3 KEMLEAFRVLEEEKHINKEDIIDAVVESLKSAY-KRRYGQSESAVVEFNEKTGDFQVFTVREVVDEV---FDSRLEISLKDALAISSAYELGDKIRFEESVDEFGRVAAQSAKQTIMEKMRKQMREITYNEYKQHEGEIMQGTVERFDQRFIYVNLGTLEAQLSRQDQIPGESFKSHDVIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVVSRFHPTRLDAKTGIEVPVEENIDVIQWVEDPAEFIYNAIAPAEVDYVLFDEDD----SKRATVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKS 354
>gi|84514878|ref|ZP_01002241.1| transcription elongation factor NusA [Loktanella vestfoldensis SKA53] >gi|84511037|gb|EAQ07491.1| transcription elongation factor NusA [Loktanella vestfoldensis SKA53] (533 aa)
Score = 392, Expect = 8.7e-36, Identities = 111/360 (30%), Positives = 201/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  + +A+EK+     +V  ++ +L ++  K     ++++ V++++++ +    RV    ++D +++   E  +++A++     ++G   S EV   +  R       Q++   + +    K YEE+KD+ G II A V++ +   V V++GS + V+ R+E+I  E  +P       IKEV+ +Q +G  I LSR     +  L K E+ EI +G+IEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V P+E L   IG+ G NVRL S LTG  IDI++E+   + +  EFE  ++L
  S:    11 LLQTAEAVAREKNIEPGLVVEAMEESLARA-AKSRYGAEMDIRVNIDRKTGRATFTRVRTVVADDAVENYQAEFTVAQAKDYMTDPQIGQEYSEEVPPVELGRIAAQSAKQVILQKVREAERDKQYEEFKDRAGTIINALVKREEYGNVIVDVGSGEAVLRRNEKIGREAYRPNDRIRCYIKEVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYEGVIEIKAVARDPGSRAKIAVISYDSSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDMPTFLVNALQPAEVTKV-VLDEE----AGKIEVVVPDEQLSLAIGRRGQNVRLASMLTGLDIDILTEEEESKRRQAEFETRTKL 365
>gi|87200505|ref|YP_497762.1| transcription elongation factor NusA [Novosphingobium aromaticivorans DSM 12444] >gi|87136186|gb|ABD26928.1| NusA antitermination factor [Novosphingobium aromaticivorans DSM 12444] (544 aa)
Score = 392, Expect = 8.7e-36, Identities = 119/355 (33%), Positives = 194/355 (54%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           + +A EK   K  ++  ++ A++KS    Y  EN   DI   +D     ++L+    VV+  ED     K++++ +A++L+   K+GD +   +      R       Q++   + D    + Y+E+KD+ G +I   ++ V+   V VNLG  +GV+ R +QIP E  + G+    LI +V+ +Q +G  I LSRA    ++ L   E+ EI DGIIEIK  +R  G + K+ ++SR   +D VG  VG KG R++ +   L  E+ID+I + ED   F+VNA  P  +  V I ++E       + +V P++ L   IG+ G NVRL S LTG +IDI++E  A E +  EF + S++
  S:    17 NAVATEKMIDKSIVIEAMEEAIQKSARNRYGAEN---DIRAKLDPRTGDLRLWRVVEVVEVVEDYF---KQVDLKQAEKLQPGAKIGDFIVDPLPPVDLGRIDAQSAKQVIFQKVRDAERDRQYDEFKDRAGEVITGVIKSVEFGHVIVNLGRAEGVIRRDQQIPREVPRVGERVRALILKVE-RQNRGPQIFLSRAHPEFMKKLFAQEVPEIYDGIIEIKAAARDPGSRAKIGVISRDSSIDPVGACVGMKGSRVQAVVQELQGEKIDIIPWSEDTATFVVNALQPATVSRVVIDEEE-----SRIEVVVPDDQLSLAIGRRGQNVRLASSLTGSAIDIMTEAEASEKRQKEFAERSKM 364
>gi|114705359|ref|ZP_01438267.1| transcription elongation factor NusA [Fulvimarina pelagi HTCC2506] >gi|114540144|gb|EAU43264.1| transcription elongation factor NusA [Fulvimarina pelagi HTCC2506] (533 aa)
Score = 392, Expect = 9.4e-36, Identities = 107/360 (29%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +E ++  +  A++K+  +     +  +  D+N ++ ++  +R++ +  ED  D   +I +  A++     + GD ++ ++    F R       Q++   + +      Y+E+KD+VG II  +V++V+   V V+LG  + ++ R EQIP E  +PG      + +V+ ++ +G  I LSR     +  L   E+ EI DGII +K ++R  G + K+A++S    VD VG  VG +G R++ +   L  E+ID+I +  D   F+VNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTGW IDI++E+   E +  EF + S++
  S:    10 LLQIADAVAREKTIDREIVIEAMADAIQKA-ARSRYGQETNIRCDINTKTGEMKLQRLL-EVVEDVEDPATQIYLELARDKNPDAEPGDFIAEQLPPMDFGRIAAQSAKQVIVQKVREAERDMQYDEYKDRVGEIINGQVKRVEYGNVIVDLGKGEAIIRRDEQIPRELYRPGDRVRAYVYDVR-REPRGPQIFLSRTHPQFMAKLFTMEVPEIYDGIITLKSVARDPGSRAKIAVVSSDSSVDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSPDAASFIVNALQPAEVAKVVLDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGWDIDILTEEEESERRQKEFNERSEI 362
>gi|86747724|ref|YP_484220.1| transcription elongation factor NusA [Rhodopseudomonas palustris HaA2] >gi|86570752|gb|ABD05309.1| NusA antitermination factor [Rhodopseudomonas palustris HaA2] (539 aa)
Score = 391, Expect = 1.2e-35, Identities = 107/360 (29%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV+  E+  +   +I++  AQ      ++GDT++  +   ++ R       Q++   + +    + Y E+KD++G+I+   V++V+   V V+LG  + +V R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E    E +  +FE+ +++
  S:    10 LLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYGSETDVHAEIDAKKGELRLSRHMLVVENVENPAN---QISLKAAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYSEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIVRRDEMLPRESFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTETEESERRQADFENSTRV 364
>gi|116627258|ref|YP_819877.1| transcription elongation factor NusA [Streptococcus thermophilus LMD-9] >gi|116100535|gb|ABJ65681.1| Transcription elongation factor [Streptococcus thermophilus LMD-9] (391 aa)
Score = 391, Expect = 1.3e-35, Identities = 117/342 (34%), Positives = 188/342 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           LE    + +EK  +KE+I++ +  +L+ +Y K         VV+ N+++   ++F  R VVD+     D   EI++ +A  +  +Y+LGD +  E ++D+F R       Q +   +        Y E+K   G I++  VE+ D R + VNLG+ +  + R +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  +               E IDVI + EDP +F+ NA  P ++  V   +D+    SK  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     2 LEAFRVLEEEKHINKEDIIDAVVESLKSAY-KRRYGQSESAVVEFNEKTGDFQVFTVREVVDEV---FDSRLEISLKDALAISSAYELGDKIRFEESVDEFGRVAAQSAKQTIMEKMRKQMREITYNEYKQHEGEIMQGTVERFDQRFIYVNLGTLEAQLSRQDQIPGESFKSHDVIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVVSRFHPTRLDAKTGIEVPVEENIDVIQWVEDPAEFIYNAIAPAEVDYVLFDEDD----SKRATVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKS 350
>gi|170719906|ref|YP_001747594.1| NusA antitermination factor [Pseudomonas putida W619] >gi|169757909|gb|ACA71225.1| NusA antitermination factor [Pseudomonas putida W619] (493 aa)
Score = 391, Expect = 1.3e-35, Identities = 105/347 (30%), Positives = 194/347 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VVD  E ++DD   E  +++  E     K+GD +  ++   +F R       Q++   + +   ++V + ++++VG II   V+KV    V V+LG+    +L R + IP E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+DE+P QF++NA  P ++  + + +D     +  + I   E++L + IG+ G NVRL S+LTGW++++++EK
  S:     3 KEVLLVVESVSNEKGVPPGVIFEALEVALATATKKRFEDEVDLRVEINRHTGSYETFRRWTVVD--EADLDDPAIETWLAKIHETHPEAKVGDVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERVGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIIPRETFRVGVRLRALLKEIRTEN-RGPQLILSRTAPQMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDENPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVAEDNLAQAIGRGGQNVRLASQLTGWTLNVMTEK 344
>gi|116669975|ref|YP_830908.1| NusA antitermination factor [Arthrobacter sp. FB24] >gi|116610084|gb|ABK02808.1| NusA antitermination factor [Arthrobacter sp. FB24] (326 aa)
Score = 390, Expect = 1.4e-35, Identities = 85/245 (34%), Positives = 146/245 (59%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN-RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   S   QI+   L D  +  V  ++K + G ++   +++ +N  +++VNLG+ + ++   EQ+PGE+   G      + +V  + TKG  I LSR+  GL+R L + E+ EI+D  +EI  ++R  G++TK+A+ + +PG++A G  +G  G R++ + + LN+E+ID++ + EDP  F+ +A  P ++  V ITD+     ++   +V P+  L   IGK G N RL +KLTGW IDI+S+
  S:    79 FGRIAASTARQIILQRLRDAEDDNVLGQFKGREGELVAGTIQQGNNPHMIQVNLGTVEALLPPPEQVPGEKYIHGNRLRAFVIDVH-RGTKGPSITLSRSHPGLVRKLFELEVPEIADRSVEIVALAREAGHRTKIAVKANIPGINAKGACIGEMGSRVRAVMTELNDEKIDIVDFSEDPATFIASALSPSRVNSVTITDE----ATRSARVVVPDYQLSLAIGKEGQNARLAAKLTGWRIDIVSD 319
>gi|158421642|ref|YP_001522934.1| transcription elongation factor NusA [Azorhizobium caulinodans ORS 571] >gi|158328531|dbj|BAF86016.1| transcription termination factor [Azorhizobium caulinodans ORS 571] (532 aa)
Score = 390, Expect = 1.4e-35, Identities = 102/345 (29%), Positives = 187/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  D +A+EK   +  ++  ++ A+ K+   +   + DI   ++     ++L    +VVD+ E+      EI +  A+    + ++GDT++  +    F R       Q++   + +    + Y+E+KD++  ++   V++V+   V V+LG  + ++ R E +P E ++ G      I +V+ ++ +G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+A++SR   VD VG  VG +G R++ + + L  E+ID+I ++ D   F+VNA  P ++V V + +D +      + +V P+  L   IG+ G NVRL S+LTGW IDI++E+
  S:    11 LLQIADAVAREKTIDRGIVIAAMEDAIAKAARSRYGQETDIHAEINPRTGELRLARHLLVVDEVENSA---TEITLDGARRHNPAAQVGDTIADTLPPFDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRISEVVNGLVKRVEYGNVVVDLGRGEAILRRDELLPREVVKTGDRIRAYIYDVR-REPRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIAVISRDQSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNPDIATFIVNALAPAEVVKVVLDEDRE-----RIEVVVPDAQLSLAIGRRGQNVRLASQLTGWDIDILTEQ 347
>gi|113969369|ref|YP_733162.1| transcription elongation factor NusA [Shewanella sp. MR-4] >gi|114046596|ref|YP_737146.1| transcription elongation factor NusA [Shewanella sp. MR-7] >gi|113884053|gb|ABI38105.1| NusA antitermination factor [Shewanella sp. MR-4] >gi|113888038|gb|ABI42089.1| NusA antitermination factor [Shewanella sp. MR-7] (499 aa)
Score = 390, Expect = 1.5e-35, Identities = 100/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+TAL  +  K+   D+D+ V +D    + + F + +V+D +   +++  +EI +  A+      + GD +  E+    F+R  T    Q++   + +   ++V E+++DK G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + L+R    +L  L + E+ EI+D +IE+   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    ESL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALETALATATKKKYEGDIDVRVAIDRKTGAYETFRRWMVIDDNGVALENPYREITLEAARFENPEIQPGDFIEDEIESVAFDRITTQTAKQVIVQKVREAERAQVVEQFQDKEGELITGVVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLTRTKPDMLIELFRVEVPEIADELIEVMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEAESLAQAIGRNGQNVRLATQLTGWELNVMT 344
>gi|149375756|ref|ZP_01893524.1| N utilization substance protein A [Marinobacter algicola DG893] >gi|149359881|gb|EDM48337.1| N utilization substance protein A [Marinobacter algicola DG893] (497 aa)
Score = 390, Expect = 1.5e-35, Identities = 106/339 (31%), Positives = 190/339 (56%)
  Q:    16 EKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           EKD   E I   L TA +K Y  ++ + DI V +D      + F + +VVD   D +     E+ + EA+++ KS + GDT   +V    F R       QI+   + +   +K+ + ++D+VG ++   V+KV    V V+LG+    +L R   IP E  + G     L++E+++   +G  +ILSR D  +L  L + E+ EI++ +IEI+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ER+D++L+D++P Q ++NA  P ++  + + +D        + +   E++L + IG+NG NVRL + LTGW++++++E+ A E
  S:    19 EKDVIFEAIELALATAAKKRY--DDEEADIRVSIDRRTGEYETFRRWLVVDN--DAVPALGTELTMQEAEDIDKSLQPGDTHEEKVESVAFGRIGAQAAKQIIFQKVREAERTKIVDSYRDRVGELVSGTVKKVTRDNVIVDLGANAEALLPREHLIPRETFRMGDRVRSLLQEIRTDH-RGPQLILSRTDPQMLIELFRIEVPEIAEELIEIRGAARDPGSRAKIAVKTNDRRIDPVGACVGMRGSRVQAVSNELGGERVDIVLWDDNPAQLVINAMAPAEVASIVMDEDR-----HTMEVAVAEDNLAQAIGRNGQNVRLATDLTGWTLNVMTEEEAGE 349
>gi|184155206|ref|YP_001843546.1| transcription termination-antitermination factor NusA [Lactobacillus fermentum IFO 3956] >gi|183226550|dbj|BAG27066.1| transcription termination-antitermination factor NusA [Lactobacillus fermentum IFO 3956] (408 aa)
Score = 390, Expect = 1.6e-35, Identities = 119/368 (32%), Positives = 202/368 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPII-LSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGV---EITDDEDIPGS-------------KIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI-ISEKLAIEDKIEFEDVSQLVSSKTRQP 373
            L+ +D + KEK   KE I+  LK AL  +Y K  E+   ++EV +       K++  + VV   E+  +D +EI++++A  + + Y+LGD    EV    F R        ++   L D   + +++++     +++  EV + D R + VNLG   +  + + +Q+P E  +        +  V  +     P++ +SR    LL+ L + E+ EI  GI+E+K I R  G + KVA+ SR   VD VGT VGP+G R++ I + L  E ID++ Y+E P++F+ NA +P ++ GV   E   + D P S             +  T++ P++ L   IGK G NVRL ++LTG+ IDI  S + A  ++ + E  +++V   T+ P
  S:    10 LLDAMDILEKEKGIKKEVIIEALKDALANAYQKNYEDNAANVEVEISDRTGEFKVYAAKTVV---EEVTNDVEEISLADALRVNRGYELGDIFKEEVTPRNFGRLAAQTAKSVVLQKLRDEERNIIFDKYNKLKDDLVEGEVSREDERYIYVNLGDGVEAAMNKHDQMPNEHYRVHDRIQVYVTRVNDKSGARGPLVFVSRTSPDLLKRLFEKEVPEIQQGIVEVKGIVREAGDRAKVAVFSRDENVDPVGTCVGPRGTRVQAIVNQLGGENIDIVKYEEAPEEFIRNALNPAEVEGVLFDENNGEVDEPASVDENGREHEERIHRGCTVIVPDDQLSLAIGKRGQNVRLAAQLTGYKIDIKSSSQAAALEEAQPEPAAEVVEQPTQAP 395
>gi|99082750|ref|YP_614904.1| transcription elongation factor NusA [Silicibacter sp. TM1040] >gi|99039030|gb|ABF65642.1| NusA antitermination factor [Silicibacter sp. TM1040] (538 aa)
Score = 390, Expect = 1.7e-35, Identities = 110/345 (31%), Positives = 190/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV+  E E +   E+ +++A++  +  K+GDT+  EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++GS +G++ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V P+E L   IG+ G NVRL S+LT   IDI++E+
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGSEMDIRVSIDRKTGKATFTRVRTVVEDEELE-NYQSELTVAQAKQYMEDPKVGDTIVDEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRNGTIINGVVKREEYGNVIVDIGSGEGILRRNEKIGRESYRPNDRIRCFIKDVR-REPRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVVSYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPDEQLSLAIGRRGQNVRLASQLTNLDIDIMTEE 349
>gi|163745072|ref|ZP_02152432.1| transcription elongation factor NusA [Oceanibulbus indolifex HEL-45] >gi|161381890|gb|EDQ06299.1| transcription elongation factor NusA [Oceanibulbus indolifex HEL-45] (542 aa)
Score = 390, Expect = 1.7e-35, Identities = 111/345 (32%), Positives = 190/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRV-VVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V  ++ +L ++  K     ++++ VD+N+++ K    RV  V   ED  +   E  + +A++     K+GDT   EV   +  R       Q++   + +    + +EE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARA-AKSRYGAEMDIRVDINRKTGKATFTRVRTVVADEDLENYQAEFTVDQAKQYMAEPKVGDTYVEEVPPVEMGRIAAQSAKQVILQKVREAERDRQFEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRVYIKDVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISHDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEE 349
>gi|56694991|ref|YP_165337.1| transcription elongation factor NusA [Silicibacter pomeroyi DSS-3] >gi|56676728|gb|AAV93394.1| transcription termination factor NusA [Silicibacter pomeroyi DSS-3] (541 aa)
Score = 389, Expect = 1.9e-35, Identities = 112/360 (31%), Positives = 194/360 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE-KLAIEDKIEFEDVSQL 365
            L+  + +A+EK      ++  ++ +L ++   +   ++DI V +D           R VV   E E +   E  + +A++  ++ ++GDT   EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E + +   + EFE  + L
  S:    11 LLQTAEAVAREKMIDPGLVIEAMEESLARAAKSRYGAEMDIRVSIDRKTGKATFTRVRTVVADEELE-NYQAEFTVDQAKQYMENPQIGDTFVEEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRCYIKDVR-REPRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEAEESARRQKEFESRTNL 365
>gi|148263956|ref|YP_001230662.1| transcription elongation factor NusA [Geobacter uraniireducens Rf4] >gi|146397456|gb|ABQ26089.1| NusA antitermination factor [Geobacter uraniireducens Rf4] (383 aa)
Score = 389, Expect = 2.0e-35, Identities = 110/348 (31%), Positives = 186/348 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           +D+I KEK   K+ ++  L+ A L  +  K     D+E   +     ++LFE   VV++ +D     KEI++ EA+E+    ++GD++  +++   F R       Q++   + +     ++ E++++ G +I   V + +   + V+LG  + ++   EQ P E  + G     LI E++   TKG  I+LSR    +L  L + E+ EI++GI+EIK + R  G + K+A+ S    VD VG  VG +G R++ + S L  E+ID+I + ED  +F  NA  P  +  V + +D     ++ + IV  ++ L   IGK G NVRL +KLTGW IDI SE    E ++
  S:    11 IDQIVKEKGIDKDVVLEALEQAVLTAANKKFRNTRDLEAHYNPEIGEVELFEFVTVVEEVQDSY---KEIDLDEAREIDPDVEVGDSLGMKMDASGFSRIAAQTAKQVIIQKVREAERETIFNEFQERHGEVINGVVRRFEKGDLVVDLGRAEALLPHKEQAPREVYRQGDRVKALITEIR-MTTKGPQILLSRTHPMMLAKLFEAEVPEIAEGIVEIKSVVREPGSRAKIAVYSHDSDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWSEDVARFACNALAPAVVSKVYVDED-----NRSMEIVVADDQLSLAIGKRGQNVRLAAKLTGWRIDIKSETRVAEAEL 350
>gi|170017453|ref|YP_001728372.1| transcription elongation factor [Leuconostoc citreum KM20] >gi|169804310|gb|ACA82928.1| Transcription elongation factor [Leuconostoc citreum KM20] (363 aa)
Score = 389, Expect = 2.1e-35, Identities = 108/352 (30%), Positives = 197/352 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFE-KRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNL-GSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           K  ++ LD +  E+   +  ++  L+ AL+ +Y K+ N + ++E V D  K ++ + + K VV+D  ED  ++D EI++ +A  + ++Y+ GD +  +V    F R       Q++   + +     +Y ++ D    II  EV++ D+R + + L G+ +  +  ++Q+P E  + G     L+ +V++   KG  I +SR    L++ L + E+ E+ DG +EI  ISR  G ++K+A+ +  P +D VG  VG +G R++ + + L  E +D++ + ED  Q++ NA +P ++  V I D E+    + VT++ P+  L   IGK G N RL ++LTG+ IDI SE  A +D
  S:     3 KELVDALDALEAERGIERAIVIEALEDALKAAYKKQYNAEQNVEAVFDTKKGNVAIKQVKHVVLD--EDFENEDTEISLEDALAINRAYEPGDEIRFDVTPKDFGRMAAQAAKQVIMQKIREAGREAIYNKFADYQDEIITGEVDRQDSRFLYMTLPGNQEAAMAPNDQMPNEHYRMGDRIKVLVNKVENN-AKGPQIFVSRTAPDLVKRLFEQEVPEVYDGTVEIMSISREAGDRSKIAVYTHDPDLDPVGAMVGQRGGRVQSVVNELGGENMDIVEWVEDEAQYIANALNPSEVTDV-IFDSEN---ERAVTVIVPDNQLSLAIGKKGQNARLAARLTGFKIDIKSETEAAKD 350
>gi|120556256|ref|YP_960607.1| transcription elongation factor NusA [Marinobacter aquaeolei VT8] >gi|120326105|gb|ABM20420.1| NusA antitermination factor [Marinobacter aquaeolei VT8] (497 aa)
Score = 389, Expect = 2.1e-35, Identities = 106/339 (31%), Positives = 186/339 (54%)
  Q:    16 EKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           EKD   E I   L TA +K Y  E+ + DI V +D      + F + +VVD   D +     E+ + EA+E+  + K GD    +V    F R       QI+   + +    K+ + ++D++G ++   V+KV    V V+LG     +L R   IP E  + G     L+ E+++   +G  +ILSR D  +L  L + E+ EI++ +IEI+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ER+D++LYD++P Q ++NA  P ++  + + +D        + +   E++L + IG+NG NVRL ++LTGW++++++E+ A E
  S:    19 EKDVIFEAIELALATAAKKRY--EDEEADIRVAIDRRTGEYETFRRWLVVDN--DAVPALGTELTLQEAEEIDTNLKPGDMYEEKVESVAFGRIGAQAAKQIIFQKVREAERMKIVDSYRDRIGELVSGTVKKVTRDNVIVDLGGNAEALLPREHLIPRETFRMGDRVRALLLEIRTDH-RGPQLILSRTDSQMLIELFRIEVPEIAEELIEIRGAARDPGSRAKIAVKTNDRRIDPVGACVGMRGSRVQAVSNELGGERVDIVLYDDNPAQLVINAMAPAEVASIVMDEDR-----HTMDVAVAEDNLAQAIGRNGQNVRLATELTGWTLNVMTEEEAGE 349
>gi|104780027|ref|YP_606525.1| transcription elongation factor NusA [Pseudomonas entomophila L48] >gi|95109014|emb|CAK13710.1| transcription termination/antitermination, L factor (N utilization substance protein A) [Pseudomonas entomophila L48] (493 aa)
Score = 389, Expect = 2.2e-35, Identities = 104/347 (29%), Positives = 195/347 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VVD  E+++DD   E  +S+ Q+     K+GD +  ++   +F R       Q++   + +   ++V + ++++VG II   V+KV    V V+LG+    +L R + IP E  + G     L+KE++++  +G  ++LSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+DE+P QF++NA  P ++  + + +D     +  + I   E++L + IG+ G NVRL S+LT W++++++EK
  S:     3 KEVLLVVESVSNEKGVPPGVIFEALEVALATATKKRFEDEVDLRVEINRHTGSYETFRRWTVVD--ENDLDDPAIETWLSKIQDTHPDAKIGDVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERVGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIIPRETFRVGVRLRALLKEIRTEN-RGPQLVLSRTAPQMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDENPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVAEDNLAQAIGRGGQNVRLASQLTAWTLNVMTEK 344
>gi|182414628|ref|YP_001819694.1| NusA antitermination factor [Opitutus terrae PB90-1] >gi|177841842|gb|ACB76094.1| NusA antitermination factor [Opitutus terrae PB90-1] (408 aa)
Score = 389, Expect = 2.2e-35, Identities = 113/362 (31%), Positives = 197/362 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSS 368
           L  L+ + KEK   + +++  +  AL K+  ++  +   E+ +++N ++ +L    ++  K  D + + K EI++  AQ LK    +G+ +  E++     R       Q +   L      ++++++KD+VGNI+   V + +   + ++LG  + V+   EQ+PGEE QPG+    L+  ++S   +G  IIL+R     +R L + E++EI+DG ++I+  +R  GY+TK+A++S  P VD VG  VG +G R+K I   LN E+ID+I Y   P++ ++ A  P   V  EIT DE     +I+  V  ++  I  IG+ G N RL S+L GW +D I E  A+ D      ++ LV +
  S:     6 LSVLEYMEKEKGIPRADMIATIANAL-KTAAQKGVNSGQELKIEINAKNGQLHAWCLL--KVVDSVSNPKTEIHVERAQALKPGAIIGEIIEKEIDPSTLGRIAAQTARQAVMQRLRQFEKDRIFDDFKDQVGNIVTGTVRRRERNDLYIDLGKAEAVMPAKEQVPGEEYQPGERIRCLLLNIEST-PRGPEIILTRGSPKFVRRLFELEVTEIADGTVKIEAFAREPGYRTKIAVISTDPKVDPVGACVGARGARVKTIVRELNGEKIDIIRYFASPREMIIEAMKPA--VPREITLDEK--NHRILLKVATDDLAIA-IGRKGQNARLTSRLIGWRLD-IEEFRAVGDDPRGNAIASLVKA 358
>gi|117919478|ref|YP_868670.1| transcription elongation factor NusA [Shewanella sp. ANA-3] >gi|117611810|gb|ABK47264.1| NusA antitermination factor [Shewanella sp. ANA-3] (499 aa)
Score = 388, Expect = 2.4e-35, Identities = 99/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+TAL  +  K+   D+D+ V +D    + + F + +V+D +   +++  +EI +  A+      + GD +  ++    F+R  T    Q++   + +   ++V E+++DK G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + L+R    +L  L + E+ EI+D +IE+   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    ESL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALETALATATKKKYEGDIDVRVSIDRKTGAYETFRRWMVIDDNGVALENPYREITLEAARYENPEIQPGDYIEDQIESVAFDRITTQTAKQVIVQKVREAERAQVVEQFQDKEGELITGVVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLTRTKPDMLIELFRVEVPEIADELIEVMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEAESLAQAIGRNGQNVRLATQLTGWELNVMT 344
>gi|184201252|ref|YP_001855459.1| transcription elongation protein NusA [Kocuria rhizophila DC2201] >gi|183581482|dbj|BAG29953.1| transcription elongation protein NusA [Kocuria rhizophila DC2201] (325 aa)
Score = 388, Expect = 2.5e-35, Identities = 86/250 (34%), Positives = 145/250 (57%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN-RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           F R   +   Q++   L D+ +  V   +K + G ++  ++++ +N R+V+VNLG+ +G++   EQ+PGE  + G      + E K +  KG  I LSR+   L+R L + E+ EI+DG +EI  ++R  G++TK+A+ +R PG +A G  +G  G R++ + + L  E+ID+I + +DP +F+ NA  P ++  V + DD     ++    V P+  L   IGK G N RL ++LTGW IDI+ E  A +
  S:    79 FGRIAAATARQVILQKLRDVEDDNVLGHFKGREGELVSGQIQQGNNPRMVQVNLGTVEGLLPPHEQVPGETYRHGDRIRAFVVEAK-RGFKGPSITLSRSHPDLVRRLFEMEVPEIADGSVEIVTLAREAGHRTKMAVEARRPGANAKGACIGDMGSRVRAVMNELGEEKIDIIDFSQDPAEFIGNALSPARVSRVVVLDD----AARSARAVVPDSQLSLAIGKEGQNARLAARLTGWKIDIVPESRATD 324
>gi|119962022|ref|YP_947326.1| transcription termination factor NusA [Arthrobacter aurescens TC1] >gi|119948881|gb|ABM07792.1| transcription termination factor NusA [Arthrobacter aurescens TC1] (326 aa)
Score = 388, Expect = 2.6e-35, Identities = 85/245 (34%), Positives = 145/245 (59%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN-RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   S   QI+   L D+ +  V  E+K + G ++   +++ +N  +++VNLG+ + ++   EQ+PGE+   G      + +V  +  KG  I LSR+  GL+R L + E+ EI+D  +EI  ++R  G++TK+A+ +  PGV+A G  +G  G R++ + + LN+E+ID++ + +DP  F+ N+  P ++  V ITD+     ++   +V P+  L   IGK G N RL +KLTGW IDI+S+
  S:    79 FGRIAASTARQIILQRLRDVEDDNVLGEFKGREGELVAGMIQQGNNPHMIQVNLGAVEALLPPPEQVPGEKYLHGSRLRAFVVDVH-RGAKGPSITLSRSHPGLVRKLFEMEVPEIADHSVEIVALAREAGHRTKIAVKANTPGVNAKGACIGEMGSRVRAVMTELNDEKIDIVDFSDDPATFIANSLSPSRVNSVTITDES----TRSARVVVPDYQLSLAIGKEGQNARLAAKLTGWRIDIVSD 319
>gi|126738452|ref|ZP_01754157.1| transcription elongation factor NusA [Roseobacter sp. SK209-2-6] >gi|126720251|gb|EBA16957.1| transcription elongation factor NusA [Roseobacter sp. SK209-2-6] (539 aa)
Score = 388, Expect = 2.6e-35, Identities = 109/345 (31%), Positives = 193/345 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSY-LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V+ ++ +L ++   +   ++DI V +D           R VV  ++DE+++   E+ + +A++  ++ ++GD  S EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ +G++ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LT   IDI++E+
  S:    11 LLQTAEAVAREKMIDPGLVVDAMEESLARAAKSRYGSEMDIRVTIDRKTGKATFTRVRTVV--ADDELENYQAEMTVEQARQYMENPEVGDVFSEEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRNGTIINGVVKREEYGNVIVDVGAGEGILRRNEKIGRESYRPNDRIRCYIKDVR-REPRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISHDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTALDIDIMTEE 349
>gi|84684618|ref|ZP_01012519.1| transcription elongation factor NusA [Rhodobacterales bacterium HTCC2654] >gi|84667597|gb|EAQ14066.1| transcription elongation factor NusA [Rhodobacterales bacterium HTCC2654] (539 aa)
Score = 388, Expect = 2.7e-35, Identities = 104/345 (30%), Positives = 188/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      ++  ++ +L ++   +   ++DI V +D           R VV+  E E +   E+ + +A++   +  +GDT+  EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       +K+V+ ++T+G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+ ++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + +D     ++ + +V P++ L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKMIDPSLVIEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVVEDEELE-NYQAELTVEQAKQYLDNPVVGDTIVDEVPPVELGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGVVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRCYVKDVR-RETRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIGVVSYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDMPTFLVNALQPAEVAKVVLDED-----AERIEVVVPDDQLSLAIGRRGQNVRLASQLTGLDIDILTEE 349
>gi|16124300|ref|NP_418864.1| transcription elongation factor NusA [Caulobacter crescentus CB15] >gi|13421138|gb|AAK22032.1| N utilization substance protein A [Caulobacter crescentus CB15] (548 aa)
Score = 388, Expect = 2.7e-35, Identities = 111/344 (32%), Positives = 196/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSED-EIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   KE ++  ++ AL+K+   +   + DI V +D   ++ +  +KRV+   S+D E++ +  ++  S A+   +  ++G      +   +  R  T    Q++ H + +    + Y+E+KD+VG I+   V++V+   V V+LG  +G++ R + IP E    G      I +V+ ++TKG  I+LSRA  G +  L   E+ E+ DG+IEI+ ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I + ED   F+VNA  P ++  V + +++     + V +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    12 LLQIADAVAREKGIEKEVVIEAIEDALQKAARARYGAEHDIRVKID--PKTGETTQKRVIEVVSDDAELEGEIGKMPFSIAKRTWRDAEIGKVYEEVLPPFEIGRVQTQMARQVVMHKVREAERERQYDEYKDRVGEIVNGSVKRVEYGNVIVDLGRGEGIMRRDQSIPRENFNVGDRIRAYIYDVR-RETKGPQIMLSRAHGGFMAKLFAQEVPEVYDGVIEIRAVARDPGSRAKMAVISNDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWSEDEATFIVNALAPAEVSKVVMDEED-----ERVEVVVPDEQLSLAIGRRGQNVRLASQLTGWQIDIMTE 350
>gi|158313032|ref|YP_001505540.1| NusA antitermination factor [Frankia sp. EAN1pec] >gi|158108437|gb|ABW10634.1| NusA antitermination factor [Frankia sp. EAN1pec] (361 aa)
Score = 388, Expect = 2.7e-35, Identities = 99/349 (28%), Positives = 174/349 (49%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDK----VGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           L  I +EK+ + + +V  ++TAL  +Y       D   VV+D     + +F +    D +  E DD                              F R  T    Q++   L +      Y ++ D+    V  +++   ++  +R+V V+LG+ +GV+  +EQ+PGE L+ G      +  V ++   G  + LSR    L++ L + E+ E++DG +E+  I+R  G++TK+A+ S+  GV+  G  +GP G R++ + + L+ E+ID++ +  DP  F+ +A  P ++  VE+TD      S+   +V P+  L   IG+ G N RL ++LTGW IDI S+    E + E
  S:     8 LRGIEREKEIAFDTLVEAIETALLTAYKHTTGSADDARVVIDRTSGEVAVFARESGPDGTSREWDDTPA--------------------------DFGRIATMTAKQVIMQRLREAQQEVTYGQYADREHEVVSGVVQHHEQRAGSRVVLVDLGTVEGVLPPAEQVPGERLEHGDRIKCYVVHV-ARGMHGPTVTLSRTHPELVKGLFRLEVPEVADGTVELAAIAREAGHRTKIAVRSKAAGVNPKGACIGPMGSRVRAVMAELHGEKIDIVDWSADPASFVGSALSPARVSRVEVTD----LASRSARVVVPDYQLSLAIGREGQNARLAARLTGWRIDIHSDTEGSEPRAE 330
>gi|146308624|ref|YP_001189089.1| transcription elongation factor NusA [Pseudomonas mendocina ymp] >gi|145576825|gb|ABP86357.1| NusA antitermination factor [Pseudomonas mendocina ymp] (493 aa)
Score = 388, Expect = 3.0e-35, Identities = 103/346 (29%), Positives = 193/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++    S + F +  VVD+SE E D   ++     Q ++   K+GD +  +V   +F R       Q++   + +   ++V + +++++G II   V+KV    V V+LG+    +L R + IP E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+I++K  SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I   E++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPAGVIFEALELALATATKKRFEDEVDLRVSINRQNGSYETFRRWTVVDESEFE-DPAYQLTEDMPQAVEAKAKIGDVLEEKVESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIIPRETFRVGVRLRALLKEIRTEN-RGPQLILSRTAPEMLIELFRIEVPEIAEGLIDVKAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVAEDNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|145224621|ref|YP_001135299.1| transcription elongation factor NusA [Mycobacterium gilvum PYR-GCK] >gi|145217107|gb|ABP46511.1| NusA antitermination factor [Mycobacterium gilvum PYR-GCK] (353 aa)
Score = 388, Expect = 3.1e-35, Identities = 98/313 (31%), Positives = 173/313 (55%)
  Q:    37 LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           ++ +  + ++VVV+  K ++    +     +++  ID D++  + +    +           +   + F R   +   Q++   L D  N K Y E+  + G+I+   +++ D R     LV V +GS    ++GV+  +EQ+PGE  + G      +  V ++  +   I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ SR PG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D+     ++   ++ P+  L   IGK G N RL ++LTGW IDI S+
  S:    11 IEADKGITVDVVVETIKSALLTAYRHTEGHEADAHIDIDRKTGVVKVMARQTDEDGNVLHEWDDTPEGFGRIAATTARQVILQRLRDAENEKNYGEFSAREGDIVAGVIQR-DARANARGLVVVRMGSETKGSEGVIPAAEQVPGERYEHGDRLRCYVVGV-ARGAREPVITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVTSRAPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPARFVANALSPAKVVSVTVIDE----AARAARVIVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSD 326
>gi|159046101|ref|YP_001534895.1| transcription elongation factor NusA [Dinoroseobacter shibae DFL 12] >gi|157913861|gb|ABV95294.1| NusA antitermination factor [Dinoroseobacter shibae DFL 12] (544 aa)
Score = 387, Expect = 3.2e-35, Identities = 107/344 (31%), Positives = 188/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK      ++  ++ +L ++   +   ++DI V +D  K  +  F +   V + E+  +   E+ + +A+      K+GDT+  +V   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G  +GV+ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTG  IDI++E
  S:    11 LLQTAEAVAREKMIDPGLVIEAMEESLARAAKSRYGSEMDIRVSID-RKTGVATFTRVRTVVEDEELENYQAELTVEQAKPYLDDPKVGDTIVDQVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGVVKREEYGNVIVDIGRGEGVLRRNEKIGRESYRPNDRIRCYIKDVR-REVRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGLDIDIMTE 348
>gi|83950734|ref|ZP_00959467.1| transcription elongation factor NusA [Roseovarius nubinhibens ISM] >gi|83838633|gb|EAP77929.1| transcription elongation factor NusA [Roseovarius nubinhibens ISM] (544 aa)
Score = 387, Expect = 3.5e-35, Identities = 109/344 (31%), Positives = 186/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV++ E E +   E+ + +A++     K+GD    EV      R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G  + ++ R+E+I  E  +P +     IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    ++ + +V PEE L   IG+ G NVRL S+LTG  IDI++E
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVVEEEELE-NYQAELTVEQAKQYLDDPKVGDQYIEEVPPVDMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGMVKREEYGNVIVDVGRGEAILRRNEKIGRESYRPNERIRCYIKDVR-REARGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AERIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTE 348
>gi|146278788|ref|YP_001168947.1| transcription elongation factor NusA [Rhodobacter sphaeroides ATCC 17025] >gi|145557029|gb|ABP71642.1| NusA antitermination factor [Rhodobacter sphaeroides ATCC 17025] (534 aa)
Score = 387, Expect = 3.6e-35, Identities = 104/344 (30%), Positives = 185/344 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK    + ++  ++ +L ++   +   DLDI V +D           R VV+    E +   +I + +A+  K   ++GD +  EV      R       Q++   + +    + Y+E+KD+ G+II   V++ +   + V++G  +G++ R+E+I  E  +P       IK+V+ ++ +G  + LSR D   +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I +++D   FLVNA  P ++  V I ++     +  + +V P+E L   IG+ G NVRL S+LT   IDI++E
  S:    11 LLQTAEAVAREKMIDPDLVIQAMEESLARAAKSRYGSDLDIRVKIDRKTGRATFARIRTVVEDEAVE-NHHAQITVKQAKSYKSDPQIGDEIIDEVPPVDLGRIAAQSAKQVILQKVREAERDRQYDEFKDRKGSIINGVVKREEYGNIIVDIGRGEGILRRNEKIGRESYRPNDRIRAYIKDVR-REARGPQVFLSRTDPQFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNQDQATFLVNALQPAEVSKVVIDEE-----AGKIEVVVPDEQLSLAIGRRGQNVRLASQLTALDIDIMTE 348
>gi|146337225|ref|YP_001202273.1| transcription elongation factor NusA [Bradyrhizobium sp. ORS278] >gi|146190031|emb|CAL74023.1| Transcription elongation protein nusA (N utilization substance protein A) (L factor) [Bradyrhizobium sp. ORS278] (535 aa)
Score = 387, Expect = 3.7e-35, Identities = 104/360 (28%), Positives = 199/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV+K E+      +I++ +A+      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V ++LG  + ++ R E +P E  + G      + +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    10 LLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYGSETDVHAEIDPRKGELRLSRHMLVVEKVENP---SNQISLDDARRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVILDLGRGEAIIRRDEMLPREVFRNGDRVRAYVFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVAKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENSTRV 364
>gi|171778095|ref|ZP_02919352.1| hypothetical protein STRINF_00187 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283077|gb|EDT48501.1| hypothetical protein STRINF_00187 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (397 aa)
Score = 387, Expect = 3.9e-35, Identities = 119/345 (34%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVV-VDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK  +K++I++ +K +L+ +Y +     +  V+  D  K   K++  R VV   E+  D   EI++S+A ++  +Y+LGD +  E ++ +F R       Q +   +        Y E+K   G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + EDP +F+ NA  P + V + + D+ED   SK  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     6 KEMLEAFRILEEEKHINKDDIIDAVKESLKSAYKRRYGQSESCVIEFDDKKGDFKVYTVREVV---EEVFDSRLEISLSDALKISSAYELGDKIRFEESVAEFGRVAAQSAKQTIMEKMRRQIREVTYNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETWKSHDRIEVYVYKVENN-PKGVNVFVSRSHPQFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRYDAKAGVEVPVEENIDVIQWVEDPAEFIYNAIAPAE-VDMVLFDEED---SKRATVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKS 357
>gi|15827820|ref|NP_302083.1| transcription elongation factor NusA [Mycobacterium leprae TN] >gi|20139308|sp|Q9Z5J1|NUSA_MYCLE Transcription elongation protein nusA >gi|4455676|emb|CAB36568.1| putative transcriptional termination/antitermination factor [Mycobacterium leprae] >gi|13093372|emb|CAC30509.1| probable transcription termination/antitermination factor [Mycobacterium leprae] (347 aa)
Score = 387, Expect = 4.0e-35, Identities = 107/337 (31%), Positives = 179/337 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           L  I  ++  S   +++ +++AL  +Y +      I+  +D+++       K  VV     E+DDD  + ISE  +  +                F R   +   Q++     D  N + Y E+  + G I+   +++ D+R     LV V +GS    ++GV+  +EQ+ GE  + G      +  V ++  +   I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ SRVPG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D      ++   +V P+  L   IGK G N RL ++LTGW IDI
  S:     8 LHAIEMDRGISVNELLDTIRSALLTAY-RHTQGHQIDARIDIDR-------KTGVVKVIAREVDDDGNV-ISEWDDTPEG---------------FGRIAATTARQVMLQRFRDAENERTYGEFSTREGEIVAGVIQR-DSRANARGLVVVRMGSETKASEGVIPAAEQVLGESYEHGNRLRCYVVGV-TRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQT----ARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDI 323
>gi|163815206|ref|ZP_02206583.1| hypothetical protein COPEUT_01364 [Coprococcus eutactus ATCC 27759] >gi|158449401|gb|EDP26396.1| hypothetical protein COPEUT_01364 [Coprococcus eutactus ATCC 27759] (398 aa)
Score = 386, Expect = 4.1e-35, Identities = 112/352 (31%), Positives = 193/352 (54%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLR-SEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           +   +E L+++ KE++ SK+ ++  ++ +L+ +  K+ N D +I V +D       ++  + VVD+ E+      +I++S+A+ L + Y++GDTV+ E+    F R        ++   +N+   + +Y+ +  K  +++   VE+     V V+L      +L+ SE I GE  + G      + EVK +  KG  I++SR    L++ L + E++EI+DG++EIK   R  G ++K+A+ S    VDAVG  VG  G+R+  + + LN E+ID+I + E+P +F+ NA  P  +  V +  DE     K   +V P+  L   IGK G N RL +KLTG+ IDI S   A E
  S:     1 MSEIIEALNQLEKERNISKDVLLEAIERSLKTACKKDFNTDENITVSLDRETGECHVYAAKEVVDEVENP---SFQISLSQAKMLNRRYEIGDTVNVEITTKNFGRIAAQRARNVIVQAINENERAAIYDHFHMKEKDVVTGIVERQVGDSVNVSLDDKTEALLKPSEMIEGETYERGDRIKLYVTEVK-KTNKGPKIVVSRTHPELVKRLFEKEVTEIADGVVEIKSFCREAGSRSKIAVWSNDENVDAVGACVGVNGDRVNAVVADLNGEKIDIIPWSENPAEFIYNALSPSDVEDVSVDLDE-----KSAFVVVPDTQLSLAIGKKGQNARLAAKLTGYKIDIKSHSKAEE 345
>gi|114762088|ref|ZP_01441556.1| transcription elongation factor NusA [Roseovarius sp. HTCC2601] >gi|114545112|gb|EAU48115.1| transcription elongation factor NusA [Roseovarius sp. HTCC2601] (542 aa)
Score = 386, Expect = 4.2e-35, Identities = 109/360 (30%), Positives = 194/360 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
            L+  + +A+EK      ++  ++ +L ++   +   ++DI V +D           R VV+  E E +   E+ + +A++     ++GD    EV      R       Q++   + +    + Y+E+KD+ G II   V++ +   V V++G  +G++ R+E+I  E  +PG      IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+ ++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + +D     ++ + +V P+E L   IG+ G NVRL S+LTG  IDI++ E+ +   + EFE+ ++L
  S:    11 LLQTAEAVAREKMIDPALVIEAMEESLARAAKSRYGSEMDIRVKIDRKTGRATFTRVRTVVEDEELE-NYQAEMTVKQAKQYMADPQVGDQYVEEVPPVDMGRIAAQSAKQVILQKVREAERDRQYDEFKDRNGTIINGTVKREEYGNVIVDIGRGEGILRRNEKIGREAYRPGDRIRCYIKDVR-REARGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIGVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDMPTFLVNALQPAEVSKVVLDED-----AERIEVVVPDEQLSLAIGRRGQNVRLASQLTGLDIDIMTEEEESARRQKEFEERTKL 365
>gi|108799047|ref|YP_639244.1| transcription elongation factor NusA [Mycobacterium sp. MCS] >gi|119868162|ref|YP_938114.1| transcription elongation factor NusA [Mycobacterium sp. KMS] >gi|126434650|ref|YP_001070341.1| transcription elongation factor NusA [Mycobacterium sp. JLS] >gi|108769466|gb|ABG08188.1| NusA antitermination factor [Mycobacterium sp. MCS] >gi|119694251|gb|ABL91324.1| NusA antitermination factor [Mycobacterium sp. KMS] >gi|126234450|gb|ABN97850.1| NusA antitermination factor [Mycobacterium sp. JLS] (347 aa)
Score = 386, Expect = 4.9e-35, Identities = 110/340 (32%), Positives = 179/340 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSE-DEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           L  I  +K  S + +V+ +K+AL  +Y   E    D  + +D    ++K+  +    D +   E DD  E                           F R   +   Q++   L D  N K Y E+  + G+I+   +++ D R     LV V +GS     +GV+  +EQ+PGE  + G      +  V ++  +   I LSR    L+R L   E+ EI+DG ++I  ++R  G+++K+A+ SRVPG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D++    ++   +V P+  L   IGK G N RL ++LTGW IDI S+
  S:     8 LHAIEADKGISVDVVVDTIKSALLTAYRHTEGHQADARIDIDRKSGAVKVMARETDADGNLIQEWDDTPE--------------------------GFGRIAATTARQVILQRLRDAENEKNYGEFSAREGDIVAGVIQR-DARANARGLVVVRMGSETKGNEGVIPAAEQVPGERYEHGDRLRCYVVGV-TRGAREPLITLSRTHPNLVRKLFSLEVPEINDGSVDIVAVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDEQ----TRAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSD 326
>gi|54026039|ref|YP_120281.1| transcription elongation factor NusA [Nocardia farcinica IFM 10152] >gi|54017547|dbj|BAD58917.1| putative transcriptional termination/antitermination factor [Nocardia farcinica IFM 10152] (342 aa)
Score = 386, Expect = 5.1e-35, Identities = 112/343 (32%), Positives = 179/343 (52%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWK----DKVGNIIRAEVEKVDNRLVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           +E L  I  +K  S E +++ +++AL  +Y +          VD+N+ +  +   RV+      E+D D  + ISE  +  +                F R   +   Q++   L D  N K + E+     D VG +++ +        V V +GS    T+G++  +EQ+PGE  + G      +  V S+  +G  I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ S VPGV+A G  +GP G+R++ + S L  E+ID+I Y +DP  F+ NA  P K+V V I D    P ++   +V P+  L   IGK G N RL ++LTGW IDI S+
  S:     5 IEALRAIVADKGISIETVISAIESALLTAY-RHTEGHQPNARVDINQRTGAV---RVMAR----ELDADGNV-ISEWDDTPEG---------------FGRIAATTARQVVLQRLRDAENEKSFGEFSTHEGDIVGGVVQRDARANARGTVVVRIGSELHGTEGLIPPAEQVPGETYEHGDRIKCYVVGV-SRGPRGPQITLSRTHPNLVRRLFALEVPEIADGSVEIVAVAREAGHRSKIAVRSTVPGVNAKGACIGPMGQRVRNVMSELAGEKIDIIDYADDPATFVGNALSPSKVVSVTIVD----PDARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSD 326
>gi|168184627|ref|ZP_02619291.1| N utilization substance protein A [Clostridium botulinum Bf] >gi|182672266|gb|EDT84227.1| N utilization substance protein A [Clostridium botulinum Bf] (439 aa)
Score = 386, Expect = 5.2e-35, Identities = 119/349 (34%), Positives = 202/349 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKE----NIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           + F+E L +I KEK  S +     I + L TA +K+Y K+    + ++V+++     IK++ ++      +   ++ +EI++ +A+E+  +Y+L D ++ EV   KF R       Q++   + +     VY E+ +K  +I+   V + D   + +N+G ++ V+  +EQIPGE+ +  +     + EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + + P + + NA  P K++ V I D+E+    K   +V  +  L   IGK G NVRL +KLTGW IDI S+  A
  S:     3 QEFVEALKEIVKEKGISADLLFTTIEDALVTAYKKNYAKQGGSTNNVKVIMNRENGEIKVYAQK---KVVDFVEEEVEEISLEDAKEIDPNYELEDIINIEVTPKKFGRIAAQAAKQVVIQRIKEEERRIVYNEYIEKEEDILTGTVLRKDKGNILINVGKSEAVLGPNEQIPGEQFRFNEKIKLYVVEVKNT-TKGPQVLISRTHPGLVKRLFELEVPEIYNGIVEIKSIAREAGSRTKIAVYSNDEAVDPMGACVGPKGVRVQNIVNELKNEKIDIIKWSKFPDELICNALSPAKVIDVTIVDEEN----KAAKVVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSQA 348
>gi|88812961|ref|ZP_01128204.1| transcription elongation factor NusA [Nitrococcus mobilis Nb-231] >gi|88789739|gb|EAR20863.1| transcription elongation factor NusA [Nitrococcus mobilis Nb-231] (500 aa)
Score = 386, Expect = 5.2e-35, Identities = 103/365 (28%), Positives = 196/365 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDII-SEKLAIEDKIEFEDVSQLVSS 368
           K  L  +D I+ EK  SKE I   ++ AL  +  K +P D+D  V V+      + F + +VVD +E      +EI ++EA+  + + + G  +   +   +F R       Q++   + +   +KV   +KD+ G ++   V++V+   V ++LG + +  + R E IP E ++PG      ++E+   + +G  +++SR     L  L K E+ E+   ++++   +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID+IL+DE+P Q+++NA  P ++  + + +D        + I   +E L + IG+ G NVRL  +LTGW ++++ SE+   + + E +++ +L  S
  S:     3 KEVLLVVDAISNEKGVSKEVIFEAVEAALASATRKRHPEDIDARVAVNRTTGEYETFRRWLVVDDAESVQVPQREIALAEARAQEPTIEAGQYIEQPMESVEFGRIAAQTAKQVIVQKVREAERAKVITAYKDRQGELMTGIVKRVERGHVYLDLGGNAEAFIAREEMIPREAVRPGDRLRGWLREI-CTEARGPQLVVSRTAPEFLIELFKLEVPEVGQDLLQLMGAARDAGQRAKIAVRALDARIDPVGACVGMRGSRVQAVSNELAGERIDIILWDENPAQYVINAMAPAEVESIIVDEDR-----HSMDIAVSQEQLSQAIGRGGQNVRLAGELTGWELNVMTSEEAQAKSEAEADELIELFVS 364
>gi|196184608|gb|EDX79584.1| NusA N-terminal domain family [Brevundimonas sp. BAL3] (587 aa)
Score = 385, Expect = 5.3e-35, Identities = 111/344 (32%), Positives = 185/344 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEK-SYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYK------LGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK+  +E ++  ++ A++K +  +     DI   +D     + L     +V+      D+ +E N S    LK + K      +G      +   +F R  T    Q++T  + +   +  YEE+KD+VG I+   V++V+     V+LG  +GV+ R + IP E    G      I +V+ +  KG  ++LSRA  G +  L   E+ E+ DG+IEI+  +R  G + K+A+LS    +D VG  VG +G R++ + + L  E+ID+I ++ D   F+VNA  P ++  V + D+E    +  V +V P+E L   IG+ G NVRL S+LTGW IDII+E
  S:    13 LLQIAEAVAREKNIEREVVIEAIEEAIQKGAKSRYGAHHDIRAKIDHKTGELALTRHVTIVEDDWQPEDELEEFNDSAMVRLKDALKRDPEAVVGKEYVETLPPFEFGRVQTQMARQVVTGKVREAERANQYEEFKDRVGEIVNGTVKRVEYGNTIVDLGRGEGVMRRDQSIPREVFNIGDRIRTYIYDVRPE-AKGPQVMLSRAHPGFMAKLFAQEVPEVYDGVIEIRAAARDSGSRAKMAVLSNDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWNPDEPTFIVNALAPAEVSKV-VLDEE----AGRVEVVVPDEQLSLAIGRRGQNVRLASQLTGWQIDIITE 357
>gi|75674221|ref|YP_316642.1| transcription elongation factor NusA [Nitrobacter winogradskyi Nb-255] >gi|74419091|gb|ABA03290.1| NusA antitermination factor [Nitrobacter winogradskyi Nb-255] (538 aa)
Score = 385, Expect = 5.3e-35, Identities = 105/360 (29%), Positives = 198/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +      ++L    +VV++ E+  +   +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V V+LG  + V+ R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    11 LLQIADAVAREKTIDRGIVIAAMEDAIAKAARARYGSETDVHAEIHPKTGQLQLTRHMLVVEQVENAAN---QISLKDAQRANPGAQIGDTIADTLPPLEYGRISAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGIVKRVEYGSVIVDLGRGEAVIRRDEMLPREVFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMVKLFTQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVAKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENATRM 365
>gi|153938223|ref|YP_001391719.1| transcription elongation factor NusA [Clostridium botulinum F str. Langeland] >gi|152934119|gb|ABS39617.1| N utilization substance protein A [Clostridium botulinum F str. Langeland] (439 aa)
Score = 385, Expect = 5.6e-35, Identities = 119/349 (34%), Positives = 202/349 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKE----NIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           + F+E L +I KEK  S +     I + L TA +K+Y K+    + ++V+++     IK++ ++      +   ++ +EI++ +A+E+  +Y+L D ++ EV   KF R       Q++   + +     VY E+ +K  +I+   V + D   + +N+G ++ V+  +EQIPGE+ +  +     + EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + + P + + NA  P K++ V I D+E+    K   +V  +  L   IGK G NVRL +KLTGW IDI S+  A
  S:     3 QEFVEALREIVKEKGISADLLFTTIEDALVTAYKKNYAKQGGSTNNVKVIMNRENGEIKVYAQK---KVVDFVEEEVEEISLEDAKEIDPNYELEDIINIEVTPKKFGRIAAQAAKQVVIQRIKEEERRIVYNEYIEKEEDILTGTVLRKDKGNILINVGKSEAVLGPNEQIPGEQFRFNEKIKLYVVEVKNT-TKGPQVLISRTHPGLVKRLFELEVPEIYNGIVEIKSIAREAGSRTKIAVYSNDEAVDPMGACVGPKGVRVQNIVNELKNEKIDIIKWSKFPDELICNALSPAKVIDVTIVDEEN----KAAKVVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSQA 348
>gi|168180700|ref|ZP_02615364.1| N utilization substance protein A [Clostridium botulinum NCTC 2916] >gi|182668525|gb|EDT80504.1| N utilization substance protein A [Clostridium botulinum NCTC 2916] (457 aa)
Score = 385, Expect = 5.9e-35, Identities = 119/349 (34%), Positives = 201/349 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKE----NIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           + F+E L +I KEK  S +     I + L TA +K+Y K+    + ++V+++     IK++ ++      +   ++ +EI++ +A+E+  +Y+L D ++ EV   KF R       Q++   + +     VY E+ +K  +I+   V + D   + +N+G ++ V+  +EQIPGE+ +  +     + EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + + P + + NA  P K++ V I D+E+    K    V  +  L   IGK G NVRL +KLTGW IDI S+  A
  S:     3 QEFVEALREIVKEKGISADLLFTTIEDALVTAYKKNYAKQGGSTNNVKVIMNRENGEIKVYAQK---KVVDFVEEEVEEISLEDAKEIDPNYELEDIINIEVTPKKFGRIAAQAAKQVVIQRIKEEERRIVYNEYIEKEEDILTGTVLRKDKGNILINVGKSEAVLGPNEQIPGEQFRFNEKIKLYVVEVKNT-TKGPQVLISRTHPGLVKRLFELEVPEIYNGIVEIKSIAREAGSRTKIAVYSNDESVDPMGACVGPKGVRVQNIVNELKNEKIDIIKWSKFPDELICNALSPAKVIDVTIVDEEN----KAARAVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSQA 348
>gi|116748667|ref|YP_845354.1| transcription elongation factor NusA [Syntrophobacter fumaroxidans MPOB] >gi|116697731|gb|ABK16919.1| NusA antitermination factor [Syntrophobacter fumaroxidans MPOB] (449 aa)
Score = 385, Expect = 6.5e-35, Identities = 103/340 (30%), Positives = 184/340 (54%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           +D++++EK   ++ +++ L+ A++ +  K+     D++V  +     ++ F+ + VV   E   D DK+++++EA +L    ++GD +   ++ +   R       Q++   + D     VYEE+K + G I    V++VD   + VN+G  + ++   EQIP E  + G      + +VK + +KG  I+LSR     L  L   E+ EI +GI+ I   +R  G + K+A++S+   VD VG  VG KG R++ +   L  E+ID++ ++ DP +F+VNA  P  I  V I        ++ + ++ P++ L   IGK G NVRL S+LT W ID+ +E
  S:     9 IDQVSREKGIDRQTLIHTLEEAIKSAIKKKYGTRQDLDVTYNEEYGELEAFQFKEVV---ETVTDPDKQVSLAEAIKLDPESEIGDELGIRMDTETLGRIAAQSAKQVIIQKMKDAEREVVYEEFKSRKGEIAHGVVQRVDKSGIVVNMGQAEAILPPKEQIPREVFRQGDRVRAYVLDVK-KISKGPQIVLSRTHPHFLIQLFHGEVPEIVEGIVSIISAAREPGSRAKIAVISKATDVDPVGACVGMKGTRVQNVVQELRGEKIDIVPWNMDPAKFVVNALAPAIISKVIIDQ-----ANRSMEVIVPDDQLSLAIGKKGQNVRLASRLTNWRIDVKNE 340
>gi|192288873|ref|YP_001989478.1| NusA antitermination factor [Rhodopseudomonas palustris TIE-1] >gi|192282622|gb|ACE99002.1| NusA antitermination factor [Rhodopseudomonas palustris TIE-1] (537 aa)
Score = 385, Expect = 6.5e-35, Identities = 102/344 (29%), Positives = 189/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV++ E+  +   +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y E+KD++G+I+   V++V+   V V+LG  + ++ R E +P E  + G      + +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKTIDRSIVIAAMEDAIAKAARARYGSETDVHAEIDPKKGELRLSRHMLVVEQVENPAN---QISLKDAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIIRRDEMLPRESFRNGDRVRAYVFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTE 347
>gi|85373514|ref|YP_457576.1| transcription elongation factor NusA [Erythrobacter litoralis HTCC2594] >gi|84786597|gb|ABC62779.1| N-utilization substance protein A [Erythrobacter litoralis HTCC2594] (557 aa)
Score = 385, Expect = 6.9e-35, Identities = 117/355 (32%), Positives = 193/355 (54%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI-EFEDVSQL 365
           + +A EK   K  ++  ++ A++KS    Y  EN   DI   +D     ++L+    VV++ ED     K++++  AQ+L++   +GD +   +      R       Q++   + D    + +EE+KD+ G +I   ++ V+   V VNLG  +GV+ R +QIP E  + G+    +I +V+ +  +G  I LSRA    +R L   E+ EI DGIIEIK  +R  G + K+ ++S    +D VG  VG KG R++ +   L  E+ID+I + ED   F+VNA  P  +  V + +DE       + +V P++ L   IG+ G NVRL S+LTG  IDI++E+ A E +  EF + S++
  S:    17 NAVASEKMIDKAIVIEAMEEAIQKSARNRYGAEN---DIRAKLDPQTGDLRLWRVVEVVEEVEDYF---KQVDLKSAQKLEEGAAIGDFIVDPLPPVDLGRIDAQSAKQVIFQKVRDAERERQFEEFKDRAGEVITGVIKSVEFGHVIVNLGRAEGVIRRDQQIPREAARVGERVRAIITKVE-RNNRGPQIFLSRAHPDFMRKLFAQEVPEIYDGIIEIKAAARDPGSRAKIGVISHDSSIDPVGACVGMKGSRVQAVVQELQGEKIDIIPWSEDQATFIVNALQPATVSRVVLDEDE-----SRIEVVVPDDQLSLAIGRRGQNVRLASQLTGNQIDIMTEEEASEKQSKEFAERSKM 364
>gi|39933515|ref|NP_945791.1| transcription elongation factor NusA [Rhodopseudomonas palustris CGA009] >gi|39647361|emb|CAE25882.1| putative NusA protein, transcriptional termination factor [Rhodopseudomonas palustris CGA009] (537 aa)
Score = 384, Expect = 7.0e-35, Identities = 102/344 (29%), Positives = 189/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  K  ++L    +VV++ E+  +   +I++ +AQ      ++GDT++  +   ++ R       Q++   + +    + Y E+KD++G+I+   V++V+   V V+LG  + ++ R E +P E  + G      + +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E
  S:    10 LLQIADAVAREKTIDRSIVIAAMEDAIAKAARARYGSETDVHAEIDPKKGELRLSRHMLVVEQVENPAN---QISLKDAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIIRRDEMLPRESFRNGDRVRAYVFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTE 347
>gi|113460963|ref|YP_719030.1| transcription elongation factor NusA [Haemophilus somnus 129PT] >gi|112823006|gb|ABI25095.1| transcription elongation protein, N utilization substance protein A [Haemophilus somnus 129PT] (493 aa)
Score = 384, Expect = 7.2e-35, Identities = 102/345 (29%), Positives = 191/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L++A+  S  K+   ++D+ VV++        F + +VV   E  ++  KEI +  AQ      KLGD +  E++   F+R       Q+++  + +   +K+ E+++ + G I+   V+KV+   + ++L    + V+LR + +P E  +PG     ++ +V S + KG  + ++RA   +L  L + E+ EI + +IEIK  SR  G + K+A+ S    +D VG  VG +G R++ I++ L  ER+D++L+D++P QF++NA  P  +  + + +D     +  + I    E+L + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLAAEAVSNEKLLPREKIFEALESAIALSTKKKYEQEIDVRVVINTKTGEFSTFRRWLVV---ETVLNPTKEITLEAAQFEDPEIKLGDYIEDEIDSIAFDRIAMQTARQVISTKIREAERNKIVEQFRSQEGEIVSGTVKKVNRDSIILDLSQQAEAVILREDMLPRENFRPGDRVRGVLYKV-SPENKGIQLFVTRAKPEMLVELFRIEVPEIGEELIEIKGASRDPGLRAKIAVKSNDKRIDPVGACVGMRGSRVQAITNELGGERVDIVLWDDNPAQFVINAMAPADVSSIVVDED-----NHSMDIAVEPENLAQAIGRNGQNVRLATQLTGWVLNVMT 340
>gi|15602625|ref|NP_245697.1| transcription elongation factor NusA [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721058|gb|AAK02844.1| NusA [Pasteurella multocida subsp. multocida str. Pm70] (494 aa)
Score = 384, Expect = 7.3e-35, Identities = 101/345 (29%), Positives = 192/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L++AL  S  K+   ++D+ VV++        F + +VVD+  +     KEI +  AQ    + +LGD V  ++    F+R       Q+++  + +   +K+ E+++ + G I+   V+KV+   + ++LG   + V+LR + +P E  +PG     ++ +V S ++KG  + ++RA   +L  L + E+ EI + +IEIK  +R  G + K+A+ S    +D VG  VG +G R++ I++ L  ER+D++L+D++P QF++NA  P  +  + + +D     S  + I     +L + IG+NG NVRL ++LT W++++++
  S:     3 KELLLAAEAVSNEKLLPREKIFEALESALALSTKKKYEQEIDVRVVINTKTGEFDTFRRWLVVDEVTNPT---KEITLEAAQFDDPNVQLGDYVEDQIESVAFDRITMQTARQVISTKIREAERNKIVEQFRSQEGEIVTGTVKKVNRDNIVLDLGQQAEAVILREDMLPRENFRPGDRVRGVLYKV-SPESKGAQLFVTRAKPEMLIELFRIEVPEIGEELIEIKNAARDPGSRAKIAVKSNDKRIDPVGACVGMRGARVQAITNELGGERVDIVLWDDNPAQFVINAMAPADVTSIVVDED-----SHAMDIAVEPANLAQAIGRNGQNVRLATQLTSWTLNVMT 340
>gi|118475774|ref|YP_892520.1| transcription elongation factor NusA [Campylobacter fetus subsp. fetus 82-40] >gi|118415000|gb|ABK83420.1| transcription termination factor NusA [Campylobacter fetus subsp. fetus 82-40] (365 aa)
Score = 384, Expect = 7.6e-35, Identities = 112/335 (33%), Positives = 188/335 (56%)
  Q:    10 LDKIAKEK----DTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD---NRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSI 344
           ++ IA EK    +  KE I+     A ++ Y  E    + E  +D N ++I L++K +VV+ S++ +D++  I++ +A EL  + ++GD+++ E+NID+  R      ++ + +++  +   K+YE++  K+  ++   V +VD   N  VE++    + V+    +I  E+ + G     +IK V+  +  G  + LSR     L  LLK E+ EI DG + I+  +RI G K K+A+ S  P +DAVG  VG KG RI  +SS LN E ID I Y  +P  F+  A  P  +  V+I D +      IV++V  ++S  K IG +GIN+RL S L+G+ I
  S:     8 IESIANEKGLNFEDVKERIIRAFVNAAKRLYGYE---CEYEASLDPNTKAIHLYQKILVVEDSDERLDEEHFISLKKAHELDATLEIGDSLNYELNIDELGRTGAGVLSREIEYHIQRLIEEKIYEKYNSKINTLVFGTVTRVDAEENTFVEID--EIRAVMSMKNRIKNEKFKVGNVVKAVIKSVRLDKKDGIKVELSRTSPKFLEALLKAEVPEIKDGGVIIQNSARIPGKKAKIALFSTTPNIDAVGATVGIKGVRINAVSSELNGENIDAIEYSSEPAIFVARALAPAIVSSVKIDDKK-----AIVSLVPEQKS--KAIGVSGINIRLASMLSGFEI 337
>gi|124515701|gb|EAY57210.1| putative transcription elongation factor [Leptospirillum sp. Group II UBA] (452 aa)
Score = 384, Expect = 7.9e-35, Identities = 109/379 (28%), Positives = 204/379 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQPRSQFGGYRL 382
           +  L  +D++ +EK  S+E ++  L++AL  +  K     D  +V ++     +++ + R +V++ E      +EI+++EA E     ++GD + + + ID F R       Q++   + +     V +E+  + G+I+   +   + +   V+LG T+ V+   EQ+P E  + G     L+ ++++  ++G  ++LSR     +  L + E+ EI++GI+E++ + R  G + K+A+ SR P VD VG+ VG KG R++ +   L+ E++D+I ++ DP  F+  A  P K V V I   +D+   K+ T+V  +  L   IG+ G NVRL +KLTGW +DI SE   ++ +   ++ ++ V+S      SQ G   L
  S:     4 QELLSVIDQLHREKGISQETLIVALESALLAAARKRYGGGDNFQVEINPRTGEVQVLQIRRIVERVESP---SEEISLAEALESDPEAEVGDEIGSYLEIDDFGRIAAQAAKQVMFQKVREAEWDVVTKEFGGRQGDIVNGVIIGHERKNYIVDLGKTEAVLPLREQMPRESFRRGDRIKALLLDMRTT-SRGPQLVLSRTHPDFVSRLFEKEVPEIAEGILEVRNVVREPGERAKIAVYSRDPNVDPVGSCVGVKGVRVQAVVRELHGEKVDIIEWNSDPATFIARALSPAKAVRVSI---KDMGSEKVATVVVQDSQLSLAIGRRGHNVRLAAKLTGWKVDIFSET-QMQSEAGLDERAERVASLAETLGSQSGDTSL 375
>gi|148380376|ref|YP_001254917.1| N utilization substance protein A [Clostridium botulinum A str. ATCC 3502] >gi|153933708|ref|YP_001384596.1| transcription elongation factor NusA [Clostridium botulinum A str. ATCC 19397] >gi|153936194|ref|YP_001388112.1| transcription elongation factor NusA [Clostridium botulinum A str. Hall] >gi|170761276|ref|YP_001787732.1| N utilization substance protein A [Clostridium botulinum A3 str. Loch Maree] >gi|148289860|emb|CAL83968.1| putative transcription elongation protein NusA [Clostridium botulinum A str. ATCC 3502] >gi|152929752|gb|ABS35252.1| N utilization substance protein A [Clostridium botulinum A str. ATCC 19397] >gi|152932108|gb|ABS37607.1| N utilization substance protein A [Clostridium botulinum A str. Hall] >gi|169408265|gb|ACA56676.1| N utilization substance protein A [Clostridium botulinum A3 str. Loch Maree] (457 aa)
Score = 384, Expect = 8.0e-35, Identities = 119/349 (34%), Positives = 201/349 (57%)
  Q:     4 KSFLENLDKIAKEKDTSKE----NIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           + F+E L +I KEK  S +     I + L TA +K+Y K+    + ++V+++     IK++ ++      +   ++ +EI++ +A+E+  +Y+L D ++ EV   KF R       Q++   + +     VY E+ +K  +I+   V + D   + +N+G ++ V+  +EQIPGE+ +  +     + EVK+  TKG  +++SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + + P + + NA  P K++ V I D+E+    K    V  +  L   IGK G NVRL +KLTGW IDI S+  A
  S:     3 QEFVEALREIVKEKGISADLLFTTIEDALVTAYKKNYAKQGGSTNNVKVIMNRENGEIKVYAQK---KVVDFVEEEVEEISLEDAKEIDPNYELEDIINIEVTPKKFGRIAAQAAKQVVIQRIKEEERRIVYNEYIEKEEDILTGTVLRKDKGNILINVGKSEAVLGPNEQIPGEQFRFNEKIKLYVVEVKNT-TKGPQVLISRTHPGLVKRLFELEVPEIYNGIVEIKSIAREAGSRTKIAVYSNDESVDPMGACVGPKGVRVQNIVNELKNEKIDIIKWSKFPDELICNALSPAKVIDVTIVDEEN----KAARAVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSQA 348
>gi|156935695|ref|YP_001439611.1| transcription elongation factor NusA [Enterobacter sakazakii ATCC BAA-894] >gi|156533949|gb|ABU78775.1| hypothetical protein ESA_03562 [Enterobacter sakazakii ATCC BAA-894] (495 aa)
Score = 384, Expect = 8.5e-35, Identities = 98/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + V+V   E+     +EI +  A+    S  +GD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LGS  + V+LR + +P E  +PG     ++  V+ +  +G  + ++RA   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKAVPREKIFEALESALATATKKKYEQEIDVRVSIDRKSGDFDTFRRWVIV---EEVTQPTREITLEAARYEDPSLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRENITLDLGSNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRAKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|123440812|ref|YP_001004803.1| transcription elongation factor NusA [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122087773|emb|CAL10559.1| N utilization substance protein A [Yersinia enterocolitica subsp. enterocolitica 8081] (495 aa)
Score = 384, Expect = 8.5e-35, Identities = 97/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + V VD+        +EI +  AQ    S +LGD V  ++    F+R  T    Q++   + +   + V E+++  +G I+   V+KV+   + ++LG+  + V+ R + +P E  +PG     ++ +V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D+       + +     +L + IG+NG NVRL ++L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEVRVSIDRKTGDFDTFRRWVAVDEVTMPT---REITLEAAQYEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVEQFRQYLGEIVTGTVKKVNRDSIALDLGNNAEAVINREDMLPRENFRPGDRIRGVLYDVRPE-ARGAQLFVSRSRPEMLIELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT 340
>gi|24372786|ref|NP_716828.1| transcription elongation factor NusA [Shewanella oneidensis MR-1] >gi|24346871|gb|AAN54273.1|AE015564_4 N utilization substance protein A [Shewanella oneidensis MR-1] (499 aa)
Score = 384, Expect = 8.9e-35, Identities = 98/345 (28%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+TAL  +  K+   D+D+ V +D    + + F + +V+D +   +++  +EI +  A+  +   + G+ +  ++    F+R  T    Q++   + +   ++V E+++DK G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + L+R    +L  L + E+ EI+D +IE+   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    ESL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALETALATATKKKYEGDIDVRVAIDRKTGAYETFRRWMVIDDNGVALENPYREITLEAARFEEPEIQPGEYIEDQIESVAFDRITTQTAKQVIVQKVREAERAQVVEQFQDKEGELITGVVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLTRTKPDMLIELFRVEVPEIADELIEVMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEAESLAQAIGRNGQNVRLATQLTGWELNVMT 344
>gi|59711092|ref|YP_203868.1| transcription elongation factor NusA [Vibrio fischeri ES114] >gi|59479193|gb|AAW84980.1| transcription termination/antitermination L factor NusA [Vibrio fischeri ES114] (495 aa)
Score = 383, Expect = 9.1e-35, Identities = 98/345 (28%), Positives = 192/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K++  ++++ V +D      + F + V V+  E+      EI+I  AQ   ++ ++G  V  ++    F+R  T    Q++   + +   + + E++ D  G +I   V+KV+   + V+LG+  + V+LR +Q+P E  +PG     L+  VK +  +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P ++  + + +D +      + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATATKKKSEMEIEVRVAIDRKTGDFETFRRWVAVENVENPT---LEISIEAAQFEDETIEIGGYVEDDIESVTFDRITTQTAKQVIVQKVREAERAMIVEQFIDNEGELITGIVKKVNRDAIIVDLGNNAEAVILREDQLPRENFRPGDRVRGLLYAVKPE-ARGFQLFMTRSKGVMLTELFRVEVPEIGEELIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPAEVASIIVDEDNN-----TMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|177670874|ref|ZP_02943964.1| NusA antitermination factor [Micrococcus luteus NCTC 2665] >gi|172072302|gb|EDT58339.1| NusA antitermination factor [Micrococcus luteus NCTC 2665] (324 aa)
Score = 383, Expect = 9.3e-35, Identities = 87/245 (35%), Positives = 143/245 (58%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-LVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   S   Q++   + +  + KV  E+KDK G ++   +++  NR +V+VNLG+ + V+   EQ+PGE+   G+     +    ++  KG  + +SR+  GL+R L + E+ EI+DG +EI  ++R  G++TK+A+ +  PGV+A G ++G  G R++ + + LN+E+ID+I + +DP   + NA  P   V VEI D +      +V    P+  L   IGK G N RL +KLTGW IDI+ +
  S:    75 FGRVAASTARQVMIQRMREEDDDKVLGEFKDKEGELVSGVIQQGLNRHMVQVNLGTLEAVLPPPEQVPGEDYAHGRRIRAYVVSA-TRGAKGPSVTVSRSHPGLVRKLFELEVPEIADGSVEITALAREAGHRTKMAVRATRPGVNAKGASIGEMGSRVRAVMTELNDEKIDIIDHVDDPAAMIANALSPATTVSVEILDADQHSARAVV----PQYQLSLAIGKEGQNARLAAKLTGWRIDIVGD 315
>gi|148251679|ref|YP_001236264.1| transcription elongation factor NusA [Bradyrhizobium sp. BTAi1] >gi|146403852|gb|ABQ32358.1| NusA antitermination factor [Bradyrhizobium sp. BTAi1] (537 aa)
Score = 383, Expect = 9.8e-35, Identities = 103/360 (28%), Positives = 199/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +D  +  ++L    +VV+K E+      +I++ +A+      ++GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V ++LG  + ++ R E +P E  + G      + +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E+   E +  +FE+ +++
  S:    10 LLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYGSETDVHAEIDPRRGELRLSRHMLVVEKVENP---SNQISLDDARRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVILDLGRGEAIIRRDEMLPREVFRNGDRVRAYVFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVAKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTEQEESERRQADFENSTRV 364
>gi|170717519|ref|YP_001784611.1| NusA antitermination factor [Haemophilus somnus 2336] >gi|168825648|gb|ACA31019.1| NusA antitermination factor [Haemophilus somnus 2336] (493 aa)
Score = 383, Expect = 9.9e-35, Identities = 102/345 (29%), Positives = 191/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L++A+  S  K+   ++D+ VV++        F + +VV   E  ++  KEI +  AQ      KLGD +  E++   F+R       Q+++  + +   +K+ E+++ + G I+   V+KV+   + ++L    + V+LR + +P E  +PG     ++ +V S + KG  + ++RA   +L  L + E+ EI + +IEIK  SR  G + K+A+ S    +D VG  VG +G R++ I++ L  ER+D++L+D++P QF++NA  P  +  + + +D     +  + I    E+L + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLAAEAVSNEKLLPREKIFEALESAIALSTKKKYEQEIDVRVVINTKTGEFSTFRRWLVV---ETVLNPTKEITLEAAQFEDPEIKLGDYIEDEIDSIAFDRIAMQTARQVISTKIREAERNKIVEQFRSQEGEIVSGTVKKVNRDSIILDLSQQAEAVILREDMLPRENFRPGDRVRGVLYKV-SPENKGIQLFVTRAKPEMLVELFRIEVPEIGEELIEIKGASRDPGLRAKIAVKSNDKRIDPVGACVGMRGSRVQAITNELGGERVDIVLWDDNPAQFVINAMAPADVSSIVVDED-----NHSMDIAVEPENLAQAIGRNGQNVRLATQLTGWVLNVMT 340
>gi|145620925|ref|ZP_01776935.1| NusA antitermination factor [Geobacter bemidjiensis Bem] >gi|144942771|gb|EDJ77886.1| NusA antitermination factor [Geobacter bemidjiensis Bem] >gi|197087048|gb|ACH38319.1| NusA antitermination factor [Geobacter bemidjiensis Bem] (383 aa)
Score = 383, Expect = 1.0e-34, Identities = 108/349 (30%), Positives = 183/349 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           +D+I KEK   K  +V  L+ A L  +  K     D+E   +  +  ++LFE   VV++ +D     +EI + EA+E     ++GD++  +++   F R       Q++   + +     ++ E+ ++ G I+   V + +   + V+LG  + ++   EQ P E  + G     LI E++   TKG  I+LSR    +L  L + E+ EI++GI+EIK + R  G + K+A+ S    VD VG  VG +G R++ + S L  E+ID+I + ED  +F  NA  P  +  V + ++E       + ++  ++ L   IGK G NVRL +KLTGW IDI SE    E +++
  S:    11 IDQIVKEKGIDKSIVVEALEQAVLTAANKKFRNTRDLEAHYNPEEGEVELFEFVTVVEEVQDSY---REIELDEAREEDPEVEIGDSIGMKMDASGFSRIAAQTAKQVIIQRVREAERETIFNEFMERQGEIVNGVVRRFEKGDLIVDLGRAEALLPHKEQAPREVYRQGDRVKALITEIR-MTTKGPQIMLSRTHPTMLAKLFEAEVPEIAEGIVEIKSVVREPGGRAKIAVYSHDSDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWSEDIARFACNALAPAVVTKVYVDEEE-----YAMEVIVADDQLSLAIGKRGQNVRLAAKLTGWKIDIKSETRMAEAELQ 351
>gi|154497680|ref|ZP_02036058.1| hypothetical protein BACCAP_01656 [Bacteroides capillosus ATCC 29799] >gi|150273178|gb|EDN00323.1| hypothetical protein BACCAP_01656 [Bacteroides capillosus ATCC 29799] (400 aa)
Score = 383, Expect = 1.0e-34, Identities = 106/343 (30%), Positives = 179/343 (52%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNL------GSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           K F   +  I +EK   K  ++  +  AL  +Y +  E    +I V  D  K  ++++ K+ VV+  ++      E+++++A++     +LGD V  EV    F R       Q++   + +     +Y+E+  K   ++   V ++D R    +L       +T   +   EQ+ GE  + G      + EV+ + TKG  +++SR   GL++ L + E+ EI DG +E+K I+R  G +TK+A+ S  P VD +G  VGP+G+R+  I   L  E++D+I Y EDP +++  A  P  ++ V   DD      K   +V P++ L   IGK G N RL +KLTG+ IDI
  S:    17 KEFFAAIGMIEQEKGIPKGYMLEKITQALISAYKRDHEGAGDNIMVEADEEKGEVRMYVKKDVVETVDNPY---TEVSLADARQRLPHIRLGDVVRVEVKTKDFGRIAAQTARQVIIQGMREAERGMIYDEFSSKEHELLTGVVTRIDPRSGSASLRIGSGNEATDAFLAAGEQVRGETFREGDRLKVYVVEVR-RSTKGPQVLISRTHPGLVKRLFELEVPEIFDGTVEVKSIAREAGSRTKLAVWSADPNVDPIGACVGPRGQRVNNIVEELKGEKVDIIKYSEDPAEYVAAALSPADVISVTTLDD-----GKSCRVVVPDDQLSLAIGKEGQNARLAAKLTGFKIDI 358
>gi|146313241|ref|YP_001178315.1| transcription elongation factor NusA [Enterobacter sp. 638] >gi|145320117|gb|ABP62264.1| NusA antitermination factor [Enterobacter sp. 638] (495 aa)
Score = 383, Expect = 1.0e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + V+V   E+     KEI +  A+   +S+ +G+ V  ++    F+R  T    Q++   + +   + V ++++   G II   V+KV+   + ++LGS  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID+IL+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWVIV---EEVTQPTKEITLEAARYEDESFNVGEYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRSHEGEIITGVVKKVNRDNIALDLGSNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSKAEMLIELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIILWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWDLNVMT 340
>gi|16123643|ref|NP_406956.1| transcription elongation factor NusA [Yersinia pestis CO92] >gi|51594831|ref|YP_069022.1| transcription elongation factor NusA [Yersinia pseudotuberculosis IP 32953] >gi|108806045|ref|YP_649961.1| transcription elongation factor NusA [Yersinia pestis Antiqua] >gi|108813401|ref|YP_649168.1| transcription elongation factor NusA [Yersinia pestis Nepal516] >gi|145600793|ref|YP_001164869.1| transcription elongation factor NusA [Yersinia pestis Pestoides F] >gi|153947426|ref|YP_001402551.1| transcription elongation factor NusA [Yersinia pseudotuberculosis IP 31758] >gi|153997274|ref|ZP_02022374.1| N utilization substance protein A [Yersinia pestis CA88-4125] >gi|162418514|ref|YP_001608285.1| transcription elongation factor NusA [Yersinia pestis Angola] >gi|165925730|ref|ZP_02221562.1| transcription termination factor NusA [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936779|ref|ZP_02225346.1| transcription termination factor NusA [Yersinia pestis biovar Orientalis str. IP275] >gi|166010132|ref|ZP_02231030.1| transcription termination factor NusA [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214620|ref|ZP_02240655.1| transcription termination factor NusA [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401309|ref|ZP_02306809.1| transcription termination factor NusA [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420758|ref|ZP_02312511.1| transcription termination factor NusA [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423617|ref|ZP_02315370.1| transcription termination factor NusA [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170025946|ref|YP_001722451.1| NusA antitermination factor [Yersinia pseudotuberculosis YPIII] >gi|186893840|ref|YP_001870952.1| NusA antitermination factor [Yersinia pseudotuberculosis PB1/+] >gi|51588113|emb|CAH19719.1| N utilization substance protein A [Yersinia pseudotuberculosis IP 32953] >gi|108777049|gb|ABG19568.1| N utilization substance protein A [Yersinia pestis Nepal516] >gi|108777958|gb|ABG12016.1| N utilization substance protein A [Yersinia pestis Antiqua] >gi|115349122|emb|CAL22085.1| N utilization substance protein A [Yersinia pestis CO92] >gi|145212489|gb|ABP41896.1| N utilization substance protein A [Yersinia pestis Pestoides F] >gi|149288911|gb|EDM38991.1| N utilization substance protein A [Yersinia pestis CA88-4125] >gi|152958921|gb|ABS46382.1| transcription termination factor NusA [Yersinia pseudotuberculosis IP 31758] >gi|162351329|gb|ABX85277.1| transcription termination factor NusA [Yersinia pestis Angola] >gi|165915428|gb|EDR34038.1| transcription termination factor NusA [Yersinia pestis biovar Orientalis str. IP275] >gi|165922342|gb|EDR39519.1| transcription termination factor NusA [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991039|gb|EDR43340.1| transcription termination factor NusA [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204195|gb|EDR48675.1| transcription termination factor NusA [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961564|gb|EDR57585.1| transcription termination factor NusA [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049334|gb|EDR60742.1| transcription termination factor NusA [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057787|gb|EDR67533.1| transcription termination factor NusA [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752480|gb|ACA69998.1| NusA antitermination factor [Yersinia pseudotuberculosis YPIII] >gi|186696866|gb|ACC87495.1| NusA antitermination factor [Yersinia pseudotuberculosis PB1/+] (495 aa)
Score = 383, Expect = 1.0e-34, Identities = 97/345 (28%), Positives = 187/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + V VD+        +EI +  AQ    S +LGD V  ++    F+R  T    Q++   + +   + V E+++  +G I+   V+KV    + ++LG + + V+ R + +P E  +PG     ++ +V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D+       + +     +L + IG+NG NVRL ++L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEVRVSIDRKTGDFDTFRRWVAVDEVTMPT---REITLDAAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEAVIGREDMLPRENFRPGDRIRGVLYDVRPE-ARGAQLFVSRSRSEMLVELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT 340
>gi|119774097|ref|YP_926837.1| transcription elongation factor NusA [Shewanella amazonensis SB2B] >gi|119766597|gb|ABL99167.1| N utilization substance protein A [Shewanella amazonensis SB2B] (499 aa)
Score = 383, Expect = 1.1e-34, Identities = 99/345 (28%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+TAL  +  K+   D+D+ V +D      + F + +VV+ + + +++  +EI +  AQ      ++G+ +  E+    F+R  T    Q++   + +   ++V E++ DK G II   V+K +   V V+LG+   GV+ + + I  E  +PG     L+  V+ +  +G  + L+R    +L  L + E+ EI+D +I++   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P QF++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALETALATATKKKYEGDIDVRVAIDRKTGDYETFRRWMVVEDNGEALENPYREITLEAAQYENPEIQVGEFIEDEIESVVFDRITTQTAKQVIVQKVREAERAQVVEQFYDKEGEIITGVVKKSNRDSVIVDLGNNADGVLYKEDLIARESFRPGDRVRALLYAVRPE-ARGAQLYLTRTKPEMLIELFRVEVPEIADEMIQVMGAARDPGSRAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQFVINAMAPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLTGWELNVMT 344
>gi|149912925|ref|ZP_01901459.1| transcription elongation factor NusA [Roseobacter sp. AzwK-3b] >gi|149813331|gb|EDM73157.1| transcription elongation factor NusA [Roseobacter sp. AzwK-3b] (540 aa)
Score = 383, Expect = 1.1e-34, Identities = 114/360 (31%), Positives = 197/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV  ++DE+++   E+ + +A++     K+GD    E+      R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G  + ++ R+E+I  E  +PG      IK+V+ ++ +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    ++ + +V PEE L   IG+ G NVRL S+LTG  IDI++E    E +  EFE+ ++L
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVSIDRKTGKANFTRVRTVV--ADDELENYQAEMTVDQAKQYLDDPKIGDEFIEEIPPVDLGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGVVKREEYGNVIVDVGRGEAILRRNEKIGRESYRPGDRVRAYIKDVR-REARGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AERIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEAEDSERRQKEFEERTKL 365
>gi|167950226|ref|ZP_02537300.1| transcription elongation factor NusA [Endoriftia persephone 'Hot96_1+Hot96_2'] >gi|110589422|gb|ABG77220.1| N utilization substance protein A [Endoriftia persephone 'Hot96_1+Hot96_2'] (497 aa)
Score = 383, Expect = 1.1e-34, Identities = 109/351 (31%), Positives = 197/351 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNK-----ESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           K  L  +D ++ EK   K  I   ++ AL  +  K+N D DI V V++++     ES + +E  VV D S DE D   ++I    A+E +   ++GD +  E++  +F R       Q++   + +   +KV   ++D+ G ++   V++VD   V ++LG + +  + R   IP E ++ G      + E++S+  +G  + +SR    LL  L K E+ E+ +G+IEI+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ LN ER+D+IL++++P QF+++A  P  +V + + +D        + +   EE+L + IG+ G NVRL S+LTGW ++++ E  A E
  S:     3 KEILLVVDAVSNEKGVEKVIIFEAIEAALASATRKKNGD-DILVRVEIDRTSGDYESFRRWE--VVEDYSSDEPDAPLRQIIFDAAKEQQPDIQIGDFIEEEIDSIEFGRIAAQAAKQVIVQKVREAERAKVVAAYEDRKGELVTGVVKRVDRGNVFLDLGGNAEAFIGREHMIPKEAVRVGDRIRGYLYEIRSE-VRGPQLFVSRTMPELLIELFKLEVPEVGEGLIEIRGAARDAGLRAKIAVKALDSRIDPVGACVGMRGSRVQAVSNELNGERVDIILWNDNPAQFVIDAMSPADVVSIVVDEDR-----HAMDVAVSEENLSQAIGRGGQNVRLASQLTGWELNVMDEAQAAE 351
>gi|183981905|ref|YP_001850196.1| N utilization substance protein a NusA [Mycobacterium marinum M] >gi|183175231|gb|ACC40341.1| N utilization substance protein a NusA [Mycobacterium marinum M] (347 aa)
Score = 383, Expect = 1.1e-34, Identities = 90/242 (37%), Positives = 143/242 (59%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           F R   +   Q++     D  N + Y E+  + G I+   +++ D+R     LV V +GS    ++GV+  +EQ+PGE  + G      +  V S+ ++   I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ S VPG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D      ++   +V P+  L   IGK G N RL ++LTGW IDI
  S:    79 FGRIAATTARQVMLQRFRDAENERTYGEFSTREGEIVAGVIQR-DSRANARGLVVVRMGSETKASEGVIPSAEQVPGESYEHGNRLRCYVVGV-SRGSREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQT----ARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDI 323
>gi|145298043|ref|YP_001140884.1| transcription elongation factor NusA [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850815|gb|ABO89136.1| transcription elongation factor nusA [Aeromonas salmonicida subsp. salmonicida A449] (500 aa)
Score = 383, Expect = 1.1e-34, Identities = 99/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  +D ++ EK   +E I   L+TAL  +  K+   ++++ V +D      + + + VVV       +   EI +  AQ  +   +LGD V  +++   F+R  T    Q++   + +   S+V +++KDK G II   V+K +   V ++LGS  + V+ R + +P E  +PG     L+  V+ +  +G  + +SR+    L+ L + E+ EI + +IEI   +R  G + K+++ +    +D +G  +G +G R++ +S+ L+ ER D++LYD++P Q+++NA  P  +  + + +D     +  + I     +L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILLVVDAVSNEKAVPREKIFQALETALATATKKKYEGEIEVRVEIDRKTGDYETYRRWVVVADQAAMENPYGEITLEAAQIEQPEIQLGDYVEDQIDSVTFDRITTQTAKQVIVQKVREAERSQVVDQFKDKEGTIISGVVKKSNRDNVILDLGSNAEAVIFRDDMLPRETFRPGDRIRGLLYAVRPE-ARGSQLFVSRSSPDFLKELFRIEVPEIGEEMIEIMGAARDPGSRAKISVKTNDRRIDPIGACIGMRGARVQAVSAELSGERADIVLYDDNPAQYVINAMAPADVASIIVDED-----NHTMDIAVEAANLAQAIGRNGQNVRLASQLTGWELNVMT 343
>gi|169183625|ref|ZP_02844127.1| NusA antitermination factor [Thauera sp. MZ1T] >gi|169009261|gb|EDS56041.1| NusA antitermination factor [Thauera sp. MZ1T] (491 aa)
Score = 383, Expect = 1.1e-34, Identities = 101/345 (29%), Positives = 196/345 (56%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEI-DDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           +D +A+EK+ +K+ + + L+TAL  +  K   D D +VVV ++++S     KR  +   ++E+ +D+ E+ I +A+EL+   ++GD +  E+    F R       Q++   + D    +V  ++ D+   ++   +++++     + +G  + V+ R +QIP E L+ G      +  +  +  +G  ++LSR     L  L + E+ EI DG++E+K  +R  G + K+A+ S    +D +GT VG +G R+  + + +  E+ID+I++ +DP QF+V A  P ++V + + D+E    S  + +V  E +L   IG++G NV+L S+LTGW+I+++SE+ + E
  S:     9 VDALAREKNVAKDIVFSALETALASATKKRIHD-DADVVVSIDRDSGDYTSKRRWLVMLDEEVANDEAEMGIIDARELRADVQIGDYIEEELEPIDFGRIGAQAAKQVILQKIRDAEREQVLNDFLDRKEFLVSGSIKRMERGNAIIEVGRMEAVLPRDQQIPRENLRVGDRVKAFLLRI-DRGARGPQLVLSRTAPEFLMKLFELEVPEIEDGLLELKACARDAGLRAKIAVKSNDQRIDPIGTCVGLRGSRVTAVRNEIAGEQIDIIVWSQDPAQFVVAALQPAEVVSI-VVDEE----SHAMDVVVDENNLAIAIGRSGQNVKLASELTGWTINLMSEQESAE 347
>gi|77359942|ref|YP_339517.1| transcription elongation factor NusA [Pseudoalteromonas haloplanktis TAC125] >gi|76874853|emb|CAI86074.1| transcription elongation protein (N utilization substance protein A) (L factor) [Pseudoalteromonas haloplanktis TAC125] (499 aa)
Score = 383, Expect = 1.1e-34, Identities = 100/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD--KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+ AL  +  K++  D+D+ V +D        + +  +    ED   ++   EI +  AQ  +   ++GD V  +++  KF+R  T    Q++   + +   + V EE+K K G ++   V+K     + ++LG+  + V+ R + +P E  +PG     L+ EVK +  +G  + ++R+   +L  L + E+ EI + +IE++  +R  G + K+A+ S    +D +G  VG +G R++ +SS L  ER+D++LYD++P QF++NA  P ++  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPKEKIFEALEFALATATKKKHGGDIDVRVAIDRKTGDYDTYRRWQIAAVLEDGSLENPYSEITLEAAQVEEPDLQMGDFVEEQIDSIKFDRITTQMAKQVIVQKVREAERALVVEEYKSKEGELVTGVVKKATRDAIVLDLGNNAEAVIYRDDMLPRENFRPGDRIRGLLYEVKPE-ARGAQLFVTRSKPEMLMELFRIEVPEIGEEMIELRAAARDPGSRAKIAVKSNDKRIDPIGACVGMRGARVQAVSSELGGERVDIVLYDDNPAQFVINAMAPAEVASIVMDED-----THSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 345
>gi|111225121|ref|YP_715915.1| transcription elongation protein nusA [Frankia alni ACN14a] >gi|111152653|emb|CAJ64394.1| Transcription elongation protein nusA [Frankia alni ACN14a] (365 aa)
Score = 383, Expect = 1.2e-34, Identities = 96/340 (28%), Positives = 171/340 (50%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDL-DIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDK----VGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           L  I +EKD + + +V  ++TAL  +Y        D  VV+D     + +  +    D +  E DD                              F R  T    Q++   L +      Y ++ D+    V  +++   ++  +++V V+LG+ +GV+  +EQ+PGE L+ G      +  V ++   G  + LSR    L++ L + E+ E++DG +E+  I+R  G+++K+A+ S+V GV+  G  +GP G R++ + + L+ E+ID++ +  DP  F+ +A  P ++  VE+TD      S+   +V P+  L   IG+ G N RL ++LTGW IDI S+
  S:     8 LRGIEREKDIAFDTLVQAMETALLTAYHHTAGSAPDARVVIDRTTGEVSVLAREPGPDGTSREYDDTPA--------------------------DFGRIATMTAKQVIMQRLREAQQEVTYGQYADREHEVVSGVVQHHEQRAGSKVVLVDLGTIEGVLPPAEQVPGERLEHGDRIKCYVVHV-ARGPHGPTVTLSRTHPELVKGLFRLEVPEVADGTVELAAIAREAGHRSKIAVRSKVAGVNPKGACIGPMGSRVRAVMAELHGEKIDIVDWSADPATFVGSALSPARVARVEVTD----LASRSARVVVPDYQLSLAIGREGQNARLAARLTGWRIDIHSD 321
>gi|77464744|ref|YP_354248.1| transcription elongation factor NusA [Rhodobacter sphaeroides 2.4.1] >gi|126463584|ref|YP_001044698.1| transcription elongation factor NusA [Rhodobacter sphaeroides ATCC 17029] >gi|77389162|gb|ABA80347.1| N-utilization substance protein A [Rhodobacter sphaeroides 2.4.1] >gi|126105248|gb|ABN77926.1| NusA antitermination factor [Rhodobacter sphaeroides ATCC 17029] (535 aa)
Score = 383, Expect = 1.2e-34, Identities = 105/344 (30%), Positives = 186/344 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK--EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK    + ++  ++ +L ++   +   DLDI V +D           R VV   EDE+ ++   ++ + +A+      K+GD +  EV      R       Q++   + +    + Y+E+KD+ G II   V++ +   + V++G  +G++ R+E+I  E  +P       IK+V+ ++ +G  + LSR D   +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I +++D   FLVNA  P ++  V I ++     +  + +V P+E L   IG+ G NVRL S+LT   IDI++E
  S:    11 LLQTAEAVAREKMIDPDLVIQAMEESLARAAKSRYGSDLDIRVKIDRKTGRATFARIRTVV---EDELIENHHAQVTVKQARSYLADPKIGDEIIDEVPPVDLGRIAAQSAKQVILQKVREAERDRQYDEFKDRKGTIINGVVKREEYGNIIVDIGRGEGILRRNEKIGRESYRPNDRIRAYIKDVR-REARGPQVFLSRTDPQFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNQDQATFLVNALQPAEVSKVVIDEE-----AGKIEVVVPDEQLSLAIGRRGQNVRLASQLTALDIDIMTE 348
>gi|119944578|ref|YP_942258.1| NusA antitermination factor [Psychromonas ingrahamii 37] >gi|119863182|gb|ABM02659.1| NusA antitermination factor [Psychromonas ingrahamii 37] (499 aa)
Score = 383, Expect = 1.2e-34, Identities = 103/345 (29%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKL--FEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+  + DIEV V++++ES K   F + +V++      +  KE+    A+      K+GD +  E+    F+R  T    Q++   + +   ++V  ++ ++ G +I   V+++  DN L+++  G+ + V+ R E +P E  +PG     L+  V+ +  +G  + ++R    +L  L + E+ EI++ +I++   +R  G + K+A+ S    +D VG  VG +G R++ +SS L  ER+D+IL+DE+P Q+ +NA  P  +V V I +D     +  + I   E++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILLVVEAVSNEKGLPREAIFQALESALAIATKKKYEN-DIEVRVEIDRESGKFDTFRRWLVLEPDAKMENPCKEMTFEAAEYETPEIKVGDYIEDEIESVTFDRITTQTAKQVIVQKVREAERAQVVAQYAEQEGELITGIVKRMNRDNILLDLG-GNAEAVIFRDEMLPRENFRPGDRLRGLLFAVRPE-ARGAQLFVTRTQPEMLIELFRLEVPEIAEEMIDLMGAARDPGSRAKIAVKSNDKRIDPVGACVGMRGARVQAVSSELGGERVDIILWDENPAQYAINAMSPADVVSVVIDED-----AHSMDIAVEEDNLAQAIGRNGQNVRLASQLTGWELNVMT 343
>gi|22124601|ref|NP_668024.1| transcription elongation factor NusA [Yersinia pestis KIM] >gi|45440440|ref|NP_991979.1| transcription elongation factor NusA [Yersinia pestis biovar Microtus str. 91001] >gi|21957405|gb|AAM84275.1|AE013671_2 transcription pausing L factor [Yersinia pestis KIM] >gi|45435297|gb|AAS60856.1| N utilization substance protein A [Yersinia pestis biovar Microtus str. 91001] (501 aa)
Score = 383, Expect = 1.2e-34, Identities = 97/345 (28%), Positives = 187/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + V VD+        +EI +  AQ    S +LGD V  ++    F+R  T    Q++   + +   + V E+++  +G I+   V+KV    + ++LG + + V+ R + +P E  +PG     ++ +V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D+       + +     +L + IG+NG NVRL ++L+GW +++++
  S:     9 KEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEVRVSIDRKTGDFDTFRRWVAVDEVTMPT---REITLDAAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEAVIGREDMLPRENFRPGDRIRGVLYDVRPE-ARGAQLFVSRSRSEMLVELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT 346
>gi|77974018|ref|ZP_00829561.1| COG0195: Transcription elongation factor [Yersinia frederiksenii ATCC 33641] (495 aa)
Score = 382, Expect = 1.2e-34, Identities = 97/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + V V++        +EI I  AQ    S +LGD V  ++    F+R  T    Q++   + +   + V E+++  +G I+   V+KV+   + ++LG+  + V+ R + +P E  +PG     ++ +V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D+       + +     +L + IG+NG NVRL ++L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEVRVSIDRKTGDFDTFRRWVAVNEVTMPT---REITIDAAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVEQFRQYLGEIVTGTVKKVNRDSIALDLGNNAEAVIGREDMLPRENFRPGDRIRGVLYDVRPE-ARGAQLFVSRSRPEMLIELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT 340
>gi|167644004|ref|YP_001681667.1| transcription elongation factor NusA [Caulobacter sp. K31] >gi|167346434|gb|ABZ69169.1| NusA antitermination factor [Caulobacter sp. K31] (568 aa)
Score = 382, Expect = 1.3e-34, Identities = 109/344 (31%), Positives = 194/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVST-EVNIDKFE--RRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  D +A+EK   KE ++  ++ AL+K+   +   + DI V +D   ++ +  +KRV+ +   D+ + + EI   +    K++++  +     E ++  FE  R  T    Q++ H + +    + Y+E+KD+ G I+   V++V+   V V+LG  +G++ R + IP E    G      I +V+ ++TKG  I+LSRA  G +  L   E+ E+ DG+IEI+ ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I + ED   F+VNA  P ++  V + ++++     +     P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    12 LLQIADAVAREKGIEKEVVIEAIEDALQKAARARYGAEHDIRVKID--TKTGETTQKRVI-EVVPDDFELEGEIGKVQLSSAKRTWRDAEVGKIYEESLPPFEIGRVQTQMARQVVMHKVREAERERQYDEYKDRAGEIVNGSVKRVEYGNVIVDLGRGEGIMRRDQSIPRENFNVGDRIRAYIYDVR-RETKGPQIMLSRAHGGFMAKLFAQEVPEVYDGVIEIRAVARDPGSRAKMAVISNDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWSEDEATFIVNALAPAEVSKVVMDEEDERVEVVV-----PDEQLSLAIGRRGQNVRLASQLTGWQIDIMTE 350
>gi|119713529|gb|ABL97582.1| transcription elongation factor NusA [uncultured marine bacterium EB0_35D03] (491 aa)
Score = 382, Expect = 1.3e-34, Identities = 109/364 (29%), Positives = 206/364 (56%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-----KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQ 364
           M  K     ++ I+ EK+ +K++++  L+ AL  +  K N ++D+ V VD +      F +  V++  E  +DDD      E++I +A+      ++   V   +   +F R       Q++   + +   + V + +  +VG ++ A V++VD   V V++G   G++ + + IP E ++        IKEVKS   +G  I LSR    ++  L + E+ EIS+G+IEIK  +R  G ++K+A+ ++   +D +G+ +G +G R++ +S+ LN ER+D+IL+DEDP QF++NA  P ++  + + +++   GS  + I   E+ L   IG+ G N++L SKLTGW ++++S  LA  D ++ +++ +
  S:     1 MDGKELFLMIEAISNEKNITKDDVIESLEEALAVATKKRN-NIDVRVEVDRHSGEFNTFRRWQVIEDGEQFVDDDGNTFDSELHIYQAES--GGLEVDAYVEEPMESMEFGRIAAQVAKQVIIQKVREAERTVVVDNFTQRVGEVVMATVKRVDRGNVFVDMGGIDGMISKYDLIPNESIRKNDRLRAYIKEVKST-PRGAQIFLSRTVNDMMIELFEMEVPEISEGVIEIKAGARDPGLRSKLAVKAKDKRIDPIGSCIGMRGARVQAVSNELNGERVDIILWDEDPAQFVINAMAPAEVSSIVVDEEK---GS--MDIAVEEDQLALAIGRGGQNIKLASKLTGWKLNVMS--LADADDMQAKELQK 358
>gi|86136807|ref|ZP_01055385.1| transcription elongation factor NusA [Roseobacter sp. MED193] >gi|85826131|gb|EAQ46328.1| transcription elongation factor NusA [Roseobacter sp. MED193] (541 aa)
Score = 382, Expect = 1.3e-34, Identities = 106/345 (30%), Positives = 189/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V+ ++ +L ++   +   ++DI V +D           R VV+    E +   E+ + +A++   +  +GDT   EV   +  R       Q++   + +    + +EE++D+ G II A V++ +   V V++G+ +G++ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DGII+IK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I +++D   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKMIDPGLVVDAMEESLARAAKSRYGSEMDIRVSIDRKTGKATFTRVRSVVEDEALE-NYQAEMTVEQAKQYMANPAVGDTFVEEVPPVEMGRIAAQSAKQVILQRVREAERDRQFEEFQDRAGTIINALVKREEYGNVIVDVGAGEGILRRNEKIGRESYRPNDRIRCYIKDVR-REPRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIQIKAVARDPGSRAKIAVISNDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNDDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEE 349
>gi|168708745|ref|ZP_02741022.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4045] >gi|168718105|ref|ZP_02750382.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4206] >gi|168734705|ref|ZP_02766982.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4115] >gi|168754150|ref|ZP_02779157.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4401] >gi|168769587|ref|ZP_02794594.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4486] >gi|168773164|ref|ZP_02798171.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4196] >gi|168781312|ref|ZP_02806319.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4076] >gi|168791509|ref|ZP_02816516.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4042] >gi|195938389|ref|ZP_03083771.1| transcription elongation factor NusA [Escherichia coli O157:H7 str. EC4024] >gi|187770909|gb|EDU34753.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4196] >gi|189001070|gb|EDU70056.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4076] >gi|189358578|gb|EDU76997.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4401] >gi|189361406|gb|EDU79825.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4486] (495 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|56551452|ref|YP_162291.1| transcription elongation factor NusA [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543026|gb|AAV89180.1| N-utilization substance protein A [Zymomonas mobilis subsp. mobilis ZM4] (541 aa)
Score = 382, Expect = 1.4e-34, Identities = 113/346 (32%), Positives = 195/346 (56%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK 356
           D +A+EK   +  ++  ++ A++++    Y  EN   DI   +D     ++L+    VVD+ +D     K++++ +AQ+L+    +GD +   +   +F R       Q++   + D    + Y E+KD++G II   V++++   V V+LG  +G + R +QIP E  + G     LI  V+ ++ +G  I+LSR+    ++ L   E+ EI DGIIEIK  SR  G + K+A++S+   +D VG  VG KG R++ +   +  E+ID+I + ED   F+VN+  P ++  V I +D+    S+I  +V P++ L   IG+ G NVRL S+LTG +IDI++E  A E +
  S:    20 DAVAREKLIDRAIVIEAMEEAIQRAARARYGAEN---DIRAKIDPKTGDMRLWRVVEVVDQVDDFF---KQVSVVDAQKLQNGAAVGDFIVDPLPPIEFGRIAAQAAKQVIFQKVRDAERERQYAEFKDRIGEIITGIVKRIEFGHVVVDLGRAEGALRRDQQIPRETFRVGDRVRSLIMNVR-RENRGPQILLSRSHPNFMKKLFAQEVPEIYDGIIEIKACSRDPGSRAKIAVVSQDNTIDPVGACVGMKGSRVQAVVQEVQGEKIDIIPWSEDLATFVVNSLQPAQVSRVVIDEDD----SRIEAVV-PDDQLSLAIGRRGQNVRLASQLTGSAIDILTEADASERR 357
>gi|170765858|ref|ZP_02900669.1| transcription termination/antitermination factor NusA [Escherichia albertii TW07627] >gi|170125004|gb|EDS93935.1| transcription termination/antitermination factor NusA [Escherichia albertii TW07627] (495 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARFEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|194438826|ref|ZP_03070912.1| transcription termination/antitermination factor NusA [Escherichia coli 101-1] >gi|194422298|gb|EDX38299.1| transcription termination/antitermination factor NusA [Escherichia coli 101-1] (495 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQTVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|120597899|ref|YP_962473.1| transcription elongation factor NusA [Shewanella sp. W3-18-1] >gi|146293929|ref|YP_001184353.1| transcription elongation factor NusA [Shewanella putrefaciens CN-32] >gi|120557992|gb|ABM23919.1| NusA antitermination factor [Shewanella sp. W3-18-1] >gi|145565619|gb|ABP76554.1| NusA antitermination factor [Shewanella putrefaciens CN-32] (499 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K+ + D+D+ V +D      + F + +VVD   + +++  +EI +  A+      + G+ +  ++    F+R  T    Q++   + +   ++V E+++DK G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + LSR    +L  L + E+ EI+D +IE+   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALEIALATATKKKYDGDIDVRVAIDRKTGGYETFRRWMVVDDHGEALENPFREITLEAARYENPDIQPGEFIEDDIESVVFDRITTQTAKQVIVQKVREAERAQVVEQFRDKEGELITGVVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLSRTKPEMLIELFRVEVPEIADELIEVMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLTGWELNVMT 344
>gi|170680571|ref|YP_001745443.1| transcription termination/antitermination factor NusA [Escherichia coli SMS-3-5] >gi|191168053|ref|ZP_03029853.1| transcription termination/antitermination factor NusA [Escherichia coli B7A] >gi|193067419|ref|ZP_03048387.1| transcription termination/antitermination factor NusA [Escherichia coli E110019] >gi|170518289|gb|ACB16467.1| transcription termination/antitermination factor NusA [Escherichia coli SMS-3-5] >gi|190901922|gb|EDV61671.1| transcription termination/antitermination factor NusA [Escherichia coli B7A] >gi|192959376|gb|EDV89811.1| transcription termination/antitermination factor NusA [Escherichia coli E110019] (495 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|15803711|ref|NP_289745.1| transcription elongation factor NusA [Escherichia coli O157:H7 EDL933] >gi|15833304|ref|NP_312077.1| transcription elongation factor NusA [Escherichia coli O157:H7 str. Sakai] >gi|16131061|ref|NP_417638.1| transcription termination/antitermination L factor [Escherichia coli str. K-12 substr. MG1655] >gi|24114460|ref|NP_708970.1| transcription elongation factor NusA [Shigella flexneri 2a str. 301] >gi|26249753|ref|NP_755793.1| transcription elongation factor NusA [Escherichia coli CFT073] >gi|30064509|ref|NP_838680.1| transcription elongation factor NusA [Shigella flexneri 2a str. 2457T] >gi|74313706|ref|YP_312125.1| transcription elongation factor NusA [Shigella sonnei Ss046] >gi|89109934|ref|AP_003714.1| transcription termination/antitermination L factor [Escherichia coli W3110] >gi|91212591|ref|YP_542577.1| transcription elongation factor NusA [Escherichia coli UTI89] >gi|117625465|ref|YP_858788.1| transcription elongation factor NusA [Escherichia coli APEC O1] >gi|157155683|ref|YP_001464646.1| transcription elongation factor NusA [Escherichia coli E24377A] >gi|157162654|ref|YP_001459972.1| transcription elongation factor NusA [Escherichia coli HS] >gi|168762136|ref|ZP_02787143.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4501] >gi|168786054|ref|ZP_02811061.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC869] >gi|168797770|ref|ZP_02822777.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC508] >gi|170018579|ref|YP_001723533.1| NusA antitermination factor [Escherichia coli ATCC 8739] >gi|170082706|ref|YP_001732026.1| transcription termination/antitermination L factor [Escherichia coli str. K12 substr. DH10B] >gi|188492867|ref|ZP_03000137.1| transcription termination/antitermination factor NusA [Escherichia coli 53638] >gi|191172236|ref|ZP_03033779.1| transcription termination/antitermination factor NusA [Escherichia coli F11] >gi|193062170|ref|ZP_03043266.1| transcription termination/antitermination factor NusA [Escherichia coli E22] >gi|194433789|ref|ZP_03066064.1| transcription termination/antitermination factor NusA [Shigella dysenteriae 1012] >gi|84028775|sp|P0AFF6|NUSA_ECOLI Transcription elongation protein nusA (N utilization substance protein A) (L factor) >gi|84028773|sp|P0AFF8|NUSA_ECO57 Transcription elongation protein nusA (N utilization substance protein A) (L factor) >gi|84028774|sp|P0AFF7|NUSA_ECOL6 Transcription elongation protein nusA (N utilization substance protein A) (L factor) >gi|84028776|sp|P0AFF9|NUSA_SHIFL Transcription elongation protein nusA (N utilization substance protein A) (L factor) >gi|12517780|gb|AAG58305.1|AE005545_7 transcription pausing; L factor [Escherichia coli O157:H7 EDL933] >gi|26110181|gb|AAN82367.1|AE016767_127 N utilization substance protein A [Escherichia coli CFT073] >gi|606109|gb|AAA57972.1| L factor [Escherichia coli] >gi|1789560|gb|AAC76203.1| transcription termination/antitermination L factor [Escherichia coli str. K-12 substr. MG1655] >gi|13363523|dbj|BAB37473.1| transcription termination-antitermination factor NusA [Escherichia coli O157:H7 str. Sakai] >gi|24053641|gb|AAN44677.1| transcription pausing; L factor [Shigella flexneri 2a str. 301] >gi|30042768|gb|AAP18491.1| transcription pausing; L factor [Shigella flexneri 2a str. 2457T] >gi|73857183|gb|AAZ89890.1| transcription pausing; L factor [Shigella sonnei Ss046] >gi|85675965|dbj|BAE77215.1| transcription termination/antitermination L factor [Escherichia coli W3110] >gi|91074165|gb|ABE09046.1| transcription pausing; L factor [Escherichia coli UTI89] >gi|115514589|gb|ABJ02664.1| transcription elongation factor NusA [Escherichia coli APEC O1] >gi|157068334|gb|ABV07589.1| transcription termination/antitermination factor NusA [Escherichia coli HS] >gi|157077713|gb|ABV17421.1| transcription termination/antitermination factor NusA [Escherichia coli E24377A] >gi|169753507|gb|ACA76206.1| NusA antitermination factor [Escherichia coli ATCC 8739] >gi|169890541|gb|ACB04248.1| transcription termination/antitermination L factor [Escherichia coli str. K12 substr. DH10B] >gi|188488066|gb|EDU63169.1| transcription termination/antitermination factor NusA [Escherichia coli 53638] >gi|189367615|gb|EDU86031.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC4501] >gi|189374081|gb|EDU92497.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC869] >gi|189379809|gb|EDU98225.1| transcription termination/antitermination factor NusA [Escherichia coli O157:H7 str. EC508] >gi|190907546|gb|EDV67142.1| transcription termination/antitermination factor NusA [Escherichia coli F11] >gi|192932390|gb|EDV84988.1| transcription termination/antitermination factor NusA [Escherichia coli E22] >gi|194418052|gb|EDX34146.1| transcription termination/antitermination factor NusA [Shigella dysenteriae 1012] (495 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|82778483|ref|YP_404832.1| transcription elongation factor NusA [Shigella dysenteriae Sd197] >gi|81242631|gb|ABB63341.1| transcription pausing [Shigella dysenteriae Sd197] (495 aa)
Score = 382, Expect = 1.4e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|83953120|ref|ZP_00961842.1| transcription elongation factor NusA [Sulfitobacter sp. NAS-14.1] >gi|83842088|gb|EAP81256.1| transcription elongation factor NusA [Sulfitobacter sp. NAS-14.1] (546 aa)
Score = 382, Expect = 1.4e-34, Identities = 109/345 (31%), Positives = 189/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV  ++DE+++   E  + +A++   + ++G   S EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKMIDPNLVVEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVV--ADDELENYQAEFTVEQAKQYMANPEVGQEFSEEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRVYIKDVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEE 349
>gi|110643410|ref|YP_671140.1| transcription elongation factor NusA [Escherichia coli 536] >gi|110345002|gb|ABG71239.1| N utilization substance protein A [Escherichia coli 536] (495 aa)
Score = 382, Expect = 1.5e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGVQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|163730636|ref|ZP_02138108.1| transcription elongation factor NusA [Vibrio fischeri MJ11] >gi|161396033|gb|EDQ20330.1| transcription elongation factor NusA [Vibrio fischeri MJ11] (495 aa)
Score = 382, Expect = 1.5e-34, Identities = 97/345 (28%), Positives = 192/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K++  ++++ V +D      + F + V V+  E+      EI+I  AQ   ++ ++G  +  ++    F+R  T    Q++   + +   + + E++ D  G +I   V+KV+   + V+LG+  + V+LR +Q+P E  +PG     L+  VK +  +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P ++  + + +D +      + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATATKKKSEMEIEVRVAIDRKTGDFETFRRWVAVENVENPT---LEISIEAAQFEDETIEVGGYIEDDIESVTFDRITTQTAKQVIVQKVREAERAMIVEQFIDNEGELITGIVKKVNRDAIIVDLGNNAEAVILREDQLPRENFRPGDRVRGLLYAVKPE-ARGFQLFMTRSKGVMLTELFRVEVPEIGEELIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPAEVASIIVDEDNN-----TMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|118617680|ref|YP_906012.1| transcription elongation factor NusA [Mycobacterium ulcerans Agy99] >gi|118569790|gb|ABL04541.1| N utilization substance protein a NusA [Mycobacterium ulcerans Agy99] (347 aa)
Score = 382, Expect = 1.5e-34, Identities = 90/242 (37%), Positives = 143/242 (59%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           F R   +   Q++     D  N + Y E+  + G I+   +++ D+R     LV V +GS    ++GV+  +EQ+PGE  + G      +  V S+ ++   I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ S VPG++A G  +GP G+R++ + S L+ E+ID+I YDEDP +F+ NA  P K+V V + D      ++   +V P+  L   IGK G N RL ++LTGW IDI
  S:    79 FGRIAATTARQVMLQRFRDAENERTYGEFSTREGEIVAGVIQR-DSRANARGLVVVRMGSETKASEGVIPSAEQVPGESYEHGNRLRCYVVGV-SRGSREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVPGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDEDPGRFVANALSPAKVVSVSVIDQT----ARAARVVVPDFQLSLAIGKEGQNARLAARLTGWWIDI 323
>gi|191162534|ref|ZP_03024413.1| NusA antitermination factor [Geobacter sp. M21] >gi|190996088|gb|EDV71537.1| NusA antitermination factor [Geobacter sp. M21] (382 aa)
Score = 381, Expect = 1.6e-34, Identities = 108/349 (30%), Positives = 183/349 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTA-LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           +D+I KEK   K  +V  L+ A L  +  K     D+E   +  +  ++LFE   VV++ +D     +EI + EA+E     ++GD++  +++   F R       Q++   + +     ++ E+ ++ G I+   V + +   + V+LG  + ++   EQ P E  + G     LI E++   TKG  I+LSR    +L  L + E+ EI++GI+EIK + R  G + K+A+ S    VD VG  VG +G R++ + S L  E+ID+I + ED  +F  NA  P  +  V + ++E       + ++  ++ L   IGK G NVRL +KLTGW IDI SE    E +++
  S:    11 IDQIVKEKGIDKSIVVEALEQAVLTAANKKFRNTRDLEAHYNPEEGEVELFEFVTVVEEVQDSY---REIELDEAREEDPEVEIGDSIGMKMDASGFSRIAAQTAKQVIIQRVREAERETIFNEFMERQGEIVNGVVRRFEKGDLIVDLGRAEALLPHKEQAPREVYRQGDRVKALITEIR-MTTKGPQIMLSRTHPTMLAKLFEAEVPEIAEGIVEIKSVVREPGGRAKIAVYSHDSDVDPVGACVGMRGSRVQNVVSELRGEKIDIIPWSEDIARFACNALAPAVVTKVYVDEEE-----YAMEVIVADDQLSLAIGKRGQNVRLAAKLTGWKIDIKSETRMAEAELQ 351
>gi|162454076|ref|YP_001616443.1| N utilization substance protein A [Sorangium cellulosum 'So ce 56'] >gi|161164658|emb|CAN95963.1| N utilization substance protein A [Sorangium cellulosum 'So ce 56'] (547 aa)
Score = 381, Expect = 1.7e-34, Identities = 114/340 (33%), Positives = 195/340 (57%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEV-----------NIDK--------------FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD--NRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           LD++AKEK   K+ +V  ++ A+ K+      P  ++E   + +   I LF+   VV   E   + ++EI+I++  +LK    LG+ +  +V           + DK              F R       Q+L   + D     ++ E+KD+ G +IR  V + +  N ++ V++G T+GV+   EQ P E  +PG   +  +K++  ++ +G  +ILSR+D  L+  L + E+ EI +GI+ I  ++R  G ++K+A+ SR   VD VG  VG KG R++ +   L  E+ID++ +D DP ++++ A  P ++  V I D+ D      + +V P+E L   IG+ G NVRL ++LT W +DIISE
  S:    18 LDQVAKEKGIDKKILVETIEAAILKAAQSVFGPTRELEARFNEDTGQIDLFQYMTVV---EAVTEPEREISITDVDKLKLDATLGEELGFQVFWRPEDAEKARDQDKEYGDILKLKHGRTTFGRIAAQTAKQVLLQRVRDAERDLIFNEYKDRKGELIRGIVRRFEKGNNII-VDIGRTEGVLTFREQTPRETYRPGDRIVAYVKDI-DREARGPQVILSRSDPRLVEKLFEAEVPEIYEGIVRIVSVAREPGARSKIAVTSRDADVDPVGACVGMKGSRVQAVVQELRGEKIDIVPFDRDPARYVIAAIQPAEVHKV-IVDEAD----GRMELVVPDEKLSLAIGRKGQNVRLAAQLTNWKLDIISE 375
>gi|119470821|ref|ZP_01613432.1| transcription elongation factor NusA [Alteromonadales bacterium TW-7] >gi|119446048|gb|EAW27327.1| transcription elongation factor NusA [Alteromonadales bacterium TW-7] (499 aa)
Score = 381, Expect = 1.9e-34, Identities = 102/345 (29%), Positives = 195/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDD--KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+ AL  +  K++ D +IEV V +++++     F +  + +  ED   ++   EI +  AQ  +   +LGD V  +++  KF+R  T    Q++   + +   + V + +KD+VG ++   V+K     + ++LG+  + V+ R + +P E  +PG     L+ EVK +  +G  + ++R+   +L  L + E+ EI + +IE++  +R  G + K+A+ S    +D +G  VG +G R++ +SS L  ER+D++LYD++P QF++NA  P ++  + + +D     +  + I    ++L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPKEKIFEALEFALATATKKKH-DGEIEVRVSIDRKTGDYDTFRRWQIAEVLEDGSLENPYSEITLEAAQVEEPDLQLGDFVEEQIDSIKFDRITTQMAKQVIVQKVREAERALVVDAYKDQVGELVTGVVKKATRDSIVLDLGNNAEAVIYRDDMLPRENFRPGDRIRGLLYEVKPE-ARGAQLFVTRSKPEMLMELFRIEVPEIGEEMIELRAAARDPGSRAKIAVKSNDKRIDPIGACVGMRGARVQAVSSELGGERVDIVLYDDNPAQFVINAMSPAEVASIVLDED-----THSMDIAVEADNLAQAIGRNGQNVRLASQLTGWELNVMT 345
>gi|124549939|ref|ZP_01707898.1| NusA antitermination factor [Shewanella putrefaciens 200] >gi|124507645|gb|EAY51770.1| NusA antitermination factor [Shewanella putrefaciens 200] (499 aa)
Score = 381, Expect = 1.9e-34, Identities = 97/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K+ + D+D+ V +D      + F + +V+D   + +++  +EI +  A+      + G+ +  ++    F+R  T    Q++   + +   ++V E+++DK G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + LSR    +L  L + E+ EI+D +IE+   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALEIALATATKKKYDGDIDVRVAIDRKTGGYETFRRWMVIDDHGEALENPFREITLEAARYENPDIQPGEFIEDDIESVVFDRITTQTAKQVIVQKVREAERAQVVEQFRDKEGELITGVVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLSRTKPEMLIELFRVEVPEIADELIEVMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLTGWELNVMT 344
>gi|167035704|ref|YP_001670935.1| transcription elongation factor NusA [Pseudomonas putida GB-1] >gi|166862192|gb|ABZ00600.1| NusA antitermination factor [Pseudomonas putida GB-1] (493 aa)
Score = 381, Expect = 1.9e-34, Identities = 103/347 (29%), Positives = 194/347 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VVD  E ++DD   E  + + ++     K+GD +  ++   +F R       Q++   + +   ++V + ++++VG II   V+KV    V V+LG+    +L R + IP E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I   E++L + IG+ G NVRL S+LTGW++++++EK
  S:     3 KEVLLVVESVSNEKGVPPGVIFEALEVALATATKKRFEDEVDLRVEINRHTGSYETFRRWTVVD--EADLDDPAIETWLDKIKDTHPEAKVGDVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERVGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIIPRETFRVGVRLRALLKEIRTEN-RGPQLILSRTAPQMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVAEDNLAQAIGRGGQNVRLASQLTGWTLNVMTEK 344
>gi|26991396|ref|NP_746821.1| transcription elongation factor NusA [Pseudomonas putida KT2440] >gi|148549780|ref|YP_001269882.1| transcription elongation factor NusA [Pseudomonas putida F1] >gi|24986465|gb|AAN70285.1|AE016669_3 N utilization substance protein A [Pseudomonas putida KT2440] >gi|148513838|gb|ABQ80698.1| NusA antitermination factor [Pseudomonas putida F1] (493 aa)
Score = 381, Expect = 1.9e-34, Identities = 103/347 (29%), Positives = 194/347 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VVD  E ++DD   E  + + ++     K+GD +  ++   +F R       Q++   + +   ++V + ++++VG II   V+KV    V V+LG+    +L R + IP E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I   E++L + IG+ G NVRL S+LTGW++++++EK
  S:     3 KEVLLVVESVSNEKGVPPGVIFEALEVALATATKKRFEDEVDLRVEINRHTGSYETFRRWTVVD--EADLDDPAIETWLDKIKDTHPEAKVGDVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERVGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIIPRETFRVGVRLRALLKEIRTEN-RGPQLILSRTAPQMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVAEDNLAQAIGRGGQNVRLASQLTGWTLNVMTEK 344
>gi|82545591|ref|YP_409538.1| transcription elongation factor NusA [Shigella boydii Sb227] >gi|187731710|ref|YP_001881914.1| transcription termination/antitermination factor NusA [Shigella boydii CDC 3083-94] >gi|81247002|gb|ABB67710.1| NusA [Shigella boydii Sb227] >gi|187428702|gb|ACD07976.1| transcription termination/antitermination factor NusA [Shigella boydii CDC 3083-94] (495 aa)
Score = 381, Expect = 2.0e-34, Identities = 98/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + + LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLELGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|110807038|ref|YP_690558.1| transcription elongation factor NusA [Shigella flexneri 5 str. 8401] >gi|110616586|gb|ABF05253.1| transcription elongation factor NusA [Shigella flexneri 5 str. 8401] (495 aa)
Score = 380, Expect = 2.3e-34, Identities = 98/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VVD+        KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPT---KEITLEAARYEDESLNLGDYVEDQIESVIFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|83942070|ref|ZP_00954532.1| transcription elongation factor NusA [Sulfitobacter sp. EE-36] >gi|83847890|gb|EAP85765.1| transcription elongation factor NusA [Sulfitobacter sp. EE-36] (542 aa)
Score = 380, Expect = 2.4e-34, Identities = 109/345 (31%), Positives = 189/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV  ++DE+++   E  + +A++   + ++G   S EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKMIDPNLVVEAMEESLARAAKSRYGAEMDIRVSIDRKTGRATFTRVRTVV--ADDELENYQAEFTVEQAKQYMANPEVGQEFSEEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRVYIKDVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEE 349
>gi|115522227|ref|YP_779138.1| transcription elongation factor NusA [Rhodopseudomonas palustris BisA53] >gi|115516174|gb|ABJ04158.1| NusA antitermination factor [Rhodopseudomonas palustris BisA53] (538 aa)
Score = 379, Expect = 2.7e-34, Identities = 104/360 (28%), Positives = 196/360 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEES--LIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A+EK   +  ++  ++ A+ K+   +   + D+   +      ++L    +VV++ E+  +   +I++ +AQ       +GDT++  +   ++ R       Q++   + +    + Y+E+KD++G+I+   V++V+   V V+LG  + ++ R E +P E  + G      I +V+ ++T+G  I LSR     +  L   E+ EI DGI+EIK ++R  G + K+ ++SR   VD VG  VG +G R++ + + L  E+ID+I +  D   F+VNA  P ++  V I +D +      + +V P+ +  L   IG+ G NVRL S+LTGW IDI++E    E +  +FE+ +++
  S:    11 LLQIADAVAREKTIDRGIVIAAMEDAIAKAARARYGSETDVHAEIHPKTGQLQLTRHMLVVEQVENSAN---QISLVDAQRANPGAMIGDTIADTLPPLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIIRRDEMLPREVFRNGDRVRAYIFDVR-RETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKVVIDEDRE-----RIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTESEESERRQADFENSTRV 365
>gi|56478754|ref|YP_160343.1| transcription elongation factor NusA [Azoarcus sp. EbN1] >gi|56314797|emb|CAI09442.1| N utilization substance protein A [Azoarcus sp. EbN1] (491 aa)
Score = 379, Expect = 3.0e-34, Identities = 96/341 (28%), Positives = 190/341 (55%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           +D +A+EK+ +K+ +   L++AL  +  K  N + D+ V +D +    + F +R VV   E+ ++D+ E+ I +A+E+    +LG+ +   +    F R       Q++   + D    ++  ++ ++  +++   +++++     + +G  + V+ R + IP E L+ G      +  +  +  +G  +ILSR     +  L + E+ EI DG++EIK  +R  G + K+A+ S  P +D +GT VG +G R+  + + +  E+ID+I++  DP QF++ A  P ++V + + D+E    S  + +V  E +L   IG+NG NV+L S+LTGW+I+++SE+
  S:     9 VDALAREKNVAKDIVFGALESALASATKKRINDEADVRVTIDRDTGDYESF-RRWVVMPDEEVVNDEAEMGIIDAREMVPGIELGEYIEEPLEPIDFGRIGAQAAKQVILQRIRDAEREQILNDFLERKEHLVSGSIKRMERGNAIIEIGRLEAVIPRDQMIPRENLRVGDRVKAFLLRI-DRGARGPQLILSRTAPEFVGKLFELEVPEIEDGLLEIKACARDPGLRAKIAVQSNDPRIDPIGTCVGLRGSRVTAVRNEIAGEQIDIIVWSADPAQFVIAALQPAEVVSI-VVDEE----SHAMDVVVDENNLAIAIGRNGQNVKLASELTGWTINLMSEE 343
>gi|84498575|ref|ZP_00997338.1| transcription elongation factor NusA [Janibacter sp. HTCC2649] >gi|84381108|gb|EAP96993.1| transcription elongation factor NusA [Janibacter sp. HTCC2649] (385 aa)
Score = 379, Expect = 3.1e-34, Identities = 83/245 (33%), Positives = 143/245 (58%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV-DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   +   Q++   L DI +  +  ++K + G+I+   +++  D R V V+ G+ +G++  +EQ+PGE+   GQ     +  VK +  +G  I LSR    L+R L   E+ EI+DG +EI  ++R  G++TK+A+ ++V G++A G  +GP G R++ + + L+ E+ID++ + EDP  F+ +A  P ++  VEI D +     +   ++ P+  L   IG+ G N RL +KLTGW IDI S+
  S:   124 FGRVAAATARQVIVQRLRDIEDDAIMGDFKGREGDIVAGVIQQSPDPRHVTVDFGTVEGILPVAEQVPGEKYVHGQRLRVYVVSVK-RGLRGPQIGLSRTHPNLVRKLFALEVPEIADGSVEIAALARESGHRTKIAVHTKVAGLNAKGACIGPMGARVRAVMAELHGEKIDIVDFSEDPASFIASALSPSRVQSVEIVDWQ----LRAARVIVPDYQLSLAIGREGQNARLAAKLTGWRIDIRSD 364
>gi|77958790|ref|ZP_00822818.1| COG0195: Transcription elongation factor [Yersinia bercovieri ATCC 43970] >gi|77961868|ref|ZP_00825697.1| COG0195: Transcription elongation factor [Yersinia mollaretii ATCC 43969] (495 aa)
Score = 379, Expect = 3.1e-34, Identities = 96/345 (27%), Positives = 187/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + V V++        +EI +  AQ    S +LGD V  ++    F+R  T    Q++   + +   + V E+++  +G I+   V+KV+   + ++LG+  + V+ R + +P E  +PG     ++ +V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D        + +     +L + IG+NG NVRL ++L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEVRVSIDRKTGDFDTFRRWVAVNEVTMPT---REITLEAAQYEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVEQFRQYLGEIVTGIVKKVNRDSIALDLGNNAEAVIGREDMLPRENFRPGDRIRGVLYDVRPE-ARGAQLFVSRSRPEMLIELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDR-----HTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT 340
>gi|187778986|ref|ZP_02995459.1| hypothetical protein CLOSPO_02581 [Clostridium sporogenes ATCC 15579] >gi|187772611|gb|EDU36413.1| hypothetical protein CLOSPO_02581 [Clostridium sporogenes ATCC 15579] (454 aa)
Score = 379, Expect = 3.1e-34, Identities = 120/354 (33%), Positives = 206/354 (58%)
  Q:     4 KSFLENLDKIAKEKDTSKE----NIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI 357
           + F+E L +I KEK  S +     I + L TA +K+Y K+    + ++V+++     IK++ ++      E   ++ +EI++ +A+E+  +Y+L D ++ EV   KF R       Q++   + +     VY E+ +K  +I+   V + D   + +N+G ++ V+  +EQIPGE+ +  +     + EVK+  TKG  +++SR   GL++ L + E+ EI +G++EIK I+R  G +TK+A+ S    VD +G  VGPKG R++ I + L NE+ID+I + + P + + NA  P K++ V I D+E+    K   +V  +  L   IGK G NVRL +KLTGW IDI S+  A +++I
  S:     3 QEFVEALKEIVKEKGISADLLFTTIEDALVTAYKKNYAKQGGSTNNVKVIMNRESGEIKVYAQK---KVVELVEEEIEEISLEDAKEIDPNYELEDIINIEVTPKKFGRIAAQAAKQVVIQRIKEEERRIVYNEYIEKEEDILTGTVLRKDKGNILINVGKSEAVLGPNEQIPGEQFRFNEKIKLYVVEVKNT-TKGPQVLISRTHPGLVKRLFELEVPEIYNGVVEIKSIAREAGSRTKIAVYSNDEAVDPMGACVGPKGVRVQNIVNELKNEKIDIIKWSKFPDELISNALSPAKVIDVTIVDEEN----KAARVVVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSQAEKEEI 353
>gi|160871616|ref|ZP_02061748.1| NusA antitermination factor [Rickettsiella grylli] >gi|159120415|gb|EDP45753.1| NusA antitermination factor [Rickettsiella grylli] (512 aa)
Score = 379, Expect = 3.2e-34, Identities = 109/345 (31%), Positives = 196/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEK-RVVVDKSE----DEI----DDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EKD  KE I   ++ AL  +  K+   D+D+ + +D      + F    VV D++E    DEI    D  K I +SEA++   + ++GD +   +   +F R       Q++   + +   +K+ E + ++VG ++   V++V    + V+LG S +  V R E IP EE++     + YL+ +    + Q +G  +++SR    +L  L K E+ EI + +IEIK  +R  G + K+A+ +    +D +G  VG +G R++ +SS L  ERID++L+D++P Q ++NA  P ++  + + +D     +K++ +   E+ L + IG+NG NVRL S+LTGW I++I+
  S:     3 KEILLVAETVSNEKDVDKELIFKAIEAALAMATKKKAGEDIDVRIAIDRRTGDYETFRTWTVVADEAEFNHSDEIPVSFDPLKHIQLSEAKKRHPNSQIGDIIEERMPSVEFGRIAAQTAKQVIIQKVREAERAKIAEAYTNRVGELLSGIVKRVTREGLIVDLGASVEAFVPREEMIPREEIRSEDRLRGYLYAV----NPQVRGPQLLMSRTRPEMLIELFKIEVPEIGEELIEIKSAARDPGSRAKIAVKTNDGRIDPIGACVGMRGARVQAVSSELAGERIDIVLWDDNPVQLVINAMAPAEVASIVVDED-----TKVMDVAVQEDQLSQAIGRNGQNVRLASELTGWIINVIT 352
>gi|114772784|ref|ZP_01450108.1| transcription elongation factor NusA [alpha proteobacterium HTCC2255] (494 aa)
Score = 379, Expect = 3.2e-34, Identities = 100/345 (28%), Positives = 192/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   KE I   L+ AL  +  K+N  ++++ V +D        F + +V+   + + +   E+ IS AQ  +   ++GD V  ++   KF+R  T    Q++   + +   +++  E++D+VG ++   V+KV+   V ++LG+  +GV+ R + +P E  +PG     L+  ++ +  +G  + +SR    ++  L + E+ EI++  +EIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ER+D++L+DE+  QF++NA  P ++    I  DED   +  + +    ++L + IGK+G NVRL S+LTGW +++++
  S:     3 KEILLVAEAVSNEKQVPKEKIFEALEFALSTATKKKNEGEIEVRVAIDRATGDFDTFRQWLVIPDDQVQENPYAEMTISAAQIDEPEIQIGDFVEEQIESIKFDRITTQTAKQVIFQKVREAERAQMIAEYEDRVGELVTGTVKKVNRDNVIIDLGNNAEGVIYRDDMLPRENFRPGDRVRGLLYVIRPE-ARGAQLFISRTHPDMIVELFRLEVPEIAEETLEIKSAARDPGSRAKIAVKTNDKRLDPVGACVGMRGSRVQAVSSELGGERVDIVLWDEEAPQFVINAMAPAEV--ASIVADED---TMTMDVAVEPDNLAQAIGKSGQNVRLASQLTGWELNVMT 343
>gi|196480322|gb|ACG79850.1| N utilization substance protein A [Phenylobacterium zucineum HLK1] (561 aa)
Score = 379, Expect = 3.3e-34, Identities = 112/344 (32%), Positives = 193/344 (56%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEK-SYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDE-----IDDDKE-----------INISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
            L+  + +A+EK   KE ++  ++ A++K +  +   + DI V +D       +  KRVV   ++D      +D +             I ++EA+   K  ++G      +   +F R  T    Q++   + D    + YEE+KD+VG I+   V++V+   V V+LG  +G++ R + IP E    G      I +V+ ++TKG  I+LSRA  G +  L   E+ E+ DG+IEI+ ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I + +D   F+VNA  P ++  V + +++     + V +V P+E L   IG+ G NVRL S+LTGW IDI++E
  S:    13 LLQIAEAVAREKAIDKEIVIEAIEEAIQKGARARYGAEHDIRVHIDPKTGETTI--KRVVTVVADDATFGGGVDPETGEELPIEEPPGIIRLAEAKRRDKDAEVGKVYEELLPPFEFGRVQTQMARQVVMGKVRDAERERQYEEYKDRVGEIVNGTVKRVEYGNVVVDLGRGEGIMRRDQSIPRENFNIGDRIRCYIYDVR-RETKGPQILLSRAHGGFMAKLFAQEVPEVYDGVIEIRAVARDPGSRAKMAVVSNDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWSQDDATFIVNALAPAEVSKVVMDEED-----ERVEVVVPDEQLSLAIGRRGQNVRLASQLTGWQIDIMTE 365
>gi|111023601|ref|YP_706573.1| transcription elongation factor NusA [Rhodococcus sp. RHA1] >gi|110823131|gb|ABG98415.1| transcription elongation protein NusA [Rhodococcus sp. RHA1] (343 aa)
Score = 379, Expect = 3.4e-34, Identities = 88/245 (35%), Positives = 142/245 (57%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWK----DKVGNIIRAEVEKVDNRLVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   +   Q++   L D  + + + E+     + VG +I+ +       +V V +GS     +G++  +EQ+PGE  + G+     +  V   Q +G  I LSR    L+R L   E+ EI+DG +EI  ++R  G+++K+A+ SRV G++A G  +GP G+R++ + S L  E+ID+I +DEDP +F+ NA  P K+V V + D    P ++   +V P+  L   IGK G N RL ++LTGW IDI S+
  S:    80 FGRIAATTARQVILQRLRDAEHERSFGEYSTHEGEIVGGVIQRDTRANSRGMVVVRIGSEASGAEGLIPPAEQVPGENYEHGERLKCYVVGVARGQ-RGPQITLSRTHPNLVRKLFALEVPEIADGSVEIIAVAREAGHRSKIAVQSRVQGLNAKGACIGPMGQRVRNVMSELAGEKIDIIDFDEDPARFVGNALSPSKVVSVTVVD----PDARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSD 327
>gi|33592374|ref|NP_880018.1| transcription elongation factor NusA [Bordetella pertussis Tohama I] >gi|33602223|ref|NP_889783.1| transcription elongation factor NusA [Bordetella bronchiseptica RB50] >gi|33572019|emb|CAE41542.1| N utilization substance protein A [Bordetella pertussis Tohama I] >gi|33576661|emb|CAE33739.1| N utilization substance protein A [Bordetella bronchiseptica RB50] (492 aa)
Score = 379, Expect = 3.4e-34, Identities = 100/339 (29%), Positives = 178/339 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           +D +A+EK+ ++E +   L++AL  +  K    D DI V +D      + F + +VV       + DK+  +SEA+E+    ++G+ +   +   +F R       Q +   + D    +V  ++ D+   II   ++++D   V +  G  +  + RSE IP E L+ G      +  V     +G  +ILSR     +R L + E+ EI  G++EIK  +R  G + K+A+++    +D +GT VG +G R+  + + L  E++D++L+ EDP QF++ A  P  +  + + +D+       + +V  EE+L K IG  G NVRL S+LTGW I+I++
  S:     9 VDALAREKNVTREVVFGALESALASAMKKRFKDDADIRVSIDRETGGHEGFRRWLVVPDEAGLQEPDKQELLSEAREMAPDIEVGEYIEEALEPVEFGRIGAQAAKQAILQKIRDAEREQVLNDFLDRGETIISGSIKRMDKGDVIIETGKIEARLPRSEMIPKENLRVGDRVRAFVLRV-DHAARGQQVILSRTSPEFIRQLFENEVPEIEQGLLEIKAAARDPGVRAKIAVVAYDKRIDPIGTCVGMRGSRVTAVRNELGGEQVDIVLWSEDPAQFVIGALAPANVESIVVDEDK-----HAMDVVVDEENLPKAIGAKGQNVRLASELTGWQINIMT 342
>gi|110803140|ref|YP_698976.1| transcription elongation factor NusA [Clostridium perfringens SM101] >gi|110683641|gb|ABG87011.1| N utilization substance protein A [Clostridium perfringens SM101] (366 aa)
Score = 378, Expect = 3.5e-34, Identities = 120/359 (33%), Positives = 200/359 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-----LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           + FL  L +I KEK  S E ++  +  A+  +Y K   +      +++V  D     I ++ ++VVV++  D+     EI++ +A+ +   Y+L D V  EV    F R       Q++   + +   + +Y E+ +K  +I+   V + D   V V+LG  +GV+  +EQ+P E+    +     + EVK + +KG  ++ SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I +   P +++ NA  P K+V VE  ++     +K   ++  +  L   IGK G NVRL +KLTGW IDI S+  A E+ ++ ED+
  S:     3 EEFLGALSEIVKEKGISVEALLETIDDAIIAAYKKNFSNSGTTAQNVKVKRDEKSGEIHVYAQKVVVEEVYDD---VTEISLEDAKAISAIYQLDDIVEIEVTPKNFGRVAAQLAKQMVIQRIKESERNVIYSEFAEKEFDILPGTVIRKDKGNVFVDLGKIEGVLGPNEQMPTEKYNFNEKLQLYVVEVK-KTSKGASVLCSRTHPGLVKRLFELEVPEIYEGIVEIKSIAREAGSRTKIAVYSNDESVDAMGACVGPKGVRVQNIVNELKNEKIDIIKWSNTPSEYIENALSPAKVVSVEADEE-----TKSAKVIVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSKA-EELLQEEDI 356
>gi|117619535|ref|YP_857795.1| transcription elongation factor NusA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560942|gb|ABK37890.1| transcription elongation protein NusA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (500 aa)
Score = 378, Expect = 3.5e-34, Identities = 101/365 (27%), Positives = 197/365 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQLVSS 368
           K  L  +D ++ EK   +E I   L+TAL  +  K+   ++++ V +D        + + VV+       +   EI +  AQ  +   ++G+ V  +++   F+R  T    Q++   + +   S+V +++KDK G II   V+K +   V ++LGS  + V+ R + +P E  +PG     L+  V+ +  +G  + +SR+    L+ L + E+ EI + +IEI   +R  G + K+A+ +    +D +G  +G +G R++ +S+ L+ ER D++LYD++P Q+++NA  P  +  + + +D     +  + I     +L + IG+NG NVRL S+LTGW +++++ E +  + + E + +  L +S
  S:     3 KEILLVVDAVSNEKAVPREKIFQALETALATATKKKYEGEIEVRVEIDRKTGDYDTYRRWVVIADQAAMENPYAEITLEAAQIEQPEIQIGEYVEDQIDSVTFDRITTQTAKQVIVQKVREAERSQVVDQFKDKEGTIISGVVKKSNRDNVILDLGSNAEAVIFRDDMLPRETFRPGDRIRGLLYAVRPE-ARGSQLFVSRSSPDFLKELFRIEVPEIGEEMIEIMGAARDPGSRAKIAVKTNDRRIDPIGACIGMRGARVQAVSAELSGERADIVLYDDNPAQYVINAMAPADVASIIVDED-----NHTMDIAVEAANLAQAIGRNGQNVRLASQLTGWELNVMTVEDMRAKHQAENDRILTLFTS 364
>gi|109898014|ref|YP_661269.1| NusA antitermination factor [Pseudoalteromonas atlantica T6c] >gi|109700295|gb|ABG40215.1| NusA antitermination factor [Pseudoalteromonas atlantica T6c] (497 aa)
Score = 378, Expect = 3.6e-34, Identities = 93/345 (26%), Positives = 194/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ A+  +  K+   ++++ V +D        F + +V+   + + +   E+ IS AQ  +   +LGD V  ++   KF+R  T    Q++   + +   ++V  E++++VG+++   V+KV+   + ++LG+  +GV+ R + +P E  +PG     L+  ++ +  +G  + +SR    +L  L + E+ EI++  +EIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L+ ER+D++L+D++P QF++NA  P ++  + + +D     +  + +    ++L + IG++G NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKQVPREKIFEALEFAIASATKKKTEGEIEVRVAIDRITGDFDTFRRWMVIADDQKQENPFAEMTISAAQIDEPDIQLGDYVEDQIESIKFDRITTQTAKQVIVQKVREAERAQVMAEYEERVGDLVTGTVKKVNRDNIIIDLGNNAEGVIYRDDMLPRETFRPGDRVRGLLYVIRPE-ARGAQLFVSRTHPDMLVELFRLEVPEIAEETLEIKAAARDPGSRAKIAVKTNDKRLDPVGACVGMRGSRVQAVSSELSGERVDIVLWDDNPAQFVINAMAPAEVASIVVDED-----NHTMDVAVESDNLAQAIGRSGQNVRLAAQLTGWELNVMT 343
>gi|163733005|ref|ZP_02140449.1| transcription elongation factor NusA [Roseobacter litoralis Och 149] >gi|161393540|gb|EDQ17865.1| transcription elongation factor NusA [Roseobacter litoralis Och 149] (538 aa)
Score = 378, Expect = 3.8e-34, Identities = 113/360 (31%), Positives = 198/360 (55%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD--KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKL-AIEDKIEFEDVSQL 365
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV   EDE+ ++   E  + +A++  ++ ++G  +  EV   +  R       Q++   + +    + +EE+KD+ G+II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+  +   + EFE  +QL
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVHIDRKTGKATFTRVRTVV---EDELLENYQAEFTVEQAKQYMENPEVGQQLIEEVPPVEMGRIAAQSAKQVILQKVREAERDRQFEEFKDRAGSIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRVYIKDVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEEQESARRQAEFELRTQL 365
>gi|188996513|ref|YP_001930764.1| NusA antitermination factor [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931580|gb|ACD66210.1| NusA antitermination factor [Sulfurihydrogenibium sp. YO3AOP1] (371 aa)
Score = 378, Expect = 3.9e-34, Identities = 121/358 (33%), Positives = 197/358 (55%)
  Q:    10 LDKIAKEKDTSKENIVNILK----TALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPII------------------LSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVS 367
           ++ I++EK+  ++ I   L+    TA++K +     D  ++++ D  K+ +K+  K+ V    EDE    KEI + EA+    +   G  V   +N++   R   S   +++   ++ +    +Y E+KD  G II   V + +   + V+LG  + ++ + EQIP E+ + G     L+ +V  + T  +PII                  LSR     L+ LL+ E+ EI++G IE+K ++R  G + KVA+ S+   +D VG  VG KG RI  +SS L+ E+IDVI +DEDP +F++ A  P +     +     +P  K + I  P E L   IGKNGIN +L  KLTGW IDI+SE+       +FE + +L S
  S:     9 IETISREKNIPEDVIEKALRDGILTAVKKEFKLREKDA-VKIIFDKEKDELKVLIKKKVTPFVEDET---KEIALEEAKNYDPNADYGKYVYVPLNLEDIGRIALSVAKEVIAKKVSKVERDILYREFKDYEGKIITGTVRRFEGDDIIVDLGRIEAILPKEEQIPKEKYKIGDRIRALVLKVSKENT--YPIIEKGKLKRVIKVFEPPMVILSRTHPNFLKKLLEIEVPEIAEGEIEVKAVAREPGERAKVAVYSKDKNIDPVGVVVGLKGSRILNVSSELSGEKIDVIEWDEDPAKFIIRALAPARAKKYRL-----LPREKRIEIAVPREELSLAIGKNGINAKLAHKLTGWHIDILSEE-------DFERIQKLPS 370
>gi|19746626|ref|NP_607762.1| transcription elongation factor NusA [Streptococcus pyogenes MGAS8232] >gi|139473254|ref|YP_001127969.1| transcription elongation factor NusA [Streptococcus pyogenes str. Manfredo] >gi|161761305|ref|YP_060778.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS10394] >gi|162139101|ref|YP_599142.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS10270] >gi|162139179|ref|YP_603019.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS10750] >gi|162139397|ref|YP_280920.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS6180] >gi|19748845|gb|AAL98261.1| transcription termination-antitermination factor [Streptococcus pyogenes MGAS8232] >gi|134271500|emb|CAM29721.1| putative N utilization substance protein A [Streptococcus pyogenes str. Manfredo] (385 aa)
Score = 378, Expect = 4.1e-34, Identities = 113/345 (32%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I++ +  +L+ +Y K         V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     3 KEMLEAFRILEEEKHIDKADIIDAVTESLKSAY-KRRYGQSESCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 354
>gi|157148740|ref|YP_001456059.1| transcription elongation factor NusA [Citrobacter koseri ATCC BAA-895] >gi|157085945|gb|ABV15623.1| hypothetical protein CKO_04570 [Citrobacter koseri ATCC BAA-895] (495 aa)
Score = 378, Expect = 4.2e-34, Identities = 97/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++V   E+     KEI +  A+   +S  LGD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LGS  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL ++L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLIV---EEVTLPTKEITLEAARFEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGSNAEAVILREDMLPRENFRPGDRIRGVLYSVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLAAQLSGWELNVMT 340
>gi|33596482|ref|NP_884125.1| transcription elongation factor NusA [Bordetella parapertussis 12822] >gi|33566251|emb|CAE37162.1| N utilization substance protein A [Bordetella parapertussis] (492 aa)
Score = 378, Expect = 4.2e-34, Identities = 100/339 (29%), Positives = 178/339 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           +D +A+EK+ ++E +   L++AL  +  K    D DI V +D      + F + +VV       + DK+  +SEA+E+    ++G+ +   +   +F R       Q +   + D    +V  ++ D+   II   ++++D   V +  G  +  + RSE IP E L+ G      +  V     +G  +ILSR     +R L + E+ EI  G++EIK  +R  G + K+A+++    +D +GT VG +G R+  + + L  E++D++L+ EDP QF++ A  P  +  + + +D+       + +V  EE+L K IG  G NVRL S+LTGW I+I++
  S:     9 VDALAREKNVTREVVFGALESALASAMKKRFKDDADIRVSIDRETGGHEGFRRWLVVPDEAGLQEPDKQELLSEAREMAPDIEVGEYIEEALEPVEFGRIGAQAAKQAILQKIRDAEREQVLNDFLDRGETIISGSIKRMDKGDVIIETGKIEARLPRSEMIPKENLRVGDRVRAFVLRV-DHAARGQQLILSRTSPEFIRQLFENEVPEIEQGLLEIKATARDPGVRAKIAVVAYDKRIDPIGTCVGMRGSRVTAVRNELGGEQVDIVLWSEDPAQFVIGALAPANVESIVVDEDK-----HAMDVVVDEENLPKAIGAKGQNVRLASELTGWQINIMT 342
>gi|78358201|ref|YP_389650.1| transcription elongation factor NusA [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78220606|gb|ABB39955.1| NusA antitermination factor [Desulfovibrio desulfuricans G20] (429 aa)
Score = 378, Expect = 4.3e-34, Identities = 98/340 (28%), Positives = 186/340 (54%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           +D+I+K++   +  ++  L+ A+  S +++  D LD+EV  +     I++++ ++V ++ EDE     +I++ +A+    S +L D +   + I+   R       Q++   + D     +YEE+KD++  +    +++ D     +NLG T+ ++ + EQIP E  + G     +I EV+ ++ +G  +++SR+    +  L K E+ E+ D  +++  ++R  G + KVA+ SR   VD VG  VG +G RI+ I   L  ERID++++  D   +  NA  P  I  + + ++E+     ++ +V P++ L   IG+ G NV+L SKL GW IDI +E
  S:     9 IDQISKDRGLDRALLIETLEEAVRTSVIRKYGDELDLEVNFNEETGEIEVYQFKIVTEEVEDEA---SQISLEDARAHDPSVQLDDEMGFRLKIEDLGRIAAQSAKQVIIQRMRDAEQEIIYEEFKDRLNEVASGIIQRRDKTGWIINLGRTEALLPKDEQIPREHYKRGDRVQAIIIEVR-KEGRGPQVVVSRSHPDYMAALFKREVPEVDDETVQVMGVARDPGSRAKVAVTSRDRDVDPVGACVGIRGSRIQNIVQELRGERIDIVVWSPDIATYARNALSPAVISRIIVDEEEN-----MLEVVVPDDQLTNAIGRKGQNVKLASKLLGWKIDIYTE 340
>gi|149185835|ref|ZP_01864150.1| transcription elongation factor NusA [Erythrobacter sp. SD-21] >gi|148830396|gb|EDL48832.1| transcription elongation factor NusA [Erythrobacter sp. SD-21] (554 aa)
Score = 378, Expect = 4.4e-34, Identities = 116/355 (32%), Positives = 193/355 (54%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
           + +A EK   K  ++  ++ A++KS    Y  EN   DI   +D     ++L+    VV++ ED     K++++  AQ+L+   ++GD +   +      R       Q++   + D    + + E++D+ G +I   ++ V+   V VNLG  +GV+ R +QIP E  + G+    LI +V+ +  +G  I LSRA    ++ L   E+ EI DGIIEIK  +R  G + K+ ++S    +D VG  VG KG R++ +   L  E+ID+I + ED   F+VNA  P  +  V + D+ED      + +V P++ L   IG+ G NVRL S+LTG  IDI++E+ A E +  EF + S++
  S:    17 NAVASEKMIDKSIVIEAMEEAIQKSARNRYGAEN---DIRAKLDPQTGDLRLWRVVEVVEEVEDYF---KQVDLKAAQKLEADARIGDFIVDPLPPVDLGRIDAQSAKQVIFQKVRDAERERQFNEFQDRAGEVITGVIKSVEFGHVIVNLGRAEGVIRRDQQIPREAARVGERVRALITKVE-RNNRGPQIFLSRAHPDFMKKLFAQEVPEIYDGIIEIKAAARDPGSRAKIGVISHDSSIDPVGACVGMKGSRVQAVVQELQGEKIDIIPWSEDGATFIVNALQPATVSRV-VLDEED----GRIEVVVPDDQLSLAIGRRGQNVRLASQLTGNQIDIMTEEEASEKRQKEFAERSKM 364
>gi|168214478|ref|ZP_02640103.1| N utilization substance protein A [Clostridium perfringens CPE str. F4969] >gi|170714047|gb|EDT26229.1| N utilization substance protein A [Clostridium perfringens CPE str. F4969] (366 aa)
Score = 377, Expect = 4.8e-34, Identities = 119/359 (33%), Positives = 200/359 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-----LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           + FL  L +I KEK  S E ++  +  A+  +Y K   +      +++V  D     I ++ ++VVV++  D+     EI++ +A+ +   Y+L D V  EV    F R       Q++   + +   + +Y E+ +K  +I+   V + D   V V+LG  +GV+  +EQ+P E+    +     + EVK + +KG  ++ SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I +   P +++ NA  P K++ VE  ++     +K   ++  +  L   IGK G NVRL +KLTGW IDI S+  A E+ ++ ED+
  S:     3 EEFLGALSEIVKEKGISVEALLETIDDAIIAAYKKNFSNSGTTAQNVKVKRDEKSGEIHVYAQKVVVEEVYDD---VTEISLEDAKAISAIYQLDDIVEIEVTPKNFGRVAAQLAKQMVIQRIKESERNVIYSEFAEKEFDILPGTVIRKDKGNVFVDLGKIEGVLGPNEQMPTEKYNFNEKLQLYVVEVK-KTSKGASVLCSRTHPGLVKRLFELEVPEIYEGIVEIKSIAREAGSRTKIAVYSNDESVDAMGACVGPKGVRVQNIVNELKNEKIDIIKWSSTPSEYIENALSPAKVISVEADEE-----TKSAKVIVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSKA-EELLQEEDI 356
>gi|18310671|ref|NP_562605.1| transcription elongation factor NusA [Clostridium perfringens str. 13] >gi|110800366|ref|YP_696376.1| transcription elongation factor NusA [Clostridium perfringens ATCC 13124] >gi|168211423|ref|ZP_02637048.1| N utilization substance protein A [Clostridium perfringens B str. ATCC 3626] >gi|168216976|ref|ZP_02642601.1| N utilization substance protein A [Clostridium perfringens NCTC 8239] >gi|169342667|ref|ZP_02863708.1| N utilization substance protein A [Clostridium perfringens C str. JGS1495] >gi|18145352|dbj|BAB81395.1| probable transcriptional terminator [Clostridium perfringens str. 13] >gi|110675013|gb|ABG84000.1| N utilization substance protein A [Clostridium perfringens ATCC 13124] >gi|169299173|gb|EDS81243.1| N utilization substance protein A [Clostridium perfringens C str. JGS1495] >gi|170710583|gb|EDT22765.1| N utilization substance protein A [Clostridium perfringens B str. ATCC 3626] >gi|182380937|gb|EDT78416.1| N utilization substance protein A [Clostridium perfringens NCTC 8239] (366 aa)
Score = 377, Expect = 5.0e-34, Identities = 119/359 (33%), Positives = 200/359 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-----LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           + FL  L +I KEK  S E ++  +  A+  +Y K   +      +++V  D     I ++ ++VVV++  D+     EI++ +A+ +   Y+L D V  EV    F R       Q++   + +   + +Y E+ +K  +I+   V + D   V V+LG  +GV+  +EQ+P E+    +     + EVK + +KG  ++ SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I +   P +++ NA  P K++ VE  ++     +K   ++  +  L   IGK G NVRL +KLTGW IDI S+  A E+ ++ ED+
  S:     3 EEFLGALSEIVKEKGISVEALLETIDDAIIAAYKKNFSNSGTTAQNVKVKRDEKSGEIHVYAQKVVVEEVYDD---VTEISLEDAKAISAIYQLDDIVEIEVTPKNFGRVAAQLAKQMVIQRIKESERNVIYSEFAEKEFDILPGTVIRKDKGNVFVDLGKIEGVLGPNEQMPTEKYNFNEKLQLYVVEVK-KTSKGASVLCSRTHPGLVKRLFELEVPEIYEGIVEIKSIAREAGSRTKIAVYSNDESVDAMGACVGPKGVRVQNIVNELKNEKIDIIKWSNTPSEYIENALSPAKVISVEADEE-----TKSAKVIVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSKA-EELLQEEDI 356
>gi|148556720|ref|YP_001264302.1| transcription elongation factor NusA [Sphingomonas wittichii RW1] >gi|148501910|gb|ABQ70164.1| NusA antitermination factor [Sphingomonas wittichii RW1] (529 aa)
Score = 377, Expect = 5.0e-34, Identities = 112/346 (32%), Positives = 192/346 (55%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK 356
           D +A+EK   +E ++  ++ A++++    Y  EN   DI   +D     ++L+    VV++ +D     K++++++AQ+L+K   +GD +   +   +F R       Q++   + D    + YEE+KD+   II   V++V+   V V+LG  +GV+ R +QIP E ++ G     LI  V+ ++ +G  I LSRA    ++ L   E+ EI DGIIEIK  +R  G + K+ ++S    +D VG  VG KG R++ +   +  E+ID+I +  D   F+VNA  P ++  V I ++E+     +     P++ L   IG+ G NVRL S+LTG +IDI++E  A E +
  S:    17 DAVAREKLIDREIVIEAMEDAIQRAARARYGAEN---DIRAKIDGKTGDMRLWRVVEVVEQVDDYF---KQVSVADAQKLQKDAAIGDFIVDPLPPIEFGRIAAQAAKQVIFQKVRDAERERQYEEFKDRANEIITGVVKRVEFGHVVVDLGRAEGVIRRDQQIPREVVRVGDRVRSLILSVR-RENRGPQIFLSRAHPEFMKKLFAQEVPEIYDGIIEIKAAARDPGSRAKIGVISHDGSIDPVGACVGMKGSRVQAVVQEMQGEKIDIIPWSPDTATFVVNALQPAQVSRVVIDEEEERIEVVV-----PDDQLSLAIGRRGQNVRLASQLTGKAIDILTEADASEKR 354
>gi|183220911|ref|YP_001838907.1| N utilization substance protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911007|ref|YP_001962562.1| Transcription elongation factor [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775683|gb|ABZ93984.1| Transcription elongation factor [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779333|gb|ABZ97631.1| N utilization substance protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (466 aa)
Score = 377, Expect = 5.1e-34, Identities = 102/345 (29%), Positives = 186/345 (53%)
  Q:     2 KIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE---NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPII-LSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           K     E + +  ++K   +E ++ +++ +L  +Y K+     + D    V+   ++       V+ D   ++  +  E+++ +AQ++    ++G  +          R ++S   Q++   L D+    +Y+E+K K G +     ++    ++ ++LG  +G++L+ +Q PGE+ + G     +I  V+ +  +  P+I LSRA    ++ L + EI E+ DGI+EI+ ++RI  Y+TKV + +    VD VG  VG KG RI+ I   L NERID++L+ ++P  F+ NA  P K V V +       G  +V +  P+ESL   IG NG NV+L+S+L+G+ IDI
  S:     8 KETGLFEAIQQFCQDKSLDRELVLGVIRDSLLAAYRKKVGLEAETDDRCQVEFGSDNKNEIIISVLRDVVAEKTINPLEVSLEDAQKIDPKIEVGSQIRVFEKPQDLSRVLSSQAKQMVFQRLRDMEKELLYQEYKSKEGELTHGYFQRWKKDIMSIDLGKVEGIMLKKDQNPGEKYRQGDRLKAIISRVELRPREPMPVITLSRASGDFVKKLFEMEIPEVYDGIVEIRDVARIPSYRTKVVVTTSKSDVDPVGACVGMKGVRIQAIVRELGNERIDIVLHSDEPSIFIANAISPAKPVEVHVDRKR---GDALVIV--PDESLSLAIGINGSNVKLVSQLSGFKIDI 351
>gi|110677786|ref|YP_680793.1| transcription elongation factor NusA [Roseobacter denitrificans OCh 114] >gi|109453902|gb|ABG30107.1| transcription termination factor NusA, putative [Roseobacter denitrificans OCh 114] (538 aa)
Score = 377, Expect = 5.1e-34, Identities = 109/345 (31%), Positives = 189/345 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD--KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V  ++ +L ++   +   ++DI V +D           R VV   EDE+ ++   E  + +A++  ++ ++G  +  EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ +Q +G  I LSR     +  L K E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LTG  IDI++E+
  S:    11 LLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRYGAEMDIRVHIDRKTGRATFTRVRTVV---EDELLENYQAEFTVEQAKQYMENPEVGQQLIEEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRVYIKDVRREQ-RGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEE 349
>gi|37523058|ref|NP_926435.1| transcription elongation factor NusA [Gloeobacter violaceus PCC 7421] >gi|35214061|dbj|BAC91430.1| glr3489 [Gloeobacter violaceus PCC 7421] (383 aa)
Score = 377, Expect = 5.1e-34, Identities = 106/339 (31%), Positives = 189/339 (55%)
  Q:     8 ENLDKIAKEKDTSKENIVNILKTALEKSYLK-----ENPDLDIE--------VVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGV------VLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           + ++ I+++++  K  +   L  AL+K Y +      +P  + E        V +D ++E  ++   + +V+   D    D+EI + E +E+    + G TV  +V  +K  F R       Q+L+  L D     + EE+++  G +++A V + + R V   + S  G       + ++EQ+P E  + G ++   +++V     +G  +++SRAD GL+ YL   E+ EI D I+ I  +       SR VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P +++ V + D    P ++   ++ P++ L   IGK G NVRL ++LTGW IDI
  S:    11 QQIETISRQRNLPKHAVKEALIEALKKGYERFRKTYRDPRENSEEMAFDNFIVELDTDREGFRVLATKTIVETVSDT---DQEIALIEVREVAPDAEPGGTVVVDVTPEKGDFGRMAAIQTKQVLSQKLRDQQRKLIQEEFRELEGTVLQARVMRFEGRSVICAVSSGFGQNEVEAELPKNEQLPNEPYRIGSAFKVFLRKVWEGSRRGPQLLVSRADAGLVVYLFANEVPEIEDEIVRIVAVAREANPPSRTVGPRTKIAVDTLERDVDPVGACIGARGSRIQAVVNELRGEKIDVIRWSPDPATYISNALSPARVIQVRLVD----PDARQAHVIVPDDQLSLAIGKEGQNVRLAARLTGWKIDI 370
>gi|94544550|gb|ABF34598.1| N utilization substance protein A [Streptococcus pyogenes MGAS10270] (396 aa)
Score = 377, Expect = 5.3e-34, Identities = 113/345 (32%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I++ +  +L+ +Y K         V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:    14 KEMLEAFRILEEEKHIDKADIIDAVTESLKSAY-KRRYGQSESCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 365
>gi|194467745|ref|ZP_03073731.1| NusA antitermination factor [Lactobacillus reuteri 100-23] >gi|194452598|gb|EDX41496.1| NusA antitermination factor [Lactobacillus reuteri 100-23] (393 aa)
Score = 377, Expect = 5.3e-34, Identities = 115/354 (32%), Positives = 195/354 (55%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSED-EIDDDKEINISEAQELK--KSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGS--------------KIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
           LD + KEK   KE ++  L+ ALE +Y +   D ++EV  +    +IK++  + + D  E  E D ++ +++++A++L   + Y +GD +  EV    F R       Q++   L +     +Y+++K     II  EV + D R   V+LG   +G +   +++P E           + +V   + +G  I +SR    LL+ L + E+ EI DG + I+ I+R  G + KVA+ S  P VD VGT VGP+G R++ I + L+ E +D++ Y +DP +F+ NA +P ++  +++  +ED P S              +  T+V P+  L   IGK G N RL ++LT + IDI SE    E+  E E+V+
  S:    14 LDYLEKEKGIKKEIVIEALEQALESAYKQNYGDKNVEVEFNSLTGNIKVYAVKTITDDEEAVEADSNEFMSLADARKLPHGQGYDIGDEIREEVTPRDFGRIAAQTAKQVVMQRLREEERKIIYDKYKTYENEIITGEVSREDKRFTYVDLGDGVEGAMGFRDKMPNEHYHVHDRIQVYVTKVNDDR-RGPQIFVSRTAPELLKRLFEREVPEIKDGTVLIENIAREAGDRAKVAVYSNDPNVDPVGTCVGPRGSRVQAIVNELDGENMDIVEYVKDPAKFIANALNPAEV--LDVIFNEDKPASENEESEETTEGQTERSCTVVVPDNQLSLAIGKRGQNARLAARLTKYKIDIKSESEMAENDQESEEVA 382
>gi|50903880|gb|AAT87595.1| N utilization substance protein A [Streptococcus pyogenes MGAS10394] >gi|71803212|gb|AAX72565.1| N utilization substance protein A [Streptococcus pyogenes MGAS6180] >gi|94548429|gb|ABF38475.1| N utilization substance protein A [Streptococcus pyogenes MGAS10750] (396 aa)
Score = 377, Expect = 5.4e-34, Identities = 113/345 (32%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I++ +  +L+ +Y K         V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:    14 KEMLEAFRILEEEKHIDKADIIDAVTESLKSAY-KRRYGQSESCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 365
>gi|86148618|ref|ZP_01066901.1| transcription elongation factor NusA [Vibrio sp. MED222] >gi|85833609|gb|EAQ51784.1| transcription elongation factor NusA [Vibrio sp. MED222] (495 aa)
Score = 377, Expect = 5.4e-34, Identities = 99/345 (28%), Positives = 196/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K+  +L+IEV V++++++   + F +   V++ E      KEI+I  A+      +LG  +  ++    F+R  T    Q++   + +   +++ E++ D  G ++   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+  VK +  +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATA-TKKKSELEIEVRVEIDRKTGNFETFRRWEAVEEVEFPT---KEISIEAAKYDDPEIELGGFIEDDIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGELVTGAVKKVNRDTVILDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYAVKPE-ARGFQLFVTRSKPEMLAELFRVEVPEIGEELIELKGAARDAGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSNDLGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----THSMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|182626384|ref|ZP_02954138.1| N utilization substance protein A [Clostridium perfringens D str. JGS1721] >gi|177908335|gb|EDT70883.1| N utilization substance protein A [Clostridium perfringens D str. JGS1721] (366 aa)
Score = 377, Expect = 5.4e-34, Identities = 119/359 (33%), Positives = 201/359 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-----LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           + FL  L +I KEK  S E ++  +  A+  +Y K   +      +++V  D     I ++ ++VVV++  D+     EI++ +A+ +   Y+L D V  EV    F R       Q++   + +   + +Y E+ +K  +I+ + V + D   V V+LG  +GV+  +EQ+P E+    +     + EVK + +KG  ++ SR   GL++ L + E+ EI +GI+EIK I+R  G +TK+A+ S    VDA+G  VGPKG R++ I + L NE+ID+I +   P +++ NA  P K++ VE  ++     +K   ++  +  L   IGK G NVRL +KLTGW IDI S+  A E+ ++ ED+
  S:     3 EEFLGALSEIVKEKGISVEALLETIDDAIIAAYKKNFSNSGTTAQNVKVKRDEKSGEIHVYAQKVVVEEVYDD---VTEISLEDAKAISAIYQLDDIVEIEVTPKNFGRVAAQLAKQMVIQRIKESERNVIYSEFAEKEFDILPSTVIRKDKGNVFVDLGKIEGVLGPNEQMPTEKYNFNEKLQLYVVEVK-KTSKGASVLCSRTHPGLVKRLFELEVPEIYEGIVEIKSIAREAGSRTKIAVYSNDESVDAMGACVGPKGVRVQNIVNELKNEKIDIIKWSNTPSEYIENALSPAKVISVEADEE-----TKSAKVIVDDSQLSLAIGKEGQNVRLAAKLTGWKIDIKSKSKA-EELLQEEDI 356
>gi|84387286|ref|ZP_00990307.1| transcription elongation factor NusA [Vibrio splendidus 12B01] >gi|84377933|gb|EAP94795.1| transcription elongation factor NusA [Vibrio splendidus 12B01] (495 aa)
Score = 377, Expect = 5.7e-34, Identities = 99/345 (28%), Positives = 196/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K+  +L+IEV V++++++   + F +   V++ E      KEI+I  A+      +LG  +  ++    F+R  T    Q++   + +   +++ E++ D  G ++   V+KV+   V ++LG+  + V+LR +Q+P E  +PG     L+  VK +  +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATA-TKKKSELEIEVRVEIDRKTGNFETFRRWEAVEEVEFPT---KEISIEAAKYDDPEIELGGFIEDDIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGELVTGAVKKVNRDTVILDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYAVKPE-ARGFQLFVTRSKPEMLAELFRVEVPEIGEELIELKGAARDAGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSNDLGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|167856225|ref|ZP_02478960.1| translation initiation factor IF-2 [Haemophilus parasuis 29755] >gi|167852645|gb|EDS23924.1| translation initiation factor IF-2 [Haemophilus parasuis 29755] (510 aa)
Score = 376, Expect = 6.2e-34, Identities = 110/358 (30%), Positives = 196/358 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP------------DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTK-------GVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFED 361
           K  L   + ++ EK   K+ I   L+TAL  S  K+              D+D+ VV+D    +   + + +VV+K        +EI +  AQ    + +LGD V  E+    F+R       Q++T  + +   +KV E+++ + G I+   V+KV    + + L   K        V++R + +P E  +PG     ++  +K + +KG  + ++RA   +L+ L K E+ EI + +IEIK  SR  G + K+A+ S    +D VG  VG +G R++ I++ L  ER+D++L+D++P QFL+NA  P  +  + + +D     +  + I     +L + IG+NG NVRL ++LTGW++++++    +E K + ED
  S:     3 KEILLAAEAVSNEKLLPKDAIFEALETALAISTKKKAAAEREDRKTGNGIDIDVRVVIDRKTGAFTTYRRWLVVEKVHHHT---REITLEAAQFEDPNIQLGDYVEDEIESIAFDRITMQTARQVITMKIREAERNKVIEQFRSEEGKIVIGTVKKVSRESIILELAGKKDDTTKAEAVIVREDMLPRENFRPGDRVRGVLYAIKPE-SKGPQLFVTRAKPVMLQELFKLEVPEIGEEVIEIKGASRDPGSRAKIAVKSNDKRIDPVGACVGMRGARVQAITNELGGERVDIVLWDDNPAQFLINAMAPADVSSIVVDED-----NHSMDIAVEANALAQAIGRNGQNVRLATQLTGWTLNVMTTD-ELEKKHQAED 369
>gi|159036964|ref|YP_001536217.1| transcription elongation factor NusA [Salinispora arenicola CNS-205] >gi|157915799|gb|ABV97226.1| NusA antitermination factor [Salinispora arenicola CNS-205] (347 aa)
Score = 376, Expect = 6.3e-34, Identities = 81/235 (34%), Positives = 139/235 (59%)
  Q:   115 QILTHNLNDISNSKVYEEW----KDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           Q++   L + ++   + E+     D V  +++A   + +  +V V+LG  +GV+ +SEQ+PGE+   G+    ++  V ++  +G  + LSR+   L++ L   E+ EI+DG +EI  I+R  G++TK+A+ S   GV+A G  +GP G+R++ + S L+ E+ID+I + EDP  F+ NA  P K + V++ D      S+   +  P+  L   IG+ G N RL ++LTGW IDI S+
  S:    89 QVILQRLREATDEVHFGEYVGRDGDLVTGVVQAHEARAEKGIVSVDLGKLEGVLPQSEQVPGEQYAHGERVRCVVVHV-AKGVRGPQVTLSRSHPALVKKLFALEVPEIADGTVEITAIAREAGHRTKIAVRSTAAGVNAKGACIGPMGQRVRAVMSELHGEKIDIIDWSEDPATFVGNALSPAKALRVDVVD----LASRTARVTVPDFQLSLAIGREGQNARLAARLTGWRIDIRSD 322
>gi|71281620|ref|YP_268927.1| transcription termination factor NusA [Colwellia psychrerythraea 34H] >gi|71147360|gb|AAZ27833.1| transcription termination factor NusA [Colwellia psychrerythraea 34H] (497 aa)
Score = 376, Expect = 6.4e-34, Identities = 98/345 (28%), Positives = 185/345 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  +D ++ EK   +E+I   ++TALE +  K+   D+ + V +D        F + ++++  E   +   EI ++ AQ       +GD    ++   KF+R  T    Q++   + +   + V E +++ +G I+   V+K     V V+LG+  + V+ R + +P E  +PG     L+ E+K +  +G  + LSR    +L  L + E+ EI + ++EIK  +R  G + K+A+ S    +D VG  VG +G R++ +S  L  ER+D++LYD++  Q+++NA  P ++  + + +D+       + I   E +L   IG++G N+RL S+LTGW +++++
  S:     3 KEILLVVDAVSNEKALPRESIFEAMETALETATKKKYEGDIIVRVSIDRISGEFDTFRRWLIIEDGEPMENPYAEIGLAAAQYDAPELNVGDYSEDQIESVKFDRVTTQTAKQVIVQKIREAERALVTEAYQEHLGEIVTGVVKKASRESVIVDLGNNAEAVIYRDDMLPRETFRPGDRVRGLLYEIKPE-ARGAQLFLSRTKPEMLIELFRVEVPEIGEEMLEIKGAARDPGSRAKIAVKSNDKRIDPVGACVGMRGSRVQAVSGELGGERVDIVLYDDNVAQYVINAMSPAEVASIIVDEDKG-----TMDIAVEEANLAMAIGRSGQNIRLASQLTGWELNVMT 343
>gi|145593916|ref|YP_001158213.1| transcription elongation factor NusA [Salinispora tropica CNB-440] >gi|145303253|gb|ABP53835.1| transcription termination factor NusA [Salinispora tropica CNB-440] (347 aa)
Score = 376, Expect = 6.5e-34, Identities = 81/235 (34%), Positives = 138/235 (58%)
  Q:   115 QILTHNLNDISNSKVYEEW----KDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           Q++   L + ++   + E+     D V  +++A   + +  +V V+LG  +GV+ +SEQ+PGE+   G+    ++  V ++  +G  + LSR+   L++ L   E+ EI+DG +EI  I+R  G++TK+A+ S   GV+A G  +GP G+R++ +   L+ E+ID+I + EDP  F+ NA  P K + VE+ D      S+   +  P+  L   IG+ G N RL ++LTGW IDI S+
  S:    89 QVILQRLREATDEVHFGEYVGRDGDLVTGVVQAHEARAEKGIVSVDLGKLEGVLPQSEQVPGEQYAHGERVRCVVVHV-AKGVRGPQVTLSRSHPALVKKLFALEVPEIADGTVEITAIAREAGHRTKIAVRSTAAGVNAKGACIGPMGQRVRAVMGELHGEKIDIIDWSEDPAAFVGNALSPAKALRVEVVD----LASRTARVTVPDFQLSLAIGREGQNARLAARLTGWRIDIRSD 322
>gi|152965409|ref|YP_001361193.1| NusA antitermination factor [Kineococcus radiotolerans SRS30216] >gi|151359926|gb|ABS02929.1| NusA antitermination factor [Kineococcus radiotolerans SRS30216] (339 aa)
Score = 376, Expect = 7.3e-34, Identities = 84/242 (34%), Positives = 140/242 (57%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEK-VDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           F R   +   Q++   L D  +  V  E+    G I+   V++  D R+V+V+LGS +GV+   EQ+PGE+ + G      +  VK +  KG  ++LSR+   L++ L   E+ EI+DG ++I  +SR  G+++K+A+ +   GV+A G  +GP G+R++ + + L  E+ID++ + +DP QF+ NA  P ++  VE+ D      ++   ++ P+  L   IGK G N RL +KLTGW IDI
  S:    83 FGRIAATTARQVILQRLRDAEDDAVIGEYAQTEGEIVSGVVQQGRDPRMVQVDLGSLEGVLPPQEQVPGEKYEHGSRLRCFVVSVK-KGPKGPQVVLSRSHPQLVKKLFALEVPEIADGTVQITALSREAGHRSKMAVRATRGGVNAKGACIGPMGQRVRAVMAELRGEKIDIVDHSDDPAQFVGNALSPARVSSVEVVD----LAARSARVIVPDYQLSLAIGKEGQNARLAAKLTGWRIDI 320
>gi|15599939|ref|NP_253433.1| transcription elongation factor NusA [Pseudomonas aeruginosa PAO1] >gi|107103844|ref|ZP_01367762.1| hypothetical protein PaerPA_01004915 [Pseudomonas aeruginosa PACS2] >gi|116052892|ref|YP_793209.1| transcription elongation factor NusA [Pseudomonas aeruginosa UCBPP-PA14] >gi|152989172|ref|YP_001350787.1| transcription elongation factor NusA [Pseudomonas aeruginosa PA7] >gi|194549504|ref|YP_002084532.1| N utilization substance protein A [Pseudomonas aeruginosa C3719] >gi|194555338|ref|YP_002090365.1| N utilization substance protein A [Pseudomonas aeruginosa 2192] >gi|9951007|gb|AAG08131.1|AE004888_6 N utilization substance protein A [Pseudomonas aeruginosa PAO1] >gi|115588113|gb|ABJ14128.1| N utilization substance protein A [Pseudomonas aeruginosa UCBPP-PA14] >gi|126170450|gb|EAZ55961.1| N utilization substance protein A [Pseudomonas aeruginosa C3719] >gi|126197731|gb|EAZ61794.1| N utilization substance protein A [Pseudomonas aeruginosa 2192] >gi|150964330|gb|ABR86355.1| N utilization substance protein A [Pseudomonas aeruginosa PA7] (493 aa)
Score = 376, Expect = 7.6e-34, Identities = 100/346 (28%), Positives = 192/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQI-PGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VV   ED  D   EI + + QE K   K+G+ +  ++   +F R       Q++   + +   ++V + +++KVG II   V+KV    V V+LG+    +L  +QI P E  + G     L+KE++++  +G  ++LSR    +L  L + E+ EI++ +I++   +R  G + K+A+ S+   +D  G  +G +G R++ +S  +  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I   E++L + IG++G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPAGVIFEALELALATATKKRFEDEVDLRVEINRHNGSYETFRRWHVV-ADEDYQDPATEITVEDVQEQKPGAKVGEVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYREKVGEIISGTVKKVTRDNVIVDLGNNAEALLARDQIIPRETFRVGTRVRALLKEIRTEN-RGPQLVLSRTAPEMLIELFRIEVPEIAEQLIDVMAAARDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGEIGGERVDIVLWDDNPAQFVINAMAPAEVAAIIVDED-----THTMDIAVAEDNLAQAIGRSGQNVRLASQLTGWTLNVMTE 343
>gi|149925033|ref|ZP_01913351.1| transcription termination factor NusA [Plesiocystis pacifica SIR-1] >gi|149814097|gb|EDM73723.1| transcription termination factor NusA [Plesiocystis pacifica SIR-1] (461 aa)
Score = 375, Expect = 8.1e-34, Identities = 107/339 (31%), Positives = 194/339 (57%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFER------------------------RITSHFA-QILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVD--NRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           +D + +EK+ S++ +V+ ++ A+  +  +   D +IE   DL   ++ LF+   VV+  E  +   +E++I +A+      ++GD +  ++   + +R                        RI +  A Q++   + +     +Y+ +KDK G ++   V + +  + +VEV+ G  + ++   +Q+P E L+PG   +  +K+V  +  +G  IILSR  +GL+  L + E+ EI +GI+ I+  +R  G ++K+A+ SR   VD VG  VG +G R++ +   L  E+ID++ +DEDP +F+ NA  P ++  V I  +        + +V P++ L   IGK G NVRL S+LTGW IDI S
  S:    11 IDAVCQEKNISRDVLVDTVEQAVATAAKRVFADREIEASFDLETGNVNLFQVLYVVETVELPM---REMSIDQARRSGLEAEIGDELLFQIFYLEDDRKQAEDQAKQYPEIPALQKVNTAFGRIAAQTAKQVIIQRVREAERENLYDRYKDKKGELMTGIVRRFERGSIVVEVDNGRAEAILPSRDQVPRESLRPGDRIVAFVKDV-DKSARGPQIILSRTHKGLVEKLFEHEVPEIFEGIVRIEACAREPGARSKIAVSSRDRDVDPVGACVGMRGSRVQAVVQELRGEKIDIVPFDEDPARFVCNAIQPAQVSRVLIDAER-----HTMELVVPDDKLSLAIGKRGQNVRLASRLTGWRIDIHS 367
>gi|163857446|ref|YP_001631744.1| transcription elongation factor NusA [Bordetella petrii DSM 12804] >gi|163261174|emb|CAP43476.1| N utilization substance protein A [Bordetella petrii] (492 aa)
Score = 375, Expect = 8.6e-34, Identities = 99/339 (29%), Positives = 178/339 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           +D +A+EK+ ++E +   L++AL  +  K    D +I V +D    S + F + +VV       + DK+  +S+A EL  + ++G+ +   +   +F R       Q +   + D    +V  ++ D+   II   ++++D   + V  G  +  + RSE IP E  + G      +  V     +G  +ILSR     +R L + E+ EI  G++EIK  +R  G + K+A+++    +D +GT VG +G R+  + + L  E++D++L+ EDP QF++ A  P  +  + + +D+       + +V  EE+L K IG  G NVRL S+LTGW I+I++
  S:     9 VDALAREKNVTREVVFGALESALASAMKKRFKEDAEIRVAIDRETGSHEGFRRWLVVPDEAGLQEPDKQEMLSDALELVPNIQVGEYIEEPLEPIEFGRIGAQAAKQAILQKIRDAEREQVLNDFLDRGETIISGTIKRMDKGDIIVETGKIEARLPRSEMIPKENFRVGDRLRAFVLRV-DHAARGQQVILSRTSPEFIRQLFENEVPEIEQGLLEIKAAARDPGVRAKIAVVAYDKRIDPIGTCVGMRGSRVTAVRNELGGEQVDIVLWSEDPAQFVIGALAPANVESIVVDEDK-----HAMDVVVDEENLPKAIGAKGQNVRLASELTGWQINIMT 342
>gi|28895281|ref|NP_801631.1| transcription elongation factor NusA [Streptococcus pyogenes SSI-1] >gi|161485737|ref|NP_665302.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS315] >gi|28810527|dbj|BAC63464.1| putative transcription termination-antitermination factor [Streptococcus pyogenes SSI-1] (385 aa)
Score = 375, Expect = 8.6e-34, Identities = 112/345 (32%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I++ +  +L+ +Y +     +   V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     3 KEMLEAFRILEEEKHIDKADIIDAVTESLKSAYKRRYGQSE-SCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 354
>gi|15675574|ref|NP_269748.1| transcription elongation factor NusA [Streptococcus pyogenes M1 GAS] >gi|71911225|ref|YP_282775.1| transcription elongation factor NusA [Streptococcus pyogenes MGAS5005] >gi|162139078|ref|YP_597145.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS9429] >gi|162139127|ref|YP_601034.2| transcription elongation factor NusA [Streptococcus pyogenes MGAS2096] >gi|13622778|gb|AAK34469.1| transcription termination-antitermination factor [Streptococcus pyogenes M1 GAS] >gi|71854007|gb|AAZ52030.1| N utilization substance protein A [Streptococcus pyogenes MGAS5005] (385 aa)
Score = 375, Expect = 9.6e-34, Identities = 112/345 (32%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I++ +  +L+ +Y +     +   V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     3 KEMLEAFRILEEEKHIDKADIIDAVTESLKSAYKRRYGQSE-SCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 354
>gi|89095215|ref|ZP_01168138.1| transcription elongation factor NusA [Oceanospirillum sp. MED92] >gi|89080512|gb|EAR59761.1| transcription elongation factor NusA [Oceanospirillum sp. MED92] (495 aa)
Score = 375, Expect = 9.7e-34, Identities = 107/349 (30%), Positives = 195/349 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           K  L   + ++ EKD  KE I   ++ AL  +  K  + + DI VV+D      + F + +VV  +E+      E+ + EA+E+  + + GD    +V    F R       Q++   + +   +KV E+++D+ G +I   V+KV    + V+LG+    +L R + I  E  + G     ++KEV+S+  +G  +I+SR+   +L  L + E+ EIS+ +IEI+  SR  G + K+A+ +    +D VG  VG +G R++ +S+ L  ER+D++L+D++P Q ++NA  P ++  + + D+E    +  + +   EE+L   IG++G NVRL S+LTGW +++++E+ A
  S:     3 KEILLVAEAVSNEKDVPKEVIFEAIEVALATATKKRYDEEADIRVVIDRATGDYETFRRWLVV-SNEEVPALGTELTMEEAEEIDTALQPGDIHEEQVESVAFGRIAAQTAKQVIVQKVREAERAKVVEQYRDRQGELISGSVKKVTRDNIIVDLGNNAEALLPRDQLIQREAFRMGDRVRAVLKEVRSE-GRGPQLIMSRSCNEMLIELFRIEVPEISEEVIEIRAASRDPGSRAKIAVKTNDGRIDPVGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQLVINAMAPAEVASI-VLDEE----THSMDVAVAEENLAMAIGRSGQNVRLASELTGWELNVMTEEDA 346
>gi|94542552|gb|ABF32601.1| N utilization substance protein A [Streptococcus pyogenes MGAS9429] >gi|94546443|gb|ABF36490.1| N utilization substance protein A [Streptococcus pyogenes MGAS2096] (396 aa)
Score = 375, Expect = 9.8e-34, Identities = 112/345 (32%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I++ +  +L+ +Y +     +   V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:    14 KEMLEAFRILEEEKHIDKADIIDAVTESLKSAYKRRYGQSE-SCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 365
>gi|66767928|ref|YP_242690.1| transcription elongation factor NusA [Xanthomonas campestris pv. campestris str. 8004] >gi|66573260|gb|AAY48670.1| N utilization substance protein A [Xanthomonas campestris pv. campestris str. 8004] (503 aa)
Score = 374, Expect = 1.0e-33, Identities = 101/362 (27%), Positives = 194/362 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
           K  L  +D +A EK   +E I + ++ AL  +  K  PD D+   V +D    + + F +  VV         D+++ + +A E      +GD V  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +  + + + IP + L+PG      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW +++++ +++A + + E     QL
  S:     3 KELLLVVDAVANEKGVPREVIFDAIEAALASAAKKRYPDQDVLTRVTIDHKDGNYETFRRWEVVADDVVMESPDRQVRLMDAIEEADGVDVGDYVEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIFVDLGGNAEAFIPKDKGIPRDVLRPGDRVRGYLAEVRSE-PRGPQLFISRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVIAHDTRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTADQVAAKSEAEQASARQL 362
>gi|21231945|ref|NP_637862.1| transcription elongation factor NusA [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|188991044|ref|YP_001903054.1| N utilization substance (transcription elongation) protein A [Xanthomonas campestris pv. campestris] >gi|21113674|gb|AAM41786.1| N utilization substance protein A [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|167732804|emb|CAP50998.1| N utilization substance (transcription elongation) protein A [Xanthomonas campestris pv. campestris] (503 aa)
Score = 374, Expect = 1.0e-33, Identities = 101/362 (27%), Positives = 194/362 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
           K  L  +D +A EK   +E I + ++ AL  +  K  PD D+   V +D    + + F +  VV         D+++ + +A E      +GD V  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +  + + + IP + L+PG      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW +++++ +++A + + E     QL
  S:     3 KELLLVVDAVANEKGVPREVIFDAIEAALASAAKKRYPDQDVLTRVTIDHKDGNYETFRRWEVVADDVVMESPDRQVRLMDAIEEADGVDVGDYVEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIFVDLGGNAEAFIPKDKGIPRDVLRPGDRVRGYLAEVRSE-PRGPQLFISRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVIAHDTRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTADQVAAKSEAEQASARQL 362
>gi|70734336|ref|YP_257976.1| transcription elongation factor NusA [Pseudomonas fluorescens Pf-5] >gi|68348635|gb|AAY96241.1| N utilization substance protein A [Pseudomonas fluorescens Pf-5] (493 aa)
Score = 374, Expect = 1.0e-33, Identities = 102/346 (29%), Positives = 193/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VV+  E ++DD   E  +S+A+E     K+GD +  ++   +F R       Q++   + +   ++V + +++++G II   V+KV    V V+LG+    +L R + I  E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+DE+P QF++NA  P ++  + + +D     +  + I    ++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPASVIFEALELALATATKKRFEDEVDLRVEINRHTGSYETFRRWTVVE--EADLDDPAVETWLSKARETHPDAKVGDVIEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVRLRALLKEIRTEN-RGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDENPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|189485237|ref|YP_001956178.1| transcription antitermination factor NusA [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287196|dbj|BAG13717.1| transcription antitermination factor NusA [uncultured Termite group 1 bacterium phylotype Rs-D17] (418 aa)
Score = 374, Expect = 1.0e-33, Identities = 95/273 (34%), Positives = 153/273 (56%)
  Q:    77 EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           EI + +A++  +S ++G  V   ++   F R       Q++   + +     +++E K+K+G I    + ++ NR + V+LG T+ ++  SEQ+  E+   GQ    +I +V+ +  KG  ++LSR    L++ L + E+ EI + I+EI  + R  G +TK+ +LS  P VD VG  VG KG R+K I   L  ERID++ Y  DP +++ +A  P KIV V    +E+     +VT    ++ L   IGKNG NVRL +KLTGW ID+ SE
  S:    76 EICVQDAKKFDQSVEIGTEVRIPLDTRDFSRIAAQTAKQVIVQKIRESERDSLFDEMKEKIGQIANGAIYRITNRNLIVDLGKTEAILPSSEQVFKEKFSVGQYIKAVIIKVE-KSVKGSGVVLSRTSIELVKRLFELEVPEIYEKIVEIVNVVREPGVRTKITVLSHNPKVDPVGACVGVKGARVKPIIDELRGERIDLVSYSVDPAKYIASAMSPAKIVSVTTISEEEKKAEVLVT----DDMLFLAIGKNGHNVRLAAKLTGWHIDVKSE 343
>gi|149117928|ref|ZP_01844571.1| NusA antitermination factor [Shewanella baltica OS223] >gi|153001790|ref|YP_001367471.1| transcription elongation factor NusA [Shewanella baltica OS185] >gi|160876524|ref|YP_001555840.1| transcription elongation factor NusA [Shewanella baltica OS195] >gi|146861900|gb|EDK47718.1| NusA antitermination factor [Shewanella baltica OS223] >gi|151366408|gb|ABS09408.1| NusA antitermination factor [Shewanella baltica OS185] >gi|160862046|gb|ABX50580.1| NusA antitermination factor [Shewanella baltica OS195] (499 aa)
Score = 374, Expect = 1.1e-33, Identities = 98/345 (28%), Positives = 186/345 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K+   D+D+ V +D        F + +VVD   + +++  +EI +  A+      + G+ +  ++    F+R  T    Q++   + +   ++V E+++D+ G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + LSR    +L  L + E+ EI+D +IEI   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALEIALATATKKKYEGDIDVRVAIDRKTGGYDTFRRWMVVDDHGEALENPYREITLEAARYENPDIQPGEFIEDDIESVVFDRITTQTAKQVIVQKVREAERAQVVEQFQDQEGELITGIVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLSRTKPEMLIELFRVEVPEIADELIEIMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLTGWVLNVMT 344
>gi|190575263|ref|YP_001973108.1| putative N utilization substance protein A [Stenotrophomonas maltophilia K279a] >gi|190013185|emb|CAQ46818.1| putative N utilization substance protein A [Stenotrophomonas maltophilia K279a] (503 aa)
Score = 374, Expect = 1.2e-33, Identities = 97/346 (28%), Positives = 189/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  +D +A EK   +E I + ++ AL  +  K  PD ++   VV+D    S + F +  VV         D++I + +A +  +   +GD +  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +G + + + IP + L+ G      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+L++    D +G  +G +G R++ +S+ LN ER+D++L++++P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW ++++++
  S:     3 KELLLVVDAVANEKGVPREVIFDAIEAALASAAKKRYPDEEVLTRVVIDHKDGSYETFRRWEVVADDVVMESPDRQIRLMDAVDEAEGVDVGDYIEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIYVDLGGNAEGFIPKDKGIPRDVLRAGDRVRGYLAEVRSE-PRGPQLFISRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVLAQDQRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNDNPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTQ 345
>gi|77978624|ref|ZP_00834051.1| COG0195: Transcription elongation factor [Yersinia intermedia ATCC 29909] (495 aa)
Score = 374, Expect = 1.2e-33, Identities = 94/345 (27%), Positives = 187/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + V V++        +EI +  AQ    + +LGD V  ++    F+R  T    Q++   + +   + V ++++  +G I+   V+KV+   + ++LG+  + V+ R + +P E  +PG     ++ +V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D        + +     +L + IG+NG NVRL ++L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEVRVSIDRKTGDFDTFRRWVAVNEVTMPT---REITLDAAQYEDPTLQLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRQYLGEIVTGVVKKVNRDSIALDLGNNAEAVIGREDMLPRENFRPGDRIRGVLYDVRPE-ARGAQLFVSRSRPEMLIELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDR-----HTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT 340
>gi|84702151|ref|ZP_01016726.1| transcription elongation factor NusA [Parvularcula bermudensis HTCC2503] >gi|84691397|gb|EAQ17237.1| transcription elongation factor NusA [Parvularcula bermudensis HTCC2503] (525 aa)
Score = 374, Expect = 1.2e-33, Identities = 100/338 (29%), Positives = 181/338 (53%)
  Q:    13 IAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           +A+EK      ++  ++ AL ++   +   + ++   +D      +L+    VV+  E+   D  E+++  AQ+     ++GD +S  +    F R       Q++   + D      Y E+KD+VG II   +++++   V V+LG  + ++ R +QIP E L+ G      I +V+ ++ +G  I LSR     +  L + E+ E+ DG+IEIK ++R  G + K+ + S    +D VG  VG +G R++ +   L  E+ID++ + ED   F+VNA  P ++  V +  DE++   + + +V P+E L   IG+ G NVRL S+LTG+ IDI++E+
  S:    17 VAQEKMIDPSIVIEAMEDALSRAARSRYGAETNVRAEIDPRTGETRLWRLMEVVESVEN---DAVEVSLKAAQKQNPEAEIGDFISDPLPPIDFGRVAALGAKQVINQKVRDAERDNQYNEYKDRVGEIISGLIKRIEYGHVIVDLGKGEAIIRRDQQIPREPLRQGDRVRAYIADVR-REPRGPQIFLSRNHPQFMARLFEQEVPEVYDGVIEIKAVARDPGSRAKIGVYSNDSSIDPVGACVGMRGSRVQAVVGELGGEKIDIVPWSEDTATFVVNALAPAEVAKVVL--DEEL---ERIEVVVPDEQLSLAIGRRGQNVRLASQLTGYEIDIMTEE 346
>gi|144897846|emb|CAM74710.1| transcription elongation protein [Magnetospirillum gryphiswaldense MSR-1] (503 aa)
Score = 373, Expect = 1.4e-33, Identities = 110/360 (30%), Positives = 189/360 (52%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK-IEFEDVSQL 365
            L+  D +A++K   ++ ++  ++ A++K+   K   + DI   +D     I+L   R +    E+  ++  ++ ++ A +     K GD +   +    F R       Q++   + D    + + E+KD+VG I    V++V+   V V+LG  + ++ R E IP E  + G      I +V+ Q+ +G  I LSR     +  L   E+ EI DGIIEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I +  +   F+VNA  P ++  V + DDE    +  + +V P++ L   IG+ G NVRL S+LTGWSIDI++E    E +  EF   S+L
  S:    12 LLQVADAVARDKGIDRDEVLEAMEQAIQKAGRSKYGHEHDIRAHIDRKTGEIQL--ARYIEVVEEEVENEATQLPLARALKKNPGAKAGDFLVDPLPPIDFGRIAAQTAKQVIVQKVRDAERQRQFNEYKDRVGEISNGLVKRVEFGNVIVDLGRAEALLRRDELIPRETFRTGDRVRAYIADVR-QEPRGPQIFLSRTSPIFMSKLFAQEVPEIYDGIIEIKAVARDPGSRAKIAVISHDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSGEYATFVVNALAPAEVSKV-VLDDE----THTMEVVVPDDQLSLAIGRRGQNVRLASQLTGWSIDIMTEAEESERRNEEFRSRSKL 365
>gi|148976708|ref|ZP_01813395.1| transcription elongation factor NusA [Vibrionales bacterium SWAT-3] >gi|145964059|gb|EDK29317.1| transcription elongation factor NusA [Vibrionales bacterium SWAT-3] (495 aa)
Score = 373, Expect = 1.4e-33, Identities = 97/345 (28%), Positives = 195/345 (56%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K+  +L+IEV V++++++   + F +   V+  E+     KEI++  A+      +LG  +  ++    F+R  T    Q++   + +   +++ E++ D  G ++   V+KV+   + ++LG+  + V+LR +Q+P E  +PG     L+  VK +  +G+ + ++R+   +L  L + E+ EI + +IE+K  +R  G + K+A+ +    +D VG  VG +G R++ +S  L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I    ++L + IG++G NVRL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATA-TKKKSELEIEVRVEIDRKTGDFETFRRWEAVEVVENPT---KEISLEAAKYDDPEIELGGFIEDDIESVTFDRITTQTAKQVIVQKVREAERAQIVEQFIDNEGELVTGVVKKVNRDTIILDLGNNAEAVILRDDQLPRENFRPGDRVRGLLYAVKPE-ARGFQLFITRSKPEMLAELFRVEVPEIGEELIELKGAARDAGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLWDDNPAQFVINAMAPADVASIIVDED-----AHSMDIAVEADNLAQAIGRSGQNVRLASQLTGWELNVMT 340
>gi|194366589|ref|YP_002029199.1| NusA antitermination factor [Stenotrophomonas maltophilia R551-3] >gi|194349393|gb|ACF52516.1| NusA antitermination factor [Stenotrophomonas maltophilia R551-3] (503 aa)
Score = 373, Expect = 1.4e-33, Identities = 97/346 (28%), Positives = 188/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  +D +A EK   +E I + ++ AL  +  K  PD ++   VV+D    S + F +  VV         D++I + +A +  +   +GD +  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +G + + + IP + L+ G      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+L+     D +G  +G +G R++ +S+ LN ER+D++L++++P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW ++++++
  S:     3 KELLLVVDAVANEKGVPREVIFDAIEAALASAAKKRYPDEEVLTRVVIDHKDGSYETFRRWEVVADDVVMESPDRQIRLMDAVDEAEGVDVGDYIEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIYVDLGGNAEGFIPKDKGIPRDVLRAGDRVRGYLAEVRSE-PRGPQLFISRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVLAHDQRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNDNPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTQ 345
>gi|85058354|ref|YP_454056.1| transcription elongation factor NusA [Sodalis glossinidius str. 'morsitans'] >gi|84778874|dbj|BAE73651.1| transcription pausing L factor [Sodalis glossinidius str. 'morsitans'] (495 aa)
Score = 373, Expect = 1.4e-33, Identities = 95/345 (27%), Positives = 186/345 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+TAL  +  K+   ++++ V +D        F + ++VD+        +EI +  AQ    + ++G  +  E+    F+R  T    Q++   + +   + V ++++   G I+   V+KV+   + ++LGS  + V+ R + +P E  +PG     ++  V+ +  +G  + +SR+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKAVPREKIFEALETALATATKKKYEQEIEVRVSIDRKSGDFDTFRRWLIVDEVTQPT---REITLDAAQFDDPTAQIGGYIEDEIESVVFDRITTQTAKQVIVQKVREAERAMVVDQFRSHEGEIVTGVVKKVNRDSISLDLGSNAEAVIGREDMLPRENFRPGDRIRGVLYSVRPE-ARGAQLFVSRSRPEMLVELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|15836839|ref|NP_297527.1| transcription elongation factor NusA [Xylella fastidiosa 9a5c] >gi|9105045|gb|AAF83047.1|AE003877_2 N utilization substance protein A [Xylella fastidiosa 9a5c] (503 aa)
Score = 373, Expect = 1.5e-33, Identities = 96/355 (27%), Positives = 194/355 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIE 358
           K  L  +D +A EK   ++ I + ++ AL  +  K   D DI   V +D    + + + +  VV         +++I + +A +     ++GD +  ++    F R       Q++   + +    +V + WK++VG ++   V++V+   + V+LG  T+  + + + IP + ++PG      + EV+S+ ++G  + +SR+    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + I D+E       + +   E+ L + IGK G NVRL S+LTGW +++++ E++A + + E
  S:     3 KELLLVVDVVANEKGVPRQIIFDAIEVALASAAKKRYQDRDILTRVTIDQKSGNYETYRRWEVVADDVVMESPERQIRLMDALDEADGVEVGDYIEEQIENPDFGRISAQAAKQVIVQRVREAERQQVVDAWKNRVGELVTGVVKRVERGNIYVDLGGGTEAFIPKDKGIPRDVIRPGDRVRGYLAEVRSE-SRGPQLFISRSAPEFMIELFKLEVPEVGQGLVEIKGCARDPGDRAKIAVIAHDNRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSI-IVDEE----KHSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTAEQVAAKSEAE 355
>gi|196237425|ref|ZP_03136202.1| NusA antitermination factor [Cyanothece sp. PCC 7425] >gi|196218221|gb|EDY12863.1| NusA antitermination factor [Cyanothece sp. PCC 7425] (413 aa)
Score = 373, Expect = 1.6e-33, Identities = 108/346 (31%), Positives = 191/346 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIE-------------VVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGV------VLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           +++    E ++ I++E++  K  +   L+ AL K Y +    L +E             V +D+ +E  ++   + +V++ ++    D +I++SE QE+    +LGDTV  +V  ++  F R       Q+L   L D     V EE++D    +++A V + + R V + + S  G       + + EQ+P +  +   ++   +K+V     +G  +++SRAD GL+ YL   E+ EI D ++ I  +       SR VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P ++  V + + E+     +VT    ++ L   IGK G NVRL ++LTGW IDI
  S:     4 VRLPGLREMINAISRERNLPKYAVQGALQEALMKGYERYRRTLRLEGGHFDEDYFQNFDVEIDVEEEGFRVLATKTIVEQVDNP---DHQISLSEVQEVAAEAQLGDTVILDVTPEQQEFGRMAAIQAKQVLAQKLRDQQRKLVQEEFQDLESTVLQARVLRFERRSVIMAVSSGFGQPEVEAELPKKEQLPNDNYRANATFKVYLKKVLEGPHRGPQLLVSRADAGLVVYLFANEVPEIEDEVVRIVAVAREANPPSRQVGPRTKIAVDTLERDVDPVGACIGARGSRIQAVVNELRGEKIDVIRWSPDPATYIANALSPARVEEVRLMNPEERQAHILVT----DDQLSLAIGKEGQNVRLAARLTGWKIDI 370
>gi|126175440|ref|YP_001051589.1| NusA antitermination factor [Shewanella baltica OS155] >gi|125998645|gb|ABN62720.1| NusA antitermination factor [Shewanella baltica OS155] (499 aa)
Score = 373, Expect = 1.6e-33, Identities = 98/345 (28%), Positives = 186/345 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K+   D+D+ V +D        F + +VVD   + +++  +EI +  A+      + G+ +  ++    F+R  T    Q++   + +   ++V E+++D+ G +I   V+K     V V+LG+   GV+ R + I  E  +PG     L+  V+ +  +G  + LSR    +L  L + E+ EI+D +IEI   +R  G + K+A+ S    +D +G  VG +G R++ +S+ L  ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++LTGW +++++
  S:     3 KEILLVAEAVSNEKAVPREKIFEALEIALATATKKKYEGDIDVRVAIDRKTGGYDTFRRWMVVDDHGEALENPYREITLEAARYENPDIQPGEFIEDDIESVVFDRITTQTAKQVIVQKVREAERAQVVEQFQDQEGELITGIVKKATRESVVVDLGNNADGVLFREDLISRESFRPGDRVRALLYSVRPE-ARGAQLFLSRTKPEMLIELFRVEVPEIADELIEIMGAARDPGARAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLTGWVLNVMT 344
>gi|21905243|gb|AAM80105.1| putative transcription termination-antitermination factor [Streptococcus pyogenes MGAS315] (381 aa)
Score = 373, Expect = 1.6e-33, Identities = 112/342 (32%), Positives = 187/342 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           LE    + +EK   K +I++ +  +L+ +Y K         V++ N+++   F+   V +  E+  D   EI++ +A  +  +Y+LGD +  E ++++F R       Q +   +       ++ E+K+  G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DDED+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     2 LEAFRILEEEKHIDKADIIDAVTESLKSAY-KRRYGQSESCVIEFNEKTAD-FQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGRVAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDEDL---KRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKS 350
>gi|28198121|ref|NP_778435.1| transcription elongation factor NusA [Xylella fastidiosa Temecula1] >gi|71898654|ref|ZP_00680824.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Xylella fastidiosa Ann-1] >gi|182680749|ref|YP_001828909.1| NusA antitermination factor [Xylella fastidiosa M23] >gi|28056181|gb|AAO28084.1| N utilization substance protein A [Xylella fastidiosa Temecula1] >gi|71731601|gb|EAO33662.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Xylella fastidiosa Ann-1] >gi|182630859|gb|ACB91635.1| NusA antitermination factor [Xylella fastidiosa M23] (503 aa)
Score = 373, Expect = 1.7e-33, Identities = 96/355 (27%), Positives = 194/355 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIE 358
           K  L  +D +A EK   ++ I + ++ AL  +  K   D DI   V +D    + + + +  VV         +++I + +A +     ++GD +  ++    F R       Q++   + +    +V + WK++VG ++   V++V+   + V+LG  T+  + + + IP + ++PG      + EV+S+ ++G  + +SR+    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + I D+E       + +   E+ L + IGK G NVRL S+LTGW +++++ E++A + + E
  S:     3 KELLLVVDVVANEKGVPRQIIFDAIEVALASAAKKRYQDRDILTRVTIDQKNGNYETYRRWEVVADDVVMESPERQIRLMDALDEADGVEVGDYIEEQIENPDFGRISAQAAKQVIVQRVREAERQQVVDAWKNRVGELVTGVVKRVERGNIYVDLGGGTEAFIPKDKGIPRDVIRPGDRVRGYLAEVRSE-SRGPQLFISRSAPEFMIELFKLEVPEVGQGLVEIKGCARDPGDRAKIAVIAHDNRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSI-IVDEE----RHSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTAEQVAAKSEAE 355
>gi|187478885|ref|YP_786909.1| transcription elongation protein (N utilization substance protein) [Bordetella avium 197N] >gi|115423471|emb|CAJ50005.1| transcription elongation protein (N utilization substance protein) [Bordetella avium 197N] (492 aa)
Score = 373, Expect = 1.7e-33, Identities = 103/354 (29%), Positives = 185/354 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
           +D +A+EK+ ++E +   L++AL  +  K    D DI V +D      + F + +VV       + DK+  +S+A E+    ++GD +   +   +F R       Q +   + D    +V  ++ D+   II   ++++D     V  G  +  + R+E IP E L+ G      +  V     +G  +ILSR     +R L + E+ EI  G++EIK  +R  G + K+A+++    +D +GT VG +G R+  + + L  E++D++L+ EDP QF++ A  P  +  + + +D+       + +V  EE+L K IG  G NVRL S+LTGW I+I++ + ++ ++ E E VS
  S:     9 VDALAREKNVTREVVFGALESALASAMKKRFKEDADIRVSIDRETGGHEGFRRWLVVPDEAGLQEPDKQELLSDAHEISPDLEVGDFIEEPLEPVEFGRIGAQAAKQAILQKIRDAEREQVLNDFLDRGETIISGTIKRMDKGDYIVETGKIEARLPRTEMIPKENLRVGDRVRAFVLRV-DHAARGQQVILSRTSPEFIRQLFENEVPEIEQGLLEIKAAARDPGVRAKIAVVAYDKRIDPIGTCVGMRGSRVTAVRNELGGEQVDIVLWSEDPAQFVIGALAPANVESIVVDEDK-----HAMDVVVDEENLPKAIGAKGQNVRLASELTGWQINIMTPEESL-NRQENERVS 356
>gi|71276363|ref|ZP_00652640.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Xylella fastidiosa Dixon] >gi|71901435|ref|ZP_00683525.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Xylella fastidiosa Ann-1] >gi|170729432|ref|YP_001774865.1| N utilization substance protein A [Xylella fastidiosa M12] >gi|71162825|gb|EAO12550.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Xylella fastidiosa Dixon] >gi|71728806|gb|EAO30947.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Xylella fastidiosa Ann-1] >gi|167964225|gb|ACA11235.1| N utilization substance protein A [Xylella fastidiosa M12] (503 aa)
Score = 373, Expect = 1.7e-33, Identities = 96/355 (27%), Positives = 194/355 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIE 358
           K  L  +D +A EK   ++ I + ++ AL  +  K   D DI   V +D    + + + +  VV         +++I + +A +     ++GD +  ++    F R       Q++   + +    +V + WK++VG ++   V++V+   + V+LG  T+  + + + IP + ++PG      + EV+S+ ++G  + +SR+    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + I D+E       + +   E+ L + IGK G NVRL S+LTGW +++++ E++A + + E
  S:     3 KELLLVVDVVANEKGVPRQIIFDAIEVALASAAKKRYQDRDILTRVTIDQKNGNYETYRRWEVVADDVVMESPERQIRLMDALDEADGVEVGDYIEEQIENPDFGRISAQAAKQVIVQRVREAERQQVVDAWKNRVGELVTGVVKRVERGNIYVDLGGGTEAFIPKDKGIPRDVIRPGDRVRGYLAEVRSE-SRGPQLFISRSAPEFMIELFKLEVPEVGQGLVEIKGCARDPGDRAKIAVIAHDNRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSI-IVDEE----RHSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTAEQVAAKSEAE 355
>gi|120434526|ref|YP_956870.1| transcription elongation factor NusA [Gramella forsetii KT0803] >gi|117576676|emb|CAL65145.1| transcription elongation protein [Gramella forsetii KT0803] (410 aa)
Score = 372, Expect = 1.7e-33, Identities = 111/361 (30%), Positives = 201/361 (55%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
           I+SF E  D    ++ T    + ++ + AL+K Y     D + +++V+ +K  ++++  R+VV   E E DD++EI++++A++++  +++G+ VS EV +    RR      Q L   +++  N+ +Y+++KD  G I  AEV  + +R + +       +VL +  QIP +  + G++   +I+ V+ +  K   II+SR   G L  L + EI E+ DG+I IK++ R+ G K KVA+ S    +D VG  VG KG RI  I   L NE IDVI +  + + F+  A  P KI  +++ ++     ++   ++   E + K IG+ G N+RL  +LTG+ ID+  E   +E+ +E ++ +
  S:     7 IESFSEFKDDKLIDRVTLMAILEDVFRNALKKKY---GEDDNFDIIVNPDKGDLEIWRNRIVVADGEVE-DDNREISLAQARKIEPDFEVGEDVSEEVKLVDLGRRAILALRQNLISKIHEHDNTNIYKQFKDLEGEIYTAEVHHIRHRAIILLDDEGNEIVLPKDRQIPSDFFRKGENVRGIIESVELKGNKP-TIIMSRTAPGFLEKLFEQEIPEVFDGLITIKKVVRVPGEKAKVAVDSYDDRIDPVGACVGMKGSRIHSIVRELGNENIDVINFTNNEQLFITRALSPAKITSIKMDEE-----ARTAEVMLKPEEVSKAIGRGGHNIRLAGQLTGYEIDVYRE--GVEEDVELKEFT 356
>gi|160943264|ref|ZP_02090500.1| hypothetical protein FAEPRAM212_00750 [Faecalibacterium prausnitzii M21/2] >gi|158445503|gb|EDP22506.1| hypothetical protein FAEPRAM212_00750 [Faecalibacterium prausnitzii M21/2] (368 aa)
Score = 372, Expect = 1.8e-33, Identities = 106/346 (30%), Positives = 190/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEK----SYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR--LVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPG-SKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K F E L  +  E+  + E ++  +K A+      +Y  E   + +++  D  +  + L +  +V D  ED  D+  EI ++EA++++ SY++GD + T +    F R        ++   + +   ++   E + +  +I++A V +VD    +V ++LG     VL R+EQ+PGE    G++    I +V S + +G  +++SR   GL++ L + E+ EI DG +E+K ISR  G +TK+A+ S+ P V+ V   +G  G R+  +   L  E+ID++ + ED  +F+  A  P K+V VE+     +PG ++   +  P++ L   IG  G N RL ++LTG++IDI  E
  S:     6 KDFFEALSMLEHERGITAEYLIEKIKAAIIIAVKKNYEVEEDHIRVDIDPDTGRFDVALIQD-IVAD--EDWYDEHAEIGVTEARKIRSSYEVGDRIITPLKTRDFGRIAAQTAKHVIRQGIREAERNQQLSEIQSRAHDIVQATVTRVDTEKGIVALDLGKGGEAVLPRNEQVPGEVYTEGETLQVYIVDVVSTE-RGPRVMISRTHPGLVKRLFELEVPEIFDGTVEVKAISREAGARTKMAVWSKDPNVNPVSACIGEHGARVAAVVEKLGGEKIDIVKWSEDISEFISAALSPAKVVKVEL-----LPGETRSCRVTVPDQQLSLAIGNKGQNARLCARLTGYNIDIRPE 350
>gi|152972093|ref|YP_001337239.1| transcription elongation factor NusA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956942|gb|ABR78972.1| transcription elongation factor NusA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (495 aa)
Score = 372, Expect = 2.2e-33, Identities = 95/345 (27%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + +VV   E+     +EI +  A+   +S  +GD V  ++    F+R  T    Q++   + +   + V +++++  G II   V+KV+   + ++LG+  + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + ++EIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWLVV---EEVTQPTREITLEAARFEDESMNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNITLDLGNNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVLEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 340
>gi|163737947|ref|ZP_02145363.1| transcription elongation factor NusA [Phaeobacter gallaeciensis BS107] >gi|163742658|ref|ZP_02150044.1| transcription elongation factor NusA [Phaeobacter gallaeciensis 2.10] >gi|161384243|gb|EDQ08626.1| transcription elongation factor NusA [Phaeobacter gallaeciensis 2.10] >gi|161388563|gb|EDQ12916.1| transcription elongation factor NusA [Phaeobacter gallaeciensis BS107] (541 aa)
Score = 371, Expect = 2.3e-33, Identities = 105/345 (30%), Positives = 184/345 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYL-KENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L+  + +A+EK      +V+ ++ +L ++   +   ++DI V +D           R VV+    E +   E+ + +A++      +GD    EV   +  R       Q++   + +    + YEE+KD+ G II   V++ +   V V++G+ + ++ R+E+I  E  +P       IK+V+ ++ +G  I LSR     +  L K E+ EI DG+IEIK ++R  G + K+A++S    +D VG  VG +G R++ + + L  E+ID+I ++ED   FLVNA  P ++  V + D+E    +  + +V PEE L   IG+ G NVRL S+LT   IDI++E+
  S:    11 LLQTAEAVAREKMIDPGLVVDAMEESLARAAKSRYGSEMDIRVSIDRKTGRATFTRVRTVVEDDALE-NYQAELTVEQAKQYMADPSVGDVFVEEVPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESYRPNDRIRCFIKDVR-REPRGPQIFLSRTAPEFMAELFKMEVPEIYDGVIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEVSKV-VLDEE----AGKIEVVVPEEQLSLAIGRRGQNVRLASQLTALDIDIMTEE 349
>gi|154506276|ref|ZP_02043014.1| hypothetical protein RUMGNA_03818 [Ruminococcus gnavus ATCC 29149] >gi|153793415|gb|EDN75835.1| hypothetical protein RUMGNA_03818 [Ruminococcus gnavus ATCC 29149] (397 aa)
Score = 371, Expect = 2.5e-33, Identities = 109/349 (31%), Positives = 186/349 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLF---EKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
            +E L  + KEK+ S++ +++ ++ +L  S  K +      + V +N+E+       EK VV    E+  D   EI + +A+E+  + ++GD     V   +F R  T +   ++   + +     VY+++ +K  +I+   V++   + + VNLG    ++  +EQ+ GE  +P       I EVK+   KG  I++SR    L++ L + E++E+ DG +EIK I+R  G +TK+A+ S    VD VG  VG  G R+  +   L  E+ID+I + ++P   + NA  P K++ V    DE     K+ +++ P+  L   IGK G N RL ++LTG+ IDI SE  AIE
  S:     5 LMEALTILEKEKNISRDTMMDAIENSL-ISACKNHFGTSDNIKVIMNRETCDYAVYAEKEVV----EEVFDPAIEITLEDAEEIDSALQIGDVCQVPVQSKEFGRIATMNAKNLILQKIREEERKVVYDQYFEKEKDIVTGIVQRYVGKNISVNLGKADAMLTENEQVKGEVFKPTDRIKLYIVEVKNT-PKGPKILVSRTHPELVKRLFEAEVAEVKDGTVEIKSIAREAGSRTKMAVWSNDENVDPVGACVGMNGARVNAVVEELRGEKIDIINWSDNPALLIENALSPAKVISVMADPDE-----KVASVIVPDYQLSLAIGKEGQNARLAARLTGYKIDIKSETQAIE 345
>gi|94497164|ref|ZP_01303736.1| NusA antitermination factor [Sphingomonas sp. SKA58] >gi|94423269|gb|EAT08298.1| NusA antitermination factor [Sphingomonas sp. SKA58] (522 aa)
Score = 371, Expect = 2.5e-33, Identities = 111/346 (32%), Positives = 188/346 (54%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS----YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK 356
           + +A EK   K  ++  ++ A++++    Y  EN   DI   +D +   ++L+    VV+  ED     K++++ + Q+LKK   +GD +   +      R       Q++   + D    + YEE+KD+VG II   V+ V+   V VNLG  +GV+ R +QIP E ++ G     ++  V+ ++ +G  I LSRA    ++ L   E+ EI DG+I I   +R  G + K+ ++SR   +D VG  VG KG R++ +   +  E+ID+I + ED   F+VNA  P ++  V I ++      + + +V P++ L   IG+ G NVRL S+LTG +IDI++E  A E +
  S:    17 NSVASEKMIDKAIVIEAMEDAIQRAARARYGAEN---DIRAKLDPDSGDLRLWRVVEVVETVEDYF---KQVDLKQGQKLKKDAVIGDFIVDPLPAIDLGRIDAQSAKQVIFQKVRDAERERQYEEYKDRVGEIITGVVKSVEFGHVVVNLGRAEGVIRRDQQIPREVVRVGDRIRSVVLNVR-RENRGPQIFLSRAHPEFMKKLFAQEVPEIYDGVITIMAAARDPGSRAKIGVISRDSSIDPVGACVGMKGSRVQAVVQEMQGEKIDIIPWSEDTATFVVNALQPAQVARVVIDEE-----EERIEVVVPDDQLSLAIGRRGQNVRLASQLTGKAIDIMTEADASEKR 354
>gi|170727895|ref|YP_001761921.1| NusA antitermination factor [Shewanella woodyi ATCC 51908] >gi|169813242|gb|ACA87826.1| NusA antitermination factor [Shewanella woodyi ATCC 51908] (499 aa)
Score = 371, Expect = 2.6e-33, Identities = 99/345 (28%), Positives = 187/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQ-IPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K+   D+++ V +D      + F + +VV+ + + +++   EI +  AQ      +LGD +  ++    F+R  T    Q++   + +   ++V ++++DK G +I   V+K +   V V+LG+    VL  E  I  E  +PG     L+  V+ +  +G  + L+R    +L  L + E+ EI D +IEI   +R  G + K+A+ S    +D +G  VG +G R++ +S+ LN ER+D++L+D++P QF++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++L+GW +++++
  S:     3 KEILLVAEAVSNEKGVPREKIFEALEIALATATKKKYEGDIEVRVQIDRKTGGYETFRRWMVVEDTGEPLENPFSEITLEAAQFEDPEIQLGDYIEDDIESVVFDRITTQTAKQVIVQKVREAERAQVVDQFRDKEGELITGVVKKSNRESVVVDLGNNADAVLFKEDLISRESFRPGDRVRALLYAVRPE-ARGAQLFLTRTKPDMLIELFRVEVPEIQDEMIEIMGAARDPGSRAKIAVKSNDKRIDPIGACVGMRGARVQAVSNELNGERVDIVLWDDNPAQFVINAMSPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLSGWELNVMT 344
>gi|51473734|ref|YP_067491.1| transcription elongation factor NusA [Rickettsia typhi str. Wilmington] >gi|51460046|gb|AAU04009.1| transcription elongation protein NusA (N utilization substance protein A) [Rickettsia typhi str. Wilmington] (503 aa)
Score = 371, Expect = 2.8e-33, Identities = 110/344 (31%), Positives = 195/344 (56%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE ++  ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ +A       K+GD +   +    + R       Q++T  + +    K Y ++KD+ G+II   V++++   + V+LG  + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II++K ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VN+  P  +   EIT    DED   S  V +V  +E+    IG+ G NVRL SKLTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILIATVEQAIQVAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEDALVKNPEAKIGDEIYEYLPPIDYARVSAQAAKQVITQRVIEAEREKQYNDFKDRKGDIINGIVKRIEYGDIIVDLGRAEAIIKKDQLIKGEHFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNKMLVKLFKLEVPEILEDIIQVKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNSLVP--LAPSEITKILIDED---SHKVEVVVSQENQSIAIGRRGQNVRLASKLTGWNIDIMTEE 348
>gi|58040013|ref|YP_191977.1| transcription elongation factor NusA [Gluconobacter oxydans 621H] >gi|58002427|gb|AAW61321.1| N utilization substance protein A NusA [Gluconobacter oxydans 621H] (517 aa)
Score = 370, Expect = 3.1e-33, Identities = 105/348 (30%), Positives = 181/348 (52%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKS-YLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           D +++EK+  +E ++  ++ A++K+   K   + DI   +D     ++L      V+  E+E   D +I +  A++ +   + G+ +   +    F R       Q++   + +    + Y E+KD+VG I+   V++ +   + V +G T+ ++ R E IP E  +        I +V+ +  +G  I LSR     L  L   E+ EI DGIIEIK +SR  G + K+A++SR   +D VG  VG +G R++ + + L  E+ID+I +      F+VNA  P ++  V + D+E    +  V +V P+E L   IG+ G NVRL S+LT W IDI++E    E + E
  S:    15 DAVSREKNIDREEVLEAMEQAIQKAGRAKYGHEKDIRATIDRKTGEVRLSRWTEAVEHVENE---DTQIPLHIARKFQPEIQAGEHLVDPLPPIDFGRIAAQTAKQVIVQRVREYERKRQYNEFKDRVGEIVNGTVKRTEYGNLMVEIGHTEALLRRDELIPRESFRNSDRVRAYIYDVRDE-PRGPQIFLSRTHPAFLAKLFAQEVPEIYDGIIEIKAVSRDPGSRAKMAVISRDAAIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWSPQAATFVVNALAPAEVSKV-VMDEE----AGRVEVVVPDEQLSLAIGRRGQNVRLASQLTRWDIDILTEAEESERRQE 354
>gi|15892740|ref|NP_360454.1| transcription elongation factor NusA [Rickettsia conorii str. Malish 7] >gi|20139038|sp|Q92HF4|NUSA_RICCN Transcription elongation protein nusA >gi|15619917|gb|AAL03355.1| N utilization substance protein A [Rickettsia conorii str. Malish 7] (503 aa)
Score = 370, Expect = 3.2e-33, Identities = 111/344 (32%), Positives = 192/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + DI+  ++     I L     +V+  ED +    +I++ EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL S+LTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQAAGRKKYGNEYDIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEEALIKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGENFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLVKLFKLEVPEILESIIQIKSVARDPGSKAKIAVFAADSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASQLTGWNIDIMTEE 348
>gi|148361087|ref|YP_001252294.1| transcription elongation factor NusA [Legionella pneumophila str. Corby] >gi|148282860|gb|ABQ56948.1| N utilization substance protein A [Legionella pneumophila str. Corby] (492 aa)
Score = 370, Expect = 3.2e-33, Identities = 104/366 (28%), Positives = 195/366 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK-ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSK 369
           K  L   + ++ E+  SK+ I+  ++ ALE +  K    D+ + + +D      + F    VV++ E E  D +++++ +A+E K S  +GD +   +   +F R       Q++   + +     + ++++ K+G +I   V+KV    + ++LG      L RSE +P E  +P       + E+ + Q +G  + +SR    +L  L + E+ EI + II+IK  +R  G + K+A+ +    +D +G  VG +G R++ +SS L  ER+D+IL+D++P Q ++NA  P  I  + + +D     +  + +   +E L + IG+NG NVRL S+LTGW++++++ +       EFE  +Q  SSK
  S:     3 KELLLVAEALSNERGVSKDVIILAIQAALESATRKILGLDIGVRIKIDPKTGDYETFRYWDVVNEEELEFPD-RQLSLEQAKERKPSAAVGDRIEEIIPSIEFGRIEAQTARQVIMQKVREAERELIIDQFRSKLGQLIYGTVKKVTRDNIIIDLGGKAEAFLPRSEMLPHEMFRPNDRVRAYLYEI-TPQARGPQLFVSRTRNEMLIELFRIEVPEIGENIIDIKAAARDPGNRAKIAVKTNDGRIDPIGACVGMRGARVQAVSSELGGERVDIILWDDNPAQLVINAMAPADITSIVVDED-----THTMDLAVAKEQLSQAIGRNGQNVRLASQLTGWTLNVMTTE-------EFESKNQEESSK 356
>gi|54298757|ref|YP_125126.1| transcription elongation factor NusA [Legionella pneumophila str. Paris] >gi|53752542|emb|CAH13974.1| Transcription elongation protein nusA [Legionella pneumophila str. Paris] (492 aa)
Score = 370, Expect = 3.4e-33, Identities = 105/366 (28%), Positives = 195/366 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK-ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSK 369
           K  L   + ++ E+  SK+ I+  ++ ALE +  K    D+ + + +D      + F    VV++ E E  D +++++ +A+E K S  +GD +   +   +F R       Q++   + +     + ++++ K+G +I   V+KV    V ++LG      L RSE +P E  +P       + E+ + Q +G  + +SR    +L  L + E+ EI + II+IK  +R  G + K+A+ +    +D +G  VG +G R++ +SS L  ER+D+IL+D++P Q ++NA  P  I  + + +D     +  + +   +E L + IG+NG NVRL S+LTGW++++++ +       EFE  +Q  SSK
  S:     3 KELLLVAEALSNERGVSKDVIILAIQAALESATRKILGLDIGVRIKIDSKTGDYETFRYWDVVNEEELEFPD-RQLSLEQAKERKPSAAVGDRIEEIIPSIEFGRIEAQTARQVIMQKVREAERELIIDQFRSKLGQLIYGTVKKVTRDNVIIDLGGKAEAFLPRSEMLPHEMFRPNDRVRAYLYEI-TPQARGPQLFVSRTRNEMLIELFRIEVPEIGENIIDIKAAARDPGNRAKIAVKTNDGRIDPIGACVGMRGARVQAVSSELGGERVDIILWDDNPAQLVINAMAPADITSIVVDED-----THTMDLAVAKEQLSQAIGRNGQNVRLASQLTGWTLNVMTTE-------EFESKNQEESSK 356
>gi|195977581|ref|YP_002122825.1| transcription termination protein NusA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974286|gb|ACG61812.1| transcription termination protein NusA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (384 aa)
Score = 370, Expect = 3.4e-33, Identities = 111/345 (32%), Positives = 185/345 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  LE    + +EK   K +I+  +  +L+ +Y +     +   V++ N ++   F+   V +  E+  D   EI++++A  +  +Y+LGD +  E ++ +F R       Q +   +        + E+K   G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S  P VDA+GT VG  G  IKK+ S  + +R              IDVI + +DP +F+ NA  P + V + + DD+D+   K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     3 KEMLEAFRILEEEKHIDKADIIEAVTESLKSAYKRRYGQAE-SCVIEFNDKTAD-FQVFTVREVVEEVFDSRLEISLNDALAISSAYELGDKIRFEESVSEFGRVAAQSAKQTIMERMRRQMREITFNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGETFKSHDRIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRYDAKTGLEIPVEENIDVIQWVDDPAEFIYNAIAPAE-VDMVLFDDDDL---KRATVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKS 354
>gi|24378911|ref|NP_720866.1| transcription elongation factor NusA [Streptococcus mutans UA159] >gi|24376794|gb|AAN58172.1|AE014888_10 putative transcription factor NusA [Streptococcus mutans UA159] (397 aa)
Score = 370, Expect = 3.6e-33, Identities = 110/345 (31%), Positives = 187/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLD-IEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           +  LE    + +EK  +K++I++ +K +L+ +Y +     +  E+  D      K+F  R VV   E+  D   EI++ +A  +  +Y+LGD +  E +  +F R       Q +   +        + E+K+    I+   VE+ DNR + VNLG+ +  + R +Q+PGE           + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG KG  IKK++S  + +R              +DVI + +DP +F+ NA  P ++  V   +++D    K  T+V P+  L   IG+ G NVRL + LTG+ IDI S
  S:     3 QEMLEAFRILEEEKHINKDDIIDAVKESLKSAYKRRYGQAESAEIEFDEKSGDFKVFTVREVV---EEVFDSRLEISLKDALAISTAYELGDKIRFEESPKEFGRVAAQSAKQTIMEKMRRQMREVTFNEYKEHEREIMTGTVERFDNRFIYVNLGTIEAQLSRQDQVPGETFASHDRIEVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRKGANIKKVTSKFHPKRFDQKTGLWVPMEENVDVIEWVDDPAEFIYNAVAPAEVDQVLFDEEDD----KHATVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKS 354
>gi|149926272|ref|ZP_01914534.1| transcription elongation factor NusA [Limnobacter sp. MED105] >gi|149825090|gb|EDM84302.1| transcription elongation factor NusA [Limnobacter sp. MED105] (489 aa)
Score = 370, Expect = 3.6e-33, Identities = 101/360 (28%), Positives = 195/360 (54%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPG---QSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQLVSSK 369
           +D +A+EK+  K+ +   L+ AL  +  K  + ++D+ V +D +      F +  VV + ED  D   ++ + +A +  +  ++GD +  E+   +F R       Q++   + D    ++ +++ D+   I+  +V++++     V  G  +  + R + IP E L+PG   ++YL+ +     +  +G  +ILSR     ++ L   E+ EI  G +EIK  +R  G + K+A+L+    +D +GT VG +G R++ ++  L  ER+D++L+ EDP QF++ A  P  +  + + +D+      ++ +V  E  L + IG++G NVRL S LTGW I+I++ E+ A   + E   + +L +SK
  S:     9 VDALAREKNVDKDIVFGALELALASATKKRFDEEVDVRVSIDRDTGDYDTFRRWEVVTE-EDFYDPAYQMVLDQALKHDEEAEMGDFIEEELEPVEFGRIGAQAAKQVILQRVRDAEREQILQDFLDRGDKIVIGQVKRMERGDAIVESGRIEARLPRDQMIPRESLRPGDRVRAYLWKV----DRMARGQQVILSRTSPEFIKALFAMEVPEIEQGHLEIKGAARDPGMRAKIAVLAHDRRIDPIGTCVGVRGSRVQAVTQELGGERVDIVLWSEDPAQFVIGALSPATVQSIVVDEDQ-----HVMEVVVDEAELAQAIGRSGQNVRLASDLTGWQINIMTPEESAKRSEEEIGKLRELFTSK 363
>gi|92115190|ref|YP_575118.1| NusA antitermination factor [Chromohalobacter salexigens DSM 3043] >gi|91798280|gb|ABE60419.1| NusA antitermination factor [Chromohalobacter salexigens DSM 3043] (497 aa)
Score = 370, Expect = 3.8e-33, Identities = 102/349 (29%), Positives = 189/349 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           K  L  +D I+ EK   +E I   +++AL  +  K  +  ++   V +D        F +  VV+    E + D EI +SEA+       LGD V  +V    F R       Q++   + +   ++V  ++ ++ G ++   V+K     + V+LG      L RSE IPGE  +  +    L+ +V ++  +G  +IL+R    ++  L K E+ EI++ +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L NER+D+I++D++P Q ++NA  P ++  + + +D     +  + +   E++L + IG++G NVRL S+LTGW++++++E+ A
  S:     3 KEILLVVDAISNEKGVPREVIFEAVESALASASRKRFDGQEVSTRVKIDRATGDYDTFRRWTVVEDEAFE-NPDSEIPLSEAERRDPPLALGDVVEEQVESVAFGRIAAQTAKQVIVQKVREAERAEVVRQYAEREGELVAGIVKKTTREGLIVDLGENAEAFLPRSEMIPGERYRMNERVRALLWKVDAE-ARGSQLILTRTRPDMIVELFKIEVPEIAEQLIEIKGAARDPGARAKIAVKTNDKRIDPVGACVGMRGSRVQAVSNELRNERVDIIMWDDNPAQLVINAMAPAEVGSILVDED-----AHSMDVAVAEDNLAQAIGRSGQNVRLASELTGWTLNVMTEEEA 347
>gi|192361293|ref|YP_001980958.1| N utilization substance protein A [Cellvibrio japonicus Ueda107] >gi|190687458|gb|ACE85136.1| N utilization substance protein A [Cellvibrio japonicus Ueda107] (493 aa)
Score = 369, Expect = 3.9e-33, Identities = 103/345 (29%), Positives = 191/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD------KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEEL-QPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   D ++ EK   KE I   ++TAL  +  K  + D  IEV+++      + +       +S D + DD       +  + EA E   S K GD    ++   +F R       Q++   + +   +++ +E++D++G ++   V+KV    + V+LG+    VL  +Q+ G E+ + G     L+ +V+++  +G  ++LSR+   +L  L K E+ EI++ +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ER+D++L+D++P QF++NA  P +I  + + +D     ++ + +   EE+L   IG+ G NVRL  +LTGW+I+++S
  S:     3 KEILLVADAVSNEKGVDKELIFQAIETALATATKKRFDEDSTIEVIINRTTGDYETW-------RSWDVVSDDILAELGTQFTLEEAHEKDTSLKAGDVYREKIENAEFGRIAAQTAKQVIVQKVREAERAQMVDEYRDRMGELVSGTVKKVTRDSIIVDLGNNAEGVLPRDQLIGREIFRMGDRVRALLLDVRTE-ARGPQLLLSRSAPQMLVELFKIEVPEIAEEVIEIKGAARDPGLRAKIAVKTNDGRIDPVGACVGMRGSRVQAVSNELGGERVDIVLWDDNPAQFVINAMSPAEIESIVVDED-----ARSMDLAVNEENLAMAIGRGGQNVRLACELTGWNINVMS 342
>gi|56752082|ref|YP_172783.1| transcription elongation factor NusA [Synechococcus elongatus PCC 6301] >gi|56687041|dbj|BAD80263.1| N utilization substance protein A [Synechococcus elongatus PCC 6301] (441 aa)
Score = 369, Expect = 4.1e-33, Identities = 111/357 (31%), Positives = 200/357 (56%)
  Q:    13 IAKEKDTSKENIVNILKTALEKSY------------LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKG------VVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI-EFEDVSQLVSSK 369
           I+++K      I   LK AL K Y             +E+   +I+V +D+ +E  ++   + +V++ E+    D +I +++ QE+    + G+ V  +V  DK  F R       Q+L+  L D     + EE++D    ++ A+V + + + V + + S  G       + R EQ+P +  +   ++   +KEV  +  +G  +I+SRA+ GL+ YL + E+ EI DG++ I  +       +R VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P ++  V + D    P  +I  ++  ++ L   IGK G NVRL ++LTGW IDI  + +A+ D + E + +S+L+  +
  S:    16 ISEQKKLPANVIEEALKEALLKGYERYRRTQQMGEQFEEDYFDNIDVELDVEQEGFRVLATKTIVNQVENP---DHQIALADVQEVAPDAQAGEIVVLDVTPDKDDFGRMAAIQTKQVLSQKLRDHQRKLIQEEFQDLEDPVLMAKVLRFERQSVILGVSSGLGRPEVEAELPRREQLPNDNYRANATFRVFLKEVSEEPRRGPQLIVSRANAGLVVYLFENEVPEIQDGVVRIVAVAREANPPTRHVGPRTKIAVDTLEREVDPVGACIGARGSRIQVVVNELRGEKIDVIRWSPDPATYIANALSPARVQEVRLVD----PEGRIAHVLVNDDQLSLAIGKEGQNVRLAARLTGWKIDI--KDVALYDAVTEGQRISELIQER 391
>gi|194289950|ref|YP_002005857.1| transcription termination/antitermination L factor [Cupriavidus taiwanensis] >gi|193223785|emb|CAQ69792.1| transcription termination/antitermination L factor [Cupriavidus taiwanensis] (491 aa)
Score = 369, Expect = 4.4e-33, Identities = 102/353 (28%), Positives = 187/353 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           +D +A+EK+  K+ +   L+ AL  +  K    D+DI V +D      + F + +VV       + DK+I + EA+E   S +LGD +  ++   +F R       Q++   + D    ++  ++ D+   I+   V++ D + + V  G  + ++ R + IP E L+ G      I  V  +  +G  I LSR     L  L + E+ E+  G++EIK  +R  G + K+A+++    +D +GT VG +G R+  + + +  E +D++L+ EDP QF++ A  P ++  + + D+E       + +V  EE+L   IG++G NVRL S+LTGW I+I++++ + + + E  DV
  S:     9 VDALAREKNVDKDVVFGALEAALASATKKRFEEDVDIRVAIDRESGEHETFRRWLVVPDELGLQEPDKQILLFEAREENPSIELGDYIEQQIESVEFGRIGAQAAKQVILQRIRDAEREQILNDYLDRGEKIMTGTVKRADKKGLIVESGRVEALLARDQIIPKENLRTGDRVRAYILNV-DRAARGPQIELSRTAPDFLIKLFENEVPEMEQGLLEIKAAARDPGVRAKIAVVAHDKRIDPIGTCVGVRGTRVTAVRNEIGGEAVDIVLWSEDPAQFVIGALAPAQVQSI-VVDEE----KHSMDVVVDEENLAVAIGRSGQNVRLASELTGWQINIMTQEESAQKQAEESDV 356
>gi|148543928|ref|YP_001271298.1| NusA antitermination factor [Lactobacillus reuteri F275] >gi|184153324|ref|YP_001841665.1| transcription termination-antitermination factor [Lactobacillus reuteri F275] >gi|148530962|gb|ABQ82961.1| NusA antitermination factor [Lactobacillus reuteri F275] >gi|183224668|dbj|BAG25185.1| transcription termination-antitermination factor [Lactobacillus reuteri F275] (395 aa)
Score = 369, Expect = 4.5e-33, Identities = 115/354 (32%), Positives = 193/354 (54%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSED-EIDDDKEINISEAQELK--KSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGS-TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGV------EITDDEDIPGSKIV--------TIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVS 363
           LD + KEK   KE ++  L+ ALE +Y +   D ++EV  +    +IK++  + + D  E  E D ++ +++++A++L   + Y +GD +  EV    F R       Q++   L +     +Y+ +K     II  EV + D R   V+LG   +G +   +++P E           + +V   + +G  I +SR    LL+ L + E+ EI DG + I+ I+R  G + KVA+ S  P VD VGT VGP+G R++ I + L+ E +D++ Y +DP +F+ NA +P +++ V        ++ ED  G +          T+V P+  L   IGK G N RL ++LT + IDI SE    E+  E E+V+
  S:    14 LDYLEKEKGIKKEIVIEALEQALESAYKQNYGDKNVEVEFNSLTGNIKVYAVKTITDDEEAVEADSNEFMSLADARKLPHGQGYDIGDEIREEVTPRDFGRIAAQTAKQVVMQRLREEERKIIYDRYKTYENEIITGEVSREDKRFTYVDLGDGVEGAMGFRDKMPNEHYHVHDRIQVYVTKVNDDR-RGPQIFVSRTAPELLKRLFEREVPEIKDGTVLIENIAREAGDRAKVAVYSNDPNVDPVGTCVGPRGSRVQAIVNELDGENMDIVEYVKDPAKFIANALNPAEVLDVIFNEEKAASETEDSEGEETTEGQTERSCTVVVPDSQLSLAIGKRGQNARLAARLTKYKIDIKSESEMAENDQESEEVA 384
>gi|157376522|ref|YP_001475122.1| transcription elongation factor NusA [Shewanella sediminis HAW-EB3] >gi|157318896|gb|ABV37994.1| NusA antitermination factor [Shewanella sediminis HAW-EB3] (499 aa)
Score = 369, Expect = 4.5e-33, Identities = 98/345 (28%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQ-IPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K+   D+++ V +D    + + F + +VV+ + + +++   EI +  AQ  +   +LG+ +  ++    F+R  T    Q++   + +   +++ +++KDK G +I   V+K +   V V+LGS    VL  E  I  E  +PG     L+  V+ +  +G  + L+R    +L  L + E+ EI+D +IEI   +R  G + K+A+ S    +D +G  VG +G R++ +S+ LN ER+D++L+D++P Q+++NA  P  +  + + +D     +  + I    +SL + IG+NG NVRL ++L+GW +++++
  S:     3 KEILLVTEAVSNEKGVPREKIFEALEIALATATKKKYEGDIEVRVEIDRKTGAYETFRRWMVVEDTGEPLENPFSEITLEAAQFEEPEIQLGEYIEDDIESVVFDRITTQTAKQVIVQKVREAERAQIVDQFKDKEGELITGVVKKSNRESVVVDLGSNADAVLFKEDLISRESFRPGDRVRALLFAVRPE-ARGAQLFLTRTKPDMLIELFRVEVPEIADEMIEIMGAARDPGSRAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELNGERVDIVLWDDNPAQYVINAMAPADVASIIVDED-----NHSMDIAVEADSLAQAIGRNGQNVRLATQLSGWELNVMT 344
>gi|76496362|gb|ABA43692.1| NusA [Spiroplasma kunkelii CR2-3x] (483 aa)
Score = 369, Expect = 4.5e-33, Identities = 107/353 (30%), Positives = 193/353 (54%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQE-LKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
            L  +D+I  EK  S++ I++ +K  + K+Y K  +P+  I V +      IK+ ++  VV K ED++    EI ++EA+E   +   + D V  +VN ++F R       QI+   + +     +++E+  + G+++   V   + + + V +  T   + R   I  E  + GQ   FL ++V   +  G  II SR     L  LL+ EI EI + +IE+K I+R  G ++K+A+ S    +D +G  VG KG RI K+++ L +E+ID+ +Y+++ +QF++N+  P K++ +   D+E     K   +V P+E L   IGK G + +L++KLT W ++I+S   A+  ++E
  S:    19 LLSTIDEIVSEKQISRDLILDSIKEGIRKAYEKHFDPEATIIVEIHQKTGQIKVEKELTVVKKVEDDL---LEIGLNEAKEKYGEQITIDDKVYEQVNSEEFSRLAIFQVGQIIKQQIKEAEKDSIFDEYIIQKGHLMTGVVIAAEEKYLLVEVERTFAYIPRKNLIFSEHFEVGQPITFLAEDVVKSKNAG-QIIGSRTSNDFLYSLLEREIPEIFEQVIEVKAIARDPGRRSKIAVYSTNENIDPIGACVGSKGSRINKVTAELQDEKIDICIYNDNSQQFIINSLSPVKVISITTNDEE-----KEADVVVPDEQLSLAIGKGGSSAKLVAKLTKWKLNIMSYSEALTKQVE 364
>gi|52842972|ref|YP_096771.1| transcription elongation factor NusA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52630083|gb|AAU28824.1| N utilization substance protein A [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (492 aa)
Score = 369, Expect = 4.6e-33, Identities = 104/366 (28%), Positives = 195/366 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK-ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSK 369
           K  L   + ++ E+  SK+ I+  ++ ALE +  K    D+ + + +D      + F    VV++ E E  D +++++ +A+E K S  +GD +   +   +F R       Q++   + +     + ++++ K+G +I   V+KV    + ++LG      L RSE +P E  +P       + E+ + Q +G  + +SR    +L  L + E+ EI + II+IK  +R  G + K+A+ +    +D +G  VG +G R++ +SS L  ER+D+IL+D++P Q ++NA  P  I  + + +D     +  + +   +E L + IG+NG NVRL S+LTGW++++++ +       EFE  +Q  SSK
  S:     3 KELLLVAEALSNERGVSKDVIILAIQAALESATRKILGLDIGVRIKIDSKTGDYETFRYWDVVNEEELEFPD-RQLSLEQAKERKPSAAVGDRIEEIIPSIEFGRIEAQTARQVIMQKVREAERELIIDQFRSKLGQLIYGTVKKVTRDNIIIDLGGKAEAFLPRSEMLPHEMFRPNDRVRAYLYEI-TPQARGPQLFVSRTRNEMLIELFRIEVPEIGENIIDIKAAARDPGNRAKIAVKTNDGRIDPIGACVGMRGARVQAVSSELGGERVDIILWDDNPAQLVINAMAPADITSIVVDED-----THTMDLAVAKEQLSQAIGRNGQNVRLASQLTGWTLNVMTTE-------EFESKNQEESSK 356
>gi|28871625|ref|NP_794244.1| transcription elongation factor NusA [Pseudomonas syringae pv. tomato str. DC3000] >gi|28854877|gb|AAO57939.1| N utilization substance protein A [Pseudomonas syringae pv. tomato str. DC3000] (493 aa)
Score = 369, Expect = 4.6e-33, Identities = 100/346 (28%), Positives = 193/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D ++E+ V++N+++   + F +  VV+  ED  D   E+ + +AQ  K     GD +  +++  +F R       Q++   + +   ++V + +++++G II   V+KV    V V+LG+    +L R + I  E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I    ++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPASVIFEALELALATATKKRFED-EVELRVEINRQTGNYETFRRWTVVE-DEDLDDPAYELAVDQAQAKKPGAVAGDLIEEKIDSIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVRVRALLKEIRTEN-RGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|66047408|ref|YP_237249.1| transcription elongation factor NusA [Pseudomonas syringae pv. syringae B728a] >gi|63258115|gb|AAY39211.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Pseudomonas syringae pv. syringae B728a] (493 aa)
Score = 369, Expect = 4.6e-33, Identities = 100/346 (28%), Positives = 193/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D ++E+ V++N+++   + F +  VV+  ED  D   E+ + +AQ  K     GD +  +++  +F R       Q++   + +   ++V + +++++G II   V+KV    V V+LG+    +L R + I  E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I    ++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPASVIFEALELALATATKKRFED-EVELRVEINRQTGNYETFRRWTVVE-DEDLDDPAYELAVDQAQAKKPGAVAGDLIEEKIDSIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVRVRALLKEIRTEN-RGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|166712599|ref|ZP_02243806.1| transcription elongation factor NusA [Xanthomonas oryzae pv. oryzicola BLS256] (503 aa)
Score = 368, Expect = 5.1e-33, Identities = 99/362 (27%), Positives = 194/362 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
           K  L  +D +A EK   +E I + ++ AL  +  K  PD D+   V +D    + + + +  VV         D+++ + +A +      +GD +  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +  + + + IP + L+PG      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ IS+ LN ER+D++L++E+P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW +++++ +++A + + E     QL
  S:     3 KELLLVVDAVANEKGVPREVIFDAIEAALASAAKKRYPDQDVLARVTIDHKDGTYETYRRWEVVADDVVMESPDRQVRLMDAIDEADGVDVGDYIEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIFVDLGGNAEAFIPKDKGIPRDVLRPGDRVRGYLAEVRSE-PRGPQLFISRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVIAHDARTDPIGACIGMRGSRVQAISNELNGERVDIVLWNENPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTADQVAAKSEAEQAAARQL 362
>gi|53804603|ref|YP_113778.1| transcription elongation factor NusA [Methylococcus capsulatus str. Bath] >gi|53758364|gb|AAU92655.1| N utilization substance protein A [Methylococcus capsulatus str. Bath] (499 aa)
Score = 368, Expect = 5.1e-33, Identities = 108/372 (29%), Positives = 201/372 (54%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD----DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSKTRQ 372
           M  K  L  +D ++ EKD  KE I + ++ AL  + +K +    D+ V +D      + F +  VV+  E+  +     ++EI++ EA++      +G+ V    +  +F R       Q++   + +    K+ + ++ +VG ++   +++++   V ++LG + +  + R E IP E ++ G     ++  V+    +G  + +SR    LL  L + E+ E+S+ +IEIK  +R  G + KVA+ S  P +D VG  VG +G R++ +S+ L  ERID+IL++E+  QF+VNA  P +IV + + +D        + I   +E+L + IG+ G NVRL S+LTGW+++++S   A  D    E+  +L+ +   Q
  S:     1 MANKEILLVVDVVSNEKDIEKEVIFSAIEEALRTATIKRHDGRYDVRVSIDRKTGDYETFRRWQVVEPREEFGNGVEFPEREISLEEARKTHPGITVGEFVEEPFDSIEFGRIAAQTAKQVIVQKVREAERRKIADAYQSRVGELVTGVIKRIERGNVFLDLGGNVEAFIPRDEMIPRESVRSGDRLRGILSAVRPD-ARGPQLFVSRTAPELLIALFRLEVPEVSENLIEIKGAARDPGVRAKVAVKSNDPRLDPVGACVGMRGSRVQAVSNELAGERIDIILWNENEAQFVVNAMSPAEIVSIVVDEDR-----HSMDIAVADENLSQAIGRGGQNVRLASELTGWTLNVMSSTQA--DAKTQEETRRLIQTFVEQ 370
>gi|189219874|ref|YP_001940515.1| Transcription elongation factor [Methylokorus infernorum V4] >gi|189186732|gb|ACD83917.1| Transcription elongation factor [Methylacidiphilum infernorum V4] (441 aa)
Score = 368, Expect = 6.0e-33, Identities = 102/346 (29%), Positives = 180/346 (52%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           ++ + KEK  +++  +  +++AL  +  K   P  D+ V +      I +  K  VV+K ++  D   +I++  A+E+  +  +GD V  EV    F R     F Q +   L  I    V  E+KD++ NI+   + +++   + ++LG  +G++   E++P EE   G+     +  V      G  IILSR+    +  LL+ E+SE++D I+E+K I+R  G++TK+A+ S  P +D VG+ VG +G R+K I   L++E+ID+  +  + ++  + A  P K+  VE+        +  V +   EE+    +GK G N  L SK+ GW IDI+ E   + D
  S:    32 MEYMEKEKGINRQVFIEAMQSALLAAAKKSIGPARDLRVEIHPKTGRINVRAKLEVVEKVQNSHD---QISLKRAREIDPNVNIGDLVEVEVTPKDFGRIAAQVFKQTINQALKGIERKMVLSEFKDRINNIVSGTIRRIERSDIIIDLGRYEGIMPFKERVPTEEYVVGERIKAYVLSV-DDTPHGPMIILSRSHPNFILRLLELEVSEVADKIVEVKAIAREPGFRTKIAVWSSNPKIDPVGSCVGVRGARVKNIVRELHSEKIDLFKWSPNVEELAIEALKPAKVKKVEVDQQ-----NHRVKVTVDEENYSIALGKKGKNAWLASKIVGWDIDIVKEPSFVVD 369
>gi|126663078|ref|ZP_01734076.1| transcription elongation factor NusA [Flavobacteria bacterium BAL38] >gi|126624736|gb|EAZ95426.1| transcription elongation factor NusA [Flavobacteria bacterium BAL38] (413 aa)
Score = 368, Expect = 6.1e-33, Identities = 117/366 (31%), Positives = 202/366 (55%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAI-EDKIEFEDVSQLVSS 368
           I+SF E  D    ++ T    + ++ + AL+K Y     D + +++++ +K  ++++  RVVV+  E E D + EI+++EA+ ++  +++G+ VS EV + +  RR      Q L   +++  N+ +Y+++KD +G+I  AEV  V  + V +       +VL + +QIP +  + G +   +I+ V+ +  K   II+SR     L  L + EI E+ DG+I IK++ RI G K KVA+ S    +D VG  VG KG RI  I   L NE IDVI +  + + ++  A  P K+  V+I ++     +K   +    E + K IG+ G N++L S LTG+ ID+I E +A  ED +E  + S  + +
  S:     7 IESFSEFKDDKLIDRVTLMAILEDVFRNALKKKY---GSDDNFDIIINPDKGDMEIWRNRVVVEDGEVE-DPNSEISLTEARRIEPDFEVGEDVSEEVKLIQLGRRAILSLRQNLISKIHEHDNTNLYKQFKDLIGDIYTAEVHHVRPKAVILMDDEGNEIVLPKEKQIPNDYFKKGDNVRGVIENVELKGNKP-QIIMSRTAPEFLEKLFEQEIPEVFDGLITIKKVVRIPGEKAKVAVDSYDDRIDPVGACVGMKGSRIHGIVRELGNENIDVINFTTNAQLYITRALSPAKVSTVKINEE-----AKTAEVFLKIEEVSKAIGRGGNNIKLASLLTGYEIDVIREGIAQEEDDVELREFSDEIEA 364
>gi|161506147|ref|YP_001573259.1| transcription elongation factor NusA [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867494|gb|ABX24117.1| hypothetical protein SARI_04337 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (500 aa)
Score = 368, Expect = 6.3e-33, Identities = 98/345 (28%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVN----LGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++V   E+     KEI +  A+   +S  +GD V  ++    F+R  T    Q++   + +   + V ++++D+ G I+   V+KV  DN  +E+      G+ + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWLIV---EEVTMPTKEITLEAARFEDESLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRDQEGEIVTGVVKKVNRDNISLEIKSEGMAGNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSRPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 345
>gi|157825875|ref|YP_001493595.1| transcription elongation factor NusA [Rickettsia akari str. Hartford] >gi|157799833|gb|ABV75087.1| transcription elongation factor NusA [Rickettsia akari str. Hartford] (503 aa)
Score = 367, Expect = 6.5e-33, Identities = 110/344 (31%), Positives = 193/344 (56%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +V+ ++ A++ +  K+   + +I+  ++     I L     +V+  +D +    +I+++EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G + K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL SKLTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILVSTVEQAVQVAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVQDYL---TQISLAEALRKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLINGENFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLVKLFKIEVPEILEDIIQIKSVARDPGSRAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASKLTGWNIDIMTEE 348
>gi|78048394|ref|YP_364569.1| transcription elongation factor NusA [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78036824|emb|CAJ24517.1| N utilization substance (transcription elongation) protein A [Xanthomonas campestris pv. vesicatoria str. 85-10] (503 aa)
Score = 367, Expect = 6.6e-33, Identities = 98/362 (27%), Positives = 194/362 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
           K  L  +D +A EK   +E I   ++ AL  +  K  PD D+   V +D    + + + +  VV         D+++ + +A +     ++GD +  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +  + + + IP + L+PG      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW +++++ +++A + + E     QL
  S:     3 KELLLVVDAVANEKGVPREVIFEAIEAALASAAKKRYPDQDVLARVTIDHKDGTYETYRRWEVVADDVVMESPDRQVRLMDAIDEADGVEVGDYIEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIFVDLGGNAEAFIPKDKGIPRDVLRPGDRVRGYLAEVRSE-PRGPQLFISRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVIAHDARTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTADQVAAKSEAEQAAARQL 362
>gi|169630217|ref|YP_001703866.1| transcription elongation protein NusA [Mycobacterium abscessus] >gi|169242184|emb|CAM63212.1| Transcription elongation protein NusA [Mycobacterium abscessus] (331 aa)
Score = 367, Expect = 6.7e-33, Identities = 90/245 (36%), Positives = 141/245 (57%)
  Q:   105 FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNR-----LVEVNLGS----TKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           F R   +   Q+    + D  N   + E+  + G I+   +++ D R     LV V +GS    ++GV+  +EQ+PGEE   G      +  V S+  +   I LSR    L+R L   E+ EISDG +EI  ++R  G+++K+A+ S+V G++A G  +GP G+R++ + S L+ E+ID+I YD DP +F+ NA  P K+V V + D+      K   ++ P+  L   IGK G N RL ++LTGW IDI S+
  S:    79 FGRIAATTARQVFQQGVRDAENEHKFGEFSTREGEIVGGVIQR-DARANARGLVVVRMGSETKGSEGVIPSAEQVPGEEYHHGDRLRCYVVGV-SRGAREPLITLSRTHPNLVRKLFSLEVPEISDGSVEIVAVAREAGHRSKIAVASKVSGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDPDPARFVANALSPAKVVSVSVIDE----AGKAARVIVPDFQLSLAIGKEGQNARLAARLTGWRIDIRSD 326
>gi|168237988|ref|ZP_02663046.1| hypothetical protein Senteenterica_17498 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194733934|ref|YP_002116237.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194709436|gb|ACF88657.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (500 aa)
Score = 367, Expect = 6.7e-33, Identities = 98/345 (28%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVN----LGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++V   E+     KEI +  A+   +S  +GD V  ++    F+R  T    Q++   + +   + V ++++D+ G I+   V+KV  DN  +E+      G+ + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWLIV---EEVTMPTKEITLEAARFEDESLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRDQEGEIVTGVVKKVNRDNISLEIKSEGMAGNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 345
>gi|54295603|ref|YP_128018.1| transcription elongation factor NusA [Legionella pneumophila str. Lens] >gi|53755435|emb|CAH16931.1| Transcription elongation protein nusA [Legionella pneumophila str. Lens] (492 aa)
Score = 367, Expect = 6.8e-33, Identities = 104/366 (28%), Positives = 195/366 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK-ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQLVSSK 369
           K  L   + ++ E+  SK+ I+  ++ ALE +  K    D+ + + +D      + F    VV++ E E  D +++++ +A+E K S  +GD +   +   +F R       Q++   + +     + ++++ K+G +I   V+KV    + ++LG      L RSE +P E  +P       + E+ + Q +G  + +SR    +L  L + E+ EI + II+IK  +R  G + K+A+ +    +D +G  VG +G R++ +SS L  ER+D+IL+D++P Q ++NA  P  I  + + +D     +  + +   +E L + IG+NG NVRL S+LTGW++++++ +       EFE  +Q  SSK
  S:     3 KELLLVAEALSNERGVSKDVIILAIQAALESATRKILGLDIGVRIKIDSKTGDYETFRYWDVVNEEELEFPD-RQLSLEQAKERKPSAAVGDRIEEIIPSIEFGRIEAQTARQVIMQKVREAERELIIDQFRSKLGQLIYGTVKKVTRDNIIIDLGGKAEAFLPRSEMLPHEMFRPNDRVRAYLYEI-TPQARGPQLFVSRTRNEMLIELFRIEVPEIGENIIDIKAAARDPGNRAKIAVKTNDGRIDPIGACVGMRGARVQAVSSELGGERVDIILWDDNPAQLVINAMAPADITSIVVDED-----THTMDLAVVKEQLSQAIGRNGQNVRLASQLTGWTLNVMTTE-------EFESKNQEESSK 356
>gi|16766585|ref|NP_462200.1| transcription elongation factor NusA [Salmonella typhimurium LT2] >gi|56415219|ref|YP_152294.1| transcription elongation factor NusA [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181798|ref|YP_218215.1| transcription elongation factor NusA [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616293|ref|YP_001590258.1| transcription elongation factor NusA [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167544107|ref|ZP_02339679.1| hypothetical protein Sentent_12568 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167552065|ref|ZP_02345818.1| hypothetical protein Sentente_16362 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167558154|ref|ZP_02351164.1| hypothetical protein Sententeri_15107 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167990148|ref|ZP_02571248.1| hypothetical protein Sententer_01000002_0100001810 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168221382|ref|ZP_02646614.1| hypothetical protein Senterenterica_13386 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227799|ref|ZP_02653030.1| hypothetical protein Sententeric_18642 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168231896|ref|ZP_02656954.1| hypothetical protein Sententerica_13000 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168243121|ref|ZP_02668053.1| hypothetical protein Senterienterica_15872 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168262702|ref|ZP_02684675.1| hypothetical protein Salmentericaenterica_16585 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463490|ref|ZP_02697407.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168477386|ref|ZP_02706409.1| hypothetical protein Salmoentericaenterica_22254 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168819644|ref|ZP_02831644.1| hypothetical protein Salentericaenterica_09673 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442917|ref|YP_002042544.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450306|ref|YP_002047316.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469393|ref|ZP_03075377.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|20141550|sp|P37430|NUSA_SALTY Transcription elongation protein nusA (N utilization substance protein A) (L factor) >gi|16421846|gb|AAL22159.1| L factor [Salmonella typhimurium LT2] >gi|56129476|gb|AAV78982.1| L factor [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129431|gb|AAX67134.1| transcription pausing; L factor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365657|gb|ABX69425.1| hypothetical protein SPAB_04099 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401580|gb|ACF61802.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408610|gb|ACF68829.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455757|gb|EDX44596.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|195633199|gb|EDX51613.1| transcription termination/antitermination factor NusA [Salmonella enterica subsp. enterica serovar Newport str. SL317] (500 aa)
Score = 367, Expect = 6.8e-33, Identities = 98/345 (28%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVN----LGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++V   E+     KEI +  A+   +S  +GD V  ++    F+R  T    Q++   + +   + V ++++D+ G I+   V+KV  DN  +E+      G+ + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWLIV---EEVTMPTKEITLEAARFEDESLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRDQEGEIVTGVVKKVNRDNISLEIKSEGMAGNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 345
>gi|148244225|ref|YP_001218919.1| transcription termination factor NusA [Candidatus Vesicomyosocius okutanii HA] >gi|146326052|dbj|BAF61195.1| transcription termination factor NusA [Candidatus Vesicomyosocius okutanii HA] (491 aa)
Score = 367, Expect = 7.0e-33, Identities = 102/358 (28%), Positives = 198/358 (55%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKL--FEKRVVVDKSEDEIDDDK---EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIE 358
           M  K     ++ I+ EK+ SKE ++  L+ AL  +  K N   +I+  V++N+++ +   F + +VV   E  +DDD    ++ +   ++      + D +   +   +F R       Q++   + +     +  ++  ++G +I   V++VD   + V++G   G++ + + IP E ++        IKEVKS   +G  I LSR+   ++  L K E+ EIS G+IEI   SR  G ++K+A+ ++   +D +G+ +G +G R++ +S+ LN ER+D+IL+DEDP QF++NA  P ++  + + +++       + I   +E L   IG+ G N++L S+LTGW ++++S   A E++++
  S:     1 MDGKELFLMVEAISNEKNISKEEVLESLEKALAIATKKRN---NIDAYVEINRQTGEFLTFRQWMVVADGELFVDDDGTEFDLELHIYEKDTDGLVVDDYMRKPIETQEFGRIAAQIVKQVIIQKVREAEREVIVNDYSSRIGEVIMVTVKRVDRGNIYVDMGGVDGMIPKFDLIPNESVRKNDRLRAYIKEVKSS-IRGVQIFLSRSVSEMMIELFKMEVPEISAGVIEIMGGSRDPGLRSKLAVRAKDKRIDPIGSCIGMRGARVQAVSNELNAERVDIILWDEDPAQFVINAMAPAEVSSIIVDENK-----HSMDIAVEDEQLALAIGRGGQNIKLASRLTGWKLNVMSTIQADEEQVQ 354
>gi|15902522|ref|NP_358072.1| transcription elongation factor NusA [Streptococcus pneumoniae R6] >gi|15458048|gb|AAK99282.1| Transcription termination [Streptococcus pneumoniae R6] (378 aa)
Score = 367, Expect = 7.2e-33, Identities = 119/357 (33%), Positives = 191/357 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI--ISEKLAIEDKIEFE 360
           K  LE    + ++K   KE+I++ +  +L  +Y +     D  V +D N+++    ++  R VVD++    D   EI++ +A  +  +Y+LGD +  E    +F R       Q +   +   + +  Y  +K+    I+   VE+ DNR + VNLGS +  + + +QIPGE           + +V+    +G  + +SR+   +++ L++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG  G  IKKI+S  +               E IDVI +  DP +F+ NA  P ++  V I D+ D   SK   +V P+  L   IG+ G NVRL + LTG+ IDI   SE  A+ED    E
  S:     3 KEMLEAFRILEEDKRIKKEDIIDAVVESLRSAYRRRYGQSD-SVAIDFNEKTGDFTVYTVREVVDEA---FDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDN-PRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQV-IFDESD---SKRALVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVE 368
>gi|86133947|ref|ZP_01052529.1| transcription elongation factor NusA [Tenacibaculum sp. MED152] >gi|85820810|gb|EAQ41957.1| transcription elongation factor NusA [Polaribacter dokdonensis MED152] (418 aa)
Score = 367, Expect = 7.2e-33, Identities = 115/353 (32%), Positives = 197/353 (55%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV-DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKI--VTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           I SF E  D  + ++ T    +  + + AL++ +     D + +++++ +K  ++++  RVVV     E DD++EI +SEA++++  +++G+ VS EV +    RR      Q L   + +  ++ +++++KD  G +  AEV  +  N ++ ++    + V+ +SEQI  +  + G +   +IK V+ +  K   IILSR     L  L + EI E+ DG+I ++ ++RI G K KVA+ S    +D VG  VG KG RI  I   L NE IDVI Y ++ + F+  A  P K+  +EIT  E+    K   V+++   E + K IG+ G+N+RL S+LTG+ ID+  E L  ED
  S:     7 IDSFSEFKDNKSIDRVTLMSILEEVFRAALKRKF---GSDDNFDIIINPDKGDLEIWRNRVVVADGFSE-DDNEEIELSEARKIEPDFEIGEDVSEEVKLIDLGRRAILALRQNLISKIYEHDSTNIFKQFKDLEGELFSAEVHHIRHNAIILLDDEGNEIVLPKSEQIRSDFFRKGDNVRGVIKTVELRGNKP-AIILSRTSPAFLNKLFEQEIPEVFDGLITVEGVARIPGEKAKVAVDSYDDRIDPVGACVGVKGSRIHGIVRELGNENIDVINYTKNEQLFISRALSPAKVTSMEITMYEEEKNGKKGRVSVLLKPEEVSKAIGRGGVNIRLASELTGYEIDVQREGLEEED 357
>gi|71734581|ref|YP_276312.1| transcription elongation factor NusA [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555134|gb|AAZ34345.1| N utilization substance protein A [Pseudomonas syringae pv. phaseolicola 1448A] (493 aa)
Score = 367, Expect = 7.8e-33, Identities = 100/346 (28%), Positives = 193/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D ++E+ V++N+++   + F +  VV+  ED  D   E+ + +AQ  K     GD +  +++  +F R       Q++   + +   ++V + +++++G II   V+KV    V V+LG+    +L R + I  E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I    ++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPASVIFEALELALATATKKRFED-EVELRVEINRQTGNYETFRRWTVVE-DEDLDDPAYELAVDQAQVKKPGAVAGDLIEEKIDSIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVRVRALLKEIRTEN-RGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|67459264|ref|YP_246888.1| transcription elongation factor NusA [Rickettsia felis URRWXCal2] >gi|67004797|gb|AAY61723.1| N utilization substance protein A, transcription termination factor NusA [Rickettsia felis URRWXCal2] (503 aa)
Score = 367, Expect = 8.0e-33, Identities = 112/344 (32%), Positives = 192/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K I++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL SKLTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQVAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEEALIKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGENFKPNDRIKVYVQDVR-QETKGPQIFLSRVDNQMLVKLFKLEVPEILEDIIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAITNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASKLTGWNIDIMTEE 348
>gi|21243417|ref|NP_642999.1| transcription elongation factor NusA [Xanthomonas axonopodis pv. citri str. 306] >gi|21108968|gb|AAM37535.1| N utilization substance protein A [Xanthomonas axonopodis pv. citri str. 306] (503 aa)
Score = 367, Expect = 8.0e-33, Identities = 98/362 (27%), Positives = 194/362 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDI--EVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQL 365
           K  L  +D +A EK   +E I   ++ AL  +  K  PD D+   V +D    + + + +  VV         D+++ + +A +     ++GD +  ++    F R       Q++   + +    +V + WKD+VG +I   V++ +   + V+LG + +  + + + IP + L+PG      + EV+S+  +G  + +SRA    +  L K E+ E+  G++EIK  +R  G + K+A+++     D +G  +G +G R++ +S+ LN ER+D++L++E+P  F++NA  P ++  + + +D+       + +   E+ L + IGK G NVRL S+LTGW +++++ +++A + + E     QL
  S:     3 KELLLVVDAVANEKGVPREVIFEAIEAALASAAKKRYPDQDVLARVTIDHKDGTYETYRRWEVVADDVVMESPDRQVRLMDAIDEADGVEVGDYIEEQIENPDFGRIAAQAAKQVIVQRVREAERQQVVDAWKDRVGELITGVVKRAERGNIFVDLGGNAEAFIPKDKGIPRDVLRPGDRVRGYLAEVRSE-PRGPQLFVSRAAPEFMIELFKLEVPEVGQGLVEIKACARDPGDRAKIAVIAHDARTDPIGACIGMRGSRVQAVSNELNGERVDIVLWNENPANFVINAMAPAEVQSIIVDEDK-----HSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQLNVMTADQVAAKSEAEQAAARQL 362
>gi|54307814|ref|YP_128834.1| transcription elongation factor NusA [Photobacterium profundum SS9] >gi|46912237|emb|CAG19032.1| putative transcription pausing L factor [Photobacterium profundum SS9] (495 aa)
Score = 367, Expect = 8.0e-33, Identities = 95/345 (27%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN-PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K++  ++D+ V +D     +  F + + VD+         E+ I  AQ   ++ +LG  V  E+    F+R  T    Q++   + +    ++ E++ D  G +I   V+KV+   V ++LG+  + V+ R +Q+P E  + G     L+  V+ +  +G+ + ++R+   +L  L + E+ EI + +IE+   +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+DE+  Q+++NA  P ++  + + +D     S  + I   +++L + IG++G N+RL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATATKKKHEAEIDVRVAIDRKTGQVATFRRWLAVDEVTQPT---LEMTIEAAQYDDETIELGGFVEDEIESVTFDRITTQTAKQVIVQKVREAEREQIVEQFMDNEGELITGIVKKVNRDAVIIDLGNNAEAVIQRDDQLPRENFRSGDRIRGLLYAVRPE-ARGFQLFMTRSKAEMLLELFRIEVPEIGEELIELMGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELAGERIDIVLWDENAAQYVINAMAPAEVASIIVDED-----SHTMDIAVEKDNLAQAIGRSGQNIRLASQLTGWELNVMT 340
>gi|88797622|ref|ZP_01113211.1| N utilization substance protein A [Reinekea sp. MED297] >gi|88779794|gb|EAR10980.1| N utilization substance protein A [Reinekea sp. MED297] (503 aa)
Score = 367, Expect = 8.1e-33, Identities = 101/349 (28%), Positives = 190/349 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALE---KSYLKENPDLDIEVVVDLNKESIKLFEK-RVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEE-LQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           K  L  +D +A EK  S++ I + ++ AL    K  L +  + D+ VV+D      + F +  V+ D    E+    +    EA E+  + K GD    ++  + F R       QI+   + D   +++ + ++++VG ++   V+KV    + ++LG+    VL  +Q+ G E  +       +++E+KS+  +G  ++LSR    +L  L + E+ EI + +IEI+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L NER+D+IL+D++P Q ++NA  P ++  + + +D     +  + +   E++L   IG+NG NVRL + LTGW I++++E  A
  S:     9 KEILLVVDAVANEKGVSRDVIFDAMELALATAAKKRLDDEGEPDVYVVIDRKTGEYETFRRWEVMGDDVVPELG--SQWTTEEAHEVDTNLKPGDVYEVQIENEGFGRISAQAAKQIIVQKVRDAERARIVDNYRERVGEMVTGTVKKVTRDALIIDLGNNAEAVLPRDQMIGREAFRLADRVRAVLQEIKSE-GRGPQLVLSRTSNEMLVELFRIEVPEIQEELIEIRSCARDPGSRAKIAVKTNDGRIDPVGACVGMRGSRVQAVSNELGNERVDIILWDDNPAQLVINAMAPAEVASIVMDED-----TNTMEVAVAEDNLAIAIGRNGQNVRLAADLTGWIINVMTEDEA 354
>gi|167471941|ref|ZP_02336645.1| N utilization substance protein A [Rickettsia africae ESF-5] (503 aa)
Score = 367, Expect = 8.4e-33, Identities = 110/344 (31%), Positives = 192/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL S+LTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQAAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEEALIKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGENFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLVKLFKLEVPEILESIIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASQLTGWNIDIMTEE 348
>gi|157828686|ref|YP_001494928.1| transcription elongation factor NusA [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933405|ref|YP_001650194.1| transcription elongation factor NusA [Rickettsia rickettsii str. Iowa] >gi|157801167|gb|ABV76420.1| transcription elongation factor NusA [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908492|gb|ABY72788.1| N utilization substance protein A [Rickettsia rickettsii str. Iowa] (503 aa)
Score = 367, Expect = 8.4e-33, Identities = 110/344 (31%), Positives = 192/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL S+LTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQAAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEEALIKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGENFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLVKLFKLEVPEILESIIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASQLTGWNIDIMTEE 348
>gi|89900917|ref|YP_523388.1| NusA antitermination factor [Rhodoferax ferrireducens T118] >gi|89345654|gb|ABD69857.1| NusA antitermination factor [Rhodoferax ferrireducens T118] (498 aa)
Score = 366, Expect = 8.7e-33, Identities = 105/344 (30%), Positives = 180/344 (52%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDII 347
           +  L  ++ I++EK+   + +   ++ AL ++  K  P D+DI V +D +  + + F +  VV         D+EI + EA+E     ++ + +   V      R       Q++   + D     +  ++  +  NI    V+++D   + V  G  +G + R+E IP E L+ G     +I EV     +G PIILSR+    +  L + E+ EI  G++EIK  +R VG + K+A+LS    VD +GT VG +G R+  +++ L  ER+D++L+ EDP QF++ A  P  +  + + D+E       + +V  EE+L   IG+ G NVRL S+LTGW I+I+
  S:     3 REMLMLVEAISREKNVELDVVFGAVEAALAQATRKIYPGDVDIRVALDRDSGNYETFRRWHVVPDEAGLQLPDQEILLFEAKEQIPDIEVDEYIEETVESLPIGRIGAMAAKQVILQKIRDAEREMLLNDFMSRGDNIFVGTVKRMDKGDLIVESGRVEGRLRRTEMIPKENLRVGDRVRAMIMEV-DLTLRGAPIILSRSAPEFMIELFRQEVPEIEQGLLEIKSCARDVGSRAKIAVLSHDKRVDPIGTCVGVRGTRVNGVTNELAGERVDIVLWSEDPAQFVIGALAPANVSSI-VVDEE----RHAMDVVVDEENLAIAIGRGGQNVRLASELTGWKINIL 341
>gi|120612038|ref|YP_971716.1| NusA antitermination factor [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590502|gb|ABM33942.1| NusA antitermination factor [Acidovorax avenae subsp. citrulli AAC00-1] (494 aa)
Score = 366, Expect = 8.9e-33, Identities = 104/361 (28%), Positives = 185/361 (51%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQ 364
           +  L  ++ I++EK+  ++ +   ++ AL ++  K  P ++DI V +D +  + + F + +VV       + D E  + +AQE     ++G+ +   +      R       Q++   + D     +  ++  +   I    V+++D   + V  G  +G + RSE IP E L+ G     +I EV     +G PIILSR+    +  L + E+ EI  G++EIK  +R  G + K+A+LS    VD +GT VG +G R+  +++ L  ER+D++L+ EDP QF++ A  P  +  + + D+E       + +V  EE+L   IG+ G NVRL S LTGW I+I+    + + +    D S+
  S:     3 RELLMLVEAISREKNVERDVVFGAVELALAQATKKLYPGEVDIRVAIDRDSGNYETFRRWLVVPDDAGLQNPDAEELLMDAQERIADIEVGEYIEEGIESLPIGRIGAMAAKQVILQKIRDAEREMLLNDFMSRGEKIFTGTVKRMDKGDIIVESGRVEGRLRRSEMIPKENLRNGDRVRAMIMEV-DLTLRGAPIILSRSAPEFMIELFRNEVPEIEQGLLEIKSCARDPGSRAKIAVLSHDKRVDPIGTCVGVRGTRVNAVTNELAGERVDIVLWSEDPAQFVIGALAPANVSSI-VVDEE----KHAMDVVVDEENLAIAIGRGGQNVRLASDLTGWKINIMDAAESAQKQANETDASR 358
>gi|52425500|ref|YP_088637.1| transcription elongation factor NusA [Mannheimia succiniciproducens MBEL55E] >gi|52307552|gb|AAU38052.1| NusA protein [Mannheimia succiniciproducens MBEL55E] (501 aa)
Score = 366, Expect = 9.1e-33, Identities = 103/358 (28%), Positives = 199/358 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTK-------GVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFED 361
           K  L   + ++ EK   +E I   L++A+  S  K+   ++D+ V ++        F + +VVD+    ++  KEI +  AQ      +LGD V  +++   F+R       Q+++  + +   +KV E+++ + G I+   V+KV    + ++L   K        V+ R + +P E  +PG     ++ +V + ++KG  + ++RA   +L  L + E+ EI + +IEIK  SR  G + K+A+ S    +D VG  VG +G R++ I++ L  ER+D++L+D++P QF++NA  P  +  + + +D     +  + I   +E+L + IG+NG NVRL ++LTGW++++++ +  ++ K + ED
  S:     3 KEILLAAEAVSNEKLLPREKIFEALESAIALSTKKKYEQEIDVRVAINQKTGEFDTFRRWLVVDEV---VNPTKEITLEAAQFEDPDIQLGDYVEDQIDSVAFDRITMQTARQVISTKIREAERNKVVEQFRSEEGKIVTGTVKKVTRDSIILDLTGNKEDPAKAEAVITREDMLPRENFRPGDRVRGVLYKV-NPESKGAQLFVTRAKPVMLEELFRLEVPEIGEELIEIKGASRDAGLRAKIAVKSNDKRIDPVGACVGMRGSRVQAITNELGGERVDIVLWDDNPAQFVINAMAPADVNSIVVDED-----NHSMDIAVEQENLAQAIGRNGQNVRLATQLTGWTLNVMTTE-ELQQKHQAED 358
>gi|81300831|ref|YP_401039.1| transcription elongation factor NusA [Synechococcus elongatus PCC 7942] >gi|81169712|gb|ABB58052.1| NusA antitermination factor [Synechococcus elongatus PCC 7942] (441 aa)
Score = 366, Expect = 9.2e-33, Identities = 111/357 (31%), Positives = 199/357 (55%)
  Q:    13 IAKEKDTSKENIVNILKTALEKSY------------LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKG------VVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKI-EFEDVSQLVSSK 369
           I+++K      I   LK AL K Y             +E+   +I+V +D+ +E  ++   + +V++ E+    D +I +++ QE+    + G+ V  +V  DK  F R       Q+L+  L D     + EE++D    ++ A+V + + + V + + S  G       + R EQ+P +  +   ++   +KEV     +G  +I+SRA+ GL+ YL + E+ EI DG++ I  +       +R VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P ++  V + D    P  +I  ++  ++ L   IGK G NVRL ++LTGW IDI  + +A+ D + E + +S+L+  +
  S:    16 ISEQKKLPANVIEEALKEALLKGYERYRRTQQMGEQFEEDYFDNIDVELDVEQEGFRVLATKTIVNQVENP---DHQIALADVQEVAPDAQAGEIVVLDVTPDKDDFGRMAAIQTKQVLSQKLRDHQRKLIQEEFQDLEDPVLMAKVLRFERQSVILGVSSGLGRPEVEAELPRREQLPNDNYRANATFRVFLKEVSEVPRRGPQLIVSRANAGLVVYLFENEVPEIQDGVVRIVAVAREANPPTRHVGPRTKIAVDTLEREVDPVGACIGARGSRIQVVVNELRGEKIDVIRWSPDPATYIANALSPARVQEVRLVD----PEGRIAHVLVNDDQLSLAIGKEGQNVRLAARLTGWKIDI--KDVALYDAVTEGQRISELIQER 391
>gi|34581537|ref|ZP_00143017.1| N utilization substance protein A [Rickettsia sibirica 246] >gi|28262922|gb|EAA26426.1| N utilization substance protein A [Rickettsia sibirica 246] (503 aa)
Score = 366, Expect = 9.5e-33, Identities = 110/344 (31%), Positives = 192/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL S+LTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQAAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEEALIKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGENFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLIKLFKLEVPEILESIIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASQLTGWNIDIMTEE 348
>gi|160892797|ref|ZP_02073587.1| hypothetical protein CLOL250_00328 [Clostridium sp. L2-50] >gi|156865838|gb|EDO59269.1| hypothetical protein CLOL250_00328 [Clostridium sp. L2-50] (393 aa)
Score = 366, Expect = 9.9e-33, Identities = 109/352 (30%), Positives = 192/352 (54%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           +   +E L+++ KEK+ SK+ +++ ++ +L+ +  K+ + D +I+VV+D       ++ K+ VV++ E       +I++ +A+ +   Y LGD ++ E+    F R        ++   +N+     +Y+ +  K  +II   V++     + V+L   T+ ++  SE +PGE    G      + EVK + ++G  I +SR    L++ L + E++EI+DG +EIK   R  G ++K+A+ S    VD VG  VG  G R+  +   LN E+ID+I +DE+P  F+ NA  P +++ V++  +E     K   +V P+  L   IGK G N RL +KLTG+ IDI SE  A E
  S:     1 MSEIIEALNQLEKEKNISKDILLDAIERSLKAACKKDFDTDENIDVVMDRETGEFHVYAKKEVVEEVERPA---TQISLEKAKMMNSKYDLGDIINIEITTKDFGRIAAQRARNVIVQAINESERDAIYDHFYTKEKDIITGIVQRYVGNNINVSLDDKTEAILKESEMVPGEVYNRGDRIKLYVTEVK-KGSRGPKITVSRTHPDLVKRLFEKEVTEIADGTVEIKSSCREAGSRSKIAVYSHDENVDPVGACVGVNGSRVNNVVEDLNGEKIDIICWDENPAIFIKNALSPSEVIAVDVDLNE-----KSAFVVVPDYQLSLAIGKKGQNARLAAKLTGYKIDIKSESQAEE 345
>gi|119898399|ref|YP_933612.1| transcription elongation factor NusA [Azoarcus sp. BH72] >gi|119670812|emb|CAL94725.1| putative N utilization substance protein A [Azoarcus sp. BH72] (491 aa)
Score = 366, Expect = 9.9e-33, Identities = 101/345 (29%), Positives = 191/345 (55%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSY-LFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           +D +A+EK+ +K+ +   L++AL  +  K  + + D+ V +D      + F +R +V   E+  +D+ E+ I +A+EL    +LG+ +   +    F R       Q++   + D    +V  ++ D+   ++   +++++     + +G  + V+ R +QIP E L+ G     FL+K    +  +G  +ILSR     L  L + E+ EI DG++EIK  +R  G + K+A+ S    +D +GT VG +G R+  + + +  E+ID+I++  DP QF++ A  P ++V + + D+E    +  + +V  E +L   IG+NG NV+L S+LTGW+I+++SE+ + E
  S:     9 VDALAREKNVAKDIVFGALESALASATKKRIHDEADVRVSIDRETGDYESF-RRWIVMPDEEVTNDEAEMGIIDARELDSKIQLGEYIEEPLEPIDFGRIGAQAAKQVILQRIRDAEREQVLNDFLDRKEFLVSGSIKRMERGNAIIEVGRLEAVLPRDQQIPRENLRVGDRVKAFLLK--IDRGARGPQLILSRTAPEFLMKLFELEVPEIEDGLLEIKACARDPGLRAKIAVKSNDQRIDPIGTCVGLRGSRVTAVRNEIGGEQIDIIVWAADPAQFVIAALQPAEVVSI-VVDEE----AHAMDVVVDESNLAIAIGRNGQNVKLASELTGWTINLMSEQESAE 347
>gi|77457005|ref|YP_346510.1| transcription elongation factor NusA [Pseudomonas fluorescens PfO-1] >gi|77381008|gb|ABA72521.1| NusA antitermination factor [Pseudomonas fluorescens PfO-1] (493 aa)
Score = 366, Expect = 1.0e-32, Identities = 101/346 (29%), Positives = 191/346 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPD-LDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDK-EINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  ++ ++ EK      I   L+ AL  +  K   D +D+ V ++ +  S + F +  VV+  E+++DD   E   S+  E     K+GD V  ++   +F R       Q++   + +   ++V + +++++G II   V+KV    V V+LG+    +L R + I  E  + G     L+KE++++  +G  +ILSR    +L  L + E+ EI++G+IE+   SR  G + K+A+ S+   +D  G  +G +G R++ +S  L  ER+D++L+D++P QF++NA  P ++  + + +D     +  + I    ++L + IG+ G NVRL S+LTGW++++++E
  S:     3 KEVLLVVESVSNEKGVPASVIFEALELALATATKKRFEDEVDLRVEINRHTGSYETFRRWTVVE--ENDLDDPAIETWPSKVAETHPGAKVGDVVEEKIESIEFGRIAAQTAKQVIVQKVREAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVRLRALLKEIRTEN-RGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAVRSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIVDED-----AHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTE 343
>gi|25010487|ref|NP_734882.1| transcription elongation factor NusA [Streptococcus agalactiae NEM316] >gi|76788260|ref|YP_329098.1| transcription elongation factor NusA [Streptococcus agalactiae A909] >gi|161485616|ref|NP_687412.2| transcription elongation factor NusA [Streptococcus agalactiae 2603V/R] >gi|23094840|emb|CAD46058.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563317|gb|ABA45901.1| transcription termination factor NusA [Streptococcus agalactiae A909] (383 aa)
Score = 366, Expect = 1.1e-32, Identities = 121/361 (33%), Positives = 197/361 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLN--KESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS----EKLAIEDKIEFEDVSQ 364
           K  LE    + +EK  +KE+I++ +  +L+ +Y K         V++ N  K    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E ++ +F R       Q +   +        + E+K   G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S    VDA+GT VG  G  IKK+ S  + +R              IDVI + EDP +F+ NA  P + V + + DDED   +K  T+V P+  L   IG+ G NVRL + LTG+ IDI S    EK+  ++ ++ E+V+Q
  S:     3 KEMLEAFRILEEEKHINKEDIIDAVTESLKSAY-KRRYGQSESCVIEFNEKKADFTVYTVREVVDEV---FDSRLEISLKDALAISSAYELGDKIRFEESVTEFGRVAAQSAKQTIMEKMRRQMREVTFNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGESFKSHDMIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEREIPEVFDGTVEIMSVSREAGDRTKVAVRSHNSNVDAIGTIVGRGGSNIKKVISNFHPKRVDAKTGLEIPVEENIDVIQWVEDPAEFIYNAIAPAE-VDMVLFDDED---TKRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEYEKMEAQE-LQTEEVAQ 373
>gi|73541717|ref|YP_296237.1| transcription elongation factor NusA [Ralstonia eutropha JMP134] >gi|72119130|gb|AAZ61393.1| Transcription termination factor NusA:Transcription termination factor NusA, C-terminal duplication [Ralstonia eutropha JMP134] (491 aa)
Score = 366, Expect = 1.1e-32, Identities = 100/352 (28%), Positives = 187/352 (53%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFED 361
           +D +A+EK+  K+ +   L+ AL  +  K    D+DI V +D      + F + +VV   +   + DK+I + EA++   S +LGD V  ++   +F R       Q++   + D    ++  ++ ++   I+   V++ D + + V  G  + ++ R + IP E L+ G      I  V  +  +G  I LSR     L  L + E+ E+  G++EIK  +R  G + K+A+++    +D +GT VG +G R+  + + +  E +D++L+ EDP QF++ A  P ++  + + D+E       + +V  EE+L   IG++G NVRL S+LTGW I+I++++ + + + E  D
  S:     9 VDALAREKNVDKDVVFGALEAALASATKKRFEEDVDIRVAIDRESGEHETFRRWLVVPDEQGLQEPDKQILLFEARDDDASLELGDYVEQQIESVEFGRIGAQAAKQVILQRIRDAEREQILNDYLERGEKIMTGTVKRADKKGLIVESGRVEALLARDQIIPKENLRTGDRVRAYILNV-DRAARGPQIELSRTAPEFLIKLFENEVPEMEQGLLEIKAAARDPGVRAKIAVVAHDKRIDPIGTCVGVRGTRVTAVRNEIGGEAVDIVLWSEDPAQFVIGALAPAQVQSI-VVDEE----KHCMDVVVDEENLAVAIGRSGQNVRLASELTGWQINIMTQEESAQKQAEESD 355
>gi|77414451|ref|ZP_00790602.1| transcription termination factor NusA [Streptococcus agalactiae 515] >gi|77159496|gb|EAO70656.1| transcription termination factor NusA [Streptococcus agalactiae 515] (381 aa)
Score = 366, Expect = 1.1e-32, Identities = 120/358 (33%), Positives = 196/358 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLN--KESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS----EKLAIEDKIEFEDVSQ 364
           LE    + +EK  +KE+I++ +  +L+ +Y K         V++ N  K    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E ++ +F R       Q +   +        + E+K   G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S    VDA+GT VG  G  IKK+ S  + +R              IDVI + EDP +F+ NA  P + V + + DDED   +K  T+V P+  L   IG+ G NVRL + LTG+ IDI S    EK+  ++ ++ E+V+Q
  S:     2 LEAFRILEEEKHINKEDIIDAVTESLKSAY-KRRYGQSESCVIEFNEKKADFTVYTVREVVDEV---FDSRLEISLKDALAISSAYELGDKIRFEESVTEFGRVAAQSAKQTIMEKMRRQMREVTFNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGESFKSHDMIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEREIPEVFDGTVEIMSVSREAGDRTKVAVRSHNSNVDAIGTIVGRGGSNIKKVISNFHPKRVDAKTGLEIPVEENIDVIQWVEDPAEFIYNAIAPAE-VDMVLFDDED---TKRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEYEKMEAQE-LQTEEVAQ 369
>gi|163752374|ref|ZP_02159569.1| transcription elongation factor NusA [Shewanella benthica KT99] >gi|161327746|gb|EDP98933.1| transcription elongation factor NusA [Shewanella benthica KT99] (499 aa)
Score = 365, Expect = 1.2e-32, Identities = 99/345 (28%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN-PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQ-IPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L   + ++ EK   +E I   L+ AL  +  K++  ++++ V +D    + + F +  VV+ + + +++   EI +  AQ      ++GD V  ++    F+R  T    Q++   + +   ++V E +KD+ G +I   V+K +   V V+LG     VL  E  I  E  +PG     L+  V+ +  +G  + ++R    +L  L + E+ EI+D +IEI   +R  G + K+A+ S    +D +G  VG +G R++ +S+ LN ER+D++L+D++P QF++NA  P ++  + + +D     S  + I    +SL + IG+NG NVRL ++L+GW +++++
  S:     3 KEILLVAEAVSNEKGVPREKIFEALEIALATATKKKHVGEIEVRVEIDRKTGAYETFRRWQVVEDTGEPLENPYGEITLEAAQYEDPELQVGDYVEDDMESVTFDRITTQTAKQVIVQKVREAERAQVVELFKDREGELITGIVKKSNRESVVVDLGGNADAVLFKEDLISRENFRPGDRIRALLFSVRPE-ARGAQLFMTRTKSEMLIELFRIEVPEIADEMIEIMGAARDPGSRAKIAVKSNDRRIDPIGACVGMRGARVQAVSNELNGERVDIVLWDDNPAQFVINAMAPAEVASIVVDED-----SHSMDIAVEADSLAQAIGRNGQNVRLAAQLSGWELNVMT 344
>gi|149909281|ref|ZP_01897937.1| N utilization substance protein A [Moritella sp. PE36] >gi|149807598|gb|EDM67546.1| N utilization substance protein A [Moritella sp. PE36] (499 aa)
Score = 365, Expect = 1.2e-32, Identities = 95/345 (27%), Positives = 190/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDD-KEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  +D ++ EK   +E I   ++ AL  +  K    D+++ V +D    + + F + +V+D   + +++   EI +  A+   ++ ++G  +   ++   F+R  T    Q++   + +     + + +    G +I   V++ +   V ++LG+  + V+ R E +P E  + G     L+KEVK +  +G  + +SRA   +L  L + E+ E ++ ++E+K  +R  G + K+A+ S    +D VG  VG +G R++ +S+ LN ER+D+IL+D++P QF++NA  P ++  + + +D+       + I   +E+L + IG+NG NVRL S+LTGW +++++
  S:     3 KEILLVVDAVSNEKALPREKIFEAMEIALATATKKRYEGDIEVRVEIDRKTGNFETFRRWLVIDDKGEPLENPFSEITLDAAKYDDETIEVGGYIEDTIDSVVFDRVTTQTAKQVIIQKVREAERDLIVQHYAKHEGELITGLVKRANRETVVLDLGNNAEAVMFRDEMLPRESFRTGDRIKGLLKEVKPE-ARGTQLFISRACNEMLIELFRIEVPEFNEEMLELKAAARDPGSRAKIAVKSNDKRIDPVGACVGMRGARVQAVSNELNGERVDIILWDDNPAQFVINAMAPAEVASIIVDEDQ-----HSMDIAVEQENLAQAIGRNGQNVRLASQLTGWELNVMT 344
>gi|149002224|ref|ZP_01827166.1| transcription elongation factor NusA [Streptococcus pneumoniae SP14-BS69] >gi|168485664|ref|ZP_02710172.1| transcription termination factor NusA [Streptococcus pneumoniae CDC1087-00] >gi|147759539|gb|EDK66530.1| transcription elongation factor NusA [Streptococcus pneumoniae SP14-BS69] >gi|183571232|gb|EDT91760.1| transcription termination factor NusA [Streptococcus pneumoniae CDC1087-00] (378 aa)
Score = 365, Expect = 1.3e-32, Identities = 119/357 (33%), Positives = 190/357 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI--ISEKLAIEDKIEFE 360
           K  LE    + ++K   KE+I++ +  +L  +Y +     D  V +D N+++    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E    +F R       Q +   +   + +  Y  +K+    I+   VE+ DNR + VNLGS +  + + +QIPGE           + +V+    +G  + +SR+   +++ L++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG  G  IKKI+S  +               E IDVI +  DP +F+ NA  P ++  V I D+ D   SK   +V P+  L   IG+ G NVRL + LTG+ IDI   SE  A+ED    E
  S:     3 KEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSD-SVAIDFNEKTGDFTVYTVREVVDEV---FDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDN-PRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQV-IFDESD---SKRALVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVE 368
>gi|157964683|ref|YP_001499507.1| transcription elongation factor NusA [Rickettsia massiliae MTU5] >gi|157844459|gb|ABV84960.1| N utilization substance protein A, transcription termination factor NusA [Rickettsia massiliae MTU5] (503 aa)
Score = 365, Expect = 1.4e-32, Identities = 110/344 (31%), Positives = 192/344 (55%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ EA       K+GD +   +      R       Q++T  + +    K Y ++KD+ G II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VNA  P  +   EIT    DED      V +V  +E+    IG+ G NVRL S+LTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQAAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEEALIKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGENFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLVKLFKLEVPEILEAIIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNALAP--LAPGEITKILIDED---RHKVEVVVSQENQSIAIGRRGQNVRLASQLTGWNIDIMTEE 348
>gi|153207276|ref|ZP_01946040.1| transcription termination factor NusA [Coxiella burnetii 'MSU Goat Q177'] >gi|154706434|ref|YP_001423972.1| transcription elongation factor NusA [Coxiella burnetii Dugway 5J108-111] >gi|165918786|ref|ZP_02218872.1| transcription termination factor NusA [Coxiella burnetii RSA 334] >gi|120576764|gb|EAX33388.1| transcription termination factor NusA [Coxiella burnetii 'MSU Goat Q177'] >gi|154355720|gb|ABS77182.1| transcription termination factor NusA [Coxiella burnetii Dugway 5J108-111] >gi|165917510|gb|EDR36114.1| transcription termination factor NusA [Coxiella burnetii RSA 334] (503 aa)
Score = 365, Expect = 1.4e-32, Identities = 96/346 (27%), Positives = 188/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEID-DDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  +D ++ E+  SKE I   ++ AL     K  E  D+ I V +D      + F    VV+ + + ++  ++E+ + +A+E+    ++GD +   V   KF R       Q++   + +   +K+  +++ +VG ++   V++V    + +++G + + ++LR E IP E  +        +  V   + +G  +++SR     L  L K E+ EI + +IEIK  +R  G + K+A+ +    +D +G  VG +G R++ +S+ L  ERID++L+D++P Q ++NA  P ++  + + +D     S  + I   ++ L + IG++G NVRL S+LTGW+++++SE
  S:     3 KDILLIVDSMSNERGVSKEVIFEAIEAALAAVTAKRYEEDDVKIRVAIDQKTGDYESFRCWTVVEDTNESLEFPNQEMTLKQAREIDSDLEVGDVIEEPVESVKFGRIAAQQAKQVIVQKVREAERAKIIRQYEKRVGELVIGVVKRVTRESIILDMGENAEALLLREEMIPREAFRINDRLRAYLYSVCQDKKRGPQLLVSRTRPEFLVELFKIEVPEIGEEVIEIKGAARDPGSRAKIAVKTNDGRIDPIGACVGMRGSRVQAVSNELGGERIDIVLWDDNPAQLVINAMAPAEVASIVVDED-----SHTMDIAVNKDQLSQAIGRSGQNVRLASELTGWTLNVMSE 347
>gi|15900465|ref|NP_345069.1| transcription elongation factor NusA [Streptococcus pneumoniae TIGR4] >gi|111657275|ref|ZP_01408041.1| hypothetical protein SpneT_02001513 [Streptococcus pneumoniae TIGR4] >gi|148983931|ref|ZP_01817250.1| transcription elongation factor NusA [Streptococcus pneumoniae SP3-BS71] >gi|148990071|ref|ZP_01821325.1| transcription elongation factor NusA [Streptococcus pneumoniae SP6-BS73] >gi|148992337|ref|ZP_01822060.1| transcription elongation factor NusA [Streptococcus pneumoniae SP9-BS68] >gi|148998226|ref|ZP_01825695.1| transcription elongation factor NusA [Streptococcus pneumoniae SP11-BS70] >gi|149005663|ref|ZP_01829402.1| transcription elongation factor NusA [Streptococcus pneumoniae SP18-BS74] >gi|149012573|ref|ZP_01833570.1| transcription elongation factor NusA [Streptococcus pneumoniae SP19-BS75] >gi|149021508|ref|ZP_01835563.1| transcription elongation factor NusA [Streptococcus pneumoniae SP23-BS72] >gi|168482793|ref|ZP_02707745.1| transcription termination factor NusA [Streptococcus pneumoniae CDC1873-00] >gi|168488244|ref|ZP_02712443.1| transcription termination factor NusA [Streptococcus pneumoniae SP195] >gi|168490557|ref|ZP_02714700.1| transcription termination factor NusA [Streptococcus pneumoniae CDC0288-04] >gi|168576545|ref|ZP_02722419.1| transcription termination factor NusA [Streptococcus pneumoniae MLV-016] >gi|169834095|ref|YP_001694040.1| transcription termination factor NusA [Streptococcus pneumoniae Hungary19A-6] >gi|182683486|ref|YP_001835233.1| transcription elongation factor NusA [Streptococcus pneumoniae CGSP14] >gi|14972027|gb|AAK74709.1| N utilization substance protein A [Streptococcus pneumoniae TIGR4] >gi|147755869|gb|EDK62913.1| transcription elongation factor NusA [Streptococcus pneumoniae SP11-BS70] >gi|147762603|gb|EDK69563.1| transcription elongation factor NusA [Streptococcus pneumoniae SP18-BS74] >gi|147763378|gb|EDK70315.1| transcription elongation factor NusA [Streptococcus pneumoniae SP19-BS75] >gi|147924078|gb|EDK75190.1| transcription elongation factor NusA [Streptococcus pneumoniae SP3-BS71] >gi|147924597|gb|EDK75684.1| transcription elongation factor NusA [Streptococcus pneumoniae SP6-BS73] >gi|147928963|gb|EDK79975.1| transcription elongation factor NusA [Streptococcus pneumoniae SP9-BS68] >gi|147930204|gb|EDK81189.1| transcription elongation factor NusA [Streptococcus pneumoniae SP23-BS72] >gi|168996597|gb|ACA37209.1| transcription termination factor NusA [Streptococcus pneumoniae Hungary19A-6] >gi|172043571|gb|EDT51617.1| transcription termination factor NusA [Streptococcus pneumoniae CDC1873-00] >gi|182628820|gb|ACB89768.1| transcription elongation factor NusA [Streptococcus pneumoniae CGSP14] >gi|183573000|gb|EDT93528.1| transcription termination factor NusA [Streptococcus pneumoniae SP195] >gi|183574829|gb|EDT95357.1| transcription termination factor NusA [Streptococcus pneumoniae CDC0288-04] >gi|183577711|gb|EDT98239.1| transcription termination factor NusA [Streptococcus pneumoniae MLV-016] (378 aa)
Score = 365, Expect = 1.4e-32, Identities = 119/357 (33%), Positives = 190/357 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI--ISEKLAIEDKIEFE 360
           K  LE    + ++K   KE+I++ +  +L  +Y +     D  V +D N+++    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E    +F R       Q +   +   + +  Y  +K+    I+   VE+ DNR + VNLGS +  + + +QIPGE           + +V+    +G  + +SR+   +++ L++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG  G  IKKI+S  +               E IDVI +  DP +F+ NA  P ++  V I D+ D   SK   +V P+  L   IG+ G NVRL + LTG+ IDI   SE  A+ED    E
  S:     3 KEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSD-SVAIDFNEKTGDFTVYTVREVVDEV---FDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDN-PRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQV-IFDEND---SKRALVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVE 368
>gi|115372730|ref|ZP_01460036.1| NusA protein [Stigmatella aurantiaca DW4/3-1] >gi|115370211|gb|EAU69140.1| NusA protein [Stigmatella aurantiaca DW4/3-1] (565 aa)
Score = 364, Expect = 1.5e-32, Identities = 106/340 (31%), Positives = 187/340 (55%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEV---------------------NIDKFER---RITSHFA-QILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           LD++AK+K   +  ++  L+ A++ +  K    D ++E   D+ K  ++LF+   VV++  D +    +I ++EA +     + GD +  ++                      +  F R   RI +  A Q++     D     V+ E+KD+   I+     + +   + V+LG  + V+   EQ+P E  +PG      + +V  +++KG  I+LSRA   LL  L + E+ EI++GI+ I+  +R  G + K+A+ SR   VD VG  VG KG R++ +   L  E+ID++ +DEDP  F+ +A  P ++  V I +      +  + ++ P++ L   IG+ G NVRL ++LTGW +DI SE
  S:    15 LDQVAKDKGIERSVLIATLEDAMKTAAKKHFGQDRNLEAKYDVEKGVVELFQAITVVEEIVDPVQAVNQITMAEAHKKGMEVEPGDELVFQIMYRDEDAAEAKAQDDQYGDILRLKTFRRGFGRIAAQTAKQVILQRTRDAERENVFNEYKDRKNEIVTGIARRFERGNIIVDLGRAEAVLPVREQVPRETYRPGDRVQAYVLDVL-RESKGPQIVLSRASVNLLTKLFEMEVPEIAEGIVVIEAAAREPGGRAKIAVSSRDSDVDPVGACVGMKGSRVQAVVQELRGEKIDIVPFDEDPASFVCSALAPAEVSRVIIDE-----ANHAMELIVPDDQLSLAIGRRGQNVRLAAQLTGWKLDINSE 374
>gi|29654724|ref|NP_820416.1| transcription termination factor NusA [Coxiella burnetii RSA 493] >gi|81628742|sp|Q83BS0|NUSA_COXBU Transcription elongation protein nusA >gi|29541992|gb|AAO90930.1| N utilization substance protein A [Coxiella burnetii RSA 493] (503 aa)
Score = 364, Expect = 1.5e-32, Identities = 96/346 (27%), Positives = 188/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEID-DDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  +D ++ E+  SKE I   ++ AL     K  E  D+ I V +D      + F    VV+ + + ++  ++E+ + +A+E+    ++GD +   V   KF R       Q++   + +   +K+  +++ +VG ++   V++V    + +++G + + ++LR E IP E  +        +  V   + +G  +++SR     L  L K E+ EI + +IEIK  +R  G + K+A+ +    +D +G  VG +G R++ +S+ L  ERID++L+D++P Q ++NA  P ++  + + +D     S  + I   ++ L + IG++G NVRL S+LTGW+++++SE
  S:     3 KDILLIVDSMSNERGVSKEVIFEAIEAALAAVTAKRYEEDDVKIRVAIDQKTGDYESFRCWTVVEDTNESLEFPNQEMTLKQAREIDSDLEVGDVIEEPVESVKFGRIAVQQAKQVIVQKVREAERAKIIRQYEKRVGELVIGVVKRVTRESIILDMGENAEALLLREEMIPREAFRINDRLRAYLYSVCQDKKRGPQLLVSRTRPEFLVELFKIEVPEIGEEVIEIKGAARDPGSRAKIAVKTNDGRIDPIGACVGMRGSRVQAVSNELGGERIDIVLWDDNPAQLVINAMAPAEVASIVVDED-----SHTMDIAVNKDQLSQAIGRSGQNVRLASELTGWTLNVMSE 347
>gi|116515364|ref|YP_815985.1| transcription elongation factor NusA [Streptococcus pneumoniae D39] >gi|116075940|gb|ABJ53660.1| transcription termination factor NusA [Streptococcus pneumoniae D39] (378 aa)
Score = 364, Expect = 1.5e-32, Identities = 119/357 (33%), Positives = 190/357 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI--ISEKLAIEDKIEFE 360
           K  LE    + ++K   KE+I++ +  +L  +Y +     D  V +D N+++    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E    +F R       Q +   +   + +  Y  +K+    I+   VE+ DNR + VNLGS +  + + +QIPGE           + +V+    +G  + +SR+   +++ L++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG  G  IKKI+S  +               E IDVI +  DP +F+ NA  P ++  V I D+ D   SK   +V P+  L   IG+ G NVRL + LTG+ IDI   SE  A+ED    E
  S:     3 KEMLEAFRILEEDKRIKKEDIIDAVVESLRSAYRRRYGQSD-SVAIDFNEKTGDFTVYTVREVVDEV---FDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDN-PRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQV-IFDESD---SKRALVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVE 368
>gi|187251076|ref|YP_001875558.1| NusA antitermination factor [Elusimicrobium minutum Pei191] >gi|186971236|gb|ACC98221.1| NusA antitermination factor [Elusimicrobium minutum Pei191] (463 aa)
Score = 364, Expect = 1.6e-32, Identities = 111/352 (31%), Positives = 191/352 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQ------------------------TKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           K  +  L+ + +EK+  +++I+  ++ AL  S L++N     ++   +N E   IK F+   V++  E   + + EI++ +A+ +    ++G T++  + ++ F R       Q+L   +  I     Y+E+K + G +I   V +  +R + V+LG  + ++  SEQI  E    G     +I +V SQQ                         +G  +ILSR     L  L K E+ EI +GI+EIK I R  G++ KV + S    VD +GT VG +G RI+ I + L+ ERID+I Y ED    ++N+  P +   V+I   E+    K   I+ P++ L   IGK+  N++L SKLTGW +++ SE   +++
  S:     6 KELMMALESLEREKNIKRDDIIKTIEDAL-VSALRKNLGKTAQISAKINPEEGDIKAFQ---VLNIVEIVANPEMEISLEQAKAMDDRSEVGGTITNVLEVEDFSRIAAQIAKQVLIQKVRGIERENTYKEFKPREGEVITGSVRRFSDRDIVVDLGKVEAILPYSEQIKRERYSNGSRIKAIITKVLSQQDLLTIGEDPVLGRYKSAAFKMDKGQRGPYVILSRTSPAFLEDLFKVEVPEIGEGIVEIKAIQRDPGFRAKVVVRSYDNKVDPIGTCVGMRGIRIRAIMNELSGERIDLIPYSEDVTTMIMNSIAPARANSVKIISAEE----KKALIIVPDDQLAIAIGKDWQNIKLASKLTGWELEVKSESQKLQE 375
>gi|126664888|ref|ZP_01735872.1| transcription elongation factor NusA [Marinobacter sp. ELB17] >gi|126631214|gb|EBA01828.1| transcription elongation factor NusA [Marinobacter sp. ELB17] (497 aa)
Score = 364, Expect = 1.6e-32, Identities = 100/351 (28%), Positives = 190/351 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDD-DKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVL-RSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           K  L  ++ ++ EK   K+ I   ++ AL  +  K  ++ D DI V +D        F + +VVD   D +     E+   EA+++    + GD     ++   F R       QI+   + +   +K+ + ++ +VG ++   V+KV    V V+LG+    +L R   I  E  + G     L+ E+++   +G  +ILSR+D  +L  L + E+ EI++ +IEI+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ LN ER+D++L+D++P Q ++NA  P ++  + + +D        + +    ++L + IG+NG NVRL ++LTGW++++++E+ A E
  S:     3 KEILLVVESVSNEKGVEKDVIFEAIELALATAAKKRFDDEDADIRVSIDRRTGEYDTFRRWLVVDN--DAVPALGTELTFQEAEDISPDLQPGDMHEERIDSVAFGRIGAQAAKQIIFQKVREAERTKIVDSYRGRVGELVSGTVKKVTRDNVIVDLGNNAEALLPREHLIARETFRMGDRVRSLLLEIRTDH-RGPQLILSRSDSKMLIELFRIEVPEIAEELIEIRGAARDPGSRAKIAVKTNDRRIDPVGACVGMRGSRVQAVSNELNGERVDIVLWDDNPAQLVINAMAPAEVASIVMDEDR-----HTMDVAVAADNLAQAIGRNGQNVRLATELTGWTLNVMTEEEAGE 349
>gi|114321098|ref|YP_742781.1| transcription elongation factor NusA [Alkalilimnicola ehrlichei MLHE-1] >gi|114227492|gb|ABI57291.1| NusA antitermination factor [Alkalilimnicola ehrlichei MLHE-1] (498 aa)
Score = 364, Expect = 1.7e-32, Identities = 102/366 (27%), Positives = 194/366 (53%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENP-DLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS-EKLAIEDKIEFEDVSQLVSSK 369
           K  L  ++  + EK   +E I   ++ AL  +  K +P D+D  V V+ N      F +  VV+  ED     ++I + EA++ +   ++G+ +   +   +F R       Q++   + +   +KV E ++D++G ++   V++++   V ++LG + + ++ R   IP E ++        +K+V+ +  +G  + +SR     L  L K E+ E+   +IEI   +R  G + K+A+ +  P +D VG  VG +G R++ +S+ L  ERID+IL+D++P QF++NA  P ++  + + +D        + I   EE L + IG+ G NVRL S+LTGW +++++ E+   +++ E     QL   K
  S:     3 KEILLVVEATSNEKGVDREVIFEAIEAALASATRKRHPEDIDARVEVNRNTGDYSTFRRWWVVESDEDVESPARQITLEEARQRQPDIEVGECLEEPMESVEFGRIAAQTAKQVIVQKVREAERAKVVEAFQDRIGELVTGTVKRLERGSVIMDLGGNAEALIPREAMIPREAVRREDRLRGYLKDVRPE-PRGPQLFVSRTAPEFLVELFKLEVPEVGQELIEIMGAARDPGVRAKIAVRALDPRIDPVGACVGMRGSRVQAVSNELAGERIDIILWDDNPAQFVINALAPAEVESIVVDEDR-----HSMDIAVAEEQLSQAIGRGGQNVRLASELTGWELNVMTAEEAEAKNQEEAAQYQQLFQEK 365
>gi|194398628|ref|YP_002037214.1| transcription termination factor NusA [Streptococcus pneumoniae G54] >gi|194358295|gb|ACF56743.1| transcription termination factor NusA [Streptococcus pneumoniae G54] (378 aa)
Score = 364, Expect = 1.7e-32, Identities = 119/357 (33%), Positives = 189/357 (52%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI--ISEKLAIEDKIEFE 360
           K  LE    + ++K   KE+I++ +  +L  +Y +     D  V +D N+++    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E    +F R       Q +   +   + +  Y  +K+    I+   VE+ DNR + VNLGS +  + + +QIPGE           + +V+    +G  + +SR+   +++ L++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG  G  IKKI+S  +               E IDVI +  DP +F+ NA  P ++  V I D+ D   SK   +V P   L   IG+ G NVRL + LTG+ IDI   SE  A+ED    E
  S:     3 KEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSD-SVAIDFNEKTGDFTVYTVREVVDEV---FDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDN-PRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQV-IFDEND---SKRALVVVPXNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVE 368
>gi|188532503|ref|YP_001906300.1| Transcription elongation protein NusA (N utilization substance protein A) [Erwinia tasmaniensis] >gi|188027545|emb|CAO95392.1| Transcription elongation protein NusA (N utilization substance protein A) [Erwinia tasmaniensis] (501 aa)
Score = 364, Expect = 1.7e-32, Identities = 100/345 (28%), Positives = 192/345 (55%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEV--NLGST---KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++VD+        +EI +  A    +S+ LG  V  ++    F+R  T    Q++   + +   + V ++++++ G II   V+KV  DN  +EV  N GS+   + V++R + +P E  +PG     ++  V+ +  +G  + +SR+   +L  L + E+ EI++ ++EIK  +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+D++P QF++NA  P  +  + + +D     +  + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKSLPREKIFEALESALATATKKKYEQEIDVRVSIDRKSGDFDTFRRWLIVDEVTQPT---REITLEAALYEDESFSLGGFVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFREQEGEIITGVVKKVSRDNISLEVRPNDGSSTNAEAVIIREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVSRSKPEMLIELFRIEVPEIAEEVLEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDED-----NHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 346
>gi|15604408|ref|NP_220925.1| transcription elongation factor NusA [Rickettsia prowazekii str. Madrid E] >gi|20139314|sp|Q9ZCZ7|NUSA_RICPR Transcription elongation protein nusA >gi|3861102|emb|CAA15002.1| N UTILIZATION SUBSTANCE PROTEIN A (nusA) [Rickettsia prowazekii] (503 aa)
Score = 364, Expect = 1.8e-32, Identities = 110/344 (31%), Positives = 193/344 (56%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITD---DEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
           L+ +D +A+EK  SKE +++ ++ A++ +  K+   + +I+  ++     I L     +V+  ED +    +I++ +A       K+GD +   +      R       Q++T  + +    K Y ++KD+ G+II   V++++   + V+L   + ++ + + I GE  +P       +++V+ Q+TKG  I LSR D  +L  L K E+ EI + II+IK ++R  G K K+A+ +    +D VG+ VG +G R+K +++ LN E+ID++L+  D  QF+VN+  P  +   EIT    DED   S  V +V  +E     IG+ G NVRL SKLTGW+IDI++E+
  S:    10 LQIIDSVAREKGISKEILISTVEQAVQVAGRKKYGNEYNIKAQINRKTGEINLLRILKIVEDVEDYL---TQISLEDALVKNPEAKIGDEIYEYLPPIDHARVSAQAAKQVITQRVIEAEREKQYHDFKDRKGDIINGIVKRIEYGDIIVDLSRAEAIIKKDQLIKGEHFKPNDRIKAYVQDVR-QETKGPQIFLSRVDNQMLVKLFKLEVPEILEDIIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSNDLAQFIVNSLIP--LAPSEITKILIDED---SHKVEVVVSQEHQSIAIGRRGQNVRLASKLTGWNIDIMTEE 348
>gi|167746758|ref|ZP_02418885.1| hypothetical protein ANACAC_01470 [Anaerostipes caccae DSM 14662] >gi|167653718|gb|EDR97847.1| hypothetical protein ANACAC_01470 [Anaerostipes caccae DSM 14662] (391 aa)
Score = 364, Expect = 1.8e-32, Identities = 115/350 (32%), Positives = 192/350 (54%)
  Q:     3 IKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES---IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLA 352
           +   ++ L+++ KEK   K+ I+  ++ +L  +  ++  + D  VVV++++E+   +   EK VV     ++ D   +I++++A+ +   Y+LGD V  E+    F R    H   ++   + +     V++ +  K  +I+   V++     V V+L   T  ++++SEQI GE  QP +     I EVK    +G  I++SR    L++ L + E++EI DGI+EIK I R  G +TK+A+ S  P VD VG  VG  G R+  I + L  E+ID+I ++EDP  ++ NA  P K+V V +  +E     K   +V P+  L   IGK G N RL ++LTG+ IDI SE  A
  S:     1 MSELIDALNQLEKEKHIDKDVIMEAIENSLVAACKRDFGNAD-NVVVNMDRETGDIVVYAEKEVVETADGEDFDPALQISLAKAKAMDPKYELGDIVRVEITPKDFGRIAAMHARSVIVQKIKEEERRVVFDHFYCKEKDIVTGVVQRYVGENVSVSLDDKTDALLMKSEQIRGEVFQPTERIKLYIVEVKDTN-RGPRILVSRTHPDLVKRLFEKEVAEIQDGIVEIKNIVREAGSRTKLAVWSNDPNVDPVGACVGMNGARVNAIVNDLKGEKIDIINWNEDPCVYIENALSPSKVVSVSVDVEE-----KSAQVVVPDYQLSLAIGKEGQNARLAARLTGYKIDIKSESQA 347
>gi|186685820|ref|YP_001869016.1| NusA antitermination factor [Nostoc punctiforme PCC 73102] >gi|186468272|gb|ACC84073.1| NusA antitermination factor [Nostoc punctiforme PCC 73102] (425 aa)
Score = 364, Expect = 1.9e-32, Identities = 102/315 (32%), Positives = 174/315 (55%)
  Q:    32 LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGV------VLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           LE+    E+   + EV +D++ E  ++   + +V   E+  + D +I++ E Q++    +LGD+V  +V  D+  F R       Q+L   L D     V EE++D  G +++A V + + + V + + S  G       + + EQ+P +  +   ++   +K+V   Q +G  +++SRAD GL+ YL   E+ EI D ++ I  +       SR VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P ++  V + D    P S+   ++  E+ L   IGK G NVRL ++LTGW IDI
  S:    48 LERKQFDEDYFENFEVELDIDGEGFRVLSTKTIV---EEVNNTDHQISLDEVQQVAPEAQLGDSVVLDVTPDQGEFGRMAAMQTKQVLAQKLRDQQRQMVQEEFQDLEGTVLQARVLRFERQSVVLAVSSGFGQPEVEAELPKREQLPNDNYRANATFKVYLKKVSQGQQRGPQLLVSRADAGLVVYLFANEVPEIEDEVVRIVAVAREANPPSRYVGPRTKIAVDTLDRDVDPVGACIGARGSRIQVVVNELRGEKIDVIRWSPDPATYIANALSPARVDEVRLMD----PESRQTHVLVAEDQLSLAIGKEGQNVRLAARLTGWKIDI 370
>gi|90409004|ref|ZP_01217134.1| transcription elongation factor NusA [Psychromonas sp. CNPT3] >gi|90309889|gb|EAS38044.1| transcription elongation factor NusA [Psychromonas sp. CNPT3] (500 aa)
Score = 363, Expect = 2.0e-32, Identities = 93/348 (26%), Positives = 195/348 (56%)
  Q:     1 MKIKSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           M  K  L  ++ ++ EK   +E I   L++AL  +  K+  +++IEV V++++E+   + F + +V+    +  +   E+    A   +   ++G+ +  ++    F+R  T    Q++   + +   ++V E++ ++ G ++   V+++    + ++LG + + V+ R E +P E  +PG     L+ +V+ +  +G  + ++R    +L  L + E+ EI++ +I++   +R  G + K+A+ S    +D +G  VG +G R++ ISS L  ER+D+IL+D++  QF +NA  P ++V + + +D     S  + I   EE+L + IG+NG N+RL S+LTGW +++++
  S:     1 MNNKEILLVVEAVSNEKGLPREAIFEALESALAIA-TKKKYEMEIEVRVEIDRETGTFETFRRWLVLAPDAEMENSCAEMTYEAAVYDQPEIQIGEFIEDDIPSVTFDRITTQTAKQVIVQKVREAERAQVVEQYIEQKGELVTGVVKRMTRDSILLDLGGNAEAVIFRDEMLPRENFRPGDRLRGLLYDVRPE-ARGAQLFMTRTQPEMLIELFRLEVPEIAEEMIDLMAAARDPGSRAKIAVKSNDQRIDPIGACVGMRGARVQAISSELGGERVDIILWDDNSAQFAINAMSPAEVVSIVVDED-----SHSMDIAVEEENLAQAIGRNGQNIRLASQLTGWELNVMT 344
>gi|167764123|ref|ZP_02436250.1| hypothetical protein BACSTE_02506 [Bacteroides stercoris ATCC 43183] >gi|167698239|gb|EDS14818.1| hypothetical protein BACSTE_02506 [Bacteroides stercoris ATCC 43183] (421 aa)
Score = 363, Expect = 2.0e-32, Identities = 112/358 (31%), Positives = 200/358 (55%)
  Q:     5 SFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV-DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           S ++   +  + K+  +  +V++L+ +      K    D + +V+V+ +K   +++  R VV   ED  + + +I++SEA+++  SY++G+ V+ EVN  KF RR   +  Q L   + ++    +Y ++ DKVG II AEV ++    ++ ++    + ++ ++EQIP +  + G++   ++  V ++      IILSR     L+ L + E+ EI+DG+I IK+I+RI G + K+A+ S    +D VG  VG KG RI  I   L NE IDVI Y  + + F+  A  P KI  + + ++E     K    + PEE  +  IGK G+N++L S LT ++ID+  E   +++ +E ED+
  S:     9 SLIDTFSEFKELKNIDRTTMVSVLEESFRSVIAKMFGTDENYDVIVNPDKGDFEIWRNREVV-ADEDLENPNLQISLSEARKIDASYEVGEEVTDEVNFAKFGRRAILNLRQTLASKILELEKDSIYNKYIDKVGTIINAEVYQIWKKEMLLLDDEGNELLLPKTEQIPSDFYRKGETARAVVARVDNKNNNP-KIILSRTSPVFLQRLFEMEVPEINDGLITIKKIARIPGERAKIAVESYDDRIDPVGACVGVKGSRIHGIVRELRNENIDVINYTSNIQLFIQRALSPAKISSIRLNEEE----HKAEVFLKPEEVSLA-IGKGGLNIKLASMLTEYTIDVFRE---LDEAVEDEDI 358
>gi|87301303|ref|ZP_01084144.1| transcription elongation factor NusA [Synechococcus sp. WH 5701] >gi|87284271|gb|EAQ76224.1| transcription elongation factor NusA [Synechococcus sp. WH 5701] (492 aa)
Score = 363, Expect = 2.0e-32, Identities = 110/340 (32%), Positives = 192/340 (56%)
  Q:     7 LENL-DKIAKEKDTSKENIVNILKTALEKSY---------------LKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKG------VVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           L+NL + I++EK    + +   L+ AL K Y                +E+   + +V +DL++E  ++   +++V++ E E   D +I ++E Q++ +  ++GDTV  +V  +K  F R   +   Q+L   L D     + EE+ D    ++ A V + + + V + + S  G       + R +Q+P +  +   ++   +KEV     +G  + +SRA+ GL+ YL + E+ EI +G + I  +       SR VG +TKVA+ S    VD VG  +G +G RI+++ + L  E+IDVI +  DP Q+L N+  P ++  V + D    P  +   ++ P + L   IG+ G NVRL ++LTGW IDI
  S:     9 LQNLIEDISEEKKLPTQVVEAALREALLKGYERYRRTLYLGISEDPFEEDYFSNFDVALDLDEEGYRVLASKIIVEEVESE---DHQIALAEVQQVAEDAQVGDTVVLDVTPEKDDFGRMAAATTKQVLAQKLRDQQRRMIQEEFADLEDPVLTARVIRFERQSVIMAVSSGLGRPEVEAELPRRDQLPNDNYRANATFKVFLKEVSEVPRRGPQLFVSRANAGLVVYLFENEVPEIQEGSVRIVAVAREANPPSRAVGPRTKVAVDSVEREVDPVGACIGARGSRIQQVVNELRGEKIDVIRWSPDPGQYLANSLSPARVEMVRLVD----PEGQHAHVLVPPDQLSLAIGREGQNVRLAARLTGWKIDI 372
>gi|119504358|ref|ZP_01626438.1| transcription elongation factor NusA [marine gamma proteobacterium HTCC2080] >gi|119459866|gb|EAW40961.1| transcription elongation factor NusA [marine gamma proteobacterium HTCC2080] (490 aa)
Score = 363, Expect = 2.1e-32, Identities = 98/344 (28%), Positives = 190/344 (55%)
  Q:    11 DKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIE 354
           + ++ EK  S++ I   ++ AL  +  K    + DIEVV+D      +   + +VV  +E  +    +    EA E   + ++GD     +    F R       Q++   + D   +++ + ++D++G ++   V+KV    V V+LG+  +G++ R E +  E  +       ++ E+ ++ ++G  +++SRA   +L  L K E+ EIS+G+I+I+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L+NER+D+IL+D++P Q ++NA  P ++  + + +D     S  + +   E++L + IG+ G NVRL S LTGW+I+++S   A+E
  S:     4 EAVSAEKGVSEDIIFEAIELALATAAKKRYEEEADIEVVIDRVSGEYQTRRRWLVVPDTELALLG-TQFTTEEAAEADANLQIGDVHEEIIENADFGRIAAQTAKQVIVQRVRDAERAQIVDLYRDRIGELLAGIVKKVTRDNVIVDLGNNAEGLLPRGELVGRETFRINDRVRAILSEINTE-SRGPQLVMSRACREMLTELFKIEVPEISEGVIQIRAAARDPGSRAKIAVKTGDQRIDPVGACVGMRGSRVQAVSNELDNERVDIILWDDNPAQLVINAMSPAEVESIVVDED-----SNTMEVAVAEDNLAQAIGRGGQNVRLASDLTGWTINVMSTDEAVE 342
>gi|88705684|ref|ZP_01103394.1| Transcription elongation protein nusA [gamma proteobacterium KT 71] >gi|88700197|gb|EAQ97306.1| Transcription elongation protein nusA [Congregibacter litoralis KT71] (497 aa)
Score = 363, Expect = 2.1e-32, Identities = 108/353 (30%), Positives = 191/353 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDK 356
           K  L   + ++ EK  S++ I   +++AL  +  K  + D DIEV +D      +   + +VV   E  +    +    EA E   S K GD    +V    F R       Q++   + D   ++V E ++ +VG ++   V+KV    V V+LG+    +L  EQ+ G E       +  I +  S +T+G  +ILSRA   +L  L K E+ EIS+ +I+I+  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L+NER+D++L+D++P Q ++NA  P ++  + + D+E++     + +   E++L + IG+ G NVRL S+LTGW+I+++S   A+E +
  S:     3 KEILLVAEAVSNEKGVSEDIIFEAIESALAMATKKRYDEDADIEVTIDRETGDYETVRRWLVVPDDELALLG-TQFTTEEAIEQDPSLKPGDVHEEKVENVGFGRIAAQTAKQVIVQKVRDAERAQVVELYESRVGELVAGTVKKVTRDNVIVDLGNNAEGLLPREQLVGRETFRINDRVRAILKEISTETRGPQLILSRACPEMLIELFKIEVPEISEEVIQIRSAARDPGSRAKIAVKTNDQRIDPVGACVGMRGSRVQAVSNELDNERVDIVLWDDNPAQLVINAMSPAEVESI-VVDEENV----TMDVAVAEDNLAQAIGRAGQNVRLASELTGWTINVMSVDEALEKQ 350
>gi|161830897|ref|YP_001597277.1| transcription elongation factor NusA [Coxiella burnetii RSA 331] >gi|161762764|gb|ABX78406.1| transcription termination factor NusA [Coxiella burnetii RSA 331] (503 aa)
Score = 363, Expect = 2.1e-32, Identities = 96/346 (27%), Positives = 188/346 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEID-DDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLG-STKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           K  L  +D ++ E+  SKE I   ++ AL     K  E  D+ I V +D      + F    VV+ + + ++  ++E+ + +A+E+    ++GD +   V   KF R       Q++   + +   +K+  +++ +VG ++   V++V    + +++G + + ++LR E IP E  +        +  V   + +G  +++SR     L  L K E+ EI + +IEIK  +R  G + K+A+ +    +D +G  VG +G R++ +S+ L  ERID++L+D++P Q ++NA  P ++  + + +D     S  + I   ++ L + IG++G NVRL S+LTGW+++++SE
  S:     3 KDILLIVDSMSNERGVSKEVIFEAIEAALAAVTAKRYEEDDVKIRVAIDQKTGDYESFRCWTVVEDTNESLEFPNQEMTLKQAREIDSDLEVGDVIEEPVESVKFGRIAVQQAKQVIVQKVREAERAKIIRQYEKRVGELVIGVVKRVTRESIILDMGENAEALLLREEMIPREAFRINDRLRAYLYSVCQDKKRGPQLLVSRTRPEFLVELFKIEVPEIGEEVIEIKGAARDPGSRAKIAVKTNDGRIDPIGACVGMRGSRVQAVSNELGGERIDIVLWDDNPAQLVINAMAPAEVASIVVDED-----SHTMDIAVNKDQLSQAIGRSGQNVRLASELTGWTLNVMSE 347
>gi|108759193|ref|YP_630295.1| transcription termination factor NusA [Myxococcus xanthus DK 1622] >gi|108463073|gb|ABF88258.1| transcription termination factor NusA [Myxococcus xanthus DK 1622] (566 aa)
Score = 363, Expect = 2.1e-32, Identities = 105/340 (30%), Positives = 188/340 (55%)
  Q:    10 LDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEV---------------------NIDKFER---RITSHFA-QILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISE 349
           LD++AK+K   +  ++  L+ A++ +  K    D ++E   D +K  ++LF+   VV++  D +    +I++ EA +     + GD +  ++                      +  F R   RI +  A Q++     D     V+ E++D+   I+     + +   + V+LG  + V+   EQ+P E  +PG      + +V  +++KG  I+LSRA   LL  L + E+ EI++GI+ I+  +R  G + K+A+ SR   VD VG  VG KG R++ +   L  E+ID++ +DEDP +F+ +A  P ++  V I +      +  + ++ P++ L   IG+ G NVRL ++LTGW +DI SE
  S:    16 LDQVAKDKGIDRAVLIATLEDAMKTAAKKHFGQDRELEAKYDPDKGVVELFQAITVVEEIVDPVQAVNQISLVEAHKKGMEVEPGDELVFQIFYRDEDAAEAKAQDDQYGDILRLKTFRRGFGRIAAQTAKQVILQRTRDAERENVFNEYRDRKNEIVTGIARRFERGNIIVDLGRAEAVLPVREQVPRETYRPGDRVQAYVLDVL-RESKGPQIVLSRASVNLLTKLFEMEVPEIAEGIVVIEAAAREPGGRAKIAVSSRDSDVDPVGACVGMKGSRVQAVVQELRGEKIDIVPFDEDPARFVCSALAPAEVSRVIIDE-----ANHAMELIVPDDQLSLAIGRRGQNVRLAAQLTGWKLDINSE 375
>gi|76798057|ref|ZP_00780314.1| transcription termination factor NusA [Streptococcus agalactiae 18RS21] >gi|77406370|ref|ZP_00783432.1| transcription termination factor NusA [Streptococcus agalactiae H36B] >gi|77408786|ref|ZP_00785516.1| transcription termination factor NusA [Streptococcus agalactiae COH1] >gi|77411664|ref|ZP_00788004.1| transcription termination factor NusA [Streptococcus agalactiae CJB111] >gi|22533395|gb|AAM99284.1|AE014208_24 N utilization substance protein A [Streptococcus agalactiae 2603V/R] >gi|76586616|gb|EAO63117.1| transcription termination factor NusA [Streptococcus agalactiae 18RS21] >gi|77162308|gb|EAO73279.1| transcription termination factor NusA [Streptococcus agalactiae CJB111] >gi|77172631|gb|EAO75770.1| transcription termination factor NusA [Streptococcus agalactiae COH1] >gi|77175039|gb|EAO77846.1| transcription termination factor NusA [Streptococcus agalactiae H36B] (379 aa)
Score = 363, Expect = 2.2e-32, Identities = 120/358 (33%), Positives = 196/358 (54%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLN--KESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNER--------------IDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS----EKLAIEDKIEFEDVSQ 364
           LE    + +EK  +KE+I++ +  +L+ +Y K         V++ N  K    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E ++ +F R       Q +   +        + E+K   G I+   VE+ D R + VNLGS +  +   +QIPGE  +        + +V++   KG  + +SR+    ++ +++ EI E+ DG +EI  +SR  G +TKVA+ S    VDA+GT VG  G  IKK+ S  + +R              IDVI + EDP +F+ NA  P + V + + DDED   +K  T+V P+  L   IG+ G NVRL + LTG+ IDI S    EK+  ++ ++ E+V+Q
  S:     2 LEAFRILEEEKHINKEDIIDAVTESLKSAY-KRRYGQSESCVIEFNEKKADFTVYTVREVVDEV---FDSRLEISLKDALAISSAYELGDKIRFEESVTEFGRVAAQSAKQTIMEKMRRQMREVTFNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSHQDQIPGESFKSHDMIDVYVYKVENN-PKGVNVFVSRSHPEFIKRIMEREIPEVFDGTVEIMSVSREAGDRTKVAVRSHNSNVDAIGTIVGRGGSNIKKVISNFHPKRVDAKTGLEIPVEENIDVIQWVEDPAEFIYNAIAPAE-VDMVLFDDED---TKRATVVVPDSKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEYEKMEAQE-LQTEEVAQ 369
>gi|16762052|ref|NP_457669.1| transcription elongation factor NusA [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143541|ref|NP_806883.1| transcription elongation factor NusA [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25299784|pir||AI0901 L factor [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504355|emb|CAD07807.1| L factor [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139175|gb|AAO70743.1| L factor [Salmonella enterica subsp. enterica serovar Typhi Ty2] (500 aa)
Score = 363, Expect = 2.2e-32, Identities = 97/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVN----LGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++V   E+     KEI +  A+   +S  +GD V  ++    F+R  T    Q++   + +   + V ++++D+ G I+   V+KV  DN  +E+      G+ + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +G R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NV L S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWLIV---EEVTMPTKEITLEAARFEDESLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRDQEGEIVTGVVKKVNRDNISLEIKSEGMAGNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVHLASQLSGWELNVMT 345
>gi|50842972|ref|YP_056199.1| transcription elongation factor NusA [Propionibacterium acnes KPA171202] >gi|50840574|gb|AAT83241.1| transcriptional termination/antitermination factor [Propionibacterium acnes KPA171202] (323 aa)
Score = 363, Expect = 2.3e-32, Identities = 82/244 (33%), Positives = 139/244 (56%)
  Q:   103 DKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           + F R   S   Q++   L +  + + Y  +    G++I   V++   D R V V+LGS +G++  +EQ+PGE+   G+     +  V+ ++ +G  +I+SR    L+R L   E+ EI  G++EIK ++R  G+++K+A++S  P V A G  +GP G+R++ +   L+ E+ID+I + EDP +F+  A  P K+  V + D    P +K    + P+  L   IG+ G N RL ++LTGW IDI
  S:    77 EDFGRVAASTARQVIFQRLREAEDEQKYGHFSAVEGDVITGVVQQSYRDTRTVRVDLGSLEGIMPPAEQVPGEKYSHGRRIRVYVVAVR-KEARGPQVIVSRTHPNLVRKLFAMEVPEIEQGVVEIKALAREAGHRSKIAVVSHNPDVSAKGACIGPMGQRVRAVMHELDEEKIDIIDWSEDPAEFVGAALSPSKVSSVTVID----PKAKTARAIVPDYQLSLAIGREGQNARLAARLTGWRIDI 317
>gi|88855366|ref|ZP_01130030.1| transcription elongation factor NusA [marine actinobacterium PHSC20C1] >gi|88815273|gb|EAR25131.1| transcription elongation factor NusA [marine actinobacterium PHSC20C1] (333 aa)
Score = 363, Expect = 2.4e-32, Identities = 108/349 (30%), Positives = 185/349 (53%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLK--ENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEID------DDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN-RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIED 355
           L  L  + +E++   E +V I++ A+  +YLK  E P+          K +      RVV+D+    +       DD+   + EA+         D+ S    I  F  +      Q++   L DI + KV  E+K + G+I+   +++  N R++ ++LG+ + ++   EQ+P EE + G      +  V ++  KG  I +SR    L+R L   E+ EI+ GI+EI  ++R  G++TK+A+ +  PGV+A G+ +G  G+R++ +++ LNNE+ID++ Y E+   F+ NA  P K+    + D+     +K V  + P+  L   IGK G N RL +KLTG  IDI  + +  ED
  S:     5 LSVLRMMEREREIPFEELVQIIEQAIMSAYLKHVEAPE---------GKAAETAPTARVVLDRKTGHVSVWVPEYDDEGAIVGEAE---------DSPSDFGRIAAFAAK------QVINQRLRDIGDDKVLGEFKGREGDIVAGVIQQGPNPRMIHIDLGTVEAIMPPEEQVPSEEYKHGSRLRVYVTAV-NKGDKGPQITVSRTHPSLVRKLFALEVPEIASGIVEITSVAREAGHRTKMAVRATEPGVNAKGSCIGELGQRVRAVTAELNNEKIDIVDYSENLAVFVANALSPAKVSSSFVIDET----TKAVRALVPDYQLSLAIGKEGQNARLAAKLTGARIDIQPDSILDED 333
>gi|183603429|ref|ZP_02716853.2| transcription termination factor NusA [Streptococcus pneumoniae CDC3059-06] >gi|183576810|gb|EDT97338.1| transcription termination factor NusA [Streptococcus pneumoniae CDC3059-06] (374 aa)
Score = 363, Expect = 2.5e-32, Identities = 118/354 (33%), Positives = 189/354 (53%)
  Q:     7 LENLDKIAKEKDTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKES--IKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLN--------------NERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI--ISEKLAIEDKIEFE 360
           LE    + ++K   KE+I++ +  +L  +Y +     D  V +D N+++    ++  R VVD+     D   EI++ +A  +  +Y+LGD +  E    +F R       Q +   +   + +  Y  +K+    I+   VE+ DNR + VNLGS +  + + +QIPGE           + +V+    +G  + +SR+   +++ L++ EI E+ DG +EI  ++R  G +TKVA+ S  P VDA+GT VG  G  IKKI+S  +               E IDVI +  DP +F+ NA  P ++  V I D+ D   SK   +V P+  L   IG+ G NVRL + LTG+ IDI   SE  A+ED    E
  S:     2 LEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSD-SVAIDFNEKTGDFTVYTVREVVDEV---FDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDN-PRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQV-IFDEND---SKRALVVVPDNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVE 364
>gi|17231321|ref|NP_487869.1| transcription elongation factor NusA [Nostoc sp. PCC 7120] >gi|17132963|dbj|BAB75528.1| transcription termination factor [Nostoc sp. PCC 7120] (425 aa)
Score = 362, Expect = 2.5e-32, Identities = 104/333 (31%), Positives = 185/333 (55%)
  Q:    32 LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGV------VLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDVSQ 364
           +E+    E+   + EV +D+++E  ++   + +V   E+  + D +I++ E Q++    +LGD+V  +V  D+  F R       Q+L   L D     V EE++D  G +++A V + + + V + + ST G       + + EQ+P +  +   ++   +K+V   Q +G  +++SRAD GL+ YL   E+ EI D ++ I  +       SR VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P ++  V + D    P ++   ++  E+ L   IGK G NVRL ++LTGW ID       I+DK +++ V++
  S:    48 IERKQFDEDYFDNFEVELDIDEEGFRVLSTKSIV---EEVNNSDHQISLDEVQQVAPEAQLGDSVVLDVTPDQGEFGRMAAMQTKQVLAQKLRDQQRQMVQEEFQDLEGTVLQARVLRFERQSVILAVSSTFGQPEVEAELPKREQLPNDNYRANATFKVYLKKVSQGQQRGPQLLVSRADAGLVVYLFANEVPEIEDEVVRIVAVAREANPPSRYVGPRTKIAVDTLDRDVDPVGACIGARGSRIQVVVNELRGEKIDVIRWSPDPATYIANALSPARVDEVRLMD----PETRQTHVLVAEDQLSLAIGKEGQNVRLAARLTGWKID-------IKDKAKYDQVAE 381
>gi|154175154|ref|YP_001408581.1| transcription elongation factor NusA [Campylobacter curvus 525.92] >gi|112803976|gb|EAU01320.1| transcription termination factor NusA [Campylobacter curvus 525.92] (366 aa)
Score = 362, Expect = 2.6e-32, Identities = 110/337 (32%), Positives = 192/337 (56%)
  Q:    10 LDKIAKEK----DTSKENIVNILKTALEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKE--INISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDN-RLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           ++ IA EK    D  KE ++  L    ++ Y  EN + D  V +D NK ++KL++K ++V   ++ +++D E  I++ EA+++    ++GD ++ E+++D   R       + L +++  +   K+++++ + VG ++   V +VDN     + +   + ++ R  +I GE+ + G     +I++V + +  G  + LSR     L  LLK E+ EI DG I I+  +RI G + KVA++S  P +D VG  VG KG RI  +S  L++E ID I Y  +P  F+  A  P  I  V+I  ++      IV++V  ++S  K IGKNGIN+RL S LTG+ I++
  S:     8 IESIANEKGLQIDDVKERVIRALINTAKRVY-SENYEYD--VTIDANK-NLKLYQKILIVANDDERLNEDNEHFISLKEAKKIDSGVEVGDELTYELSLDNLGRTAAQTLHKELEYHIQRLVEEKIFQKYDEMVGQMVFGSVVRVDNDENTYIEIDELRAILPRKNRIKGEKFKIGDVVKAVIRKVFTDKNLGIRVELSRTSPKFLEALLKAEVPEIKDGGIIIQNSARIPGERAKVALISTTPNIDPVGATVGTKGVRINAVSKELHDENIDAIEYASEPAIFISRAMAPAIISSVKIDGNK-----AIVSLVGEQKS--KAIGKNGINIRLASMLTGFEIEL 340
>gi|90412484|ref|ZP_01220487.1| transcription elongation factor NusA [Photobacterium profundum 3TCK] >gi|90326521|gb|EAS42927.1| transcription elongation factor NusA [Photobacterium profundum 3TCK] (495 aa)
Score = 362, Expect = 2.6e-32, Identities = 94/345 (27%), Positives = 188/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKEN-PDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGST-KGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L+ AL  +  K++  ++D+ V +D      + F + + VD+         E+ I  AQ   ++ +LG  V  E+    F+R  T    Q++   + +    ++ E++ D  G +I   V+KV+   V ++LG+  + V+ R +Q+P E  + G     L+  V+ +  +G+ + ++R+   +L  L + E+ EI + +IE+   +R  G + K+A+ +    +D VG  VG +G R++ +SS L  ERID++L+DE+  Q+++NA  P ++  + + +D     +  + I   +++L + IG++G N+RL S+LTGW +++++
  S:     3 KEILAVVEAVSNEKAVPRERIFEALEIALATATKKKHEAEIDVRVAIDRKTGQFETFRRWIAVDEVTQPT---LEMTIEAAQYDDETIELGGFVEDEIESVTFDRITTQTAKQVIVQKVREAEREQIVEQFMDNEGELITGIVKKVNRDAVVIDLGNNAEAVIQRDDQLPRENFRSGDRIRGLLYAVRPE-ARGFQLFMTRSKAEMLLELFRIEVPEIGEELIELMGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELAGERIDIVLWDENAAQYVINAMAPAEVASIIVDED-----NHTMDIAVEKDNLAQAIGRSGQNIRLASQLTGWELNVMT 340
>gi|150384383|ref|ZP_01923080.1| NusA antitermination factor [Victivallis vadensis ATCC BAA-548] >gi|150259213|gb|EDM96455.1| NusA antitermination factor [Victivallis vadensis ATCC BAA-548] (414 aa)
Score = 362, Expect = 2.7e-32, Identities = 105/345 (30%), Positives = 186/345 (53%)
  Q:     6 FLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEK 350
            L  L+ I +E+  S+++++  L++A+  +  K  +P  +++V +D     I+ +    VV+  E+   D  ++ I+ A+E     +LG+ V  EV    F R       Q +   L       V EE+ D++G II   V + +   + ++    +G++   E+I  E+  PG     L+  V    T G  +I+SR+    +  L + EI+EI DG+++I  I+R  G +TK++++S  P VD VG  VG +G+R++ I++ L NERID++ YD D +++  NA  P K+  VE+ + +     +++  V  E+S +   GK   NVRL SKL GW+I+I +E+
  S:     5 LLTILEYIEQERGISRDSLIKALESAILTAARKSIHPASELKVKIDPVTGQIQAWATLEVVE--ENPTCD--QLVIARARERFPDVQLGEKVEWEVTPRNFGRIAAQTARQAIVQQLRKAEKENVQEEFADRIGQIISGTVRRFEAGNIIIDFQKAEGIMPSKEKIHDEQYMPGDIIRALLLRV-DINTAGPSLIVSRSCPEFVTRLFEREIAEIHDGVVKIMGIAREAGKRTKISVMSTDPRVDPVGACVGMRGQRVRNITNELGNERIDIVPYDADIRKYATNALLPAKVQSVEVNEAK----HELIVRVTDEQSKLAF-GKKAQNVRLCSKLIGWNINIRNEE 340
>gi|119511041|ref|ZP_01630161.1| transcription elongation factor NusA [Nodularia spumigena CCY9414] >gi|119464292|gb|EAW45209.1| transcription elongation factor NusA [Nodularia spumigena CCY9414] (423 aa)
Score = 362, Expect = 2.8e-32, Identities = 101/315 (32%), Positives = 172/315 (54%)
  Q:    32 LEKSYLKENPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDK--FERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKVDNRLVEVNLGSTKGV------VLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRI-------SRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDI 346
           LEK    E    + EV +D+  E  ++   + +V+  ++    D +I++ E Q++    +LGD+V  +V  D+  F R       Q+L   L D     V EE++D  G +++A V + + + V + + S  G       + + EQ+P +  +   ++   +K+V   Q +G  +++SRAD GL+ YL   E+ EI D ++ I  +       SR VG +TK+A+ +    VD VG  +G +G RI+ + + L  E+IDVI +  DP  ++ NA  P ++  V + D    P ++   ++  E+ L   IGK G NVRL ++LTGW IDI
  S:    46 LEKRQFDEEYFDNFEVELDIEGEGFRVLSTKSIVEAVDNT---DHQISLEEVQQVAPEAQLGDSVVLDVTPDQGEFGRMAAMQTKQVLAQKLRDQQRQMVQEEFQDLEGTVLQARVLRFERQSVILAVASGFGQPEVEAELPKREQLPNDNYRANATFKVYLKKVSQGQQRGPQLLVSRADAGLVVYLFANEVPEIEDEVVRIVAVAREANPPSRYVGPRTKIAVDTLDRDVDPVGACIGARGSRIQVVVNELRGEKIDVIRWSPDPSTYIANALSPARVDEVRLMD----PETRQTHVLVAEDQLSLAIGKEGQNVRLAARLTGWKIDI 368
>gi|515637|gb|AAA20049.1| transcription factor (500 aa)
Score = 362, Expect = 2.8e-32, Identities = 97/345 (28%), Positives = 189/345 (54%)
  Q:     4 KSFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV--DNRLVEVN----LGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIIS 348
           K  L  ++ ++ EK   +E I   L++AL  +  K+   ++D+ V +D        F + ++V   E+     KEI +  A+   +S  +GD V  ++    F+R  T    Q++   + +   + V ++++D+ G I+   V+KV  DN  +E+      G+ + V+LR + +P E  +PG     ++  V+ +  +G  + ++R+   +L  L + E+ EI + +IEIK  +R  G + K+A+ +    +D VG  VG +  R++ +S+ L  ERID++L+D++P QF++NA  P  +  + + +D+       + I     +L + IG+NG NVRL S+L+GW +++++
  S:     3 KEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFRRWLIV---EEVTMPTKEITLEAARFEDESLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVDQFRDQEGEIVTGVVKKVNRDNISLEIKSEGMAGNAEAVILREDMLPRENFRPGDRIRGVLYAVRPE-ARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRRARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDEDK-----HTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT 345
>gi|189465081|ref|ZP_03013866.1| hypothetical protein BACINT_01425 [Bacteroides intestinalis DSM 17393] >gi|189437355|gb|EDV06340.1| hypothetical protein BACINT_01425 [Bacteroides intestinalis DSM 17393] (440 aa)
Score = 362, Expect = 2.9e-32, Identities = 112/358 (31%), Positives = 197/358 (55%)
  Q:     5 SFLENLDKIAKEKDTSKENIVNILKTALEKSYLKE-NPDLDIEVVVDLNKESIKLFEKRVVVDKSEDEIDDDKEINISEAQELKKSYKLGDTVSTEVNIDKFERRITSHFAQILTHNLNDISNSKVYEEWKDKVGNIIRAEVEKV-DNRLVEVNLGSTKGVVLRSEQIPGEELQPGQSYLFLIKEVKSQQTKGWPIILSRADEGLLRYLLKTEISEISDGIIEIKRISRIVGYKTKVAILSRVPGVDAVGTAVGPKGERIKKISSTLNNERIDVILYDEDPKQFLVNACHPEKIVGVEITDDEDIPGSKIVTIVCPEESLIKLIGKNGINVRLLSKLTGWSIDIISEKLAIEDKIEFEDV 362
           S ++   +  + K+  +  +V++L+ +      K    D + +V+V+ +K   +++  R VV   ED  + + +I +SEAQ++  SY++G+ V+ EV    F RR   +  Q L   + ++    +Y ++ DKVGNII AEV ++    ++ ++    + ++ ++EQIP +  + G++   ++  V ++      IILSR     L+ L + E+ EI+DG+I IK+I+RI G + K+A+ S    +D VG  VG KG RI  I   L NE IDVI Y  + + F+  A  P KI  + + ++E     K    + PEE  +  IGK G+N++L S LT ++ID+  E   ++  +E ED+
  S:     9 SLIDTFSEFKELKNIDRTTMVSVLEESFRSVIAKMFGTDENYDVIVNPDKGDFEIWRNREVV-ADEDLENPNLQIALSEAQKIDASYEVGEEVTDEVIFANFGRRAILNLRQTLASKILELEKDSIYNKYIDKVGNIINAEVYQIWKKEMLLLDDEGNELLLPKTEQIPSDFYRKGETARAVVARVDNKNNNP-KIILSRTSPVFLQRLFEMEVPEINDGLITIKKIARIPGERAKIAVESYDDRIDPVGACVGVKGSRIHGIVRELRNENIDVINYTSNIQLFIQRALSPAKISSIRLNEEE----RKAEVFLRPEEVSLA-IGKGGLNIKLASMLTEYTIDVFRE---LDQAVEDEDI 358