>gi|26553564|ref|NP_757498.1| hypothetical protein MYPE1100 [Mycoplasma penetrans HF-2] >gi|26453570|dbj|BAC43902.1| hypothetical protein [Mycoplasma penetrans HF-2] (90 aa)
Score = 294, Expect = 2.0e-25, Identities = 90/90 (100%), Positives = 90/90 (100%)
  Q:     1 MNKKTLEKKKIYRICCLSKQKYEINKLVKITKVKTNIFINDLNIKGRSVYFLKDEVKKININKFYNLINARLKLNLEEVDKQKISQFLNG 90
           MNKKTLEKKKIYRICCLSKQKYEINKLVKITKVKTNIFINDLNIKGRSVYFLKDEVKKININKFYNLINARLKLNLEEVDKQKISQFLNG
  S:     1 MNKKTLEKKKIYRICCLSKQKYEINKLVKITKVKTNIFINDLNIKGRSVYFLKDEVKKININKFYNLINARLKLNLEEVDKQKISQFLNG 90