>gi|26553463|ref|NP_757397.1| hypothetical protein MYPE110 [Mycoplasma penetrans HF-2] >gi|26453469|dbj|BAC43801.1| hypothetical protein [Mycoplasma penetrans HF-2] (80 aa)
Score = 307, Expect = 5.5e-27, Identities = 79/80 (98%), Positives = 80/80 (100%)
  Q:     1 VFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQLH 80
           +FEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQLH
  S:     1 MFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQLH 80
>gi|26553464|ref|NP_757398.1| hypothetical protein MYPE120 [Mycoplasma penetrans HF-2] >gi|26453470|dbj|BAC43802.1| hypothetical protein [Mycoplasma penetrans HF-2] (152 aa)
Score = 289, Expect = 6.9e-25, Identities = 75/80 (93%), Positives = 79/80 (98%)
  Q:     1 VFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDV--------------SKIKRCPTIARELAQLH 80
           VFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLE+IESDIR+LK+DVTVLKEDVAVLKEDV              SKIKRCPTI RELAQL+
  S:    59 VFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
>gi|26553951|ref|NP_757885.1| hypothetical protein MYPE4990 [Mycoplasma penetrans HF-2] >gi|26453959|dbj|BAC44289.1| hypothetical protein [Mycoplasma penetrans HF-2] (141 aa)
Score = 149, Expect = 1.4e-08, Identities = 37/63 (58%), Positives = 49/63 (77%)
  Q:    17 PKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           P  P D + E+L  ++ ++  I+ +I V+K+D+  LKEDVAVLKEDVSKIKRCPTIARELA+L
  S:    78 PIVPTDDVREMLKILITEVRGIKEEIVVIKEDIKTLKEDVAVLKEDVSKIKRCPTIARELAEL 140
>gi|26554204|ref|NP_758138.1| hypothetical protein MYPE7480 [Mycoplasma penetrans HF-2] >gi|26454213|dbj|BAC44542.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (169 aa)
Score = 143, Expect = 7.0e-08, Identities = 49/79 (62%), Positives = 63/79 (79%)
  Q:     1 VFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKED--------------VSKIKRCPTIARELAQL 79
           VFEGNMK  KTK+++KP        D K P         I + LG IL  ++ ++ DI  LK DV++LK DV+VLK+D              VSKIK+CPTIA+ELAQL
  S:    61 VFEGNMKIYKTKRHRKPIEVPPPGDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKKDINYLKDDVSILKNDVSVLKDDMVEVKSDIKILKDDVSKIKQCPTIAKELAQL 169
>gi|26553952|ref|NP_757886.1| hypothetical protein MYPE5000 [Mycoplasma penetrans HF-2] >gi|26453960|dbj|BAC44290.1| hypothetical protein [Mycoplasma penetrans HF-2] (86 aa)
Score = 130, Expect = 1.9e-06, Identities = 35/63 (55%), Positives = 48/63 (76%)
  Q:    17 PKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           P  P D I E+L  ++  +  I+ +I V+K+D+ +LKEDV VLK+DV+KIKRCPTIARELA+L
  S:    23 PIVPTDDIREMLKILITDVRGIKEEIVVIKEDIKILKEDVEVLKKDVAKIKRCPTIARELAEL 85
>gi|26554192|ref|NP_758126.1| hypothetical protein MYPE7360 [Mycoplasma penetrans HF-2] >gi|26454201|dbj|BAC44530.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (153 aa)
Score = 115, Expect = 1.1e-04, Identities = 27/59 (45%), Positives = 43/59 (72%)
  Q:    22 DPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQLH 80
           +P  ++L +IL +L+ I SD+  LK D+  +K D+  LK+DVS+I +CPTI RELA+++
  S:    95 NPSPDILEEILKQLKTISSDVAQLKTDMVEVKADITQLKKDVSRIMKCPTIVRELAEIN 153
>gi|26554093|ref|NP_758027.1| hypothetical protein MYPE6410 [Mycoplasma penetrans HF-2] >gi|26454101|dbj|BAC44431.1| hypothetical protein [Mycoplasma penetrans HF-2] (179 aa)
Score = 110, Expect = 4.0e-04, Identities = 34/73 (46%), Positives = 53/73 (72%)
  Q:     3 EGNMKASKTKKYQKP----------------KDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARE 75
           +G ++   ++KYQKP                 D  D I + L  ++D+++ ++ DI++LK+DV VLKEDVAVLKEDV+ +K   TI +E
  S:    64 KGYVEMVVSRKYQKPIILGPTDGRGGGTICGGDAHDEINKKLDYLIDEMKEMKQDIKILKEDVAVLKEDVAVLKEDVAVLKEDVTILKE 152
>gi|26554208|ref|NP_758142.1| hypothetical protein MYPE7520 [Mycoplasma penetrans HF-2] >gi|26454217|dbj|BAC44546.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (152 aa)
Score = 107, Expect = 8.7e-04, Identities = 34/65 (52%), Positives = 45/65 (69%)
  Q:     1 VFEGNMKASKTKKYQKPKDPKDP----------------IWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSK 65
           VFEGNMK  KTK+  KP D   P                I + LG IL  ++ ++ DI  LK+ VTVL+ DV++LK DVS+
  S:    61 VFEGNMKIYKTKRQPKPIDIPPPGDDDKKTTDLSNEIKFIKDSLGIILSDMKEMKQDINYLKEKVTVLENDVSILKTDVSE 141
>gi|26554020|ref|NP_757954.1| hypothetical protein MYPE5680 [Mycoplasma penetrans HF-2] >gi|26454028|dbj|BAC44358.1| hypothetical protein [Mycoplasma penetrans HF-2] (171 aa)
Score = 106, Expect = 1.4e-03, Identities = 26/51 (50%), Positives = 37/51 (72%)
  Q:    17 PKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIK 67
           PKD    I  +LGKILDK+E+IE D++ LK+DV  LK D+  +K DV+++K
  S:    79 PKDKDSSIEVILGKILDKMEVIELDLKTLKEDVAQLKTDMVEVKSDVAQLK 129
>gi|26553926|ref|NP_757860.1| hypothetical protein MYPE4750 [Mycoplasma penetrans HF-2] >gi|26453934|dbj|BAC44264.1| hypothetical protein [Mycoplasma penetrans HF-2] (156 aa)
Score = 103, Expect = 2.7e-03, Identities = 26/51 (50%), Positives = 37/51 (72%)
  Q:    17 PKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIK 67
           PKD    I  +L KILDK+++IE D++ LK+DVT+LK DV  LK D+ ++K
  S:    64 PKDIDGSIEGMLRKILDKMDVIELDLKTLKEDVTILKSDVTQLKTDMVEVK 114
>gi|26553797|ref|NP_757731.1| hypothetical protein MYPE3420 [Mycoplasma penetrans HF-2] >gi|26453804|dbj|BAC44135.1| hypothetical protein [Mycoplasma penetrans HF-2] (146 aa)
Score = 100, Expect = 5.9e-03, Identities = 28/58 (48%), Positives = 41/58 (70%)
  Q:    22 DPIWEVLGKILDKLELIESDIRVLKKDVTVLKED-------VAVLKEDVSKIKRCPTIARELAQL 79
           +P  ++L +IL +L+ I SD+  LK DV  LK D       V  LK+DVS+I +CPTI  EL+++
  S:    81 NPSPDILEEILKQLKTISSDVSELKTDVAQLKTDMVEVKADVTQLKKDVSRIMKCPTIVSELSEI 145
>gi|26553927|ref|NP_757861.1| hypothetical protein MYPE4760 [Mycoplasma penetrans HF-2] >gi|26453935|dbj|BAC44265.1| hypothetical protein [Mycoplasma penetrans HF-2] (149 aa)
Score = 99, Expect = 7.2e-03, Identities = 25/50 (50%), Positives = 36/50 (72%)
  Q:    18 KDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIK 67
           KD    I  +LGKILDK+++IE D++ LK+DV +LK DV  LK D+ ++K
  S:    65 KDIDGSIEGMLGKILDKMDVIELDLKTLKEDVAILKLDVTQLKTDMVEVK 114
>gi|26553925|ref|NP_757859.1| hypothetical protein MYPE4740 [Mycoplasma penetrans HF-2] >gi|26453933|dbj|BAC44263.1| hypothetical protein [Mycoplasma penetrans HF-2] (150 aa)
Score = 93, Expect = 4.2e-02, Identities = 24/51 (47%), Positives = 36/51 (70%)
  Q:    17 PKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIK 67
           PKD    I  +LGKILDK+++IE D++ LK+DV  LK D+  +K D++ +K
  S:    79 PKDIDGSIEGMLGKILDKMDVIELDLKTLKEDVAQLKTDMVEVKSDIAILK 129
>gi|26554206|ref|NP_758140.1| hypothetical protein MYPE7500 [Mycoplasma penetrans HF-2] >gi|26454215|dbj|BAC44544.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 93, Expect = 4.2e-02, Identities = 33/72 (45%), Positives = 48/72 (66%)
  Q:     1 VFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTI 72
           VFEGNMK  KTK+++KP        D K P         I + LG IL  ++ ++ DI  LK+ VTVL+ D+  +K D+  +K   T+
  S:    61 VFEGNMKIYKTKRHRKPIEVPPPGDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKQDINYLKEKVTVLETDMVEVKSDIKILKEKVTV 148
>gi|26553796|ref|NP_757730.1| hypothetical protein MYPE3410 [Mycoplasma penetrans HF-2] >gi|26453803|dbj|BAC44134.1| hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 93, Expect = 4.4e-02, Identities = 21/42 (50%), Positives = 33/42 (78%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           +++D+  +K D+  LK DV+ LK+DVS+I +CPTI RELA++
  S:   138 LKTDMVEVKADIVELKTDVSQLKKDVSRIMKCPTIVRELAEI 179
>gi|26554207|ref|NP_758141.1| hypothetical protein MYPE7510 [Mycoplasma penetrans HF-2] >gi|26454216|dbj|BAC44545.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 92, Expect = 4.8e-02, Identities = 32/64 (50%), Positives = 44/64 (68%)
  Q:     1 VFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVS 64
           VFEGNMK  KTK++ KP        D K P         I + LG IL  ++ ++ DI VLK D+  +K D+ +LKE V+
  S:    61 VFEGNMKIYKTKRHPKPIEVPPPSDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKHDISVLKDDMVEVKSDIKILKEKVT 140
>gi|26554205|ref|NP_758139.1| hypothetical protein MYPE7490 [Mycoplasma penetrans HF-2] >gi|26454214|dbj|BAC44543.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (187 aa)
Score = 92, Expect = 5.0e-02, Identities = 37/65 (56%), Positives = 51/65 (78%)
  Q:     1 VFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKIL--------------DKLELIESDIRVLKKDVTVLKEDVAVLKEDVSK 65
           VFEGNMK  KTK++ KP        D K P         I + LG IL              D +  ++SDI++LK+ VTVL+ DV++LK+DVS+
  S:    61 VFEGNMKIYKTKRHPKPIEVPPPSDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKHDISVLKDDMVEVKSDIKILKEKVTVLENDVSILKKDVSE 155
>gi|26554191|ref|NP_758125.1| hypothetical protein MYPE7350 [Mycoplasma penetrans HF-2] >gi|26454200|dbj|BAC44529.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (113 aa)
Score = 91, Expect = 6.5e-02, Identities = 21/42 (50%), Positives = 32/42 (76%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           +++D+  LK D+  +K D+  LK+DVS+I +CPTI RELAQ+
  S:    71 LKTDVAQLKTDMVEVKADITQLKKDVSRIMKCPTIVRELAQI 112
>gi|26554302|ref|NP_758236.1| hypothetical protein MYPE8480 [Mycoplasma penetrans HF-2] >gi|26454311|dbj|BAC44640.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (181 aa)
Score = 91, Expect = 7.6e-02, Identities = 21/42 (50%), Positives = 33/42 (78%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           +++D+  +K D+  LK DV+ LK+DVS+I +CPTI RELA++
  S:   139 LKTDMVEVKADIVELKTDVSQLKKDVSRIMKCPTIVRELAEI 180
>gi|26554019|ref|NP_757953.1| hypothetical protein MYPE5670 [Mycoplasma penetrans HF-2] >gi|26454027|dbj|BAC44357.1| hypothetical protein [Mycoplasma penetrans HF-2] (118 aa)
Score = 90, Expect = 9.1e-02, Identities = 24/52 (46%), Positives = 37/52 (71%)
  Q:    17 PKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIKR 68
           PKD    I  +LGKILDK+++IE D++ LK+DV  LK D+  +K D+ ++K+
  S:    19 PKDKDSSIEVILGKILDKMDVIELDLKTLKEDVAQLKTDMVQVKADIVEMKK 70
>gi|26554301|ref|NP_758235.1| hypothetical protein MYPE8470 [Mycoplasma penetrans HF-2] >gi|26454310|dbj|BAC44639.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (148 aa)
Score = 90, Expect = 1.0e-01, Identities = 20/42 (47%), Positives = 33/42 (78%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           +++D+  +K D+  LK DV+ L++DVS+I +CPTI RELA++
  S:   106 LKTDMVEVKADIVELKTDVSQLEKDVSRIMKCPTIIRELAEI 147
>gi|26553798|ref|NP_757732.1| hypothetical protein MYPE3430 [Mycoplasma penetrans HF-2] >gi|26453805|dbj|BAC44136.1| hypothetical protein [Mycoplasma penetrans HF-2] (90 aa)
Score = 86, Expect = 2.6e-01, Identities = 20/42 (47%), Positives = 33/42 (78%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIARELAQL 79
           +++D+  +K D+  LK DV+ LK+DVS+I +CPT+ RELA++
  S:    48 LKTDMVEVKADILELKTDVSQLKKDVSRIMKCPTVVRELAEI 89
>gi|26554281|ref|NP_758215.1| hypothetical protein MYPE8270 [Mycoplasma penetrans HF-2] >gi|26454290|dbj|BAC44619.1| hypothetical protein [Mycoplasma penetrans HF-2] (135 aa)
Score = 83, Expect = 5.3e-01, Identities = 22/39 (56%), Positives = 28/39 (71%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIAREL 76
           +++D+  LK DV  LK DVA LK DV+ IK CPTI +EL
  S:    93 LKTDVAQLKVDVAELKTDVAQLKVDVAAIKACPTIQKEL 131
>gi|32455415|ref|NP_862721.1| hypothetical protein pUH24_04 [Synechococcus elongatus PCC 7942] >gi|97585|pir||S20527 hypothetical protein B - Synechococcus sp. (strain PCC 7942) plasmid pUH24 >gi|247788|gb|AAB21871.1| pmaA [Synechococcus sp. PCC 7942] (147 aa)
Score = 83, Expect = 5.5e-01, Identities = 20/46 (43%), Positives = 29/46 (63%)
  Q:    22 DPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDVSKIK 67
           D I   LG+I D+L+ +ESD+  LK DV  ++  +A L  DV KI+
  S:    64 DTIDARLGRIEDRLDRVESDLSELKTDVKEVRSSLAELTGDVRKIE 109
>gi|26554282|ref|NP_758216.1| hypothetical protein MYPE8280 [Mycoplasma penetrans HF-2] >gi|26454291|dbj|BAC44620.1| hypothetical protein [Mycoplasma penetrans HF-2] (129 aa)
Score = 83, Expect = 5.6e-01, Identities = 23/39 (58%), Positives = 29/39 (74%)
  Q:    38 IESDIRVLKKDVTVLKEDVAVLKEDVSKIKRCPTIAREL 76
           +++D+  LK DVT LK DVA LK DV+ IK CPTI +EL
  S:    87 LKTDVAQLKVDVTELKTDVAQLKVDVAAIKACPTIQKEL 125