>gi|26553565|ref|NP_757499.1| translation initiation factor IF-2 [Mycoplasma penetrans HF-2] >gi|81846243|sp|Q8EWU0|IF2_MYCPE Translation initiation factor IF-2 >gi|26453571|dbj|BAC43903.1| translation initiation factor IF-2 [Mycoplasma penetrans HF-2] (620 aa)
Score = 2892, Expect = 0.0e+00, Identities = 620/620 (100%), Positives = 620/620 (100%)
  Q:     1 MEVFMAKNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           MEVFMAKNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE
  S:     1 MEVFMAKNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
>gi|13357880|ref|NP_078154.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762062|ref|YP_001752402.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920150|ref|ZP_02931550.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508780|ref|ZP_02958246.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701844|ref|ZP_02971508.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189028347|sp|B1AIV8|IF2_UREP2 Translation initiation factor IF-2 >gi|20138527|sp|Q9PQH1|IF2_UREPA Translation initiation factor IF-2 >gi|11357061|pir||B82906 translation initiation factor IF-2 UU320 [imported] - Ureaplasma urealyticum >gi|6899297|gb|AAF30729.1|AE002129_5 translation initiation factor IF-2 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827639|gb|ACA32901.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902520|gb|EDT48809.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675724|gb|EDT87629.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701138|gb|EDU19420.1| translation initiation factor IF-2 [Ureaplasma parvum serovar 6 str. ATCC 27818] (614 aa)
Score = 1482, Expect = 4.3e-162, Identities = 313/608 (51%), Positives = 429/608 (70%)
  Q:    13 SKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS---EKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           +K   K+  DNR  ID+K   KKV+ G+ +G FVFT+ L+I E + K+NK   EII   F KG+  NLNT+LDE Q+GELCLE+  DFK E  +N +N L+NI F+D E  L  R PIVTIMGHVDHGKTTLLDTIRKS + A+EAG ITQ IGAYQ+      ITF DTPGHEAF++MRA GA+LTDIV+LVVAADDG+K QTEEAIDHA  A  PIIVF+NKMDK +AN EK+ +QL+ K ++ EE GG  + +KGSAL N+GI ELL++I++ AE+   KANP RLA G TIEA++DKG G +A LLVQ+GTL   DY++VG  YGK++ M D    EI+ ALPS PV++SG   +P +GDK++   DEK  + ++   +++++  ++  L +        +  +K +N+I+K D  GSLEA+KG+ SSI + G    L+R+AIG+I+ESD+ LA+TS ++++ FN + S  + D A S+G+ I NY+IIY+ K+++E  +KG LDP+ +E+ IG  ++ +L+ HS +G I G RV+ G+IKRNA  R+ R D  +I N+KI +L+H KDS+    A KECG T+ NFND  E DI+E+Y  V + H+
  S:     2 AKKNIKQKKDNRIAIDVKKHIKKVDVGVFDGTFVFTSPLSISELAPKLNKSPNEIIMRYFKKGVVYNLNTILDEEQIGELCLEYDLDFKIEKNVNTENLLENIYFDDLEIDLVARAPIVTIMGHVDHGKTTLLDTIRKSSITASEAGGITQHIGAYQIIKDNRAITFIDTPGHEAFTEMRARGANLTDIVILVVAADDGIKMQTEEAIDHAKAANVPIIVFVNKMDKYEANPEKVLNQLSAKEIVAEELGGDVVFVKGSALKNEGISELLDSILLIAELNNYKANPNRLAYGTTIEANLDKGHGPLATLLVQNGTLRKGDYLVVGSTYGKIRNMFDEYDNEIEIALPSKPVKVSGFEEVPTAGDKFLALADEKQARAIANDVKQKKMRLERAMLQSSDIRTKIANGELKNINLIIKADVQGSLEALKGIFSSINIEGVTTTLIRSAIGTISESDVRLAQTSDAIIIGFNVRASRIIKDLADSVGVQIMNYDIIYKFKEDLELWMKGTLDPIIIEEVIGEAKVLKLFKHSQVGTICGCRVINGKIKRNALVRVLR-DGIVIYNSKIATLQHNKDSVNEVIADKECGLTIANFNDIKENDIIEVYIKVEKKHD 611
>gi|188568595|ref|ZP_03005388.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 2] (614 aa)
Score = 1477, Expect = 1.5e-161, Identities = 313/608 (51%), Positives = 430/608 (70%)
  Q:    13 SKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS---EKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           +K   K+  DNR  ID+K   KKV+ G+  G FVFT+ L+I E + K+NK + EII   F KG+  NLNT+LDE Q+GELCLE+  DFK E  +N +N L+NI F+D E  L  R PIVTIMGHVDHGKTTLLDTIRKS V A+EAG ITQ IGAYQ+      ITF DTPGHEAF++MRA GA+LTDIV+LVVAADDG+K QTEEAIDHA  A  PIIVF+NKMDK +AN +K+ +QL+ K ++ EE GG  + +KGSAL N+GI ELL++I++ AE+ + KANP RLA G TIEA++DKG G +A LLVQ+GTL   DY++VG  YGK++ M D    EI+ ALPS PV++SG   +P +GDK++   DEK  + ++   +++++  ++  L +        +  +K +N+I+K D  GSLEA+KG+ +SI + G    LVR+AIG+I+ESD+ LA+TS ++++ FN + +  + D A S+G+ I NY+IIY+ K+++E  +KG LDP+ VE+ IG  ++ +L+ HS +G I G RV+ G+IKRNA  R+ R D  +I N+KI +L+H KDS+    A KECG T+ NFND  E DI+E+Y  V + H+
  S:     2 AKKNIKQKKDNRIAIDVKKHIKKVDVGVFGGTFVFTSPLSIAELAPKLNKSANEIIMRYFKKGVVYNLNTILDEEQIGELCLEYDLDFKIEKNVNTENLLENIAFDDLEADLVARAPIVTIMGHVDHGKTTLLDTIRKSSVTASEAGGITQHIGAYQILKDDKPITFIDTPGHEAFTEMRARGANLTDIVILVVAADDGIKMQTEEAIDHAKAANVPIIVFVNKMDKYEANPDKVLNQLSAKEIVAEELGGDIVFVKGSALKNEGISELLDSILLIAELNDYKANPNRLAYGTTIEANLDKGHGPLATLLVQNGTLRKGDYLVVGSTYGKIRNMFDEYDNEIEMALPSKPVKVSGFEEVPTAGDKFLALADEKQARAIANDVKQKKIRLERAMLQSSDIRAKIANGELKNINLIIKADVQGSLEALKGIFNSINIEGVTTTLVRSAIGTISESDVRLAQTSDAIIIGFNVRANRIIKDLADSVGVQIMNYDIIYKFKEDLEAWMKGTLDPIIVEEVIGEAKVLKLFKHSQVGTICGCRVINGKIKRNALVRVLR-DGIVIYNSKIATLQHNKDSVNEVIADKECGLTIANFNDVKENDIIEVYVKVEKNHD 611
>gi|188592405|ref|ZP_03005774.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 10] (614 aa)
Score = 1476, Expect = 2.1e-161, Identities = 313/608 (51%), Positives = 430/608 (70%)
  Q:    13 SKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS---EKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           +K   K+  DNR  ID+K   KKV+ G+  G FVFT+ L+I E + K+NK + EII   F KG+  NLNT+LDE Q+GELCLE+  DFK E  +N +N L+NI F+D E  L  R PIVTIMGHVDHGKTTLLDTIRKS V A+EAG ITQ IGAYQ+      ITF DTPGHEAF++MRA GA+LTDIV+LVVAADDG+K QTEEAIDHA  A  PIIVF+NKMDK +AN +K+ +QL+ K ++ EE GG  + +KGSAL N+GI ELL++I++ AE+ + KANP RLA G TIEA++DKG G +A LLVQ+GTL   DY++VG  YGK++ M D    EI+ ALPS PV++SG   +P +GDK++   DEK  + ++   +++++  ++  L +        +  +K +N+I+K D  GSLEA+KG+ +SI + G    LVR+AIG+I+ESD+ LA+TS ++++ FN + +  + D A S+G+ I NY+IIY+ K+++E  +KG LDP+ VE+ IG  ++ +L+ HS +G I G RV+ G+IKRNA  R+ R D  +I N+KI +L+H KDS+    A KECG T+ NFND  E DI+E+Y  V + H+
  S:     2 AKKNIKQKKDNRIAIDVKKHIKKVDVGVFGGTFVFTSPLSIAELAPKLNKSTNEIIMRYFKKGVVYNLNTILDEEQIGELCLEYDLDFKIEKNVNTENLLENIAFDDLEADLVARAPIVTIMGHVDHGKTTLLDTIRKSSVTASEAGGITQHIGAYQILKGDKPITFIDTPGHEAFTEMRARGANLTDIVILVVAADDGIKMQTEEAIDHAKAANVPIIVFVNKMDKYEANPDKVLNQLSAKEIVAEELGGDIVFVKGSALKNEGIFELLDSILLIAELNDYKANPNRLAYGTTIEANLDKGHGPLATLLVQNGTLRKGDYLVVGSTYGKIRNMFDEYDNEIEMALPSKPVKVSGFEEVPTAGDKFLALADEKQARAIANDVKQKKIRLERSMLQSSDIRAKIANGELKNINLIIKADVQGSLEALKGIFNSINIEGVTTTLVRSAIGTISESDVRLAQTSDAIIIGFNVRANRIIKDLADSVGVQIMNYDIIYKFKEDLEAWMKGTLDPIIVEEVIGEAKVLKLFKHSQVGTICGCRVINGKIKRNALVRVLR-DGIVIYNSKIATLQHNKDSVNEVIADKECGLTIANFNDVKENDIIEVYVKVEKNHD 611
>gi|171920974|ref|ZP_02932106.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179158|ref|ZP_02964869.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024162|ref|ZP_02996888.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039433|ref|ZP_02998197.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 8] >gi|188518620|ref|ZP_03004068.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524496|ref|ZP_03004496.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530884|ref|ZP_03005167.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867592|ref|ZP_03079594.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903000|gb|EDT49289.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208941|gb|EDU05984.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018793|gb|EDU56833.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997789|gb|EDU66886.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659601|gb|EDX52981.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660649|gb|EDX53904.1| translation initiation factor IF-2 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (614 aa)
Score = 1475, Expect = 2.3e-161, Identities = 313/608 (51%), Positives = 430/608 (70%)
  Q:    13 SKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS---EKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           +K   K+  DNR  ID+K   KKV+ G+  G FVFT+ L+I E + K+NK + EII   F KG+  NLNT+LDE Q+GELCLE+  DFK E  +N +N L+NI F+D E  L  R PIVTIMGHVDHGKTTLLDTIRKS V A+EAG ITQ IGAYQ+      ITF DTPGHEAF++MRA GA+LTDIV+LVVAADDG+K QTEEAIDHA  A  PIIVF+NKMDK +AN +K+ +QL+ K ++ EE GG  + +KGSAL N+GI ELL++I++ AE+ + KANP RLA G TIEA++DKG G +A LLVQ+GTL   DY++VG  YGK++ M D    EI+ ALPS PV++SG   +P +GDK++   DEK  + ++   +++++  ++  L +        +  +K +N+I+K D  GSLEA+KG+ +SI + G    LVR+AIG+I+ESD+ LA+TS ++++ FN + +  + D A S+G+ I NY+IIY+ K+++E  +KG LDP+ VE+ IG  ++ +L+ HS +G I G RV+ G+IKRNA  R+ R D  +I N+KI +L+H KDS+    A KECG T+ NFND  E DI+E+Y  V + H+
  S:     2 AKKNIKQKKDNRIAIDVKKHIKKVDVGVFGGTFVFTSPLSIAELAPKLNKSANEIIMRYFKKGVVYNLNTILDEEQIGELCLEYDLDFKIEKNVNTENLLENIAFDDLEADLVARAPIVTIMGHVDHGKTTLLDTIRKSSVTASEAGGITQHIGAYQILKGDKPITFIDTPGHEAFTEMRARGANLTDIVILVVAADDGIKMQTEEAIDHAKAANVPIIVFVNKMDKYEANPDKVLNQLSAKEIVAEELGGDIVFVKGSALKNEGIFELLDSILLIAELNDYKANPNRLAYGTTIEANLDKGHGPLATLLVQNGTLRKGDYLVVGSTYGKIRNMFDEYDNEIEMALPSKPVKVSGFEEVPTAGDKFLALADEKQARAIANDVKQKKIRLERSMLQSSDIRAKIANGELKNINLIIKADVQGSLEALKGIFNSINIEGVTTTLVRSAIGTISESDVRLAQTSDAIIIGFNVRANRIIKDLADSVGVQIMNYDIIYKFKEDLEAWMKGTLDPIIVEEVIGEAKVLKLFKHSQVGTICGCRVINGKIKRNALVRVLR-DGIVIYNSKIATLQHNKDSVNEVIADKECGLTIANFNDVKENDIIEVYVKVEKNHD 611
>gi|31544319|ref|NP_852897.1| translation initiation factor IF-2 [Mycoplasma gallisepticum R] >gi|39931204|sp|Q7NBZ4|IF2_MYCGA Translation initiation factor IF-2 >gi|31541163|gb|AAP56465.1| InfB/IF-2 [Mycoplasma gallisepticum R] (615 aa)
Score = 1431, Expect = 3.1e-156, Identities = 305/604 (50%), Positives = 427/604 (70%)
  Q:    12 KSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINC-NLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           K   +NKK VD R+ I+IKS  K+V+ G+K+GVF++T+ L+ID+F+KK+N+  A+IIK+ F KGIN  NLNT+L   Q+GELCL+ G DFK E  +  +N LDNI+F+D+++ L KRPPIVT+MGHVDHGKT+LLD IR + V + EAG ITQ IGAYQV+    LITF DTPGHEAF++MRA GA+LTDIVVLVVA DDG+KPQTEEAIDHA  A  PIIVF+NKMDK  AN +++  Q+++ ++  EE+GG T+ ++GSA+  +GI+ELL+AI+  AEI E KANP     GI IE+ ++ G G  A ++++ GTL V DYI +G  YGKV+ M D N   +  A PS PV+ISGL+ IP++G+K++    EK +KELS+  +L  +++K  +   +  +    N+ GIK +++I+K+D  GSLEAIK  +S+I + G   N++RA+ G I+E+DI LA+ S S V+ FN  VS ++ D A S  + I +Y IIY++ +++E+++KG LDPV+ E  IG   +R LW HS IG IAG  V +G++ +NA  R+ R D  II  +KI SL+     +      KECG  +EN+ND  E DI+E+YEIV
  S:     3 KKPTRNKKPVDQRSKINIKSYLKEVQVGVKDGVFIYTDPLSIDQFAKKVNQPVAKIIKHFFSKGINTINLNTILSLEQIGELCLDLGLDFKIEKSVTSENLLDNIEFKDKKEDLVKRPPIVTVMGHVDHGKTSLLDAIRSTNVTSNEAGGITQHIGAYQVKKNDELITFIDTPGHEAFTEMRARGANLTDIVVLVVAGDDGIKPQTEEAIDHAKNANVPIIVFVNKMDKSGANFDRVIQQISKYDLSPEEYGGDTIFVQGSAIKKEGINELLDAILTLAEINEYKANPNADPYGIVIESKLEPGLGPQATVIIKRGTLKVGDYICIGAAYGKVRIMQDENGNNLTEATPSRPVKISGLDAIPQAGEKFLGLATEKEVKELSDSYKLKQQKQKHLSLQESHEKRTRINTNGIKCVDLIIKSDVQGSLEAIKYAISNINIEGVTTNIIRASTGVISETDIKLAQASNSTVISFNLGVSKQIRDLANSDNVQILSYEIIYKMVEDLEKIMKGELDPVYEESVIGQAVVRVLWKHSKIGTIAGSYVTSGKVVKNALCRVLRDDV-IIYKSKIASLKSKTTFVDKVEHNKECGIVVENYNDIKEDDIIEVYEIV 610
>gi|110005295|emb|CAK99619.1| translation initiation factor if-2 protein [Spiroplasma citri] (617 aa)
Score = 1394, Expect = 6.1e-152, Identities = 295/604 (48%), Positives = 416/604 (68%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH-LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ-LNTKQRKLSNFGTNLNENSQGI-----KELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + +++  +NKK +  +    I+SQ K +E  +  GVF++   LTI EF++KINK  +EIIKY F KGI  N NT L E Q+GELCLEFG DFK+E  +  +N +++ +  D    L+KRPPIVTIMGHVDHGKTTLLDTIR + V +TE G ITQ IGAYQ++ K +  ITF DTPGHEAF++MRA G+ +TDIVVLVVAADDG+  QT+EAIDHA  A  PIIVF+NKMDK   N++ I  QL+++ +  EEWGG T  +KGSA   QGIDELL+ I++ A++MELKANP R A G  +E+ +++G G VA LLVQSGTL + D ++VG  +G V+ + D + K+IK+A PSTPV I GLN +P +GD+++V  DEKL +E++ KR+ ++T  ++  N   +L   S  I     K++N+ILK D  G++EA+K  L  I + G K+N++RA +G I+ESD+ L   S++ +V FN + ++ V   A   G+ I+ + IIY++ +EI    +G+LDP  VE+ +G  E+RQ++ HS IG IAG  V  G I R +  R+ R D  I+ + ++ SL+H KD I  A  G ECG T++N+ND  E D++E+Y
  S:     1 MSSQNNKQNKKTLAKKQRNRIQSQLKTIEAHVTEGVFIYDETLTIAEFAQKINKPVSEIIKYFFSKGIMLNQNTFLTEDQLGELCLEFGLDFKREKSVTHENLIESFEVNDDPASLEKRPPIVTIMGHVDHGKTTLLDTIRNTNVVSTEHGGITQHIGAYQIKTKNNEKITFVDTPGHEAFTQMRARGSAVTDIVVLVVAADDGVMLQTKEAIDHAKAAGVPIIVFVNKMDKVGINLDNILMQLSQEELTPEEWGGTTPYVKGSAKQKQGIDELLDTILLMADLMELKANPNRFALGTVLESHLNRGLGPVATLLVQSGTLNIKDALVVGYTFGYVRDLSDESGKKIKSAGPSTPVMIHGLNEVPNAGDRFMVFRDEKLAREIALKRKTIDTMNKRYKNQNFSLESLSAQIKDGQLKQINIILKADTQGTVEAVKASLLKINIAGLKINVLRATVGGISESDVTLGLASQAFIVGFNVRPTAHVRKKAEDEGVAIRLHTIIYKLTEEIVAAAEGMLDPEMVEEVLGQAEVRQIFRHSDIGTIAGCYVTDGIIPRKSRVRVLR-DGVIVYSGELASLKHIKDDIKEAKTGAECGLTIKNYNDLKEQDVIEVY 610
>gi|13507894|ref|NP_109843.1| translation initiation factor IF-2 [Mycoplasma pneumoniae M129] >gi|2497279|sp|P75590|IF2_MYCPN Translation initiation factor IF-2 >gi|1674382|gb|AAB96324.1| protein synthesis initiation factor 2 [Mycoplasma pneumoniae M129] (617 aa)
Score = 1290, Expect = 7.0e-140, Identities = 282/604 (46%), Positives = 398/604 (65%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE------NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           K K ++  K   DNR     K QF++V+TG+K+GVFV+   LT+ EF  K N  +A IIK+ FL G+   LN++L   Q+ + C+ FG+DFK E +I  DN + NIKF+D    L  RPPIVTIMGHVDHGKT+LLD IR++  AA E G ITQ IGAYQV+ ++   ITF DTPGHEAF+ MRA GA +TDIVVLVVA DDGLK QTEEAI HA  AK PIIVFINKMDK  AN + +  QL + +++ EEWGG T+ +KGSAL  +GI ELL++I++ AE+ + KAN    ++G  IE    KG G  A ++V+ GTL + D +++G  +GKV+ M D N   ++ A+PS PV+ISG + +P +G+K+IV +DEK  K ++ K +   KQ KL+   T +NE       S+ IK LN+I K D++GSL AIK  + SI+V G  +N++ + +G I+E+DI LA+ S +L+   N  +S  V + A   G+ +  +  I ++ +EIE +LKG L+PV+ + E+G  E+ QLW HS +G IAG  V TG++KR A  ++ R++ E I   +++SL+  K+ +    AGK CG  +    D    DI+ +YE
  S:     3 KHKPRHFQKNKFDNRAKTSAKQQFRQVKTGVKDGVFVYKGPLTVSEFCLKTNIPTANIIKHFFLNGVPLTLNSVLSTEQLADACVNFGFDFKVETEITHDNIISNIKFDDDPTQLSPRPPIVTIMGHVDHGKTSLLDAIRQTNTAAKEFGGITQKIGAYQVKNQEGKTITFIDTPGHEAFTGMRARGAQVTDIVVLVVAGDDGLKQQTEEAISHAKSAKTPIIVFINKMDKPTANPDMVIQQLNKFDLVPEEWGGDTIFVKGSALTKEGIQELLDSILLVAEVEDYKANFNAHSSGYAIEVQTTKGLGPTATIIVKRGTLKIGDIVVLGPAWGKVRTMQDENGVHLQEAMPSKPVQISGFDIVPVAGEKFIVFDDEKDAKLIANKFREQQKQ-KLNT--TQINEELKQKIKSKEIKVLNLIFKVDSDGSLAAIKQAMQSIDVPGMSVNIIHSGVGLISENDIMLAKASGALLFSLNLGLSQVVKNIASLQGVKVDVHYHIPKLAEEIENILKGQLEPVYEDVELGRAEVLQLWYHSKVGHIAGTLVKTGKVKRGALCKLLRRN-ETIYEGRVDSLKSEKNPVNQMEAGKNCGIVINGCEDIQVCDIILVYE 609
>gi|12044994|ref|NP_072804.1| translation initiation factor IF-2 [Mycoplasma genitalium G37] >gi|1352430|sp|P47388|IF2_MYCGE Translation initiation factor IF-2 >gi|3844735|gb|AAC71360.1| translation initiation factor IF-2 [Mycoplasma genitalium G37] >gi|166078787|gb|ABY79405.1| translation initiation factor IF-2 [synthetic Mycoplasma genitalium JCVI-1.0] (619 aa)
Score = 1263, Expect = 1.1e-136, Identities = 286/604 (47%), Positives = 395/604 (65%)
  Q:    10 KTKSKNKNKKI-VDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE-WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQ----GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           K ++ N+ KK   D R     K Q + V+TG+K+GVF++   LT+ EF+ K N   A IIK+ FL G+   +N++L   Q+ + C+ FG+DFK E ++  +N + NI+FED +DLL  RPPIVTIMGHVDHGKT+LLDTIRK+ V A E G ITQ IGAYQV+  +   ITF DTPGHEAF+ MRA GA +TDIVVLVVAADDG+K QTEEAI HA  A  PIIVFINKMDK  AN + +  QL + +++ E WGGKT+ + GSAL  QGI+ELL+ I++  E+   +AN    ++G  IE    KG G +A+++V+ GTL + D +++G  YG+V+ M D N   +K A PS PV+ISG + +P +G+K+IV +DEK  K ++ K +   KQ K +N   N     Q     IK LN+I K D++GSL+AIK  + +I V    L+++ AA+G I+ESDI LA+ S +L+   N  +S  V + A   G+ ++ +  I ++ +EIE +LKG LDPV+ E EIG  E+ QLW HS IG IAG  V +G+IKR    ++ R DKEII   +I+SL++ K  +     GK CG  +   ND   GDI+  YE
  S:     3 KNRAFNQVKKTKFDGRIKTSAKHQLRNVKTGVKDGVFIYKGPLTVSEFASKTNIAVANIIKHFFLNGLALTVNSVLTNEQLADACVNFGFDFKMETEVTHENIVANIQFEDSDDLLQPRPPIVTIMGHVDHGKTSLLDTIRKTNVTAKEFGGITQKIGAYQVKNHQNKTITFIDTPGHEAFTLMRARGAKVTDIVVLVVAADDGIKKQTEEAISHAKSANTPIIVFINKMDKPTANPDLVIQQLNKFDLVPEAWGGKTIFVMGSALTGQGINELLDNILLLGEVEGYQANYNAHSSGYAIEVQTSKGLGPIANVIVKRGTLKLGDIVVLGPAYGRVRTMHDENGNSLKQATPSKPVQISGFDIMPVAGEKFIVFDDEKDAKLIANKFKEQQKQ-KANNLTVNQTLKEQIKNKEIKILNLIFKADSDGSLQAIKQAVENINVAKISLSIIHAAVGQISESDIMLAKASGALLFSLNLGLSQTVKNIASLQGVKLEVHYHIPKLAEEIENILKGQLDPVYEEIEIGKAEVLQLWFHSKIGNIAGTIVKSGKIKRGNLCKLFR-DKEIIFEGRIDSLKNEKTPVNLIETGKNCGIVINGCNDIKIGDIIVAYE 610
>gi|50365111|ref|YP_053536.1| translation initiation factor IF-2 [Mesoplasma florum L1] >gi|81827309|sp|Q6F1H1|IF2_MESFL Translation initiation factor IF-2 >gi|50363667|gb|AAT75652.1| translation initiation factor IF-2 [Mesoplasma florum L1] (629 aa)
Score = 1255, Expect = 8.4e-136, Identities = 290/609 (47%), Positives = 408/609 (66%)
  Q:     5 MAKNVKTKSKNK--NKKIVDNRTNIDIKSQFKK-VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKF--EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-QLNTKQRKLSNFGTNLNENSQGI-----KELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI---FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           MAKN+KT  K +  NKK +  +    IK Q  + V TGI +GVFV+T  L+I +F+ +I K  AEI+KY F +G+  N N +L E QM EL LEFG+DF+KE  + ++NF + +    ED+ + L+ R PIVTIMGHVDHGKTTLLD+I+ + V   EAG ITQ+IGAYQV+ K    ITF DTPGHEAFS+MR+ GA++TDIV+L+VAADDG+ PQTEEAIDHA  A  PIIVFINK DK  A+ E++ ++L +  ++ EE+GG    ++GSA    G+D+L E I++ AE+ + KANP +LA G+ IEA +DK +G VA +LV+ GTL + D I+ G  YG +K M D   K++  A PS PV + GLN +P +GDK+IV NDEK+ + ++E + +      + SN   +L+   + I     K +N+I+K D  GS+EA+KG L+ I++ G KLN++RA++G+I  SD+ LA T    +V+   FN +  + V   A   GI I+ +NIIY++ +E+E   KG+LDP + E   GS EIR  + HS IG I G  +  G I+R +  RI R +  +I   ++ +L+H KD I  A    E G T++NFND  EGDIVE Y+
  S:     1 MAKNIKTNKKPQQVNKKEMSKQHAKQIKQQLNETVATGIIDGVFVYTEALSIADFANQIGKSVAEILKYFFAQGLMLNQNVVLSEEQMAELALEFGFDFRKEESLTKENFFEALDASEEDKPEDLEHRAPIVTIMGHVDHGKTTLLDSIKNTNVVGGEAGGITQAIGAYQVKNKDGKKITFIDTPGHEAFSEMRSRGANVTDIVILIVAADDGVMPQTEEAIDHAKLANVPIIVFINKCDKPGADPERVKAELMKYEIVAEEYGGDIPFVQGSAKQKIGLDQLEETILLIAEMQDYKANPNKLAKGVVIEAHLDKAKGPVASILVKEGTLDIRDMIIAGTTYGNIKHMEDETNKKVLKAGPSKPVVVYGLNEVPSAGDKFIVMNDEKMARTIAEAQAEKKLAAERQSNQIFSLDSIKKHIDDGELKAINLIVKADTQGSVEALKGSLTKIDIPGVKLNIIRASVGTITLSDVTLASTVTDGIVLIYGFNVRPDAVVRKKAEEEGIEIRLHNIIYKVIEELEDAAKGMLDPEYKEVVTGSAEIRATFKHSDIGTIGGFHITDGSIERKSKVRIIR-NGIVIYTGELATLKHLKDDIKEAKINSEGGLTIKNFNDIKEGDIVEGYK 623
>gi|169350441|ref|ZP_02867379.1| hypothetical protein CLOSPI_01209 [Clostridium spiroforme DSM 1552] >gi|169292761|gb|EDS74894.1| hypothetical protein CLOSPI_01209 [Clostridium spiroforme DSM 1552] (612 aa)
Score = 1231, Expect = 4.6e-133, Identities = 277/579 (47%), Positives = 385/579 (66%)
  Q:    34 KKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT--NLNENSQGIK-----ELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           K+ E+  K+GV V+   +T+ + ++KI +  A IIK LFL G    +N+ L + Q+  +CLE+G+D +K I++NE NF + I+  D E  L  R P+VTIMGHVDHGKTTLLDTIRKS V   E G ITQ IGAYQV+     +TF DTPGHEAF+ MRA GA +TDIV++VVAADDG+ PQT+EAIDHA  A  PI+V INK+DK+ A+ E+I  +++E  +L E+WGG T+  + SA    GIDELLE +IV AE+ +LKANP R A G  +E  +D+G G VA LLV++GTL   D I+VG  +G+V++M+D   K IK ALP+TPV I+GLN +P +GDK++V   EK  + + E R L  K  K  + G   +L++    IK     +LN+I+K D  G+ EA+K  L  I+V G ++N++R+  G I+ESD+ LA  SK+++  FN + ++KV   A   GI I+ +NIIY++ +EIE  +KG+L P   E   G  EIRQ+   S +G IAG  V  G I+RN   R+ R D  ++   K+ SL+  +D +   A+G ECG ++ENFND  EGDIVE Y
  S:    22 KQEESVAKDGVIVYEEGITVGQLAEKIGQTPANIIKVLFLLGTMVTINSALSDEQVELICLEYGFDAEKHIEVNEINF-EEIEIVDDESDLVPRCPVVTIMGHVDHGKTTLLDTIRKSAVVEGEFGGITQHIGAYQVDVNGKKVTFLDTPGHEAFTAMRARGAQVTDIVIIVVAADDGVMPQTKEAIDHAKAAGVPIVVAINKIDKEGADPERIKGEMSEYGLLPEDWGGDTVYCEISAKKGIGIDELLETLIVVAELADLKANPNRYAYGSVVEGKLDRGRGPVATLLVENGTLRAGDPIVVGTAHGRVRQMLDDRGKVIKEALPATPVEITGLNDVPVAGDKFMVFESEKQARSVGESR-LKAKLDKERSVGAAMSLDDLFSQIKDGEVLDLNIIVKADVQGTAEAVKASLEKIDVEGVRVNVIRSTAGGISESDVLLATASKAIIYGFNVRPNAKVRQKAEEEGIEIRLHNIIYKMVEEIETAMKGMLAPEIKEVITGQAEIRQVIKVSKVGNIAGCYVTDGFIRRNCGVRLIR-DGVVVYEGKLGSLKRFQDDVKEVASGFECGLSIENFNDIKEGDIVEGY 604
>gi|196247593|ref|ZP_03146295.1| translation initiation factor IF-2 [Geobacillus sp. G11MC16] >gi|196212377|gb|EDY07134.1| translation initiation factor IF-2 [Geobacillus sp. G11MC16] (735 aa)
Score = 1228, Expect = 1.0e-132, Identities = 268/566 (47%), Positives = 377/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F  +LT+ E +KK+ +  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++++ I+E NF + I+  D  + L +RPP+VTIMGHVDHGKTTLLD IR SKV   EAG ITQ IGAYQV      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+HA  A  PIIV INKMDK +AN +++  +L E N++ EEWGG T+  K SA    GID LLE I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ+GTL V D I+VG  YG+V+ MV+ + + +K A PS PV I+GL+ +P++GD+++V  DEK  +++ E R     Q + S     +      +  QG +KELN+I+K D  GS+EA+   L  I++ G ++ ++ AA+G+I ESDI LA TS ++V+ FN +  +     A S  + I+ + IIY + +EIE  +KG+LDP + EK IG  E+RQ +  S +G IAG  V  G+I R++  R+ R+   ++   +I+SL+  KD +   A G ECG T++NFND  EGD++E Y
  S:   158 FEGSLTVAELAKKLGREPSEIIKKLFMLGVMATINQDLDKDAIELICSDYGVEVEEKVTIDETNF-ETIEIVDAPEDLVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAYQVTVNGKKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDGVMPQTVEAINHAKAANVPIIVAINKMDKPEANPDRVMQELMEYNLVPEEWGGDTIFCKLSAKTQDGIDHLLEMILLVSEMEELKANPNRRALGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQAGDRFMVFEDEKKTRQIGEARAQRQLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDIEGVRVKIIHAAVGAITESDILLATTSNAIVIGFNVRPDTNAKRAAESENVDIRLHRIIYNVIEEIEAAMKGMLDPEYEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGI-VVYEGEIDSLKRYKDDVREVAQGYECGVTIKNFNDIKEGDVIEAY 727
>gi|138894783|ref|YP_001125236.1| translation initiation factor IF-2 [Geobacillus thermodenitrificans NG80-2] >gi|166232548|sp|A4IMD7|IF2_GEOTN Translation initiation factor IF-2 >gi|134266296|gb|ABO66491.1| Translation initiation factor IF-2 [Geobacillus thermodenitrificans NG80-2] (735 aa)
Score = 1228, Expect = 1.1e-132, Identities = 268/566 (47%), Positives = 377/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F  +LT+ E +KK+ +  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++++ I+E NF + I+  D  + L +RPP+VTIMGHVDHGKTTLLD IR SKV   EAG ITQ IGAYQV      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+HA  A  PIIV INKMDK +AN +++  +L E N++ EEWGG T+  K SA    GID LLE I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ+GTL V D I+VG  YG+V+ MV+ + + +K A PS PV I+GL+ +P++GD+++V  DEK  +++ E R     Q + S     +      +  QG +KELN+I+K D  GS+EA+   L  I++ G ++ ++ AA+G+I ESDI LA TS ++V+ FN +  +     A S  + I+ + IIY + +EIE  +KG+LDP + EK IG  E+RQ +  S +G IAG  V  G+I R++  R+ R+   ++   +I+SL+  KD +   A G ECG T++NFND  EGD++E Y
  S:   158 FEGSLTVAELAKKLGREPSEIIKKLFMLGVMATINQDLDKDAIELICSDYGVEVEEKVTIDETNF-ETIEIVDAPEDLVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAYQVTVNGKKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDGVMPQTVEAINHAKAANVPIIVAINKMDKPEANPDRVMQELMEYNLVPEEWGGDTIFCKLSAKTQDGIDHLLEMILLVSEMEELKANPNRRALGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQAGDRFMVFEDEKKARQIGEARAQRQLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDIEGVRVKIIHAAVGAITESDILLATTSNAIVIGFNVRPDTNAKRAAESENVDIRLHRIIYNVIEEIEAAMKGMLDPEYEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGI-VVYEGEIDSLKRYKDDVREVAQGYECGVTIKNFNDIKEGDVIEAY 727
>gi|167756911|ref|ZP_02429038.1| hypothetical protein CLORAM_02460 [Clostridium ramosum DSM 1402] >gi|167703086|gb|EDS17665.1| hypothetical protein CLORAM_02460 [Clostridium ramosum DSM 1402] (617 aa)
Score = 1227, Expect = 1.4e-132, Identities = 279/584 (47%), Positives = 386/584 (66%)
  Q:    29 IKSQF--KKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT--NLNENSQGIKE-----LNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +KS F  KK E   K+GV V+   +T+ + + KI +  A +IK LFL G    +N+ L++ Q+  +CLE+G++ +K ++++E NF + I  +D E  L  R P+VTIMGHVDHGKTTLLDTIRKS V   E G ITQ IGAYQVE     +TF DTPGHEAF+ MRA GA +TDIV++VVAADDG+ PQT+EAIDHA  A  PI+V INK+DK+ A+ E+I  ++AE  +L E WGG T+  + SA    GI+ELLE + V AE+ +LKANP R A G  +E  +DKG G VA LLV++GTL   D I+VG  +G+V++M+D   K IK ALP+TPV I+GLN +P +GDK++   +EK  + + E R L  KQ K  + G   +L++    IKE     LN+I+K D  G+ EA+K  L  I+V G ++N++R+  G I+ESD+ LA  S++++  FN + ++KV   A   GI I+ +NIIY++ +EIE  +KG+L P   E   G  EIRQ+   S +G IAG  V  G I+RN   R+ R D  ++   K+ SL+  +D     AAG ECG ++ENFND  EGDIVE Y
  S:    20 LKSNFPTKKEEIVAKDGVIVYEEGITVGQLADKIGQTPANVIKVLFLLGTMVTINSSLNDEQVELICLEYGFEVEKHVEVSEVNF-EEIDIQDDEKDLQPRCPVVTIMGHVDHGKTTLLDTIRKSAVVEGEFGGITQHIGAYQVEVNGKKVTFLDTPGHEAFTAMRARGAQVTDIVIIVVAADDGVMPQTKEAIDHAKAAGVPIVVAINKIDKEGADPERIKGEMAEHGLLPEGWGGDTVYCEISAKKRIGIEELLETLTVVAELADLKANPNRYAYGSVVEGKLDKGRGPVATLLVENGTLRAGDPIVVGTSFGRVRQMLDDRGKIIKEALPATPVEITGLNDVPVAGDKFMAFENEKQARSVGETR-LKAKQDKERSSGAALSLDDLYSQIKEGEMIDLNIIVKADVQGTAEAVKASLEKIDVDGVRVNVIRSTAGGISESDVLLASASQAIIYGFNVRPNAKVRQKAEEEGIEIRLHNIIYKMVEEIETAMKGMLAPEIKEVVTGQAEIRQVIKVSKVGNIAGCYVTDGFIRRNCGIRLLR-DSVVVYEGKLGSLKRFQDDAKEVAAGFECGLSIENFNDIKEGDIVEGY 609
>gi|47458987|ref|YP_015849.1| translation initiation factor IF-2 [Mycoplasma mobile 163K] >gi|81828484|sp|Q6KID8|IF2_MYCMO Translation initiation factor IF-2 >gi|47458315|gb|AAT27638.1| translation initiation factor if-2 [Mycoplasma mobile 163K] (600 aa)
Score = 1226, Expect = 1.8e-132, Identities = 266/597 (44%), Positives = 395/597 (66%)
  Q:    19 KIVDNRTNID-IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           K    ++N++ +K+Q  +++T +K+GVF FT  +TI+EFSKKI K + ++I + F +G   N N +++E ++ ELCLEF Y+FKKE QI   NF+D +   D    L++R PI+T+MGHVDHGKTTL+D IRKSK+  TEAG ITQ  GAYQ+E+    ITF DTPGHEAF++MR+ GA +TDIV+LVVAADDG+ PQT+EAIDHA  A  PIIVF+NKMDK + +I++I S L+  +V+ EEW G T  I GSAL NQGID+L +AI + AEI+ELKAN  R A G  IE+ +DKG+G+V+ L+VQ+GTL   D+I+ G  YG+++ + D N   +  A P TPV ++GLN +P +GD++I  +DE   K ++E++    KQ +L +  T + ++  GIK LN+ILK D  G  EAIK  L  I+    K+N+VR+++G+I +SDI LA+ S +++  FN + +  +  +A    + +K + IIY++ DE+  LL G+  P F E   G   I++++ +S +G IAG  V++G++      R+ R +   +    ++SL+  K+       G E G  ++ FND  E DI++ +E V
  S:     4 KKAKRKSNVEEVKTQLLEIKTELKDGVFTFTGPMTINEFSKKIKKQAKDVILHFFKQGKMYNANQIINEEEIAELCLEFDYEFKKEEQITVSNFMDTLVLSDEAKDLEERAPIITVMGHVDHGKTTLIDVIRKSKIVDTEAGGITQHTGAYQIEYNGKKITFIDTPGHEAFTQMRSRGAKVTDIVILVVAADDGVMPQTKEAIDHAKSANVPIIVFVNKMDKPNKDIDRILSALSTLDVVSEEWSGDTQFIYGSALKNQGIDKLFDAINLQAEILELKANRNRDAIGTIIESHLDKGKGSVSVLIVQNGTLTPRDFIVAGSQYGRIRSIEDTNGNSLDAAYPGTPVIVTGLNYVPNAGDRFIALSDESFAKNIAEQKAFVDKQAELISRNTIVVQD--GIKVLNIILKADVQGIAEAIKSKLLEIKNEEVKINVVRSSVGAITKSDILLAQASNAIIFGFNIRATGGIKTFAEESRVIVKTHTIIYELLDEVNELLNGLKAPKFKEVVTGEARIKKIFFYSKVGNIAGCEVISGKVTSGTKMRLIR-NGITVHEGILDSLQREKNQAREVLKGFEFGTHIKKFNDIKEDDIIQTFEDV 598
>gi|167925559|ref|ZP_02512650.1| translation initiation factor IF-2 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (620 aa)
Score = 1226, Expect = 2.1e-132, Identities = 288/606 (47%), Positives = 413/606 (68%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKK-VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNI-KFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL-ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQRKLSNFGTNLNE---NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI---FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +K + KN  K+   N+T  +IK Q K+ V TG+ +G+FV+T  L++ EF+ KINK    I+K+ F +G+  N NTLL E QMGELCLEFG+DFKKE  + ++N L  + +  D E  L +RPPIVTIMGHVDHGKTTLLD+I+ S V A+EAG ITQ+IGAYQ+  K +  ITF DTPGHEAF++MR+ GA++TDIVVL+VAADDG+ PQTEEAIDHA  A  PIIVFINK+DK  A+  ++ ++L +  ++ EE+GG    I+GSA+    +D+L + II+ +E+  LKANP + A+G+ +EA +DK +G VA +LVQ GTL + D ++ G  +G +K + D  + ++  A PS PV + GLN +PK+GDK++V NDEK+ +E+SE   K+Q   ++R    F  +  +   +   +K + +I+K D  GS+EA+K  LS I ++G K+N++RA++G+I+ SDI LA T +  +VI   FN +  + V   A    I I+ +NIIY++ +E+E   KGILDP   E  +G  ++R L+ HS+IG I G  VL G I RNA  R+ R +  ++ + +INSL+H K       AG E G T++NFND  E DI E Y+I
  S:     1 MKKQVKNIKKQKAQNQTK-NIKKQLKEEVNTGLIDGIFVYTEPLSVIEFATKINKPLTAILKHYFNQGLLLNQNTLLTEEQMGELCLEFGFDFKKETTVTKENILQTLLETVDDEKHLKERPPIVTIMGHVDHGKTTLLDSIKNSNVVASEAGGITQAIGAYQITTKHNKKITFIDTPGHEAFTEMRSRGANVTDIVVLIVAADDGVMPQTEEAIDHAKLANVPIIVFINKIDKPGADPNRVKTELMKYGLVAEEFGGDIPFIEGSAIKKINLDKLQDTIILISELENLKANPDKFASGVVLEAHLDKAKGPVASVLVQQGTLEIKDIMIAGTTFGSIKHIEDEFKHKVLKAEPSKPVVVYGLNQVPKAGDKFVVINDEKMAREISEAQLKKQQEEERRTKQAFTLDAIKQHIDEGELKNITLIIKADTQGSVEALKNSLSKINISGVKINIIRASVGAISLSDISLASTVRDGLVIVYGFNVRPDAIVRKKAEEDHIEIRLHNIIYKVIEELEDAAKGILDPEIKEVVLGQAQVRALFRHSAIGTIGGFYVLDGVIPRNAKIRVIR-NGVVVYDGEINSLQHQKQDAKEIKAGFEGGLTIKNFNDIKEEDIFEAYKI 616
>gi|124208|sp|P04766|IF2_BACST Translation initiation factor IF-2 >gi|39954|emb|CAA27987.1| unnamed protein product [Geobacillus stearothermophilus] (741 aa)
Score = 1223, Expect = 3.8e-132, Identities = 266/566 (46%), Positives = 376/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F  +LT+ E +KK+ +  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++++ I+E NF + I+  D  + L +RPP+VTIMGHVDHGKTTLLD IR SKV   EAG ITQ IGAYQV      ITF DTPGHEAF+ MRA G  +TDIV+LVVAADDG+ PQT EAI+HA  A  PIIV INKMDK +AN +++  +L E N++ EEWGG T+  K SA   +G+D LLE I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ+GTL V D I+VG  YG+V+ MV+ + + +K A PS PV I+GL+ +P++GD+++V  DEK  +++ E R     Q + S     +      +  QG +KELN+I+K D  GS+EA+   L  I+V G ++ ++ AA+G+I ESDI LA  S ++V+ FN +  +     A S  + I+ + IIY + +EIE  +KG+LDP + EK IG  E+RQ +  S +G IAG  V  G+I R++  R+ R+   ++   +I+SL+  KD +   A G ECG T++NFND  EGD++E Y
  S:   164 FEGSLTVAELAKKLGREPSEIIKKLFMLGVMATINQDLDKDAIELICSDYGVEVEEKVTIDETNF-EAIEIADAPEDLVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAYQVTVNDKKITFLDTPGHEAFTTMRARGRQVTDIVILVVAADDGVMPQTVEAINHAKAANVPIIVAINKMDKPEANPDRVMQELMEYNLVPEEWGGDTIFCKLSAKTKEGLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQAGDRFMVFEDEKKARQIGEARAQRQLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAMKGMLDPEYEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGI-VVYEGEIDSLKRYKDDVREVAQGYECGLTIKNFNDIKEGDVIEAY 733
>gi|42560893|ref|NP_975344.1| translation initiation factor IF-2 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81829398|sp|Q6MTQ0|IF2_MYCMS Translation initiation factor IF-2 >gi|42492390|emb|CAE76986.1| translation initiation factor IF-2 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (620 aa)
Score = 1222, Expect = 5.3e-132, Identities = 288/606 (47%), Positives = 413/606 (68%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKK-VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNI-KFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL-ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQRKLSNFGTNLNE---NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI---FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +K + KN  K+   N+T  +IK Q K+ V TG+ +G+FV+T  L++ EF+ KINK    I+K+ F +G+  N NTLL E QMGELCLEFG+DFKKE  + ++N L  + +  D E  L +RPPIVTIMGHVDHGKTTLLD+I+ S V A+EAG ITQ+IGAYQ+    +  ITF DTPGHEAF++MR+ GA++TDIVVL+VAADDG+ PQTEEAIDHA  A  PIIVFINK+DK +A+  ++ ++L +  ++ EE+GG    I+GSA+    +D+L + II+ +E+  LKANP + A+G+ +EA +DK +G VA +LVQ GTL + D ++ G  +G +K + D  + ++  A PS PV + GLN +PK+GDK++V NDEK+ +E+SE   K+Q   ++R    F  +  +   +   +K + +I+K D  GS+EA+K  LS I ++G K+N++RA++G+I+ SDI LA T +  +VI   FN +  + V   A    I IK +NIIY++ +E+E   KGILDP   E  +G  ++R L+ HS+IG I G  VL G I RNA  R+ R +  ++ + +INSL+H K       AG E G T++NFND  E DI E Y+I
  S:     1 MKKQVKNIKKQKAQNQTK-NIKKQLKEEVNTGLIDGIFVYTEPLSVIEFATKINKPLTAILKHYFNQGLLLNQNTLLTEEQMGELCLEFGFDFKKETTVTKENILQTLLETVDDEKHLKERPPIVTIMGHVDHGKTTLLDSIKNSNVVASEAGGITQAIGAYQITTNHNKKITFIDTPGHEAFTEMRSRGANVTDIVVLIVAADDGVMPQTEEAIDHAKLANVPIIVFINKIDKPEADPNRVKTELMKYGLVAEEFGGDIPFIEGSAIKKINLDKLQDTIILISELENLKANPDKFASGVVLEAHLDKAKGPVASVLVQQGTLEIKDIMIAGTTFGSIKHIEDEFKHKVLKAEPSKPVVVYGLNQVPKAGDKFVVINDEKMAREISEAQLKKQQEEERRTKQAFTLDAIKQHIDEGELKNITLIIKADTQGSVEALKNSLSKINISGVKINIIRASVGAISLSDISLASTVRDGLVIVYGFNVRPDAIVRKKAEEDHIEIKLHNIIYKVIEELEDAAKGILDPEVKELVLGQAQVRALFRHSAIGTIGGFYVLDGIIPRNAKIRVIR-NGVVVYDGEINSLQHQKQDAKEIKAGFEGGLTIKNFNDIKEEDIFEAYKI 616
>gi|83319583|ref|YP_424317.1| translation initiation factor IF-2 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123740056|sp|Q2SSE6|IF2_MYCCT Translation initiation factor IF-2 >gi|83283469|gb|ABC01401.1| translation initiation factor IF-2 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (620 aa)
Score = 1222, Expect = 5.6e-132, Identities = 287/606 (47%), Positives = 413/606 (68%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKK-VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNI-KFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL-ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQRKLSNFGTNLNE---NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI---FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +K   KN  K+   N+T  +IK Q K+ V TG+ +G+FV+T  L+I EF+ KINK    I+K+ F +G+  N NTLL E QMGELCLEFG+DFKKE  + ++N L+ +    D E  L +RPPIVTIMGHVDHGKTTLLD+I+ S V A+EAG ITQ+IGAYQ+  K +  ITF DTPGHEAF++MR+ GA++TDIVVL+VAADDG+ PQTEEAIDHA  A  PIIVFINK+DK  ++  ++ ++L +  ++ EE+GG    I+GSA+    +D+L + II+ +E+  LKANP R A+G+ +EA +DK +G VA +LVQ G+L + D ++VG  +G +K + D  + ++  A PS PV + GLN +PK+GDK++V NDEK+ +E+SE   K+Q   ++R    F  +  +   +   +K + +I+K D  GS+EA+K  LS I ++G K+N++RA++G+I+ SDI LA T +  +VI   FN +  + V   A    I I+ +NIIY++ +E+E   KGILDP   E  +G  ++R L+ HS+IG I G  V+ G I RNA  R+ R +  ++ + +INSL+H K       AG E   T++NFND  EGDI E Y++
  S:     1 MKKPVKNIKKQKAQNQTK-NIKKQLKEEVNTGLIDGIFVYTEPLSILEFATKINKPVTVILKHYFNQGLLLNQNTLLTEEQMGELCLEFGFDFKKETSVTKENILETLLDTVDDEKHLKERPPIVTIMGHVDHGKTTLLDSIKNSNVVASEAGGITQAIGAYQITTKNNKKITFIDTPGHEAFTEMRSRGANVTDIVVLIVAADDGVMPQTEEAIDHAKLANVPIIVFINKIDKPGSDPNRVKTELMKYGLVAEEFGGDIPFIEGSAIKKINLDKLEDTIILISELENLKANPDRFASGVVLEAHLDKAKGPVASVLVQQGSLEIKDIMVVGTTFGSIKHIEDEFKHKVLKAEPSKPVVVYGLNQVPKAGDKFVVINDEKMAREISEAQLKKQQEEERRTKQAFTLDAIKQHIDEGELKNITLIIKADTQGSVEALKNSLSKINISGVKINIIRASVGAISLSDISLASTVRDGLVIVYGFNVRPDAIVRKKAEEDRIEIRLHNIIYKLIEELEDAAKGILDPEIKEVVLGQAQVRALFRHSAIGTIGGFYVVDGAITRNAKIRVIR-NGVVVYDGEINSLQHQKQDAKEVKAGFEGALTIKNFNDIKEGDIFEAYKL 616
>gi|171324503|ref|ZP_02913017.1| translation initiation factor IF-2 [Geobacillus sp. WCH70] >gi|171089545|gb|EDT35873.1| translation initiation factor IF-2 [Geobacillus sp. WCH70] (732 aa)
Score = 1214, Expect = 4.8e-131, Identities = 272/566 (48%), Positives = 374/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F   LT+ E +KK+ +  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++++ I+E NF      +D EDL++ RPP+VTIMGHVDHGKTTLLD+IR SKV   EAG ITQ IGAYQV      ITF DTPGHEAF+ MRA GA +TDIVVLVVAADDG+ PQT EAI+HA  A  PIIV INKMDK DAN +++  +L E N++ EEWGG T+  K SA   +GID LLE I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ+GTL V D I+VG  YG+V+ MV+   + +K A PSTPV I+GL+ +P++GD+++V  DEK  +++ E R       Q N K R  L +    + +    +KELN+I+K D  GS+EA+   L  IEV  +       A+G+I ESDI LA TS ++V+ FN +  +     A S  + I+ + IIY++ +EIE  +KG+LDP + EK IG  E+RQ +  S +G IAG  V  G+I R++  R+ R+   ++   +I+SL+  KD +     G ECG T++NFND  EGD++E Y
  S:   155 FEGTLTVAELAKKLGREPSEIIKKLFMLGVMATINQELDKDAIELICSDYGVEVEEKVVIDETNFESIEIVDDPEDLVE-RPPVVTIMGHVDHGKTTLLDSIRHSKVTEQEAGGITQHIGAYQVTVNDKKITFLDTPGHEAFTTMRARGAQVTDIVVLVVAADDGVMPQTVEAINHAKAANVPIIVAINKMDKPDANPDRVMQELMEYNLIPEEWGGDTIFCKLSAKTGEGIDNLLEMILLVSEMEELKANPNRRATGTVIEAKLDKGRGPVATLLVQAGTLHVGDPIVVGCTYGRVRAMVNDTGRRVKEAGPSTPVEITGLHEVPQAGDRFMVFEDEKKARQIGEARAQKQLMEQRNMKARVSLDDLFEQIKQGE--MKELNIIVKADVQGSVEALVAALQKIEVERSARQNYPCAVGAITESDILLATTSNAIVIGFNVRPDANAKRVAESEKVDIRLHRIIYKVIEEIEAAMKGMLDPEYEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGI-VVYEGEIDSLKRFKDDVKEVMQGYECGLTIKNFNDIKEGDVIEAY 724
>gi|15828676|ref|NP_326036.1| translation initiation factor IF-2 [Mycoplasma pulmonis UAB CTIP] >gi|81855825|sp|Q98R05|IF2_MYCPU Translation initiation factor IF-2 >gi|14089618|emb|CAC13378.1| TRANSLATION INITIATION FACTOR IF-2 [Mycoplasma pulmonis] (603 aa)
Score = 1214, Expect = 5.1e-131, Identities = 264/601 (43%), Positives = 400/601 (66%)
  Q:    13 SKNKNKKIVDNRTNI-DIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKEL-NVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           +K ++K++    +NI +IK+Q   V+T +KNGVF+F++ +TI EF++KIN    EI+K  FLKG    LN +L E ++ +LC + GYDF+ E +IN  NFLDNI+FED+++ L+ RPPI+TIMGHVDHGKTTL+D IRKS + +TE+  ITQ  GAYQ+ +    ITF DTPGHEAFS MRA G+ +TDIV+LVVAADDG+KPQT+EAI HA  A  PIIVF+NKMDK   ++ ++ + L+   +  EEWGG T ++ GSAL  +GI++L E I + AEI++LK NPKR   G+ IE+ MDKG G++  ++VQ+GTL   D+++ G  YG+VK + D N+K +K     TPV + GLN  P +G+K++  NDEK  K+LS++R+ + KQ K       ++      K++ N+I+K+D  G+ EAIK L+  I     ++ +V   IG IN SD+ LA+TS S ++ FN+K +  +   A  + I I +++++Y+I D +   +  ++ P F ++ IG  +I +++ +S +G IAG  +  G +K ++F ++ RK+K +I + ++ +LR G D +     G E G  ++NF+D  E D +EI E
  S:     2 AKKRDKRL----SNINEIKTQIINVKTELKNGVFIFSSPMTIGEFAQKINISGTEIVKEYFLKGKMYTLNHILSEEEIADLCFKHGYDFRVEKEINASNFLDNIEFEDKKEDLETRPPIITIMGHVDHGKTTLIDKIRKSNIVSTESSGITQHTGAYQIIYDNKKITFLDTPGHEAFSAMRARGSKVTDIVILVVAADDGVKPQTKEAIAHAQAANVPIIVFVNKMDKPSKDLNRLKNDLSVSGINLEEWGGDTPIVYGSALKGEGIEKLFENINLQAEILDLKFNPKRHPLGVVIESKMDKGVGSLTTVIVQNGTLHKGDFLVAGPRYGRVKAIYDTNKKPLKKVGAGTPVFVIGLNYAPSAGEKFVGINDEKYAKKLSQEREDSEKQEKFLQQTQTISIRRDNDKKIFNIIIKSDTQGTAEAIKDLILQIANDEIEVIVVSYGIGVINNSDLLLAQTSNSEIIGFNSKPNPNIKQQAEDLNIQINSFDVVYKIVDYLNEKINKMVKPKFEKRTIGRAKILKVFFYSKVGNIAGCLMEEGHVKSDSFVKVYRKNK-LIHDGRVETLRKGPDEVKKIEKGFEFGLRIKNFDDIKEDDQLEIIE 599
>gi|15614976|ref|NP_243279.1| translation initiation factor IF-2 [Bacillus halodurans C-125] >gi|20138522|sp|Q9KA77|IF2_BACHD Translation initiation factor IF-2 >gi|10175033|dbj|BAB06132.1| translation initiation factor IF-2 [Bacillus halodurans C-125] (730 aa)
Score = 1212, Expect = 7.4e-131, Identities = 269/566 (47%), Positives = 373/566 (65%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F+ +LT+ E ++K+NK  +E+IK L   G+   +N  LD+  +  +C ++G + ++E+ I+E + +++   ED   LL +RPP+VTIMGHVDHGKTTLLD+IR +KV   EAG ITQ IGAYQV  +   ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT+EAI HA  A  PIIV +NKMDK+ AN +++  +L E  ++ E WGG+T+ +  SAL   GIDELLE +++ AE+ ELKANP RLA G  IEA +DKG G VA LLVQSGTL V D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD++    DEK  + + E R    K+ + +     +     N+  QG +KE+NVI+K D  GS+EA++G L  I+V G K+N++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + +IY   +EIE  +KG+LDP + EK IG VE+R  +  S IG IAG  V  G+I R+A  R+ R D  +I    IN+L+  KD +   A G ECG TLENFND  EGDI+E Y
  S:   153 FSGSLTVGELAEKLNKEPSELIKKLMFLGVMATINQELDKDSIELICEDYGVEVEEEVIIDETD-IESYVVEDDPSLLKERPPVVTIMGHVDHGKTTLLDSIRNTKVTEGEAGGITQHIGAYQVTVEGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTKEAISHAKAAGVPIIVAVNKMDKETANPDRVMQELTEYELVPEAWGGETIFVNVSALTGTGIDELLEMVLLVAEVEELKANPDRLARGTVIEAELDKGRGPVATLLVQSGTLKVGDPIVVGSTFGRVRAMVNDEGRRVKAVGPSTPVEITGLNDVPQAGDQFQAFADEKKARSIGEARATRQKEEERAETSKVSLDDLFNQIQQGEVKEINVIIKADVQGSVEAMRGSLEKIDVEGVKINIIHTGVGAITESDIILAAASNAIVIGFNVRPDGGAKRTAEQEKVDIRLHRVIYNAIEEIEAAMKGMLDPEYEEKIIGQVEVRTTFKVSRIGTIAGSYVTEGKIVRDATVRLIR-DGVVIYEGSINALKRFKDDVKEVAQGYECGITLENFNDIKEGDIIEAY 722
>gi|160913527|ref|ZP_02076218.1| hypothetical protein EUBDOL_00003 [Eubacterium dolichum DSM 3991] >gi|158434079|gb|EDP12368.1| hypothetical protein EUBDOL_00003 [Eubacterium dolichum DSM 3991] (612 aa)
Score = 1207, Expect = 3.1e-130, Identities = 267/604 (44%), Positives = 392/604 (64%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN-TKQRKLSNFGTNLNENSQGIKE-----LNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           + + K K  +  +N+ N   K+   +V+         ++  +T+ E ++K+N++++EIIK LF+ G    +N+ LD+  +  +C+EF  + +KE+ ++E +F + ++ E+  D L  RPP+VTIMGHVDHGKTTLLDTIRK+ V   E G ITQ IGAYQV      +TF DTPGHEAF+ MRA GA +TDIV++VVAADDG+ PQT+EA+DHA  A  P+IV +NKMDK +AN +++ S+++E  ++ EEWGG T+    SA    G+DELLE I+V AE+ + KANP +LA G  IEA +DKG G V  LLVQSGTL   D ++VG  YGKV+KM D   +EIKTALPS PV I GLN +P +GD + V   +K  ++++E R      Q + ++   +L++ ++ I+E     +NVI+K D  GS EA+K  +  I+V G K+N++R+  G+I ESDI LA  S++++  FN + S+ V   A   GI I+ +NIIY+  +E+E  +KG+L PV+ E  IG  E+RQL+  S IG IAG  V  G +++    R+ R D  ++   K+ SL+  ++      +G +CG T+ENFND    DI+E YE
  S:     3 RQQKKGKGNRKGNNKGNFAPKAPRVEVKE------ITYSLPITVGELAEKLNRNASEIIKLLFMMGTMVTINSSLDDETIELICMEFNVECEKEVVVDETDFEELLEEEEDSDKLVGRPPVVTIMGHVDHGKTTLLDTIRKTHVTQGEFGGITQHIGAYQVNVGGKKVTFLDTPGHEAFTAMRARGAKVTDIVIIVVAADDGVMPQTKEAVDHAKAAGVPVIVAVNKMDKPEANRDRVVSEMSELGLMPEEWGGDTIYANISAKTGMGVDELLETILVVAEVQDYKANPDKLAVGSVIEAKLDKGRGPVTTLLVQSGTLHTGDAVVVGTAYGKVRKMTDDRGREIKTALPSMPVEIIGLNDVPIAGDIFKVFESDKKARQIAEARLYKRIDQERNASSAMSLDDLARQIEEGEVQDVNVIIKADVQGSAEAVKASMEKIDVQGVKVNVIRSTAGAITESDILLASASRAVIYGFNVRPSALVRKKAEEEGIEIRLHNIIYKALEEMENAMKGMLAPVYEEVVIGQAEVRQLYKASKIGTIAGCMVTDGALRKECGVRLIR-DGVVVYTGKLGSLKRFQNDAKEVTSGFDCGLTIENFNDIKVDDIIEAYE 605
>gi|126652568|ref|ZP_01724733.1| translation initiation factor IF-2 [Bacillus sp. B14905] >gi|126590696|gb|EAZ84812.1| translation initiation factor IF-2 [Bacillus sp. B14905] (760 aa)
Score = 1207, Expect = 3.2e-130, Identities = 261/566 (46%), Positives = 376/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F  +L++ E +KK+++  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++EI+++  +      FE  E++    L +RPP+VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQV      ITF DTPGH AF+ MRA GA +TD+ +LVVAADDG+ PQT EAI+HA  A+ PIIV +NKMDK  AN +++  +L E  ++ E WGG+T+ +  SAL  +GID LLE I++ AE+ ELKANP RLA G  IEA +DKG G+VA LLVQ GTL V D I+VG  +G+V+ MV+   + +K A PSTPV I+GLN +P++GD+++V  DEK  +++ E R ++  Q + S            + SQG +KELN+I+K D  G++EA+   L  I+V G  + ++    G+I ESDI LA  S ++V+ FN +        A   G+ I+ + IIY++ +EIE+ +KG+LDP F EK IG  E+RQ    S +G IAG  ++ G++ R++  R+ R D  +I   ++++L+  KD +   A G ECG T+ NFND  EGDI+E Y
  S:   180 FVESLSVAELAKKLHREPSEIIKKLFMLGVMATINQELDKDAIELICADYGVEVEEEIRVDITDL--ETHFEQTEEVNEAELSERPPVVTIMGHVDHGKTTLLDSIRNTKVTAGEAGGITQHIGAYQVTEGDKKITFLDTPGHAAFTTMRARGAKITDLTILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKMDKPSANPDRVMQELTEHGLVPEAWGGETIFVPISALKGEGIDTLLEMILLVAEVGELKANPDRLALGTVIEAQLDKGRGSVATLLVQDGTLKVGDPIVVGHTFGRVRAMVNDKGRRVKEAGPSTPVEITGLNDVPQAGDRFVVFEDEKTARQVGETRAMSAIQAQRSEKQRVTLDNLFEQMSQGEMKELNLIVKADVQGTVEAMAASLMKIDVEGVNVKIIHTGAGAITESDISLAAASNAIVIGFNVRPDVNAKRAAEEEGVDIRLHRIIYKVIEEIEQAMKGMLDPEFEEKIIGQAEVRQTIKVSKVGTIAGSYIIEGKVTRDSGVRVIR-DNVVIFEGELDTLKRFKDEVKEVARGYECGITITNFNDIREGDIIEAY 752
>gi|169827168|ref|YP_001697326.1| translation initiation factor IF-2 [Lysinibacillus sphaericus C3-41] >gi|168991656|gb|ACA39196.1| Translation initiation factor IF-2 [Lysinibacillus sphaericus C3-41] (758 aa)
Score = 1201, Expect = 1.4e-129, Identities = 262/566 (46%), Positives = 375/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F  +L++ E +KK+++  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++EI+++  +      FE  E++    L +RPP+VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQV      ITF DTPGH AF+ MRA GA +TD+ +LVVAADDG+ PQT EAI+HA  A+ PIIV +NKMDK  AN +++  +L E  ++ E WGG+T+ +  SAL  +GID LLE I++ AE+ ELKANP RLA G  IEA +DKG G+VA LLVQ GTL V D I+VG  +G+V+ MV+   + +K A PSTPV I+GLN +P++GD+++V  DEK  +++ E R ++  Q + S            + SQG +KELN+I+K D  G++EA+   L  I+V G  + ++    G+I ESDI LA  S ++V+ FN +        A   G+ I+ + IIY++ +EIE+ +KG+LDP F EK IG  E+RQ    S +G IAG  V  G++ R++  R+ R D  +I   ++++L+  KD +   A G ECG T+ NFND  EGDI+E Y
  S:   178 FVESLSVAELAKKLHREPSEIIKKLFMLGVMATINQELDKDAIELICADYGVEVEEEIRVDITDL--ETHFEQTEEVNEAQLSERPPVVTIMGHVDHGKTTLLDSIRNTKVTAGEAGGITQHIGAYQVTEGDKKITFLDTPGHAAFTTMRARGAKVTDLTILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKMDKPSANPDRVMQELTEHGLVPEAWGGETIFVPISALKGEGIDTLLEMILLVAEVGELKANPDRLALGTVIEAQLDKGRGSVATLLVQDGTLKVGDPIVVGHTFGRVRAMVNDKGRRVKEAGPSTPVEITGLNDVPQAGDRFVVFEDEKTARQVGETRAMSAIQAQRSEKQRVTLDNLFEQMSQGEMKELNLIVKADVQGTVEAMAASLMKIDVEGVNVKIIHTGAGAITESDISLAAASNAIVIGFNVRPDVNAKRAAEEEGVDIRLHRIIYKVIEEIEQAMKGMLDPEFEEKIIGQAEVRQTIKVSKVGTIAGSYVTEGKVTRDSGVRVIR-DNVVIFEGELDTLKRFKDEVKEVARGYECGITITNFNDIKEGDIIEAY 750
>gi|184155209|ref|YP_001843549.1| translation initiation factor IF-2 [Lactobacillus fermentum IFO 3956] >gi|183226553|dbj|BAG27069.1| translation initiation factor IF-2 [Lactobacillus fermentum IFO 3956] (775 aa)
Score = 1200, Expect = 2.2e-129, Identities = 260/571 (45%), Positives = 382/571 (66%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  +TN +   +  K +++  AEIIK LF+ G+  N N  LD   +  L  ++G   K+++Q++    D+F D  +  +  +L D RPP+VT+MGHVDHGKTTLLD IR S V   EAG ITQ+IGAYQV++   LITF DTPGH AF++MRA GA++TDI VLVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN + +  QL E  ++ E+WGG T+ +K SA   + IDELL+ I++ AE+MELKANP + A G  +EA +D+G+G+VA LLVQ GTL V D I+VG+ +G+V+ M + N + IK A PSTPV I+GLNG+P++GD ++V +DEK  +   E   KR  + K+R+ S+   +   +   +G +K L +I+K D  GS+EA+   L  I+V G +++++  A+G+I+ESD+ LA  S ++++ FN + +      A +  I I+ + +IY   +E+E  +KG+L+PV+ E+ +G VE+RQL+  S IG IAGG V++G+I R+A  R+ R D  +I   ++ SL+  KD       G ECG T++NFND  E D++E Y +
  S:   193 VLEYTNGMNAQDLGKILHRSPAEIIKKLFMLGVMVNQNQSLDADTIEILAADYGIGAKEKVQVDVADLDHFFDE-RINNDANLAD-RPPVVTVMGHVDHGKTTLLDKIRHSHVTEGEAGGITQAIGAYQVKYNDKLITFLDTPGHAAFTEMRARGANITDITVLVVAADDGVMPQTIEAINHAKAAGTPIIVVVNKIDKPGANPDHVTEQLTEYGLIPEDWGGDTIYVKVSAKFGKNIDELLDMILLQAEVMELKANPGQNAAGAVVEARLDQGKGSVATLLVQQGTLHVGDPIVVGDTFGRVRTMTNENGRRIKDATPSTPVEITGLNGVPEAGDHFVVFDDEKTARAAGEERAKRAEDEKRRRTSHVTLDNLFDTMKKGEMKSLPIIIKADVQGSVEALAQSLQKIQVDGVRVDIIHKAVGAISESDVTLAEASNAIIIGFNVRPTPLAKSEAETNNIDIRLHRVIYNAIEEVEDAMKGMLEPVYEEEVLGQVEVRQLYKASKIGTIAGGMVVSGKITRDAKVRLIR-DGVVIYEGELGSLKRFKDDAKEVKMGFECGLTIKNFNDVKENDVIEAYHM 769
>gi|134299804|ref|YP_001113300.1| translation initiation factor IF-2 [Desulfotomaculum reducens MI-1] >gi|172044304|sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 >gi|134052504|gb|ABO50475.1| bacterial translation initiation factor 2 (bIF-2) [Desulfotomaculum reducens MI-1] (985 aa)
Score = 1192, Expect = 1.8e-128, Identities = 250/564 (44%), Positives = 366/564 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-SNFGTNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ E ++K+ K +AE+IK L   G+   +N  +D      +  E+G + + ++ ++++  +     ED ED L  RPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV INKMDK DAN +K+  +L +  ++ E+WGG  + +  SA N  G+D LLE I++ AE+ ELKANP R+A G  +EA +DKG G VA +LVQ+GTL V D I+VG+  G+V+ M+D   + +K A PSTPV I GL+ +P++GD  +   DEKL ++++EKR++  ++  L S+   +L++         IKEL +I+K D  GS+EA+   L  +     K+NL+   +G++NE+DI LA  S ++V+ FN +  +     A +  + I  Y +IY++ D++++ + G+LDP F E  +G VE+R+ +  S IG IAGG V  G+I R+A  R+ R D  ++   K++SL+  KD     A G ECG T++ FND  EGDI+E + +
  S:   411 ITVQELAEKLKKTAAEVIKKLMGLGVLATINQEVDFETATLIAGEYGIETELKVAVDKEALVMAEPEED-EDKLVLRPPVVTIMGHVDHGKTSLLDAIRETNVTAGEAGGITQHIGAYQVERNGKKITFVDTPGHAAFTSMRARGAQITDIAILVVAADDGVMPQTIEAINHAKAANVPIIVAINKMDKPDANPDKVKQELTQHELVVEDWGGDVIAVPVSAKNRTGLDNLLEMILLVAEVHELKANPDRMARGTVVEAELDKGRGPVATVLVQNGTLNVGDTIVVGQVSGRVRAMIDDKGRRVKKAPPSTPVEILGLSDVPEAGDILVAVEDEKLARDVAEKRKIRKREEGLKSSTKISLDDLFKHIQEGQIKELPIIVKADVQGSIEALAQALEKLTTEEVKVNLIHTGVGAVNETDIMLATASNAIVIGFNVRPDNNARKLADAEKVDINLYRVIYEVIDDVKKAMSGLLDPEFKEVVLGHVEVRKTFKASKIGTIAGGYVTEGKIVRDASVRVIR-DGIVVFEGKLDSLKRFKDDAKEVAQGYECGLTIDRFNDVQEGDIIEAFTM 978
>gi|163762562|ref|ZP_02169627.1| RNA polymerase, sigma 32 subunit, RpoH [Bacillus selenitireducens MLS10] >gi|160357301|gb|EDP83949.1| RNA polymerase, sigma 32 subunit, RpoH [Bacillus selenitireducens MLS10] (740 aa)
Score = 1188, Expect = 5.6e-128, Identities = 264/567 (46%), Positives = 379/567 (66%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL-LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK--QRKLS---NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T  +T+ +F++KI++  +E+IK L   G+   +N  L+E  +  L  E+G   ++E+ ++E +F   I  ++ +D  L +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQV      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK+ AN +++  +L E  ++ E WGG T+ ++ SALN +GID+LLE I++  E+ ELKANP R A G  +EA +DKG G VA LLVQ GTL V D I+VG  +GKV+ MV+   + +KTA PS PV I+GLN +P++GD+++V  DEK  +++ E+R +  +  QR+ S   +     N+  QG IKE+NVI+K D  GS EA+KG L  IEV G K+N++   +G+I ESD+ LA  S ++++ FN +        A   G+ I+ + +IY   +EIE  +KG+LDP++ EK IG  E+RQ++  S +G IAG  V  G+I R++  R+ R D  ++   ++N L+  KD +   A   ECG T+ENFND  EGDI+E Y
  S:   160 LYTPPITVGDFAEKIHREPSEVIKKLMFLGVMATINQELEEEALEILAEEYGITVEEEVIVDETDFESIIGDQEEDDAKLQERPAVVTIMGHVDHGKTTLLDSIRHTKVVAGEAGGITQHIGAYQVVENDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKAAEVPIIVAVNKIDKEGANPDRVMQELTEHGLVAEAWGGDTIFVEVSALNAKGIDDLLEMILLVTEVEELKANPDREAYGTVVEAELDKGRGPVATLLVQGGTLHVGDPIVVGNAFGKVRAMVNDLGRRVKTADPSMPVEITGLNAVPQAGDRFMVFKDEKKARQIGEQRAMKQREAQRRESSRVSLDDLFNQIQQGDIKEINVIVKADVQGSAEAMKGSLEKIEVEGVKINIIHTGVGAIAESDVILASASNAVIIGFNVRPDVNAKRTAEVEGVDIRLHRVIYDAIEEIESAMKGLLDPIYQEKVIGQAEVRQVFKVSKVGSIAGSYVTDGKITRHSSVRVIR-DGVVVFEGEVNDLKRFKDDVKEVAKNYECGITIENFNDVKEGDIIEAY 732
>gi|83589898|ref|YP_429907.1| translation initiation factor 2 [Moorella thermoacetica ATCC 39073] >gi|123752933|sp|Q2RJM5|IF2_MOOTA Translation initiation factor IF-2 >gi|83572812|gb|ABC19364.1| bacterial translation initiation factor 2 (bIF-2) [Moorella thermoacetica ATCC 39073] (903 aa)
Score = 1176, Expect = 1.1e-126, Identities = 247/568 (43%), Positives = 367/568 (64%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFG--YDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG-TNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            T ++T+ E +K+I K +AE+IKYL  +GI   +N  LD      +  + G   + K E  I E   L+++   D  + L +RPP+VT+MGHVDHGKT+LLD IR++ V A+EAG ITQ IGAYQV  K   ITF DTPGH AF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V INK+D+ +AN E++  QL E  ++ EEWGG T+++  SA+  +GI++LLE +++TA++ ELKANP R A GI IEA +D+G G VA +LVQ GTL + D ++ G  YG+V+ M+D   + + +A PSTPV + GL+ +P++GD + V  DEKL ++++  RQ   +Q +L     T L++      +  +KELN+++K D  GS+EA++G L  +  +  K+NL+   +G+I E+D+ LA  SK++++ FN +  + V   A   G+ I+ Y +IY++ D+++  + G+L+P   E  +G  E+R  +     G +AG  V  G+I+  A AR+ R D  ++   +I SL+  KD +   A G ECG  LE FND  EGD++E Y I
  S:   327 LTGSITVQELAKRIGKTAAEVIKYLMGQGIMATINQELDLETAALVAQDLGAIVEIKAEKPITE---LEDLV--DPPETLRERPPVVTVMGHVDHGKTSLLDAIRRTNVTASEAGGITQHIGAYQVRLKNRKITFLDTPGHAAFTAMRARGAQATDIAILVVAADDGVMPQTIEAINHAKAAGVPIVVAINKIDRPEANPERVKQQLTEYGLVPEEWGGDTIMVPVSAVTKEGINDLLEMVLLTADVAELKANPDRPARGIVIEAKLDRGRGPVATMLVQKGTLKIGDNLVAGSVYGRVRAMIDDRGERVNSAPPSTPVEVLGLSELPEAGDIFQVVEDEKLARQIASSRQEEKRQEELKAASKTTLDDLFKQMEAGEVKELNLVIKGDVQGSVEALRGALEQLSTSEVKVNLLHGGVGAITETDVMLAAASKAIIIGFNVRPEANVRKAAEEAGVEIRLYRVIYEVIDDVKAAMSGLLEPEEREVILGRAEVRATFKVPKAGTVAGCFVTEGKIQNRALARVIR-DGVVVFEGRIESLKRFKDDVREVAQGYECGVGLEKFNDIKEGDVIEAYTI 896
>gi|46578923|ref|YP_009731.1| translation initiation factor IF-2 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|81830507|sp|Q72ER1|IF2_DESVH Translation initiation factor IF-2 >gi|46448335|gb|AAS94990.1| translation initiation factor IF-2 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (1079 aa)
Score = 1175, Expect = 1.7e-126, Identities = 248/567 (43%), Positives = 362/567 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQGIK--ELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + + + + ++   + EIIK LF  G+   +N  LD      +  EFGY+ +K +  +ED++L   K ED  + L  RPP+VTIMGHVDHGKT+LLD IRKS V A EAG ITQ IGAY V  KK  I F DTPGHEAF+ MRA GA +TD+VVLVVAADDG+  QT EA++H+  A  PI+V +NKMDK+ AN +++  +L+E  ++ E+WGG T+  K SA   +G+DELLE I + AEI+ELKANP + A G  +EA +DKG G +A +LVQ GTL   D  + G + G+V+ M D   +++K A PSTPV + G +G+ ++G++++   D+K+ + ++E R +  ++R+L+        T L+  +   +   LN++LK D  G+LEAI   +  +     K+N++    G+I ESDI LA  S ++++ FN + +SKV D A    + I+ Y+IIY++ DEI+  + G+L PV  E  +G  E+R+ +S   IGVIAG  V  G++ RNA  R+ R D  ++   KI SL+  KD +     G ECG  LENFND   GD++E +E+V E
  S:   505 IRVADMAHQMGLKANEIIKVLFGLGVMATINQSLDIDTATVVAGEFGYEVEK-VGFSEDDYLVP-KEEDAPETLVTRPPVVTIMGHVDHGKTSLLDAIRKSNVTAGEAGGITQHIGAYHVTTKKGEIVFLDTPGHEAFTAMRARGAQITDLVVLVVAADDGVMEQTREAVNHSKAAGVPIMVAVNKMDKEGANPDRVIRELSELGLVAEDWGGDTIFAKVSAKTREGLDELLELIAIQAEILELKANPDKAARGHVVEAKLDKGRGPLATVLVQEGTLRQGDAFVCGVFAGRVRAMFDDQGRKVKEAGPSTPVEVQGFDGVVEAGEEFVSVADDKVARRIAESRAVKQRERELAKESKVTLETFLSRRADAAEALTLNLVLKADVQGTLEAISEAVRKLSTEKVKINIIHGGAGAITESDILLASASDAIIIGFNVRPTSKVKDIAEQENVDIRFYDIIYKLVDEIKSAMAGMLAPVQREVYLGQAEVRETFSVPKIGVIAGCHVADGKVTRNAGVRLLR-DGVVVYTGKITSLKRFKDDVRDVQKGYECGMGLENFNDIKVGDVIEAFEMVEE 1075
>gi|120603476|ref|YP_967876.1| translation initiation factor IF-2 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166232543|sp|A1VG83|IF2_DESVV Translation initiation factor IF-2 >gi|120563705|gb|ABM29449.1| translation initiation factor IF-2 [Desulfovibrio vulgaris subsp. vulgaris DP4] (1079 aa)
Score = 1174, Expect = 2.0e-126, Identities = 248/567 (43%), Positives = 362/567 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQGIK--ELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + + + + ++   + EIIK LF  G+   +N  LD      +  EFGY+ +K +  +ED++L   K ED  + L  RPP+VTIMGHVDHGKT+LLD IRKS V A EAG ITQ IGAY V  KK  I F DTPGHEAF+ MRA GA +TD+VVLVVAADDG+  QT EA++H+  A  PI+V +NKMDK+ AN +++  +L+E  ++ E+WGG T+  K SA   +G+DELLE I + AEI+ELKANP + A G  +EA +DKG G +A +LVQ GTL   D  + G + G+V+ M D   +++K A PSTPV + G +G+ ++G++++   D+K+ + ++E R +  ++R+L+        T L+  +   +   LN++LK D  G+LEAI   +  +     K+N++    G+I ESDI LA  S ++++ FN + +SKV D A    + I+ Y+IIY++ DEI+  + G+L PV  E  +G  E+R+ +S   IGVIAG  V  G++ RNA  R+ R D  ++   KI SL+  KD +     G ECG  LENFND   GD++E +E+V E
  S:   505 IRVADMAHQMGLKANEIIKVLFGLGVMATINQSLDIDTATVVAGEFGYEVEK-VGFSEDDYLVP-KEEDAPETLVTRPPVVTIMGHVDHGKTSLLDAIRKSNVTAGEAGGITQHIGAYHVTTKKGEIVFLDTPGHEAFTAMRARGAQITDLVVLVVAADDGVMEQTREAVNHSKAAGVPIMVAVNKMDKEGANPDRVIRELSELGLVAEDWGGDTIFAKVSAKTREGLDELLELIAIQAEILELKANPDKAARGHVVEAKLDKGRGPLATVLVQEGTLRQGDAFVCGVFAGRVRAMFDDQGRKVKEAGPSTPVEVQGFDGVVEAGEEFVSVADDKVARRIAESRAVKQRERELAKESKVTLETFLSRRADAAEALTLNLVLKADVQGTLEAISEAVRKLSTEKVKINIIHGGAGAITESDILLASASDAIIIGFNVRPTSKVKDIAEQENVDIRFYDIIYKLVDEIKSAMAGMLAPVQREVYLGQAEVRETFSVPKIGVIAGCHVADGKVTRNAGVRLLR-DGVVVYTGKITSLKRFKDDVRDVQKGYECGMGLENFNDIKVGDVIEAFEMVEE 1075
>gi|157692346|ref|YP_001486808.1| translation initiation factor IF-2 [Bacillus pumilus SAFR-032] >gi|166918482|sp|A8FDD1|IF2_BACP2 Translation initiation factor IF-2 >gi|157681104|gb|ABV62248.1| initiation factor IF2 [Bacillus pumilus SAFR-032] (706 aa)
Score = 1170, Expect = 6.4e-126, Identities = 258/566 (45%), Positives = 377/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           FTN++T+ + ++++ K +AEIIK L + G+   +N  LD+  +  +  E+G   + E+ I E+  L+  + ED+E+ +  RPP+VTIMGHVDHGKTTLLD+IRK+KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA++TD  +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  AN +++  +L E  ++ E WGG+T+ +  SA   +GIDEL+E I++ +E+ ELKANP R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +KTA PSTPV I+GLN +P +GD+++V  DEK  +++ E R   QL+ ++   +    +    +  QG +K++N+I+K D  GS EA+   L  IEV G K+ ++   +G+I ESDI LA  S ++V+ FN +        A +  + I+ + IIY++ DEIE  +KG+LDP + EK IG VE+RQ +  S IG IAGG V  G I R++  R+ R D  +I   +++ L+  KD +   + G ECG T++ +ND  EGD++E +
  S:   129 FTNSMTVGQLAEELGKETAEIIKKLMMLGVMATINQELDKDTVELIASEYGVPVE-EVIILEETELEKYEVEDKEEDMQVRPPVVTIMGHVDHGKTTLLDSIRKTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTTMRARGAEVTDTTILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKIDKPTANPDRVMQELTEHGLVPEAWGGETIFVPLSAKTGEGIDELIEMILLVSEVGELKANPNRAAKGTVIEAELDKGRGSVATLLVQTGTLHVGDPIVVGNTFGRVRAMVNDIGRRVKTAGPSTPVEITGLNDVPNAGDQFLVFKDEKTARQVGEARASKQLDEQRSDKAKLSLDDLFEQIKQGEVKDINLIVKADVQGSAEALTAALQKIEVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAETENVDIRLHRIIYKVIDEIEAAMKGMLDPEYEEKVIGQVEVRQTFKVSKIGTIAGGYVTEGTITRDSGIRLIR-DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDVMESF 698
>gi|194014966|ref|ZP_03053583.1| translation initiation factor IF-2 [Bacillus pumilus ATCC 7061] >gi|194013992|gb|EDW23557.1| translation initiation factor IF-2 [Bacillus pumilus ATCC 7061] (706 aa)
Score = 1168, Expect = 9.4e-126, Identities = 258/566 (45%), Positives = 377/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           FTN++T+ + ++++ K +AEIIK L + G+   +N  LD+  +  +  E+G   + E+ I E+  L+  + ED+E+ +  RPP+VTIMGHVDHGKTTLLD+IRK+KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA++TD  +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  AN +++  +L E  ++ E WGG+T+ +  SA   +GIDEL+E I++ +E+ ELKANP R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +KTA PSTPV I+GLN +P +GD+++V  DEK  +++ E R   QL+ ++   +    +    +  QG +K++N+I+K D  GS EA+   L  IEV G K+ ++   +G+I ESDI LA  S ++V+ FN +        A +  + I+ + IIY++ DEIE  +KG+LDP + EK IG VE+RQ +  S IG IAGG V  G I R++  R+ R D  +I   +++ L+  KD +   + G ECG T++ +ND  EGD++E +
  S:   129 FTNSMTVGQLAEELGKETAEIIKKLMMLGVMATINQELDKDTVELIASEYGVPVE-EVIILEETELEKYEVEDKEEDMQVRPPVVTIMGHVDHGKTTLLDSIRKTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTMMRARGAEVTDTTILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKIDKPTANPDRVMQELTEHGLVPEAWGGETIFVPLSAKTGEGIDELIEMILLVSEVGELKANPNRAAKGTVIEAELDKGRGSVATLLVQTGTLQVGDPIVVGNTFGRVRAMVNDIGRRVKTAGPSTPVEITGLNDVPNAGDQFLVFKDEKTARQVGEARASKQLDEQRSDKAKLSLDDLFEQIKQGEVKDINLIVKADVQGSAEALTAALQKIEVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAETENVDIRLHRIIYKVIDEIEAAMKGMLDPEYEEKVIGQVEVRQTFKVSKIGTIAGGYVTEGTITRDSGIRLIR-DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDVLESF 698
>gi|89101193|ref|ZP_01174024.1| translation initiation factor IF-2 [Bacillus sp. NRRL B-14911] >gi|89084102|gb|EAR63272.1| translation initiation factor IF-2 [Bacillus sp. NRRL B-14911] (705 aa)
Score = 1168, Expect = 1.0e-125, Identities = 267/566 (47%), Positives = 375/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG----TNLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F+++LT+ E +KK+++  +EIIK LF+ G+   +N  LD+  +  +  E+G + ++EI I+  + L+    ED    L +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NKMDK  AN +++  +L E  ++ E WGG+T+ +  SAL   GID LLE I++ +E+ E KANP R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +K A PSTPV I+GLN +P +GD+++V  DEK  +++ E R     Q + S        NL E+  QG +K+LN+I+K D  GS EA+   L+ I+V G  + ++  A+G+INESDI LA  S ++V+ FN +  +     A +  + ++ + IIY++ DEIE  +KG+LDP F EK IG  EIRQ +  S +G IAG  V  G+I R++  R+ R D  +I   +I++L+  KD     + G ECG T++NFND  EGD+VE Y
  S:   129 FSDSLTVAELAKKLHREPSEIIKKLFMLGVMATINQDLDKDAIELIAGEYGVEVEEEILIDTTD-LEVYFTEDESAELSERPSVVTIMGHVDHGKTTLLDSIRNTKVTAGEAGGITQHIGAYQVEENGKKITFLDTPGHAAFTTMRARGAKITDITILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKMDKPAANPDRVMQELTEHGLVPEAWGGETIFVPLSALTGDGIDSLLEMILLVSEVEEYKANPDRNAVGTVIEAQLDKGRGSVATLLVQNGTLKVGDPIVVGTTFGRVRAMVNDLGRRVKEAGPSTPVEITGLNDVPLAGDRFVVFKDEKTARQVGEVRSQQAIQAQRSEKTRVSLDNLFEHMKQGEMKDLNIIIKADVQGSAEALAAALNKIDVEGVNVRIIHTAVGAINESDITLAAASNAIVIGFNVRPDNNAKRAADTEEVDVRLHRIIYKVIDEIESAMKGMLDPEFEEKVIGQAEIRQTFKVSKVGTIAGSYVTDGKITRDSGIRLIR-DGVVIFEGEIDALKRFKDDAKEVSQGYECGITIKNFNDVKEGDVVEAY 698
>gi|78043976|ref|YP_360586.1| translation initiation factor IF-2 [Carboxydothermus hydrogenoformans Z-2901] >gi|90101351|sp|Q3AB98|IF2_CARHZ Translation initiation factor IF-2 >gi|77996091|gb|ABB14990.1| translation initiation factor IF-2 [Carboxydothermus hydrogenoformans Z-2901] (827 aa)
Score = 1166, Expect = 1.6e-125, Identities = 260/569 (45%), Positives = 365/569 (64%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRK--------LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    +T+ EF+K + K +AE+IK L   GI   +N  +D      +  +FGY+   E +  ED +L     +D E L + RPPIVT+MGHVDHGKT+LLD IR++ V ATEAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK +A  +++  QL E  ++ E WGG T+ ++ SAL   GI+ELLE I++ A++ ELKANP + A G  IEA +DKG G VA +LVQSGTL V D ++VG  YG+V+ ++D   + +K A PS PV + GLN +P +GD  +V +DEK  + L+EKRQ   ++ +        L +   ++ E    IKELN++LK D +GS+EAIK  LS +     K+N++ + +G+I E+DI LA  S ++V+ FN +  S     A +  I ++ Y IIY++ D+I+  + G+L+P   E  +G  E+R+ +  S +G IAG  VL G+I R+A  R+ R D  +I    + SL+  KD +   A G ECG T+E FND  EGDI+E + I
  S:   247 VIPERMTVQEFAKIMGKSAAEVIKKLMSYGILATINQEIDADTATIIATDFGYEVTVEKEEKEDIWLLEETPDDPESL-EPRPPIVTVMGHVDHGKTSLLDAIRQTNVTATEAGGITQHIGAYQVEHNGRKITFIDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKIDKPNAQPDRVKQQLTEYGLIPEAWGGDTVFVEVSALKKIGIEELLEMILLVADLKELKANPNKPARGTVIEAKLDKGRGPVATVLVQSGTLNVGDVVVVGLTYGRVRALMDDKGRRVKKATPSMPVEVLGLNDVPSAGDILVVVDDEKTARTLAEKRQEQKREEELRASSKVSLEDLFKHIQEGK--IKELNIVLKADVHGSVEAIKQSLSRLSTEEVKVNVIHSGVGAITETDIMLASASNAIVIGFNVRPDSNARKLAETEKIDVRVYRIIYELLDDIKAAMAGLLEPEQKEVVLGRAEVRKTFKASKVGTIAGLYVLEGKITRSAKVRVIR-DGIVIHEGNVESLKRFKDDVREVAQGYECGLTIEKFNDIREGDIIEAFTI 819
>gi|70726646|ref|YP_253560.1| translation initiation factor IF-2 [Staphylococcus haemolyticus JCSC1435] >gi|90101381|sp|Q4L5X1|IF2_STAHJ Translation initiation factor IF-2 >gi|68447370|dbj|BAE04954.1| translation initiation factor IF-2 [Staphylococcus haemolyticus JCSC1435] (716 aa)
Score = 1166, Expect = 1.8e-125, Identities = 261/569 (45%), Positives = 374/569 (65%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ----LNTKQRKLSNFGTNLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ E + K+N  S+ IIK LFL GI  N+N  LDE  +  +  ++G + +KE+ +NE++   +I F++ E   D  +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  P IV +NK+DK  AN +++  +L E  ++ E+WGG+T+ +  SAL+ +GID+LLE I + AE+ ELKANP + A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   + IK+A PSTPV I+G+N +P +GD++++  DEK  + + E R     +  +Q   +    NL E   QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  +     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  RI R D  ++   ++++L+  KD     A G ECG T+E FND  EGDI+E +E+V
  S:   139 YEEGITVGELADKLNIESSGIIKKLFLLGIVANINQALDEETLELIADDYGVELEKEVVVNEEDL--SIYFDEEEADPDAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENAGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEANVPTIVAVNKIDKPTANPDRVMQELTEYGLIPEDWGGETIFVPLSALSGEGIDDLLEMIGLVAEVQELKANPDKQAVGTVIEAELDKSRGPAASLLVQNGTLNVGDSIVVGNTYGRIRAMVNDLGQRIKSAGPSTPVEITGINDVPLAGDRFVIFKDEKQARRIGEARHEASVIQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDAGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGSYVTEGKITRNAGVRIIR-DGIVLFEGELDTLKRFKDDAKEVAQGYECGITIEKFNDIKEGDIIEAFEMV 712
>gi|194467748|ref|ZP_03073734.1| translation initiation factor IF-2 [Lactobacillus reuteri 100-23] >gi|194452601|gb|EDX41499.1| translation initiation factor IF-2 [Lactobacillus reuteri 100-23] (752 aa)
Score = 1164, Expect = 2.8e-125, Identities = 250/571 (43%), Positives = 385/571 (67%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD---KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQRK-----LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  +T+ +   +  K +++  AEI+K LF+ G+  N N  LD+  +  L  ++G + K+++Q++  + +D + FED ++  +    RP +VT+MGHVDHGKTTLLD +R S V   EAG ITQ IGAYQV +   LITF DTPGH AF++MRA GA++TDI VLVVAADDG+ PQT EAI HA  A+ PIIV +NK+DK  AN +++  +LA+ N++ E+WGG T+ +K SA   + +DELL+ I++ AE++ELKANP++ A G  +EA +D+G G+VA +LVQ GTL V D I+VG  +G+V+ M + N + IK A PSTPV I+GLN +P++GD+++V +DEK  +   E   KR ++ +++K     L N    + +    +K L +I+K D  GS+EA+   L  I+V G +++++  A+G+IN+SD+ LA  S ++++ FN + ++     A S  I I+ + +IY   +E+E  +KG+L+PV+ E+ IG VE+RQ++  S +G IAGG V +G+I R+A  R+ R D  +I   ++ SL+  KD +     G ECG T+EN+ND  E D++E Y++
  S:   170 VLEYTDGMNAQDLGKILHRSPAEIVKKLFMLGVMINQNQSLDKDTIELLATDYGIEAKEKVQVDVSD-IDKM-FEDEQNNTEHQVTRPAVVTVMGHVDHGKTTLLDKLRHSHVTEHEAGGITQEIGAYQVHYNDQLITFLDTPGHAAFTEMRARGANITDITVLVVAADDGVMPQTVEAIHHAQAAQTPIIVAVNKIDKPGANPDRVTEELAKYNLIPEDWGGDTIFVKISAKFGKNLDELLDMILLQAEMLELKANPEQNAAGSVVEARLDQGRGSVATVLVQQGTLHVGDPIVVGNTFGRVRTMTNENGRRIKEATPSTPVEITGLNEVPEAGDRFVVFDDEKTARAAGEERAKRAMDKERQKTSHVTLDNLFATMKKGQ--MKTLPIIIKADVQGSVEALSQSLQKIKVDGVRVDIIHQAVGAINQSDVTLAEASNAVIIGFNVRPTAVAKTLADSNSIDIRLHRVIYDAIEEVEDAMKGMLEPVYKEETIGQVEVRQIYKASKVGTIAGGMVTSGKITRDAKVRLVR-DGVVIYEGELGSLKRFKDDVKEVKQGYECGLTIENYNDIKEMDVIEAYKM 746
>gi|73662808|ref|YP_301589.1| translation initiation factor IF-2 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90101382|sp|Q49X54|IF2_STAS1 Translation initiation factor IF-2 >gi|72495323|dbj|BAE18644.1| translation initiation factor IF-2 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (701 aa)
Score = 1163, Expect = 3.6e-125, Identities = 254/569 (44%), Positives = 379/569 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-QLNTKQRKLSNFGTNLN----ENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + +T+ E ++K+N  S+ IIK LFL GI  N+N  LD+  +  +  ++G + +KEI ++E++       E  ++   +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ P IV +NK+DK  +N +++  +L E  ++ E+WGG T+ +  SAL+  GI++LLE I++T+E+ ELKANP++ A G  IEA +DK  G  A LLVQ+GTL V D ++VG  YG+++ MV+   + IKTA PSTPV I+G+N +P++GD+++V  DEK  + + E R + N  Q++  +   +L+    +  QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  +     A + G+ ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V+ G+I RNA  R+ R D  +    ++++L+  KD     A G ECG T+E +ND  EGDI+E +E+V
  S:   124 YQDGITVGELAEKLNVDSSGIIKKLFLLGIMANINQSLDDETLELIVDDYGVEIEKEIVVDEEDLAIYFDDETEDENAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPTIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGDTIFVPLSALSGDGIEDLLEMIVLTSEVQELKANPEKNAVGTVIEAELDKSRGPSASLLVQNGTLNVGDSLVVGNTYGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFKDEKQARRIGEARHEANVMQQRQESKSVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDTGAKRAADNEGVDMRLHRVIYNVIEEIESAMKGMLDPEFEEQVIGQAEVRQTFKVSKVGTIAGSYVIDGKITRNAGVRVIR-DGIVQFEGELDTLKRFKDDAKEVAQGYECGITIEKYNDLKEGDIIEAFEMV 697
>gi|163791148|ref|ZP_02185567.1| translation initiation factor IF-2 [Carnobacterium sp. AT7] >gi|159873620|gb|EDP67705.1| translation initiation factor IF-2 [Carnobacterium sp. AT7] (715 aa)
Score = 1163, Expect = 3.8e-125, Identities = 263/572 (45%), Positives = 372/572 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN--TKQRKLSNFGT--NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           V V+T+ +T+ + SKKI +  AEIIK LFL G+   LN  L +  +  L  E+G   +++IQ++  +       E  E+ L  RPP+VTIMGHVDHGKTTLLD++R +KV+  EAG ITQ IGAYQV+     ITF DTPGH AF+ MRA GAD+TDI ++VVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK DAN E++  +L E  ++ E WGG T+ ++ SA   Q +DELLE I++ AE+ +LKA+PKRLA G  IEA +DK +G +A LLVQ GTL V D I+VG  YG+V+ MV+ N + +K A PS PV I+GLN  P++GD+++V  DEK  +   E R+     +QR ++N  T  NL  + Q   +KE+NVI+K D  GS EA+   L  I+V G ++ ++  A+G+INESDI LA  S ++++ FN + + +    A    + I+ + IIY   DEIE  +KG+LDP + EK  G   +R+ +  S +G IAGG V  G I R++  R+ R D  +I   ++ SL+  KD       G ECGF ++++N+    DI+E YE+V
  S:   134 VLVYTDGMTVADISKKIYREPAEIIKKLFLLGVVATLNQSLGKEAIELLAEEYGIQTEEKIQVDVSDLDIYFDQEVVEENLITRPPVVTIMGHVDHGKTTLLDSLRNTKVSLGEAGGITQHIGAYQVDVDGKTITFLDTPGHAAFTTMRARGADVTDITIIVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKVDKPDANPERVMQELTEYGLVPESWGGDTIFVEISAKFGQNLDELLEMILLVAEVEDLKADPKRLALGSVIEARLDKSKGPIATLLVQEGTLNVGDPIVVGNTYGRVRVMVNENGRRVKHAGPSAPVEITGLNTAPQAGDQFVVFEDEKTARAAGETREKKAMAEQRSVTNRVTIDNLFSSLQEGELKEVNVIIKADVQGSAEALSSSLQKIDVEGVRVKMIHTAVGAINESDITLAAASNAIIIGFNVRPTPQAKIQADQEQVDIRLHRIIYNAIDEIETAMKGLLDPEYEEKVTGQAVVRETFKVSKVGTIAGGFVTDGYITRSSSIRLIR-DNIVIFEGELASLKRFKDDAKEVKKGFECGFMVKDYNEVEVDDIIEAYEMV 710
>gi|51892660|ref|YP_075351.1| translation initiation factor IF-2 [Symbiobacterium thermophilum IAM 14863] >gi|81826138|sp|Q67P86|IF2_SYMTH Translation initiation factor IF-2 >gi|51856349|dbj|BAD40507.1| putative translational initiation factor [Symbiobacterium thermophilum IAM 14863] (1044 aa)
Score = 1163, Expect = 3.8e-125, Identities = 247/567 (43%), Positives = 365/567 (64%)
  Q:    48 TNNLTIDEFSKKINKHSAEIIKYLFLK-GINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK-RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNL----NENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           T  +++ + + ++   +AE+IK L    GI   +N  LD      +  EFG +   E + +     D ++  D    L K R P+VTIMGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY+VE     ITF DTPGHEAF+ MRA GA++TDI VLVVAADD + PQT E+I+HA  A  PI+V INK+DK +AN +++   L +  ++ EEWGG T+++  SA     +D LLE I+V AE+ +LKANP + A G  +EA++DK  G VA +LVQ+GTL   D  + G  +G+V+ M D   +++K+A PSTPVR+ G + +P++GD + VT DEK  + ++EKR    +  +L+    +L    N+ +QG IK+LNVI+K D  GS+EAI+G L  +     K+ ++ A +G+I+ESD+ LA  SK++++ FN +   + S  A   GI ++ Y++IY I D+IE  +KG+L P   E  +G  E+R+ +    +G+ AG  V+ G++ RNA  R+ R D  ++ + +IN+LR  KD +   + G ECG TL+NF+DF  GDI+E YE+
  S:   466 TGPMSVKDLAHEMGVTAAEVIKTLLTGFGIMATINQELDVDTCVLVASEFGVEATVEQKEDIIEVYDRVEDPDEPAELKKPRHPVVTIMGHVDHGKTSLLDAIRQAKVAAGEAGGITQHIGAYEVELNGRKITFLDTPGHEAFTAMRARGANVTDIAVLVVAADDSVMPQTVESINHAKAANVPILVAINKIDKPEANPQRVMQDLTQYGLVPEEWGGDTIMVPVSAKQKTNLDLLLENILVLAEVSDLKANPDKPAAGTILEAALDKARGPVATVLVQAGTLNTGDVFVAGTSWGRVRAMFDHRGRKLKSAGPSTPVRVLGFDSVPQAGDVFRVTPDEKTARAIAEKRIAKAQAERLAQKAISLDDFMNQVAQGEIKDLNVIVKADVQGSVEAIRGQLEKLRNEEVKVKVIHAGVGAISESDVMLAVASKAIIIGFNVRPDDRASRAADEHGIDVRTYSVIYDIVDDIEAAMKGMLKPKIEEVILGKAEVRETFKVPKVGMAAGCMVIQGKVTRNARYRLIR-DGVVVWDGEINALRRFKDEVREVSEGYECGITLQNFHDFKRGDILEAYEL 1038
>gi|172057846|ref|YP_001814306.1| translation initiation factor IF-2 [Exiguobacterium sibiricum 255-15] >gi|171990367|gb|ACB61289.1| translation initiation factor IF-2 [Exiguobacterium sibiricum 255-15] (722 aa)
Score = 1162, Expect = 4.6e-125, Identities = 254/603 (42%), Positives = 379/603 (62%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQR-----KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + K + +  ++ D  +    +   ++ +      V  + +NLT+ E ++K++K   E+I  L   G+   +N  LD+  +  L  +FG++ +K +Q++E +F D  +       L +RPP+VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQVE +   ITF DTPGH AF+ MRA GAD+TDI ++VVAADDG+ PQTEEAI HA  A  PIIV +NKMDK+ AN +++  +L E  ++ E+WGG T+ +  SAL   GIDELLE I++ +E+ E K+ P     G  IEA +DKG G VA LLVQ GTL V D I+VG  +G+++ MV+   + +K   PSTP+ I+GLN +PK+GD++    DEK  +++ E   +R++  ++R      L +    + E    +K+LN+I+K D  GS+EA+ G L  I+V GAK+N+V + +G+I E D+ LA  + ++++ FN +        A    + I+ + IIY   +EIE+ +KG+LDP FVEK IG  E+R +   S +G IAGG V  G++ R A  R+ R D  +I   K+++LR  KD +   AAG ECG  +E ++D    D++E +
  S:   108 QKKVEPRKLEVADPNSKSSQRKAARRAQEEAMANVVQYADNLTVGELAEKMDKKPNELIMKLMGMGVMATINQDLDDETVELLASDFGFEVEKTVQVDETDF-DAYELNLDNYELSERPPVVTIMGHVDHGKTTLLDSIRNTKVTAGEAGGITQHIGAYQVEIEGKKITFLDTPGHAAFTTMRARGADVTDIAIIVVAADDGVMPQTEEAISHAKAAGVPIIVAVNKMDKEGANPDRVKQELTEFELVAEDWGGDTIFVPVSALKGDGIDELLEMILLVSEVQEYKSTPDMHGRGTVIEAKLDKGRGPVATLLVQHGTLRVGDPIVVGHTFGRIRAMVNDIGRRVKEVGPSTPIEITGLNDVPKAGDQFFAFEDEKKARQIGEARYQREIEAQRRDSAKVSLEDLFDRIKEGE--VKDLNIIIKGDVQGSVEALAGSLKKIDVEGAKINIVHSGVGAITEGDVILASAANAIIIGFNVRPDGNAKSMADQEKVEIRLHKIIYNAIEEIEQAMKGLLDPEFVEKIIGQAEVRDVIKVSKVGTIAGGYVTEGKLTRAAGVRVVR-DSIVIYEGKLDTLRRFKDDVKEVAAGYECGIKIERYDDIKVDDVIEAF 714
>gi|116618450|ref|YP_818821.1| translation initiation factor 2 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271350|sp|Q03WH4|IF2_LEUMM Translation initiation factor IF-2 >gi|116097297|gb|ABJ62448.1| bacterial translation initiation factor 2 (bIF-2) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (834 aa)
Score = 1162, Expect = 5.0e-125, Identities = 253/570 (44%), Positives = 372/570 (65%)
  Q:    43 GVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENS-------QGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
            V  +   + + + SK +++ +AEIIK LFL GI  N N  LDE  +  L  ++G + + +    E++  D  +F D E++    L  RPP+VTIMGHVDHGKTTLLD +R S V   EAG ITQ IGAYQ      LITF DTPGH AF++MRA GA++TD+ +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN + + +QL   +++ EE+GG T+ +K SA   Q +DELLE I++ AE++ELKANP   A G  IEA +DKG G V+ +LVQ GT+ V D I+VG  YG+V+ M +    E+  ALP+TP++I+GLNG+P++GD++IV  DEK  +   E+R     Q  + N G+ +  ++       + +K + VI+K D  GS+EA+ G L  IEV G +++++  A+G+INESD+ LA  S ++++ FN + +      + S  + I+ YN+IY   D++E  +KG L+PV+ EK IG VE+++L+  S +G IAG  V  G+I +++  R+ R D  ++ + ++ SL+ GKD++     G E GFT+  FND   GD+VE Y
  S:   251 AVLEYRVGMNVQDLSKLLHRDTAEIIKKLFLLGIVTNQNQSLDEDTIEILAADYGIEAQAK---EEEDVADIDRFFDDENIDESKLVSRPPVVTIMGHVDHGKTTLLDYLRNSHVTEGEAGGITQHIGAYQTRINDKLITFLDTPGHAAFTEMRARGANVTDLTILVVAADDGVMPQTIEAINHAKAAGTPIIVAVNKIDKPGANPDDVMNQLMAYDLVPEEYGGDTIFVKISAKFGQNVDELLEMILLQAEVLELKANPNMPARGSVIEARLDKGRGPVSTVLVQQGTMHVGDPIVVGNTYGRVRTMTNERGVELSEALPATPIQITGLNGVPQAGDRFIVMADEKTARAAGEERA-KRAQEAVRNSGSVVTLDTLFNTMAEKAMKTVPVIVKADVQGSVEALSGSLKKIEVDGVRVDIIHTAVGAINESDVTLAEASGAIIIGFNVRPTPLAKSQSDSEKVDIRFYNVIYNAIDDVEAAMKGQLEPVYEEKVIGKVEVKELFKFSKVGTIAGAMVEEGKITKDSKVRVIR-DNVVVFDGEVGSLQRGKDAVNEVKMGFEFGFTVAKFNDVHAGDVVEAY 826
>gi|148543931|ref|YP_001271301.1| translation initiation factor 2 [Lactobacillus reuteri F275] >gi|184153327|ref|YP_001841668.1| translation initiation factor IF-2 [Lactobacillus reuteri F275] >gi|166918488|sp|A5VJE0|IF2_LACRF Translation initiation factor IF-2 >gi|148530965|gb|ABQ82964.1| bacterial translation initiation factor 2 (bIF-2) [Lactobacillus reuteri F275] >gi|183224671|dbj|BAG25188.1| translation initiation factor IF-2 [Lactobacillus reuteri F275] (752 aa)
Score = 1162, Expect = 5.1e-125, Identities = 250/571 (43%), Positives = 384/571 (67%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD---KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE---KRQLNTKQRK-----LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  +T+ +   +  K +++  AEI+K LF+ G+  N N  LD+  +  L  ++G + K+++Q++  + +D + FED ++  +    RP +VT+MGHVDHGKTTLLD +R S V   EAG ITQ IGAYQV +   LITF DTPGH AF++MRA GA++TDI VLVVAADDG+ PQT EAI HA  A+ PIIV +NK+DK  AN +++  +LA+ N++ E+WGG T+ +K SA   + +DELL+ I++ AE++ELKANP + A G  +EA +D+G G+VA +LVQ GTL V D I+VG  +G+V+ M + N + IK A PSTPV I+GLN +P++GD+++V +DEK  +   E   KR ++ +++K     L N    + +    +K L +I+K D  GS+EA+   L  I+V G +++++  A+G+IN+SD+ LA  S ++++ FN + ++     A S  I I+ + +IY   +E+E  +KG+L+PV+ E+ IG VE+RQ++  S +G IAGG V +G+I R+A  R+ R D  +I   ++ SL+  KD +     G ECG T+EN+ND  E D++E Y++
  S:   170 VLEYTDGMNAQDLGKILHRSPAEIVKKLFMLGVMINQNQSLDKDTIELLATDYGIEAKEKVQVDVSD-IDKM-FEDEQNNTEHQVTRPAVVTVMGHVDHGKTTLLDKLRHSHVTEHEAGGITQEIGAYQVHYNDQLITFLDTPGHAAFTEMRARGANITDITVLVVAADDGVMPQTVEAIHHAQAAQTPIIVAVNKIDKPGANPDRVTEELAKYNLIPEDWGGDTIFVKISAKFGKNLDELLDMILLQAEMLELKANPDQNAAGSVVEARLDQGRGSVATVLVQQGTLHVGDPIVVGNTFGRVRTMTNENGRRIKEATPSTPVEITGLNEVPEAGDRFVVFDDEKTARAAGEERAKRAMDKERQKTSHVTLDNLFATMKKGQ--MKTLPIIIKADVQGSVEALSQSLQKIKVDGVRVDIIHQAVGAINQSDVTLAEASNAVIIGFNVRPTAVAKTLADSNSIDIRLHRVIYDAIEEVEDAMKGMLEPVYKEETIGQVEVRQIYKASKVGTIAGGMVTSGKITRDAKVRLVR-DGVVIYEGELGSLKRFKDDVKEVKQGYECGLTIENYNDIKEMDVIEAYKM 746
>gi|56963993|ref|YP_175724.1| translation initiation factor IF-2 [Bacillus clausii KSM-K16] >gi|81822104|sp|Q5WFU2|IF2_BACSK Translation initiation factor IF-2 >gi|56910236|dbj|BAD64763.1| translation initiation factor IF-2 [Bacillus clausii KSM-K16] (761 aa)
Score = 1160, Expect = 7.7e-125, Identities = 256/561 (45%), Positives = 371/561 (66%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           T+ E + K+++ ++E+IK L   G+   +N  LD+  +  L  ++G + ++E+ ++E + ++    ED+E+ L +RPP+VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT+EAI HA  A+ PIIV +NK+DK+ A+ +++  +L E  ++ E WGG T+ +  SAL  +GIDEL+E I++ AE+ E KANP +LA G  +EA +DKG G VA LLVQSGTL V D ++VG  +G+V+ +V+   + +KTA PS PV I+GLN +P++GD++    DEK  ++L E      +++ L+     +     N+  QG +K++NVI+K D  GS+EA+KG L  I+V G K+N++    G+I ESDI LA  S ++V+ FN +        A +  + I+ + +IY   DEIE+ +KG LDP F EK IG VE+R  +  S +G IAG  V  G+I RN+  R+ R D  +I   ++N+L+  KD      AG ECG TL+ FND  EGD++E Y
  S:   189 TVSELAAKLHREASELIKKLIGLGVMATINQELDKDTIELLAADYGVEVEEEVIVDELD-IELYDREDKEEELKERPPVVTIMGHVDHGKTTLLDSIRNTKVTAGEAGGITQHIGAYQIEHSGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTKEAISHAKAAEVPIIVAVNKIDKETASPDRVMQELTEFELVPEAWGGDTIFVNVSALTGEGIDELIEMILLVAEVEEFKANPDKLATGTVVEAQLDKGRGPVATLLVQSGTLNVGDAVVVGSTFGRVRALVNDVGRRVKTAGPSAPVEITGLNEVPQAGDRFQAFEDEKKARQLGEGLMARYREQNLTASSKVSLDDLFNQIQQGDVKDINVIIKADVQGSVEAMKGSLEKIDVAGVKVNIIHTGAGAITESDIILASASNAIVIGFNVRPDVNAKRVAEAENVDIRLHRVIYNAIDEIEQAMKGALDPEFEEKVIGQVEVRTTFKVSKVGTIAGSYVTEGKITRNSSVRLIR-DGIVIYEGELNALKRYKDDAKEVQAGYECGITLDKFNDIKEGDMIEAY 753
>gi|162447186|ref|YP_001620318.1| translation initiation factor IF-2 [Acholeplasma laidlawii PG-8A] >gi|161985293|gb|ABX80942.1| translation initiation factor IF-2 [Acholeplasma laidlawii PG-8A] (620 aa)
Score = 1160, Expect = 8.6e-125, Identities = 252/566 (44%), Positives = 375/566 (66%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-----QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVE 610
            +F   +T+ + ++ ++  +A +IK L   G+  ++N +L+   +  + ++ G + K E+  +   + +    +D +DL+ KR PI+TIMGHVDHGKTTLLD+IRKS+V   EAG ITQ IGAYQVE     ITF DTPGH AF++MRA GA +TDIVVLVVAADDG+KPQT EA+ HA  +  PIIV INK+DK  AN + + S L+  ++  E WGG T  ++ SAL   GID LL+ I+V AE+ +LKANPKR A G  IEA +DKG G VA ++V++GTL + D I++G  +G+++ M D  +K    ALP TPV I+GL+ +P++GD ++V  DE++ ++ +E R     +   KQ+K S+  +       G K LN++LK D  GS+EA+KG+L  I+V G K N+VR+ +G I+E+D+ LA  S ++V+ FN + ++ V   A SM + I+ YN++Y+I ++IE+ LKG+L+PVF +   G+ E+RQL+  S IG IAG  V  G I R++   + R +  +I N  ++SL+ GKD +     G E GF++EN+ND  EGD++E
  S:    42 LIFKPEMTVSDVAEALDISNAVLIKKLMGLGMMTSVNQVLERDVVELIAMDMGIEVKDEVITDLTRYDEMEIIDDPKDLV-KRSPIITIMGHVDHGKTTLLDSIRKSRVVTGEAGGITQHIGAYQVEHGGEKITFIDTPGHAAFTEMRARGAKVTDIVVLVVAADDGVKPQTIEALQHAKASGVPIIVAINKIDKPTANPDNVMSALSAHDLTPEAWGGTTPYVEVSALKRLGIDNLLDIILVLAEVEDLKANPKRDAMGTVIEAYLDKGRGPVATVIVENGTLRIGDIIVIGNTFGRIRTMNDDLKKRYDEALPGTPVEITGLDQVPQAGDIFMVFKDERVARQTAEARSSKLKETYIKQQKASSLESMFGAQDDGEKVLNLVLKCDVQGSIEALKGMLDKIDVDGFKANIVRSGVGGISETDVQLASASGAVVIGFNVRPTAAVKSLAESMNVEIRLYNVVYRITEDIEKALKGMLEPVFEDVVTGTAEVRQLFKISKIGTIAGSYVTNGVIHRDSKVTVIR-EGVVIYNGVLSSLKRGKDDVKEVRQGFEFGFSVENYNDLKEGDVIE 610
>gi|169831089|ref|YP_001717071.1| translation initiation factor IF-2 [Candidatus Desulforudis audaxviator MP104C] >gi|169637933|gb|ACA59439.1| translation initiation factor IF-2 [Candidatus Desulforudis audaxviator MP104C] (888 aa)
Score = 1158, Expect = 1.5e-124, Identities = 238/567 (41%), Positives = 364/567 (64%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK-KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG--------TNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           V T +LT+ + ++++   SAEIIK L   GI   +N  +D      +  E G+  + KE +++ +  L+    ED  + L  RPP+VT++GHVDHGKT+LLD IR +KV ATEAG ITQ IGAYQV++++  ITF DTPGHEAF+ MRA GA +TD+ +LVVAADDG+KPQT EAI+HA  A  PIIV INK+DK DAN +++  QL E  ++ EEWGG T+ +  SAL   G+DELLE I++ AE+ ELKANP R A G  IE+ +DKG G V  +LV++GT+ V D+++ G  + +V+ M+D   + +K A PS PV + G + +P++G+++    +EK+ ++++ KRQ   +Q++L   G        + + E +  +KEL +I+K D  GS EA+   L  +     K+ L+   +G+I ESD++LA  + ++++ FN +        A    + I+ Y +IY+  D+++  L G+L+P + E  +G  ++RQ++  S +G IAG  VL G+I R+A  R+   D +++ + +++SL+  KD +     G ECG TLE FND  EGD +E Y
  S:   307 VLTGSLTVKDLAERMGVKSAEIIKQLMFLGIMATINQEIDVETAVVVAEEMGFRVEIKERELDPEELLELEPEEDEPEKLQSRPPVVTVLGHVDHGKTSLLDAIRDAKVTATEAGGITQHIGAYQVKYQQKRITFLDTPGHEAFTAMRARGARITDVAILVVAADDGVKPQTVEAINHAKAAGVPIIVAINKIDKPDANPDRVKQQLTEHGLVAEEWGGDTICVPVSALQKTGLDELLEMILLVAEMNELKANPFRSARGTVIESQLDKGRGPVVTVLVENGTVEVGDFLVAGSAFCRVRAMIDHKGRRVKKAGPSAPVEVLGFSEVPQAGERFYEVPEEKVARQIALKRQERKRQQELKASGRISLEDVFSRIQEGT--VKELPLIVKADVQGSAEAMVQSLQRLSTEEVKVQLIHQGVGAITESDVNLAALAGAIIIGFNVRPDVNARKAAERELVDIRLYQVIYEALDDVKAALSGLLEPTYREVILGRAQVRQIFKVSRVGTIAGCYVLEGKITRDAGVRVIH-DGKVVHDGRLSSLKRFKDDVREVVQGYECGLTLERFNDIHEGDQLEFY 879
>gi|154686080|ref|YP_001421241.1| translation initiation factor IF-2 [Bacillus amyloliquefaciens FZB42] >gi|166226247|sp|A7Z4T4|IF2_BACA2 Translation initiation factor IF-2 >gi|154351931|gb|ABS74010.1| InfB [Bacillus amyloliquefaciens FZB42] (716 aa)
Score = 1157, Expect = 1.7e-124, Identities = 258/566 (45%), Positives = 376/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F+ +LT+   ++++ K  +E+IK L L G+   +N  LD+  +  +  E+G +  +E+ + E+  L+  +  D+E+ L  RPP+VTIMGHVDHGKTTLLD+IRK+KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA++TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK+ AN +++  +L E  ++ E WGG+T+ +  SAL  +GIDEL+E I++ +E+ ELKANP R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +KTA PSTPV I+GLN +P++GD+++V  DEK  + + E R   QL  ++   +    +    +  QG +K++N+I+K D  GS EA+   L  IEV G K+ ++   +G+I ESDI LA  S ++V+ FN +        A +  + I+ + IIY++ +EIE  +KG+LDP + EK IG VE+RQ +  S IG IAGG V  G I R++  R+ R D  +I   +++ L+  KD +   + G ECG T++ +ND  EGDI+E Y
  S:   139 FSGSLTVGALAEELGKEPSELIKKLMLLGVMATINQELDKDTIELIASEYGVE-TEEVIVLEETELEKYEEADKEEDLQIRPPVVTIMGHVDHGKTTLLDSIRKTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTTMRARGAEVTDITILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKVDKESANPDRVMQELTEYGLVPEAWGGETIFVPLSALTGKGIDELVEMILLVSEVEELKANPNRQAKGTVIEAELDKGRGSVATLLVQTGTLNVGDPIVVGNTFGRVRAMVNDLGRRVKTAGPSTPVEITGLNDVPQAGDQFLVFKDEKTARSVGEARASKQLEEQRSDKAKLSLDDLFEQIKQGDVKDINLIVKADVQGSAEALTAALQKIEVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAEAENVDIRLHRIIYKVIEEIEAAMKGMLDPEYEEKVIGQVEVRQTFKVSKIGTIAGGYVTDGHITRDSGLRLIR-DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDIIEAY 708
>gi|168727922|ref|ZP_02760199.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (705 aa)
Score = 1156, Expect = 2.2e-124, Identities = 266/569 (46%), Positives = 381/569 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ----LNTKQRKLSNFGTNLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ EF+ K+N  S+EIIK LFL GI  N+N LL++  +  +  ++G + ++E+ INE++   +I FED +D  +  +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  +N +++  +L E  ++ E+WGG+T+ +  SAL+  GID+LLE I + AE+ ELKANPK  A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   + IKTA PSTPV I+G+N +P++GD+++V +DEK  + + E R     +  +Q   +    NL E   QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  S     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  RI R D  +    ++++L+  KD     A G ECG T+EN+ND  EGD++E +E+V
  S:   128 YQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQLLNQETIELIADDYGVEVEEEVVINEEDL--SIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNTYGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASIIQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIR-DGIVQYEGELDTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMV 701
>gi|193216988|ref|YP_002000230.1| translation initiation factor IF-2 [Mycoplasma arthritidis 158L3-1] >gi|193002311|gb|ACF07526.1| translation initiation factor IF-2 [Mycoplasma arthritidis 158L3-1] (553 aa)
Score = 1155, Expect = 3.2e-124, Identities = 254/548 (46%), Positives = 359/548 (65%)
  Q:    68 IKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNT-KVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + F KG+  N+NT L+E ++ ELCLEFG+DF+KE  ++  NFLD ++  D  + L KRPPIVTIMGHVDHGKTTL+D IRKS +   E G ITQ  GAYQ+ +K   ITF DTPGHEAF++MR+ GA +TDIVV+VVAADDG+KPQT EAIDHA  A  PIIVF+NKMDK  A+ EK+ SQL+E NV+CEEWGG    + GSAL NQ ID LLEAI + A+++ LKAN  R   G  IE+ +D+G+G VA ++V++GTL   D+I+ G  YG ++ +     K +  ALP TP  I+GLN  P++GDK+I  +DEK  K+++ ++    KQR+L+    N    S  +K +NVI+KTD  G+ EAIK  +S I+     +N++RA  G I ++D+ LA  S + + +FN   +S +V   A   GI I+ +NIIY+I +E+  L+K + +PV+ EK IG  ++ QL+ +S +G IAG  V  G++K      + RK+K I     I+SLR G + +     G + G  +++F+     D ++ YE V
  S:     1 MTFYFKKGLIRNINTSLNEEEIAELCLEFGFDFRKEDSVDAQNFLDKLQIIDDPNDLVKRPPIVTIMGHVDHGKTTLIDHIRKSNIQGGEFGGITQHTGAYQITFKGDKITFLDTPGHEAFTEMRSRGAKVTDIVVIVVAADDGVKPQTIEAIDHAKAAGVPIIVFVNKMDKPGADPEKVKSQLSEANVICEEWGGDVQFVYGSALANQNIDSLLEAIFLQADLLNLKANLNRDPIGTIIESKVDRGKGVVATIIVENGTLIPRDFIVAGSQYGNIRSIYSVEGKLLDKALPGTPCVITGLNKNPQAGDKFIALSDEKFAKKIASEKSYLDKQRELN--AKNSISISSDLKAVNVIIKTDVQGTAEAIKNTISKIKNNEVAVNVIRAIAGEITKADVILAEASNARIYLFNNDSLSPEVKSLAEQKGIKIQRHNIIYKIVEELNALVKTLKEPVYEEKLIGEAKVLQLFYYSKVGTIAGCMVEVGQVKEFCKVEVIRKNKAIF-KGTISSLRRGANDVKVVEKGFDFGTHIKDFDKIEVDDTLKFYEDV 546
>gi|116624263|ref|YP_826419.1| translation initiation factor 2 [Solibacter usitatus Ellin6076] >gi|122253045|sp|Q01W31|IF2_SOLUE Translation initiation factor IF-2 >gi|116227425|gb|ABJ86134.1| bacterial translation initiation factor 2 (bIF-2) [Solibacter usitatus Ellin6076] (1001 aa)
Score = 1155, Expect = 3.4e-124, Identities = 246/584 (42%), Positives = 359/584 (61%)
  Q:    29 IKSQFKKVETG---IKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL--LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG-TNLNENSQG-----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++ Q + VE G   I   + + +  +T+ E S+K++  +  ++K L  +GI   +N  LD    G+L  E   DF                 E+ +D   L++R P+VTIMGHVDHGKT+LLD IR++ VA  EAG ITQ IGAYQVE K   I F DTPGHEAF++MR+ GA +TDIV+LVVAADDG+ PQT EAIDHA  A  PIIV INK+DK DA  E+I  QL+++ +L E+WGG  +++  SA   QG+ +LLE I++ A++ +LKANP R A G  IEA +D+G G VA +LV++GTL+V D+ + G  +GKV+ M++    +I+ A PSTPV + GL+ +P++GD + V  D    K++   R    K+  L+      L +  Q      +KEL VI+K D  GS E +K  L  +     K+ ++ + +G+INESDI LA  S ++V+ FN +     +  A    + ++ + IIY + DEI+R + G+L PVF E   G  E+R+ +  S +G +AG +V+ G I R++  R+ R D  ++   KI SLR  KD ++    G ECG TL NF D  +GDI+E +
  S:   402 LRPQRRHVEAGPPPISREITI-SEGITVKELSEKLDVKANLVMKKLMDRGIFVAINQTLD----GKLATEVARDFGASTATVSYEVEAMQSVEEAQDTTDLERRAPVVTIMGHVDHGKTSLLDAIREANVAGREAGGITQHIGAYQVEMKGRKIVFIDTPGHEAFTRMRSRGAKVTDIVILVVAADDGVMPQTLEAIDHAKAAAVPIIVAINKIDKADAQPERIKQQLSDRGLLPEDWGGDVVMVPVSARTQQGLPDLLEMILLVADMQDLKANPSRPAMGTVIEAQLDRGRGPVATVLVRNGTLSVGDFFICGAVFGKVRAMLNDRGTQIRKAEPSTPVEVLGLDSLPEAGDDFQVVTDTAKAKQIVNFRDQRQKEAALAKSSRITLEQLHQQMREGEVKELPVIIKADVGGSAEVLKETLEKLSNDKVKVRVIHSGVGAINESDILLASASNAIVIGFNVRPERNAAATAEQEKVDVRLHTIIYNLTDEIKRAMSGLLAPVFKEVYRGKAEVRETFRISKVGAVAGCQVIDGSIPRDSECRVLR-DNIVVHTGKIGSLRRFKDDVSEVKIGMECGITLANFADLKQGDIIEAF 990
>gi|86606965|ref|YP_475728.1| translation initiation factor IF-2 [Synechococcus sp. JA-3-3Ab] >gi|123724548|sp|Q2JSB7|IF2_SYNJA Translation initiation factor IF-2 >gi|86555507|gb|ABD00465.1| translation initiation factor IF-2 [Synechococcus sp. JA-3-3Ab] (1031 aa)
Score = 1154, Expect = 4.6e-124, Identities = 250/572 (43%), Positives = 372/572 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK---EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           V +   +LT+ E ++++     EIIK LF KG+   +N +LDE     +  E GY+ ++   E +  +   LD    ED + L+  RPP+VTIMGHVDHGKTTLLD IR + VA  EAG ITQ IGAY V    E +K  I F DTPGH+AF+ MRA GA +TDI VLVVAADDG++PQT EA+ HA  A+ PIIV INK+DK  +  E++  QLAE  +L EEWGG T +++ SAL  + +D LLE I++ A++ EL+ANP R A G  IEA +DK  G VA LLVQ+GTL V D ++ G   G+VK M+D   + ++ A PS+ V++ GL  +P +GD++ V  DEK  + ++E+R    +Q +L         + G+   +  +G +KELN+I+KTD  GS EAI+  L  +     +L ++ AA G I E+D+DLA  S ++++ FNT  +      A   G+ ++ Y+IIY + D++   ++G+L+P  VE+ +G  E+R++   S  G +AG  VL+G+++RNA  R++RK  E++   +++SL+  KD +   AAG ECG  +E F+ + EGD++E+Y++V
  S:   441 VLLLEGSLTVQELARRLRVAETEIIKTLFFKGVRVTINQVLDESLAESVAKELGYEVRRPEAEPKAKKTEILD---LEDIDHLV-PRPPVVTIMGHVDHGKTTLLDAIRHTNVAQREAGGITQRIGAYHVDVDFEGQKRRIVFLDTPGHQAFTAMRARGARVTDIAVLVVAADDGVQPQTLEALSHARAAQVPIIVAINKIDKPGSQPERVKQQLAEHGLLPEEWGGDTPMVEVSALTRRNLDALLEMILLVADVAELQANPNRPARGTVIEAHLDKARGPVATLLVQNGTLRVGDTLVAGAVLGRVKAMMDDRGQRLQEAGPSSAVQLLGLEEVPAAGDEFQVYADEKEARRIAEERAEALRQARLQQALLSRRVSLGSISAKAQEGQLKELNLIIKTDVQGSAEAIQTALQDLPQEEVRLRVLLAAPGEITETDVDLAAASDAIILGFNTSFAPGARQAADDKGVDVREYDIIYNLLDDLRAAMEGLLEPEEVEEPLGQAEVRKVIPISR-GAVAGSYVLSGKVQRNALVRVRRKG-EVVYQGRLDSLKRFKDDVREVAAGFECGIGIEKFDAWQEGDLIEVYQMV 1022
>gi|16078726|ref|NP_389545.1| translation initiation factor IF-2 [Bacillus subtilis subsp. subtilis str. 168] >gi|2634035|emb|CAB13536.1| initiation factor IF-2 [Bacillus subtilis subsp. subtilis str. 168] (716 aa)
Score = 1154, Expect = 4.6e-124, Identities = 257/566 (45%), Positives = 373/566 (65%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F+  LT+   ++++ K  +E+IK L L G+   +N  LD+  +  +  E+G + ++ I + E       + ++ EDL + RPP+VTIMGHVDHGKTTLLD+IRK+KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA++TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK+ AN +++  +L E  ++ E WGG+T+ +  SAL  +GIDEL+E I++ +E+ ELKANP R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +KTA PSTPV I+GLN +P++GD+++V  DEK  + + E R   QL  ++   +    +    +  QG +K++N+I+K D  GS EA+   L  IEV G K+ ++   +G+I ESDI LA  S ++V+ FN +        A +  + I+ + IIY++ DEIE  +KG+LDP + EK IG VE+RQ +  S IG IAGG V  G I R++  R+ R D  +I   +++ L+  KD +   + G ECG T++ +ND  EGDI+E +
  S:   139 FSGTLTVGALAEELGKEPSELIKKLMLLGVMATINQELDKDTIELIASEYGVETEEVIVLEETELEKYEEPDNEEDL-EIRPPVVTIMGHVDHGKTTLLDSIRKTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTTMRARGAEVTDITILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKIDKESANPDRVMQELTEYGLVPEAWGGETIFVPLSALTGKGIDELVEMILLVSEVEELKANPNRQAKGTVIEAELDKGRGSVATLLVQTGTLHVGDPIVVGNTFGRVRAMVNDIGRRVKTAGPSTPVEITGLNDVPQAGDQFLVFKDEKTARSVGEARASKQLEEQRSDKAKLSLDDLFEQIKQGDVKDINLIVKADVQGSAEALTAALQKIEVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAEAENVDIRLHRIIYKVIDEIEAAMKGMLDPEYEEKVIGQVEVRQTFKVSKIGTIAGGYVTEGTITRDSGLRLIR-DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDILEAF 708
>gi|124209|sp|P17889|IF2_BACSU Translation initiation factor IF-2 >gi|49319|emb|CAA79234.1| IF2 [Bacillus subtilis] >gi|143359|gb|AAA22673.1| protein synthesis initiation factor 2 (infB) (716 aa)
Score = 1154, Expect = 4.6e-124, Identities = 257/566 (45%), Positives = 373/566 (65%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F+  LT+   ++++ K  +E+IK L L G+   +N  LD+  +  +  E+G + ++ I + E       + ++ EDL + RPP+VTIMGHVDHGKTTLLD+IRK+KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA++TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK+ AN +++  +L E  ++ E WGG+T+ +  SAL  +GIDEL+E I++ +E+ ELKANP R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +KTA PSTPV I+GLN +P++GD+++V  DEK  + + E R   QL  ++   +    +    +  QG +K++N+I+K D  GS EA+   L  IEV G K+ ++   +G+I ESDI LA  S ++V+ FN +        A +  + I+ + IIY++ DEIE  +KG+LDP + EK IG VE+RQ +  S IG IAGG V  G I R++  R+ R D  +I   +++ L+  KD +   + G ECG T++ +ND  EGDI+E +
  S:   139 FSGTLTVGALAEELGKEPSELIKKLMLLGVMATINQELDKDTIELIASEYGVETEEVIVLEETELEKYEEPDNEEDL-EIRPPVVTIMGHVDHGKTTLLDSIRKTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTTMRARGAEVTDITILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKIDKESANPDRVMQELTEYGLVPEAWGGETIFVPLSALTGKGIDELVEMILLVSEVEELKANPNRQAKGTVIEAELDKGRGSVATLLVQTGTLHVGDPIVVGNTFGRVRAMVNDIGRRVKTAGPSTPVEITGLNDVPQAGDQFLVFKDEKTARSVGEARASKQLEEQRSDKAKLSLDDLFEQIKQGDVKDINLIVKADVQGSAEALTAALQKIEVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAEAENVDIRLHRIIYKVIDEIEAAMKGMLDPEYEEKVIGQVEVRQTFKVSKIGTIAGGYVTEGTITRDSGLRLIR-DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDILEAF 708
>gi|116492656|ref|YP_804391.1| translation initiation factor IF-2 [Pediococcus pentosaceus ATCC 25745] >gi|122265880|sp|Q03FS3|IF2_PEDPA Translation initiation factor IF-2 >gi|116102806|gb|ABJ67949.1| bacterial translation initiation factor 2 (bIF-2) [Pediococcus pentosaceus ATCC 25745] (918 aa)
Score = 1154, Expect = 4.7e-124, Identities = 254/571 (44%), Positives = 381/571 (66%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL---LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR----QLNTKQRK----LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  ++  + + E +KKI++  AEIIK LF+ G+  N N  LD   +  L  ++G + +++++++  + +D I FED E     L  RPP+VTIMGHVDHGKTTLLD +R S +   EAG ITQ IGAYQ++    LITF DTPGH AF++MRA GAD+TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK+ AN   +  QL E  ++ E WGG T+ ++ SA   Q IDELL+ I++ AE++ELKANP + A G  IEA +D G+G++A +LVQ GT+ V D I++G  +G+++ MV+ + + +K A PSTPV I+GLNG+P++GD+++V +DEK  +   E+R    Q+  ++R     L N   +L E    +K++++I+K D  GS+EA+   L  IEV G ++N++  A+G+INESD+ LA  S ++++ FN + +++    A S  + I+ + +IY   DE+E  +KG+L+PV+ E+ IG V+IR+ +  S +G IAGG V  G I R++  R+ R D  +I   K+ SL+  KD +     G E G T+EN+ND   GD++E Y +
  S:   336 VLEYSEGINVAEIAKKIHREPAEIIKKLFMMGVMVNQNQSLDNDTVELLAADYGIEAQQKVEVDISD-IDKI-FEDEEKNTTNLVSRPPVVTIMGHVDHGKTTLLDKLRHSHITEGEAGGITQGIGAYQLKHDDKLITFLDTPGHAAFTEMRARGADVTDITILVVAADDGVMPQTIEAINHAKAANVPIIVAVNKIDKQGANPNHVMEQLTEYGLIPESWGGDTIFVEISAKLGQNIDELLDMILLQAEVLELKANPDQNAAGSVIEAQLDPGKGSIATILVQQGTMHVGDPIVIGNTFGRIRTMVNEHGRRVKEATPSTPVEITGLNGVPEAGDRFVVFDDEKSARAAGEERAKRAQMEERKRSNHVTLDNLFDSLKEGE--MKKVDIIIKADVQGSVEALADSLQKIEVEGVRVNIIHKAVGAINESDVTLAAASNAIIIGFNVRPTAQAKQMADSEDVDIRLHRVIYNAIDEVESAMKGMLEPVYEEEIIGQVDIRETYKVSRVGTIAGGFVTEGFITRDSGVRLIR-DGVVIYEGKLGSLKRFKDDVKEVKRGFELGLTVENYNDIKIGDVIEAYRM 912
>gi|49483432|ref|YP_040656.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus MRSA252] >gi|56748921|sp|Q6GHG6|IF2_STAAR Translation initiation factor IF-2 >gi|49241561|emb|CAG40247.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus MRSA252] (705 aa)
Score = 1152, Expect = 8.2e-124, Identities = 264/569 (46%), Positives = 381/569 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLS---NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ EF+ K+N  S+EIIK LFL GI  N+N  L++  +  +  ++G + ++E+ INE++   +I FED +D  +  +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  +N +++  +L E  ++ E+WGG+T+ +  SAL+  GID+LLE I + AE+ ELKANPK  A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   + IKTA PSTPV I+G+N +P++GD+++V +DEK  + + E R   +  +QR+ S   +      +  QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  S     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  RI R D  +    ++++L+  KD     A G ECG T+EN+ND  EGD++E +E+V
  S:   128 YQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVEVEEEVVINEEDL--SIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNTYGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASIVQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIR-DGIVQYEGELDTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMV 701
>gi|15924259|ref|NP_371793.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926852|ref|NP_374385.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus N315] >gi|82750870|ref|YP_416611.1| translation initiation factor IF-2 [Staphylococcus aureus RF122] >gi|148267759|ref|YP_001246702.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus JH9] >gi|150393818|ref|YP_001316493.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus JH1] >gi|156979590|ref|YP_001441849.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus Mu3] >gi|166198934|sp|A7X1Q1|IF2_STAA1 Translation initiation factor IF-2 >gi|189028439|sp|A6U188|IF2_STAA2 Translation initiation factor IF-2 >gi|189028440|sp|A5ISF3|IF2_STAA9 Translation initiation factor IF-2 >gi|54037379|sp|P65134|IF2_STAAN Translation initiation factor IF-2 >gi|54041109|sp|P65133|IF2_STAAM Translation initiation factor IF-2 >gi|90101380|sp|Q2YXP7|IF2_STAAB Translation initiation factor IF-2 >gi|13701069|dbj|BAB42364.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus N315] >gi|14247039|dbj|BAB57431.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus Mu50] >gi|82656401|emb|CAI80820.1| translation initiation factor IF-2 [Staphylococcus aureus RF122] >gi|147740828|gb|ABQ49126.1| bacterial translation initiation factor 2 (bIF-2) [Staphylococcus aureus subsp. aureus JH9] >gi|149946270|gb|ABR52206.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus JH1] >gi|156721725|dbj|BAF78142.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus Mu3] (705 aa)
Score = 1150, Expect = 1.2e-123, Identities = 264/569 (46%), Positives = 381/569 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLS---NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ EF+ K+N  S+EIIK LFL GI  N+N  L++  +  +  ++G + ++E+ INE++   +I FED +D  +  +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  +N +++  +L E  ++ E+WGG+T+ +  SAL+  GID+LLE I + AE+ ELKANPK  A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   + IKTA PSTPV I+G+N +P++GD+++V +DEK  + + E R   +  +QR+ S   +      +  QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  S     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  RI R D  +    ++++L+  KD     A G ECG T+EN+ND  EGD++E +E+V
  S:   128 YQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVEVEEEVVINEEDL--SIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNTYGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASIVQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIR-DGIVQYEGELDTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMV 701
>gi|192812888|ref|ZP_03041554.1| translation initiation factor IF-2 [Geobacillus sp. Y412MC10] >gi|192798216|gb|EDV74730.1| translation initiation factor IF-2 [Geobacillus sp. Y412MC10] (893 aa)
Score = 1150, Expect = 1.3e-123, Identities = 253/567 (44%), Positives = 368/567 (64%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-SNFGTNLNENSQG-----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +   N+T+ E +K ++K ++E+IK L   G+   +N  LD   +  L  EFG + + +I + ED F + ++  D  + L +RPP+VTIMGHVDHGKTTLLD IR + V++ EAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TD+ ++VVAADDG+ PQT EAI+HA  A  PIIV +NK+DK DAN +K+  +L E  ++ EEWGG T+ +  SA    G+++LLE I++ AE+ E KANP + A G  IEA +DKG G VA +LVQ GTL V D  + G  +G+++ MV+   + +K A PSTPV I+GL  +P +GD ++V  DE+  + +++KR +  +Q +L +N    L++  Q      IK+LNVI+K D  GS+EA+KG L+ IEV G ++ ++ +  G+I ESDI LA  S ++V+ FN +   +    A    + I+ + +IY + +EIE+ +KG+LDP + E  IG  E+R  +  S +G IAG  V +G+I RNA AR+ R D  ++   KI+SL+  KD     A G ECG TL  ++D  EGD++E +
  S:   316 IVRGNMTVGETAKLLHKDASEVIKKLIFLGVMATINQELDIDTILLLAGEFGVEVEVKIPVEEDRF-ETVEENDAPEELKERPPVVTIMGHVDHGKTTLLDAIRSTNVSSGEAGGITQHIGAYQVEINNKKITFLDTPGHEAFTAMRARGAQVTDMTIIVVAADDGVMPQTVEAINHAKAAGLPIIVAVNKIDKPDANPDKVKQELTEYELVPEEWGGDTIFVNVSAKQRMGLEDLLEMILLVAEVNEYKANPDKRARGTVIEAELDKGRGPVARILVQHGTLKVGDAFVAGNCFGRIRAMVNDKGRRLKEAGPSTPVEITGLTEVPGAGDPFMVFEDERKARNIADKRAITHRQSELNTNTRVTLDDLFQHIKDGEIKDLNVIIKGDVQGSVEALKGSLNKIEVEGVRVKIIHSGAGAITESDIILAAASNAIVIGFNVRPDVQAKQTAEQEKVDIRLHRVIYNVIEEIEQAMKGMLDPEYKESVIGHAEVRNTFKVSKVGTIAGCMVTSGKITRNAEARLIR-DGIVVHEGKIDSLKRFKDDAKEVAQGYECGITLVGYSDVKEGDVIEAF 886
>gi|57651839|ref|YP_186145.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus COL] >gi|87161873|ref|YP_493859.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus USA300] >gi|88194979|ref|YP_499779.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221390|ref|YP_001332212.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509435|ref|YP_001575094.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123407128|sp|Q2G2D0|IF2_STAA8 Translation initiation factor IF-2 >gi|123735989|sp|Q2FHG9|IF2_STAA3 Translation initiation factor IF-2 >gi|172049023|sp|A6QGG8|IF2_STAAE Translation initiation factor IF-2 >gi|189028441|sp|A8Z3U9|IF2_STAAT Translation initiation factor IF-2 >gi|71152149|sp|Q5HGG2|IF2_STAAC Translation initiation factor IF-2 >gi|57286025|gb|AAW38119.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus COL] >gi|87127847|gb|ABD22361.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202537|gb|ABD30347.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374190|dbj|BAF67450.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368244|gb|ABX29215.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (705 aa)
Score = 1149, Expect = 1.5e-123, Identities = 265/569 (46%), Positives = 380/569 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ----LNTKQRKLSNFGTNLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ EF+ K+N  S+EIIK LFL GI  N+N  L++  +  +  ++G + ++E+ INE++   +I FED +D  +  +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  +N +++  +L E  ++ E+WGG+T+ +  SAL+  GID+LLE I + AE+ ELKANPK  A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   + IKTA PSTPV I+G+N +P++GD+++V +DEK  + + E R     +  +Q   +    NL E   QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  S     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  RI R D  +    ++++L+  KD     A G ECG T+EN+ND  EGD++E +E+V
  S:   128 YQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVEVEEEVVINEEDL--SIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNTYGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASIIQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIR-DGIVQYEGELDTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMV 701
>gi|160880905|ref|YP_001559873.1| translation initiation factor IF-2 [Clostridium phytofermentans ISDg] >gi|189028311|sp|A9KNW4|IF2_CLOPH Translation initiation factor IF-2 >gi|160429571|gb|ABX43134.1| translation initiation factor IF-2 [Clostridium phytofermentans ISDg] (1131 aa)
Score = 1148, Expect = 2.4e-123, Identities = 254/565 (44%), Positives = 359/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED--LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE-------KRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           LTI E + K+    + ++K LFL G   ++N+ +   +  E+ L +    +KE+ +N+   ++ +  ED ED  L+ KRPP+V +MGHVDHGKT+LLD IR++ V + EAG ITQ IGAY VE     ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI HA  A   IIV INK+DK  ANIE++  +L E  ++ E+WGG T+ +  SA   +GID+LLE II+TAE+ ELKANP R+A GI IEA +DKG G VA +LVQ GTL V D I++G  YGKV+ M+D   + +K A PSTPV I GLN +P +G+ ++ T +EK  + +++       +R L   + KLS  G      +  IKELN+I+K D  GS+EA+K  L  +      + ++   +G+INESD+ LA TS ++++ FN +  +   + A    + ++ Y +IY   +++E  +KG+LDP F EK +G  E+RQ++  S +G IAG  VL G+I R   ARI R+  +I   A + SL+  KD +     G ECG   E FND  E D+VE+Y +V
  S:   558 LTIKELADKMKVVPSVVVKKLFLAGKMVSINSEITFEEAEEIALGYEIIAEKEVLVNK---VEELLKEDDEDENLMVKRPPVVCVMGHVDHGKTSLLDAIREANVTSREAGGITQHIGAYTVEVNGEKITFLDTPGHEAFTSMRMRGAKSTDIAILVVAADDGVMPQTVEAISHAKAAGVQIIVAINKIDKPSANIERVKQELTEHELIAEDWGGDTIFVPVSAHTKEGIDQLLEMIILTAEMGELKANPDRMARGIVIEAELDKGRGTVATILVQKGTLHVGDNIVIGSTYGKVRAMMDDKGRRVKEATPSTPVEILGLNAVPNAGEIFMATENEKEARNIADAFISQGKERLLADTKAKLSLDGLFSQIQAGNIKELNLIVKADVQGSVEAVKQSLVKLSNEEVAVRIIHGGVGAINESDVMLASTSNAIIIGFNVRPDNMAREIAEREKVDLRLYRVIYSAIEDVEAAMKGMLDPTFEEKVMGHAEVRQVFKASGLGTIAGSYVLDGKIVRGCSARITREGTQIFEGA-LASLKRFKDDVKEVNTGYECGLVFEKFNDIQEYDLVELYMMV 1127
>gi|118479033|ref|YP_896184.1| translation initiation factor IF-2 [Bacillus thuringiensis str. Al Hakam] >gi|118418258|gb|ABK86677.1| bacterial translation initiation factor 2 (bIF-2) [Bacillus thuringiensis str. Al Hakam] (706 aa)
Score = 1147, Expect = 2.8e-123, Identities = 262/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:   109 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 699
>gi|23099053|ref|NP_692519.1| translation initiation factor IF-2 [Oceanobacillus iheyensis HTE831] >gi|39931288|sp|Q8EQU1|IF2_OCEIH Translation initiation factor IF-2 >gi|22777281|dbj|BAC13554.1| translation initiation factor IF-2 [Oceanobacillus iheyensis HTE831] (692 aa)
Score = 1147, Expect = 3.1e-123, Identities = 256/570 (44%), Positives = 366/570 (64%)
  Q:    43 GVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQL-----NTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           G   +   LT+ + + K+NK  AE+IK L   G+    N  +D+  +  +C E+  + +KEI I ED  LD    ED E+ L +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MR+ GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NKMDK+ AN +++  +L E  ++ E+WGG T+ +  SA+ N+GID+LLE I++ +E+ ELKANP   A G  I+A +DKG G+VA LLVQ+GTL V D ++VG  +GKV+ MV+     +    PSTPV I+GL+G+P++GD+++V  DEK  +++ E R+      N   +   +      +  QG +KELN+I+K D  GS+EA+   L  IEV G  + ++   +G+I ESDI LA  SK++V+ FN +      + A S  + ++ + +IY   +EIE  +KG+LDP + EK IG  E+R+++  S IG IAG  V  G+I R+A  R+ R D  ++   ++ +L+  KD +       ECG T+ NFND  EGD +E +
  S:   111 GKITYHGTLTVQDLAGKLNKEPAELIKKLMFLGVMATKNQDIDDDAIELICGEYDVEVEKEI-ILEDTDLDKYIEEDAEENLQERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQVENDGKKITFLDTPGHAAFTSMRSRGAQVTDIAILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKMDKEGANPDRVMQELTEHQLIPEDWGGNTIFVNLSAIKNEGIDDLLEMILLVSEVEELKANPNAKAFGSVIDAQLDKGRGSVATLLVQNGTLHVGDPLVVGSTFGKVRAMVNDLGNRVTEVGPSTPVEITGLHGVPQAGDQFLVFKDEKKARQIGEAREQKQIDENRGTQSTVSLDDLFEQIKQGEMKELNIIVKADVQGSVEALAASLQKIEVEGVNVKIIHTGVGAITESDIILASASKAIVIGFNVRPDVNAKNAAESEKVDLRLHRVIYNAIEEIESAMKGLLDPEYQEKVIGQAEVREIFKVSRIGTIAGSYVTDGKITRDAGVRLIR-DGVVLYEGELQALKRFKDDVKEVQTNYECGITISNFNDIKEGDTIEAF 684
>gi|81428859|ref|YP_395859.1| translation initiation factor IF-2 [Lactobacillus sakei subsp. sakei 23K] >gi|90101362|sp|Q38W81|IF2_LACSS Translation initiation factor IF-2 >gi|78610501|emb|CAI55552.1| Translation initiation factor IF-2 [Lactobacillus sakei subsp. sakei 23K] (937 aa)
Score = 1146, Expect = 3.2e-123, Identities = 256/569 (44%), Positives = 373/569 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL-LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           V VF+  + + + +KKI++  AEIIK LF+ GI  N+N  LD+  +  L  ++G + +++++++  +     + E + D  L  RPP+VTIMGHVDHGKTTLLD +R S V   EAG ITQ IGAYQ +    LITF DTPGH AF+ MRA GAD+TDI++LVVAADDG+ PQT EAI+HA  AKAPIIV +NK+DK  AN + +  QL    ++ E+WGG T+ +K SA   + ID+LLE +++ A+++ELKAN  + A G  IEA +DKG+G VA LLVQ GTL + D I+VG  +G+V+ M +   + +K   PS PV I+GLN +P++ D+++V  DEK  +   E+R      K+R  SN  T  NL E   QG +KE+ VI+K D  GS EA+ G L  IEV G ++N++  A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ + IIY+  +EIE  +KG+L+PV+ EK  G + +R+ ++ S IG IAG  V TG I+R++  R+ R D  +I   K++SL+  KD +     G ECG T+E++ND    D +E Y
  S:   355 VLVFSEGMNVADIAKKIHREPAEIIKKLFMLGIMVNMNQSLDKDTIELLATDYGIEAEQKVEVDIADIDSVFETEAKSDANLVSRPPVVTIMGHVDHGKTTLLDNLRNSHVTDGEAGGITQHIGAYQTKLNDRLITFLDTPGHAAFTNMRARGADITDIIILVVAADDGVMPQTIEAINHAKAAKAPIIVAVNKIDKPGANPDHVMEQLMGYGLVPEDWGGDTIFVKISAKTGENIDDLLEMVLLEADVLELKANRDQKAVGTVIEARLDKGKGPVASLLVQQGTLRIGDPIVVGNTFGRVRVMTNDRGRRVKEVFPSEPVEITGLNDVPQAADRFVVFEDEKTARAAGEERAKRALLKERSRSNPVTLDNLFETMKQGELKEVGVIIKADVQGSTEALAGSLRKIEVEGVRVNIIHEAVGAINESDVTLAAASNAIIIGFNVRPTPQAKIQADAEQVDIRLHRIIYKAIEEIEAAMKGMLEPVYEEKVTGQLTVRETYNVSKIGTIAGCIVDTGVIRRDSGVRLIR-DSIVIYEGKLSSLKRFKDDVKEVKTGFECGVTIEDYNDIKIDDQIEAY 929
>gi|119964199|ref|YP_947328.1| translation initiation factor IF-2 [Arthrobacter aurescens TC1] >gi|189028279|sp|A1R516|IF2_ARTAT Translation initiation factor IF-2 >gi|119951058|gb|ABM09969.1| translation initiation factor IF-2 [Arthrobacter aurescens TC1] (958 aa)
Score = 1146, Expect = 3.4e-123, Identities = 252/563 (44%), Positives = 372/563 (66%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE-----DNFLDNIKFE---DREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV--TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +I +F++KI+ + A ++  LF  G        LDE   G L  E GY  +     +E     D F  NI+ E   + +D+L+ R P+VT+MGHVDHGKT LLD IR S V A E G ITQ IGAYQ+    E K   ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK+ AN +K+  QL E  ++ EE+GG TM ++ SA  N  IDEL++A+++TA+  ++L+ANP + A GI IEA++DKG GAVA +LVQSGTLAV D I+ G  +G+V+ M D N + +  ALPS PV++ GL+ +P++GD ++VT DE+  ++++EKR+         K+RK   L +F   + E    I  LN+ILK D +G++EA++  L  I+V     +L ++   +G+I ++D++LA    ++++ FN K + +V++ A   G+ ++ Y++IY   D+IE  LKG+L P + E ++G+ E+R+++  S  G IAG  V TG I+RN+ AR+ R  K I  N  + +L+  KD         ECG  L +FND  EGDI+E +E+
  S:   368 SITDFAEKIDANPASLVTVLFHLGEMATATQSLDEDTFGLLGAELGYKLQVVSPEDEERELLDQFDINIQDELDAEGDDVLEARAPVVTVMGHVDHGKTRLLDAIRNSNVVAGEHGGITQHIGAYQISHVHEGKARDITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMPQTVEALNHAQAANVPIVVAVNKIDKEGANPDKVKGQLTEYGLVPEEYGGDTMFVEVSARQNLNIDELIDAVLLTADAALDLRANPDKDARGIAIEANLDKGRGAVATVLVQSGTLAVGDTIVAGTAHGRVRAMFDENGEALDVALPSRPVQVLGLSNVPRAGDTFLVTPDERTARQIAEKREAADRNAALAKRRKRISLEDFDQAVAEGK--IDTLNLILKGDVSGAVEALEDALLKIDVGDDDVQLRVIHRGVGAITQNDVNLATVDNAIIIGFNVKPAERVAELADREGVDMRFYSVIYAAIDDIEMALKGMLKPEYEEVQLGTAEVREVFRSSKFGNIAGSIVRTGIIRRNSKARVSRDGKVIGDNLTVETLKRFKDDATEVRTDFECGIGLGSFNDINEGDIIETFEM 952
>gi|21282881|ref|NP_645969.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus MW2] >gi|49486108|ref|YP_043329.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus MSSA476] >gi|23821722|sp|Q8NWZ1|IF2_STAAW Translation initiation factor IF-2 >gi|56748910|sp|Q6G9U4|IF2_STAAS Translation initiation factor IF-2 >gi|21204320|dbj|BAB95017.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus MW2] >gi|49244551|emb|CAG42980.1| translation initiation factor IF-2 [Staphylococcus aureus subsp. aureus MSSA476] (705 aa)
Score = 1145, Expect = 4.2e-123, Identities = 263/569 (46%), Positives = 380/569 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLS---NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ EF+ K+N  S+EIIK LFL GI  N+N  L++  +  +  ++G + ++E+ INE++   +I FED +D  +  +RP +VTIMGHVDHGKTTLLD+IR +KV A EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  +N +++  +L E  ++ E+WGG+T+ +  SAL+  GID+LLE I + AE+ ELKANPK  A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   + IK A PSTPV I+G+N +P++GD+++V +DEK  + + E R   +  +QR+ S   +      +  QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  S     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  RI R D  +    ++++L+  KD     A G ECG T+EN+ND  EGD++E +E+V
  S:   128 YQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVEVEEEVVINEEDL--SIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAGGITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNTYGRIRAMVNDLGQRIKMAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASIVQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIR-DGIVQYEGELDTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMV 701
>gi|28378673|ref|NP_785565.1| translation initiation factor IF-2 [Lactobacillus plantarum WCFS1] >gi|38257836|sp|Q88VK7|IF2_LACPL Translation initiation factor IF-2 >gi|28271509|emb|CAD64414.1| translation initiation factor IF-2 [Lactobacillus plantarum WCFS1] (858 aa)
Score = 1145, Expect = 4.3e-123, Identities = 254/568 (44%), Positives = 376/568 (66%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRE----DLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--QLNTKQRKLSNFGT--NLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
            V+T  +   +  K +++  AEIIK LF+ G+  N N  LD+  +  L  ++G + ++++Q++     D  KF D E    D L  R P+VT+MGHVDHGKTTLLD +R + V   EAG ITQ+IGAYQV+    +ITF DTPGH AF++MRA GAD+TDI VLVVAADDG+ PQT EAI+HA  AK PIIV +NK+DK  AN   +  QL E  ++ E+WGG T+ ++ SA   + +DELL+ I++ +E++EL ANPK+ A G  +EAS+D+G+G+ A LLVQ GT+ V D I+VG  YGKV+ M + + K IK A+PSTP+ I+GLN +P +GD+++V +DEK  ++  E+R  Q   ++RK +   T  NL ++  QG +KE++VI+K D  GS+EA+ G L  I+V G ++N++  A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ + +IY   DEIE  +KG+L+P + E+  G  EIR+++  S IG I GG V  G I R++  R+ R D  +I + K+ SLR  KD +     G E G  +E++ND    D++E Y
  S:   277 LVYTVGMNAQDLGKLLHREPAEIIKKLFMLGVAVNQNQSLDKDTIEILATDYGINAQEKVQVD---VTDLDKFFDDEVNNTDNLAPRAPVVTVMGHVDHGKTTLLDQLRHTHVTEGEAGGITQAIGAYQVKHDGKVITFLDTPGHAAFTEMRARGADITDITVLVVAADDGVMPQTIEAINHAKAAKVPIIVAVNKIDKPGANPNHVMEQLTEYGLIPEDWGGDTIFVQISAKFGKNLDELLDMILLQSEVLELTANPKQNAAGSVLEASLDRGKGSTATLLVQQGTMHVGDPIVVGNTYGKVRTMTNDHGKRIKEAVPSTPIEITGLNDVPDAGDRFVVFDDEKTARDAGEQRAKQALMEERKQTAHVTLDNLFDSMKQGELKEVDVIIKADVQGSVEALAGSLRKIDVEGVRVNIIHTAVGAINESDVALAEASNAIIIGFNVRPTPQAKAQADTDDVDIRLHQVIYNAIDEIESAMKGMLEPTYKEEITGQAEIREIYKVSKIGTIGGGMVTDGVIHRDSGVRVIR-DGVVIYDGKLASLRRFKDDVKEVKQGFELGLRIEDYNDIKVNDVIEAY 850
>gi|27467863|ref|NP_764500.1| translation initiation factor IF-2 [Staphylococcus epidermidis ATCC 12228] >gi|57866759|ref|YP_188418.1| translation initiation factor IF-2 [Staphylococcus epidermidis RP62A] >gi|29427436|sp|Q8CST4|IF2_STAES Translation initiation factor IF-2 >gi|71152150|sp|Q5HPS2|IF2_STAEQ Translation initiation factor IF-2 >gi|27315408|gb|AAO04542.1|AE016747_39 translation initiation factor IF-2 [Staphylococcus epidermidis ATCC 12228] >gi|57637417|gb|AAW54205.1| translation initiation factor IF-2 [Staphylococcus epidermidis RP62A] (720 aa)
Score = 1145, Expect = 4.5e-123, Identities = 261/569 (45%), Positives = 373/569 (65%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ----LNTKQRKLSNFGTNLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +   +T+ E ++K+N  SA IIK LFL GI  N+N  LDE  +  +  ++G + +KE+ ++E++   +I F+D  D  D  +RP +VTIMGHVDHGKTTLLD+IR +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A+ P IV +NK+DK  AN +++  +L E  ++ E+WGG T+ +  SAL+  GID+LLE I + AE+ ELKANP + A G  IEA +DK  G  A LLVQ+GTL V D I+VG  YG+++ MV+   K IK+A PSTPV I+G+N +P +GD+++V  DEK  + + E R     +  +Q   +    NL E   QG +K+LNVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESD+ LA  S  +++ FN +  +     A +  + ++ + +IY + +EIE  +KG+LDP F E+ IG  E+RQ +  S +G IAG  V  G+I RNA  R+ R D  ++   ++++L+  KD     A G ECG T+E +ND  EGDI+E +E+V
  S:   143 YQEGITVGELAEKLNVESAGIIKKLFLLGIMANINQSLDEETLELIADDYGVEIEKEVVVDEEDL--SIYFDDETDDSDAIERPAVVTIMGHVDHGKTTLLDSIRNTKVTEGEAGGITQHIGAYQIENSGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEAINHAKEAEVPTIVAVNKIDKPTANPDRVMQELTEYGLIPEDWGGDTIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPNKQAVGTVIEAELDKSRGPAASLLVQNGTLNVGDAIVVGNTYGRIRAMVNDLGKRIKSAGPSTPVEITGINDVPLAGDRFVVFGDEKQARRIGEARHEASVIQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDAGAKRAAEAENVDMRLHRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGSYVTEGKITRNAGVRVIR-DGIVLFEGELDTLKRFKDDAKEVAQGYECGITIEKYNDLKEGDIIEAFEMV 716
>gi|42782901|ref|NP_980148.1| translation initiation factor IF-2 [Bacillus cereus ATCC 10987] >gi|81830996|sp|Q732Q9|IF2_BACC1 Translation initiation factor IF-2 >gi|42738828|gb|AAS42756.1| translation initiation factor IF-2 [Bacillus cereus ATCC 10987] (686 aa)
Score = 1143, Expect = 7.7e-123, Identities = 262/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTTFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIYEGQLDTLKRFKDDVKEVAQNYECGITIEKYNDLKEGDIIEAY 679
>gi|168164214|ref|ZP_02599447.1| translation initiation factor IF-2 [Bacillus cereus H3081.97] (686 aa)
Score = 1143, Expect = 7.9e-123, Identities = 262/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTTFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIYEGQLDTLKRFKDDVKEVAQNYECGITIEKYNDLKEGDIIEAY 679
>gi|168142533|ref|ZP_02585762.1| translation initiation factor IF-2 [Bacillus cereus G9842] (688 aa)
Score = 1143, Expect = 8.7e-123, Identities = 262/587 (44%), Positives = 374/587 (63%)
  Q:    26 NIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           N   + Q + VET  K     F+ +LT+ E +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++EI ++E  F   +  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + ++ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V+ G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    93 NFAGRQQTQIVETPDK---ITFSGSLTVGELAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIATDYGIEVEEEIVVSETEFETFMDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAISHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALVAQRGEKSKLSLEDLFQQIQESDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDVRLHRIIYKVIEEIELAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVIDGKITRDSGVRIIR-DGIVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 681
>gi|159027906|emb|CAO89713.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (1010 aa)
Score = 1143, Expect = 9.2e-123, Identities = 252/570 (44%), Positives = 371/570 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL--LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTK------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           V T +LT+ + S+ +     EII+ LF KG+  N+   LD   +  +  +F  D   E    +   +   +  D  D   L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V+     K   I F DTPGHEAF+ MRA GA +TDI VLVVAADDG++PQT+EAI HA  A+ PI+V INK+DK  AN ++I  +L E+ ++ E+WGG+T+++  SAL  + +D LLE I++ AE+ EL ANP RLA G  IEA++D+ +G VA LLVQ+GTL V + I+ G  +GK++ M+D   ++++ A PS  V I GL+ +P +GD++ V   EK  + ++++R   Q NT+       R++S    ++      +KELN+ILK D  GS+EAI G L  +     ++ ++ A+ G I E+D+DLA  S ++VV FNT ++S     A   G+ I++YNIIY++ D+I+  ++G+LDP  VE+ +G  E+R +++    G +AG  V +G++ RN F R+ R+ KEI+    ++SL+  K+     A G ECG  +  FND+ EGDI+E YE+V
  S:   422 VITGSLTVRDLSELMKVPETEIIRTLFFKGMAVNITQTLDVDTIEMIARDF--DMTVETPSTQSAAIKTTEMIDVSDWESLQRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDVEHNGKPEQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDGVQPQTKEAISHARAAEVPIVVAINKVDKPSANPDRIKQELTEQGLVAEDWGGETIMVPVSALRGENLDNLLEMILLVAEVEELVANPDRLAKGTVIEANLDRTKGPVATLLVQNGTLRVGNSIVAGSVFGKIRAMIDDRGQKVEAATPSFAVEILGLSDVPAAGDEFDVYESEKEARSIADQRAIEQRNTRLQQALSSRRVSLSTLSIQAQEGQLKELNLILKADVQGSVEAILGALKQLPQNEVQIRVLLASPGEITETDVDLAAASGAVVVGFNTTLASGARASADREGVDIRDYNIIYKLLDDIQGAMEGLLDPEEVEEHLGFAEVRAVFTVGR-GAVAGCYVQSGKLVRNRFLRV-RRGKEIVYQGVLDSLKRMKEDAREVATGFECGVGVSKFNDWKEGDIIEAYEMV 1002
>gi|145620927|ref|ZP_01776937.1| translation initiation factor IF-2 [Geobacter bemidjiensis Bem] >gi|144942773|gb|EDJ77888.1| translation initiation factor IF-2 [Geobacter bemidjiensis Bem] >gi|197087050|gb|ACH38321.1| translation initiation factor IF-2 [Geobacter bemidjiensis Bem] (986 aa)
Score = 1142, Expect = 9.3e-123, Identities = 250/601 (41%), Positives = 381/601 (63%)
  Q:    14 KNKNKKIVDNRTNI--------DIKSQFKKVETGIKNGVFV---------FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K+  K I+D R  +          K +++KV+ G K  + V          + ++T+ E +K++   + ++I+ L   G+   +N  LD      L  +FGY+ +  + ++ D  L+     D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA++H+  A  PIIV INK+DK DA+  K+  +L E  ++ EEWGG+T+ ++ SA     ++ LLE +++ A+++EL+ANP + A G  +EA +DKG G VA +LVQ GTL   DY + G +YG+V+ M +   +++  A P+ PV + G NG+P +GD ++   DEK  KE++  RQ+  ++ +L+         L E  Q   +K+LN I+K D  GS+EA+   L  +     +LN++ A++G+I E+D++LA  S ++++ FN +   K +  A   G+ ++ YNIIY   D+I++ ++G+L+P F EK +G  EIR+++S    G++AG  V  G+I RNA  R+ R D  ++   K+ SLR  KD +   A G ECG +LEN+ND   GDI E +E+
  S:   360 KDSFKDILDKRERVFEPGPRSKGRKGKYEKVQIGKKTEITVPKAIKRIIKISESITVGELAKRMGIKATDLIRALMKLGVMATINHPLDFDTATLLATDFGYEIEN-VALDVDEILE--AEPDTPESLLKRPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELNGKKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAVNHSKAAGVPIIVAINKIDKPDASPGKVKQELMEFGLVSEEWGGETIFVEVSAKKRINLESLLEMVLLQADVLELRANPDKPARGTIVEAKLDKGRGPVATVLVQEGTLKSGDYFVAGVHYGRVRAMQNDRGEKVLAAGPAMPVEVIGFNGVPDAGDIFVAMGDEKQAKEIANHRQMKLRESELAKHSKLSLEQLYEKIQKGEVKDLNAIVKGDVQGSVEAVAESLRKLSTDAIRLNVLHASVGAITETDVNLASASNAIILGFNVRPEVKAAALAEKEGVDVRLYNIIYDAVDDIKKAMEGLLEPTFKEKYLGRAEIREVFSVPKAGMVAGSYVTDGKIVRNAQVRLLR-DNMVVYEGKLGSLRRFKDDVKEVATGYECGMSLENYNDLKIGDIFECFEM 979
>gi|148243069|ref|YP_001228226.1| translation initiation factor IF-2 [Synechococcus sp. RCC307] >gi|166198942|sp|A5GVG4|IF2_SYNR3 Translation initiation factor IF-2 >gi|147851379|emb|CAK28873.1| Translation initiation factor IF-2 [Synechococcus sp. RCC307] (1106 aa)
Score = 1142, Expect = 1.0e-122, Identities = 237/568 (41%), Positives = 374/568 (65%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKEL-----SEKR------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           NLT+ E + K++  S+EIIK LF KGI   +   LD   + ++  EFG    + +I+      ++ I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQV+         +TF DTPGHEAF+ MRA G  +TD+ +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A I+++  +L+++++L E+WGG T+++  SAL  +G+D+LLE I++  E+ +LKANP+R+A G  +EA +DK +G VA LLVQ+GTL   D +  G   GKV+ MV+ + + +K A PS+ V + G + +P +GD++ V  DEK  + +     SE R      Q+ +++  L++     +E    +KELN+ILK D  GS+EAI G+L  +     ++ ++ +A G + E+D+DLA  S +++V FNT ++S     A   G+ +++YN+IY++ ++I+  ++G+L+P  VE  +G  E+R ++S      +AG  V +G I+RN   R+ R  K+++ +  ++SL+  K+ +     G ECGF  + F D+ EGD VE + +V +
  S:   522 NLTVQELADKLSVESSEIIKSLFFKGIIATVTQTLDLESIEKVSQEFGVPVLQDDIEEAAKKTVEMIEESDLDHLI-RRPPVVTVMGHVDHGKTSLLDAIRKTRVAAGEAGGITQHIGAYQVDVDHAGASKKVTFLDTPGHEAFTAMRARGTKVTDVAILVVAADDGVRPQTLEAISHARAAEVPIVVAINKVDKEGAQIDRVKQELSDQSLLAEDWGGDTVMVPVSALKGEGLDKLLEMILLVTEVEDLKANPERMAKGTVVEAHLDKAKGPVATLLVQNGTLRPGDVVAAGPVLGKVRAMVNDSGRRVKEAAPSSAVEVLGFSEVPAAGDEFEVYPDEKAARSVVGDRASEARATRLAQQMASRRVSLTSMSGQASEGE--LKELNLILKADVQGSVEAILGMLEQLPQGEVQVRVLLSAPGEVTETDVDLAAASGAVIVGFNTTLASGARRAAELAGVDVRDYNVIYKLLEDIQAAMEGLLEPELVESPLGEAEVRAVFSIGK-SAVAGCYVTSGSIQRNCKIRVHR-GKQLVFSGDLDSLKRMKNDVKEVNTGFECGFGCDRFADWQEGDRVEAFAMVTQ 1100
>gi|47569090|ref|ZP_00239779.1| translation initiation factor IF-2 [Bacillus cereus G9241] >gi|47554252|gb|EAL12614.1| translation initiation factor IF-2 [Bacillus cereus G9241] (686 aa)
Score = 1142, Expect = 1.1e-122, Identities = 262/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 679
>gi|49478920|ref|YP_037874.1| translation initiation factor IF-2 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141676|ref|YP_085154.1| translation initiation factor IF-2 [Bacillus cereus E33L] >gi|166994466|ref|ZP_02260926.1| translation initiation factor IF-2 [Bacillus cereus AH820] >gi|196042139|ref|ZP_03109422.1| translation initiation factor IF-2 [Bacillus cereus NVH0597-99] >gi|196044661|ref|ZP_03111896.1| translation initiation factor IF-2 [Bacillus cereus 03BB108] >gi|189028464|sp|A0RHI4|IF2_BACAH Translation initiation factor IF-2 >gi|81824219|sp|Q636L3|IF2_BACCZ Translation initiation factor IF-2 >gi|81828230|sp|Q6HF02|IF2_BACHK Translation initiation factor IF-2 >gi|49330476|gb|AAT61122.1| translation initiation factor IF-2 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975145|gb|AAU16695.1| translation initiation factor IF-2 [Bacillus cereus E33L] >gi|196024696|gb|EDX63368.1| translation initiation factor IF-2 [Bacillus cereus 03BB108] >gi|196026991|gb|EDX65615.1| translation initiation factor IF-2 [Bacillus cereus NVH0597-99] (686 aa)
Score = 1142, Expect = 1.1e-122, Identities = 262/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 679
>gi|90101365|sp|Q5YSC6|IF2_NOCFA Translation initiation factor IF-2 (969 aa)
Score = 1141, Expect = 1.4e-122, Identities = 249/563 (44%), Positives = 366/563 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKF-----EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F++KI+ + A +++ LF  G        +++  +  L  E  Y  +     +ED   L++        E  ED L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV      +  LITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ AN EKI  QL E  ++ EE+GG TM +  SA     ID LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D I+ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD  +V +++++ ++++++R       L  + RK   L +    L E S    ELN+ILK DN G++EA++  L  IEV    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE+ LKG+L P++ E E+G  EIR ++  S +G IAG  VL+G +KRNA AR+ R +  +     I+SLR  KD +     G ECG TL  +ND  EGDI+E YE+
  S:   385 SLSDFAEKIDANPAALVQALFNLGEMVTATQSVNDETLELLGSEMNYVVQVVSPEDEDRELLESFDLTYGEDEGDEDDLQVRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVMTHLGDEDRLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGANPEKIRQQLTEYGLVAEEYGGDTMFVDISAKQGTNIDALLEAVLLTADAALDLRANPNMDAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGEDVEAALPSRPVQVVGFTSVPGAGDNLLVVDEDRIARQIADRRNARKRNALAARSRKRISLEDLDAALKETS----ELNLILKGDNAGTVEALEEALMGIEVGDEVRLRVIDRGVGGVTETNVNLASASNAIIIGFNVRAEGKATELANREGVDIRYYSVIYQAIDEIEKALKGMLKPIYEEVELGRAEIRAIFRSSKVGNIAGCMVLSGSVKRNAKARLLRDNVVVAETTTISSLRREKDDVTEVREGFECGMTL-TYNDIKEGDIIEAYEL 963
>gi|54026037|ref|YP_120279.1| translation initiation factor IF-2 [Nocardia farcinica IFM 10152] >gi|54017545|dbj|BAD58915.1| putative translation initiation factor IF-2 [Nocardia farcinica IFM 10152] (980 aa)
Score = 1141, Expect = 1.4e-122, Identities = 249/563 (44%), Positives = 366/563 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKF-----EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F++KI+ + A +++ LF  G        +++  +  L  E  Y  +     +ED   L++        E  ED L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV      +  LITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ AN EKI  QL E  ++ EE+GG TM +  SA     ID LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D I+ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD  +V +++++ ++++++R       L  + RK   L +    L E S    ELN+ILK DN G++EA++  L  IEV    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE+ LKG+L P++ E E+G  EIR ++  S +G IAG  VL+G +KRNA AR+ R +  +     I+SLR  KD +     G ECG TL  +ND  EGDI+E YE+
  S:   396 SLSDFAEKIDANPAALVQALFNLGEMVTATQSVNDETLELLGSEMNYVVQVVSPEDEDRELLESFDLTYGEDEGDEDDLQVRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVMTHLGDEDRLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGANPEKIRQQLTEYGLVAEEYGGDTMFVDISAKQGTNIDALLEAVLLTADAALDLRANPNMDAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGEDVEAALPSRPVQVVGFTSVPGAGDNLLVVDEDRIARQIADRRNARKRNALAARSRKRISLEDLDAALKETS----ELNLILKGDNAGTVEALEEALMGIEVGDEVRLRVIDRGVGGVTETNVNLASASNAIIIGFNVRAEGKATELANREGVDIRYYSVIYQAIDEIEKALKGMLKPIYEEVELGRAEIRAIFRSSKVGNIAGCMVLSGSVKRNAKARLLRDNVVVAETTTISSLRREKDDVTEVREGFECGMTL-TYNDIKEGDIIEAYEL 974
>gi|167635845|ref|ZP_02394154.1| translation initiation factor IF-2 [Bacillus anthracis str. A0442] >gi|170687872|ref|ZP_02879086.1| translation initiation factor IF-2 [Bacillus anthracis str. A0465] >gi|167528802|gb|EDR91560.1| translation initiation factor IF-2 [Bacillus anthracis str. A0442] >gi|170668188|gb|EDT18937.1| translation initiation factor IF-2 [Bacillus anthracis str. A0465] (686 aa)
Score = 1141, Expect = 1.4e-122, Identities = 261/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI ++VVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVELNDKKITFLDTPGHAAFTTMRARGAQVTDITIIVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 679
>gi|109645608|ref|ZP_01369528.1| translation initiation factor IF-2 [Desulfitobacterium hafniense DCB-2] >gi|109643557|gb|EAT53110.1| translation initiation factor IF-2 [Desulfitobacterium hafniense DCB-2] (855 aa)
Score = 1141, Expect = 1.5e-122, Identities = 241/567 (42%), Positives = 348/567 (61%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQM----GELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           V   +LT+ + + K+++ S E+IK L   G+   +N  +D        GE+ +      +K I + E+        ED    L  RPP+VT+MGHVDHGKT+LLD IR +KV A+EAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV INK+DK+++N +++  +L E  ++ EEWGG T+ +  SA     I++LLE +++ AEI ELKANP R A G  IEA +DKG+G VA +LV  GTL V D IL G  +G+++ MVD   + +K A PSTPV + GLN +PK+G  + V +DEK  ++++E R           T +  L +    + E    +KELNVI+K D  GS+EA+K  L  +  +  ++N +   +G+I E+DI LA  S ++++ FN +  +     A   G+ ++ Y +IY   ++++  + G+LDP F E   G  E+RQ++    +G + G  VL G+I R++  R+ R D  +I   ++ SLR  KD       G ECG  + NFND  EGDI+E +
  S:   278 VIPESLTVQDLAAKMSRKSGEVIKKLMDMGVMATINQEIDSETAVIIAGEMGVTVEVKIEKPITVIEE-------IEDDPAELRSRPPVVTVMGHVDHGKTSLLDAIRTTKVTASEAGGITQHIGAYQVEINGQKITFLDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQTVEAINHAKAADVPIIVAINKIDKEESNPDRVKQELTEYGLVVEEWGGDTIAVPVSAKARMNIEQLLEMVLLVAEIKELKANPNRSATGTVIEAELDKGKGPVATVLVSKGTLNVGDIILAGSSFGRIRAMVDDKGRRVKKAGPSTPVEVQGLNEVPKAGQVFNVVDDEKHARQIAEARANERKAEEVRQTTKVSLEDLFDRIKEGE--VKELNVIIKADVQGSIEALKQSLLRLSTSEVRVNPIHGGVGAITETDIMLAAASNAIIIGFNVRPDANTKATAELQGVDMRLYRVIYDAIEDVKAAMTGMLDPDFKEVVQGRAEVRQVFKVPKVGTVGGSYVLNGKITRHSKIRVIR-DGIVIHEGELESLRRFKDDAKEVVEGYECGIGVANFNDIKEGDIIEAF 846
>gi|29375843|ref|NP_814997.1| translation initiation factor IF-2 [Enterococcus faecalis V583] >gi|39931261|sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2 >gi|29343305|gb|AAO81067.1| translation initiation factor IF-2 [Enterococcus faecalis V583] (798 aa)
Score = 1141, Expect = 1.6e-122, Identities = 257/567 (45%), Positives = 371/567 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK----RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVE 610
           V  +T  + + + +KKI++  AEIIK LF+ G+  N N  LD+  +  L +++G + ++++Q++     D  KF + E ++++    RPP+VTIMGHVDHGKTTLLDT+R S+V + EAG ITQ IGAYQ++     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  AK PIIV +NK+DK  AN + +  +L+E  ++ EEWGG T+ +  SA  NQ IDELLE I++ AE+ +LKA+P + A G  IEA +DKG+G VA LLVQ GTL V D I+VG  YG+V+ M +   +  K A P+TPV I+GLN +P++GD+++V  DEK  ++  E+R       Q +   R  L N   +L E    +KE+N+I+K D  GS EA+   L  I+V G ++ +V AA+G+INESD+ LA  S ++++ FN + + +    A    + I+ + IIY+  +EIE  +KG+LDP F EK  G + +R+L+  S +G IAG  V  G I+R++  R+ R D  +I   K+ SL+  KD +     G ECG  +ENFND    D +E
  S:   217 VLEYTEGMNVADIAKKIHREPAEIIKKLFMMGVMVNQNQALDKDTIELLAVDYGMEPQEKVQVD---IADIDKFFEPEAVVEENLTTRPPVVTIMGHVDHGKTTLLDTLRHSRVTSGEAGGITQHIGAYQLDIDGKPITFLDTPGHAAFTSMRARGASITDITILVVAADDGVMPQTIEAINHAKAAKVPIIVAVNKIDKPGANPDHVKQELSEHELIPEEWGGDTIFVNISAKFNQNIDELLENILLIAEVEDLKADPTQKAIGTVIEARLDKGKGPVATLLVQQGTLHVGDPIVVGNTYGRVRVMTNDMGRRDKEAGPATPVEITGLNDVPQAGDRFVVFEDEKTARQAGEERAKRALLEQRSASSRVTLDNLFESLKEGE--LKEVNIIVKADVQGSAEAVSASLQKIDVEGVRVKIVHAAVGAINESDVTLAAASNAIIIGFNVRPTPQAKQQAEQEEVDIRLHRIIYKALEEIETAMKGLLDPEFEEKITGQMTVRELYKVSKVGTIAGCYVTEGFIRRDSGVRVIR-DGIVIYEGKLASLKRFKDDVKEVKLGFECGAMIENFNDLRVDDAIE 789
>gi|30263816|ref|NP_846193.1| translation initiation factor IF-2 [Bacillus anthracis str. Ames] >gi|47529240|ref|YP_020589.1| translation initiation factor IF-2 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186663|ref|YP_029915.1| translation initiation factor IF-2 [Bacillus anthracis str. Sterne] >gi|65321140|ref|ZP_00394099.1| COG0532: Translation initiation factor 2 (IF-2; GTPase) [Bacillus anthracis str. A2012] >gi|165872631|ref|ZP_02217262.1| translation initiation factor IF-2 [Bacillus anthracis str. A0488] >gi|167639880|ref|ZP_02398149.1| translation initiation factor IF-2 [Bacillus anthracis str. A0193] >gi|170706824|ref|ZP_02897282.1| translation initiation factor IF-2 [Bacillus anthracis str. A0389] >gi|177652137|ref|ZP_02934683.1| translation initiation factor IF-2 [Bacillus anthracis str. A0174] >gi|190568443|ref|ZP_03021350.1| translation initiation factor IF-2 [Bacillus anthracis Tsiankovskii-I] >gi|39931255|sp|Q81WM3|IF2_BACAN Translation initiation factor IF-2 >gi|30258460|gb|AAP27679.1| translation initiation factor IF-2 [Bacillus anthracis str. Ames] >gi|47504388|gb|AAT33064.1| translation initiation factor IF-2 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180590|gb|AAT55966.1| translation initiation factor IF-2 [Bacillus anthracis str. Sterne] >gi|164711663|gb|EDR17209.1| translation initiation factor IF-2 [Bacillus anthracis str. A0488] >gi|167512281|gb|EDR87658.1| translation initiation factor IF-2 [Bacillus anthracis str. A0193] >gi|170128242|gb|EDS97111.1| translation initiation factor IF-2 [Bacillus anthracis str. A0389] >gi|172082506|gb|EDT67571.1| translation initiation factor IF-2 [Bacillus anthracis str. A0174] >gi|190560447|gb|EDV14425.1| translation initiation factor IF-2 [Bacillus anthracis Tsiankovskii-I] (686 aa)
Score = 1140, Expect = 1.7e-122, Identities = 261/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI ++VVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQTVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVELNDKKITFLDTPGHAAFTTMRARGAQVTDITIIVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLISEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALLAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 679
>gi|30021902|ref|NP_833533.1| translation initiation factor IF-2 [Bacillus cereus ATCC 14579] >gi|168138557|ref|ZP_02581786.1| translation initiation factor IF-2 [Bacillus cereus B4264] >gi|39931252|sp|Q812X7|IF2_BACCR Translation initiation factor IF-2 >gi|29897458|gb|AAP10734.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Bacillus cereus ATCC 14579] (686 aa)
Score = 1140, Expect = 1.8e-122, Identities = 262/589 (44%), Positives = 375/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   + Q + VET  K     F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + I+ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:    89 QENFAGRQQTQIVETPDK---ITFSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIANDYGIEVEEEVIVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALVAQRGEKSKLSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDIRLHRIIYKVIEEIEAAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 679
>gi|90961548|ref|YP_535464.1| translation initiation factor IF-2 [Lactobacillus salivarius UCC118] >gi|123269964|sp|Q1WUF4|IF2_LACS1 Translation initiation factor IF-2 >gi|90820742|gb|ABD99381.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Lactobacillus salivarius UCC118] (737 aa)
Score = 1139, Expect = 2.1e-122, Identities = 256/568 (45%), Positives = 363/568 (63%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
            V+T  + + + +KKI++  AEIIK LF+ G+  N N  LD+  +  L  ++G + +++++++    D F +  + ++  + L+KRPP+VTIMGHVDHGKTTLLD +R + V   EAG ITQ IGAYQV     +ITF DTPGH AF+ MRA GAD+TDI VLVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN   +  QL E  ++ E WGG T+ ++ SA   + +DELL+ I++ AE++EL ANP +   G  IEA +DKG+G+VA LLVQ GTL V D I+VG  +G+V+ MVD    +IK A P+TPV I+GLN +P SGD++I   DEK  +   EKR        +  T    L N    L E    +KE+ VI+K D  GS+EA+      I+V G ++N++  A+G+INESD+ LA  S +++V FN + +      A S  + I+ + +IY+  DEIE  +KG+L+P + EK  G VEIRQ +  S +G I GG V+ G I+R++  R+ R D  +I   K+ SL+  KD +     G ECG  +E +ND   GD +E Y
  S:   156 LVYTVGMNVADIAKKIHREPAEIIKKLFMMGVMVNQNQSLDKDTIELLAADYGINAEEKVEVDVSDIDKFFE--EEQNNTEHLEKRPPVVTIMGHVDHGKTTLLDKLRHTHVTEGEAGGITQHIGAYQVRHDDKIITFLDTPGHAAFTNMRARGADITDITVLVVAADDGVMPQTIEAINHAKAAGVPIIVAVNKIDKPGANPNHVMEQLTEYELIPESWGGDTIFVEISAKFGKNLDELLDMILLEAEMLELHANPNQRGAGSVIEARLDKGKGSVASLLVQQGTLHVGDPIVVGNTFGRVRTMVDARGYDIKKATPATPVEITGLNEVPDSGDRFITFEDEKTARAAGEKRAERALLKERSQTNHVTLDNLFDTLKEGE--LKEVGVIIKADVQGSVEALAQSFKKIDVEGVRVNIIHQAVGAINESDVTLAEASNAIIVGFNVRPTPLAKQQAESDNVDIRLHRVIYKAIDEIETAMKGMLEPEYQEKITGQVEIRQTYKVSKLGTIGGGYVIDGYIRRDSGVRVIR-DGIVIYEGKLASLKRFKDDVKEVKQGYECGLMIEKYNDIKVGDQIEAY 729
>gi|87301305|ref|ZP_01084146.1| translation initiation factor IF-2 [Synechococcus sp. WH 5701] >gi|87284273|gb|EAQ76226.1| translation initiation factor IF-2 [Synechococcus sp. WH 5701] (1122 aa)
Score = 1139, Expect = 2.1e-122, Identities = 236/568 (41%), Positives = 367/568 (64%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           NLT+ E + ++   S+EIIK LF KGI   +   LD   +  +  EFG    + +++      +D I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQV      +   ITF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PIIV INK+DK+ A  E++  +L+   ++ E+WGG T+++  SA   + ID+LLE I++  E+ +L+ANP R+A G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD + K +KTA PS+ V   G + +P +GD++ V  DEK+ + +   R    +  +L+        +  +   + S+G +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V +G+++RN   RI+R +K+++    ++SLR  KD +   A G ECG   + F ++ +GD V  Y++V +
  S:   538 NLTVQELADRLGVESSEIIKSLFFKGIIATVTQTLDLSTIETVSDEFGVPVLQDDVEEAAKKTVDMIEASDFDHLI-RRPPVVTVMGHVDHGKTSLLDAIRKTRVAAGEAGGITQHIGAYQVTIPHSGEDRRITFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIIVAINKIDKEGAQPERVKQELSALELVSEDWGGTTVMVPVSATKGENIDKLLEMILLVTEVEDLQANPDRMAKGTVIEAHLDKAKGPVATLLIQNGTLKAGDVVAAGPVLGKVRAMVDDSGKRVKTAGPSSAVEALGFSEVPTAGDEFEVYPDEKIARSVVGDRANEARATRLAQQMASRRVSLASMSGQASEGELKELNLILKADVQGSVEAILGSLEQLPQGEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGAKRAADANGVDVRDYDVIYKLLEDIQLAMEGLLEPELVEEPLGEAEVRAVFTIGK-SAVAGCYVTSGKLQRNCKVRIQR-NKQVVFEGDLDSLRRNKDDVKEVATGFECGIGCDRFANWQDGDRVMAYKLVTQ 1116
>gi|166364174|ref|YP_001656447.1| translation initiation factor IF-2 [Microcystis aeruginosa NIES-843] >gi|189028333|sp|B0JU67|IF2_MICAN Translation initiation factor IF-2 >gi|166086547|dbj|BAG01255.1| translation initiation factor IF-2 [Microcystis aeruginosa NIES-843] (1010 aa)
Score = 1139, Expect = 2.2e-122, Identities = 251/570 (44%), Positives = 371/570 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL--LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQL---NTK------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           V T +LT+ + S+ +     EII+ LF KG+  N+   LD   +  +  +F  +   E    +   +   +  D  D   L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V+     K   I F DTPGHEAF+ MRA GA +TDI VLVVAADDG++PQT+EAI HA  A+ PI+V INK+DK  AN ++I  +L E+ ++ E+WGG+T+++  SAL  + +D LLE I++ AE+ EL ANP RLA G  IEA++D+ +G VA LLVQ+GTL V D I+ G  +GK++ M+D   ++++ A PS  V I GL+ +P +GD++ V   EK  + ++++R +   NT+       R++S    ++      +KELN+ILK D  GS+EAI G L  +     ++ ++ A+ G I E+D+DLA  S ++VV FNT ++S     A   G+ I++YNIIY++ D+I+  ++G+LDP  VE+ +G  E+R +++    G +AG  V +G++ RN F R+ R+ KEI+    ++SL+  K+     A G ECG  +  FND+ EGDI+E YE+V
  S:   422 VVTGSLTVRDLSELMKVPETEIIRTLFFKGMAVNITQTLDVDTIEMIARDF--EIAVETPSTQSAAIKTTEMIDVSDWESLQRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDVEHNGKPEQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDGVQPQTKEAISHARAAEVPIVVAINKVDKPSANPDRIKQELTEQGLVAEDWGGETIMVPVSALRGENLDNLLEMILLVAEVEELVANPDRLAKGTVIEANLDRTKGPVATLLVQNGTLRVGDSIVAGSVFGKIRAMIDDRGQKVEAATPSFAVEILGLSDVPAAGDEFDVYESEKEARSIADQRAIERRNTRLQQALSSRRVSLSTLSIQAQEGQLKELNLILKADVQGSVEAILGALKQLPQNEVQIRVLLASPGEITETDVDLAAASGAVVVGFNTTLASGARASADREGVDIRDYNIIYKLLDDIQGAMEGLLDPEEVEEHLGFAEVRAVFTVGR-GAVAGCYVQSGKLVRNRFLRV-RRGKEIVYQGVLDSLKRMKEDAREVATGFECGVGVSKFNDWKEGDIIEAYEMV 1002
>gi|25028434|ref|NP_738488.1| translation initiation factor IF-2 [Corynebacterium efficiens YS-314] >gi|39931290|sp|Q8FPA7|IF2_COREF Translation initiation factor IF-2 >gi|23493719|dbj|BAC18688.1| putative translation initiation factor IF-2 [Corynebacterium efficiens YS-314] (964 aa)
Score = 1138, Expect = 2.8e-122, Identities = 253/564 (44%), Positives = 369/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDN---FLDNIKFEDREDLLD-----KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KI   +A +++ LF  G        + +  +  L  E   +FK E+   ED     L++   +  ED+ D     KRPP+VT+MGHVDHGKT LLDTIRK+ V + EAG ITQ IGAYQV    E     ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK DA+ EKI  QL E  ++ EE+GG T+ +  SA     IDELL ++ +TA+  ++L ANP   A G+ IEA +D+G G VA ++VQ GTL V D I+VG+ YG+V++MVD   +++  A PS PV++ GLNG+P +GD  +V  D+++ ++++ +R       L  + RK   L +  + L E S     LN+ILK DN GS+EA++  L  IE+    +LN++   +G++ ++++ LA  S ++++ FN +   K ++ A + G+ I+ Y IIY+  +E+E  LKG+L P++ E+E+G  EIR ++  S+IG+IAG  V  G+++RNA ARI R    I SNAKI SLR  KD +   +AG ECG  L ++ D   GD +E++E+V
  S:   379 SLSDFADKIGADAAALVQALFNLGEMVTATASVSDETLMLLGDEM--NFKVEVVSPEDEDRELLESFDLQFGEDIGDEQDLAKRPPVVTVMGHVDHGKTRLLDTIRKANVGSGEAGGITQGIGAYQVKVEVEDDLRTITFLDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTIEAINHAKAADVPIVVAVNKIDKPDASPEKIRGQLTEYGLVPEEYGGDTIFVDISAKQGTNIDELLASVCLTADAELDLVANPDMDAQGVAIEAHLDRGRGPVATVIVQRGTLRVGDSIVVGDTYGRVRRMVDEYGRDVDEAGPSRPVQVQGLNGVPGAGDNLLVVEDDRIARQIANQRNARKRNALAARSRKRVSLEDLDSVLKETSV----LNLILKGDNAGSVEALEEALLKIEMDDEVELNIIDRGVGAVTQTNVTLAAASNAVIIAFNVRAEGKATEEANAEGVDIRYYTIIYRAIEEVEAALKGMLKPIYEEREVGKAEIRAIFKASAIGLIAGCMVEEGKVRRNATARIIRDGNVIASNAKIESLRREKDDVTEVSAGYECGMVL-SYPDIAVGDKIEVFEMV 958
>gi|52080270|ref|YP_079061.1| translation initiation factor IF-2 [Bacillus licheniformis ATCC 14580] >gi|52785647|ref|YP_091476.1| translation initiation factor IF-2 [Bacillus licheniformis ATCC 14580] >gi|81825301|sp|Q65JI1|IF2_BACLD Translation initiation factor IF-2 >gi|52003481|gb|AAU23423.1| initiation factor IF-2 [Bacillus licheniformis ATCC 14580] >gi|52348149|gb|AAU40783.1| InfB [Bacillus licheniformis DSM 13] (716 aa)
Score = 1138, Expect = 3.0e-122, Identities = 257/566 (45%), Positives = 375/566 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           FTN++++   ++++ K  +EIIK L L GI   +N  LD+  + EL         +E+ ++E+   +  +  D E+ L+ RPP+VTIMGHVDHGKTTLLD+IRK+KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA++TDI +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  AN +++  +L E  ++ E WGG+T+ +  SAL+ +GIDEL+E I++ +E+ ELKANP R A G  IEA +DKG+G+VA LLVQ+GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN +P +GD+++V  DEK  + + E R   QL  ++   +    +    +  QG +KE+N+++K D  GS+EA+   L  IEV G ++ ++   +G+I ESDI LA  S ++V+ FN +        A +  + I+ + IIY++ DEIE  +KG+LDP + EK IG VE+RQ +  S IG IAGG V  G I R++  R+ R D  +I   +++ L+  KD +   + G ECG T++ +ND  EGD++E Y
  S:   139 FTNSMSVGALAEELGKEPSEIIKKLMLLGIMATINQDLDKDTV-ELIASEYGVEVEEVIVHEETEFEKYEEPDNEEDLEIRPPVVTIMGHVDHGKTTLLDSIRKTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTTMRARGAEVTDITILVVAADDGVMPQTVEAINHAKAAEVPIIVAVNKIDKPTANPDRVMQELTEHGLVPEAWGGETIFVPLSALSGEGIDELIEMILLVSEVEELKANPNRRAKGTVIEAELDKGKGSVATLLVQNGTLHVGDPIVVGNTFGRVRAMVNDVGRRVKSAGPSTPVEITGLNEVPNAGDQFLVFKDEKTARSVGEARATKQLEEQRSDKAKLSLDDLFEQIKQGDVKEINLVVKADVQGSVEALAAALQKIEVEGVRVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAEAENVDIRLHRIIYKVIDEIEAAMKGMLDPEYEEKVIGMVEVRQTFKVSKIGTIAGGYVTEGTITRDSGIRLIR-DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDMIEAY 708
>gi|152976179|ref|YP_001375696.1| translation initiation factor IF-2 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189028300|sp|A7GRE3|IF2_BACCN Translation initiation factor IF-2 >gi|152024931|gb|ABS22701.1| translation initiation factor IF-2 [Bacillus cereus subsp. cytotoxis NVH 391-98] (689 aa)
Score = 1138, Expect = 3.2e-122, Identities = 268/589 (45%), Positives = 376/589 (63%)
  Q:    24 RTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED-LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--QLNTKQR------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + N   K Q + VET  K     F+  LT+ E + K+ K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ I+E  F   I  +D E+  L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+GA+A LLVQ+GTL V D I+VG  YG+V+ MV+   + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R  Q    QR       L +    + E    +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A S  + I+ + IIY+  +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V  G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E +
  S:    91 QENFAGKQQAQTVETPDK---ITFSGTLTVGELANKLGKEPSEIIKKLFMLGIMATINQDLDKDTIELIASDYGIEVEEEVVIDEIEFETFIDEQDEEEGDLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIKGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGAIATLLVQNGTLRVGDPIVVGTTYGRVRAMVNDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQQALLAQRGEKSKLSLEDLFQQIQEGD--VKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAESENVDIRLHRIIYKAIEEIEAAMRGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVTDGKITRDSGVRIIR-DGVVIYEGQLDTLKRFKDDVKEVAQNYECGITIEKYNDIKEGDIIEAF 682
>gi|184201250|ref|YP_001855457.1| translation initiation factor IF-2 [Kocuria rhizophila DC2201] >gi|183581480|dbj|BAG29951.1| translation initiation factor IF-2 [Kocuria rhizophila DC2201] (967 aa)
Score = 1137, Expect = 3.9e-122, Identities = 252/560 (45%), Positives = 364/560 (65%)
  Q:    55 EFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY--------DFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQ----VEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +F++KIN + A ++  L   G        LDE     L  E GY        D ++E+  + D  LD     + ED+L  RPP+VT+MGHVDHGKT LLD IR +KV   EAG ITQ IGAYQ    V+ ++ LITF DTPGHEAF+ MRA GA +TDI VLVVAADDG+ PQT EA++HA  A  PI+V +NK+DK DAN +KI  QL E  ++ EE+GG TM +  SA  N  IDELL+AI++TA+  +EL+A P + A G+ IEA++DKG GAV  +LVQSGTL V D I+ G  YG+V+ M D   + ++ A PS PV++ GL+ +P++GD ++ T +E+  ++++EKR+         K+RK   L +F   + E    I  LN+I+K D +G++EA++  L  I+V    +L ++   +G+I ++D++LA    ++++ FN + + +V++ A   G+ +K Y++IY   DE+E  LKG+L P + E E+G+ EIR+++  S  G IAG  V  G I+RN  AR+ R    +  N  I+SLR  KD       G ECG  L +FND  EGDI+E +E+
  S:   381 DFAEKINANPASLVTVLIHLGEMATQTQSLDEETFQLLGAELGYQIQVVSPEDEERELLESFDIDLDAELEAEGEDVLAPRPPVVTVMGHVDHGKTRLLDAIRNTKVIEGEAGGITQHIGAYQISTEVDGQERLITFIDTPGHEAFTAMRARGAQVTDIAVLVVAADDGVMPQTVEALNHAQAANVPIVVAVNKVDKPDANPDKIRGQLTEYGLVPEEYGGDTMFVDVSARENLNIDELLDAIVLTADGALELQATPDKNARGVAIEANLDKGRGAVCTVLVQSGTLKVGDSIVAGAAYGRVRAMFDEMGRTVEAATPSRPVQVLGLSTVPRAGDTFLATQEERTARQIAEKREAADRNAQLAKRRKRITLESFDEAVAEGK--IDTLNLIIKGDVSGAVEALEDSLLKIDVGEEVQLRVIHRGVGAITQNDVNLATVDNAVIIGFNVRPAERVTELADREGVEMKFYSVIYNAIDEVESALKGMLKPEYEEVELGTAEIREVFRSSKWGNIAGAYVTKGLIRRNGKARLVRDGNVVQDNLSIDSLRRFKDDATEVREGYECGIGLGSFNDIHEGDIIETWEM 961
>gi|147677604|ref|YP_001211819.1| translation initiation factor 2 [Pelotomaculum thermopropionicum SI] >gi|189028338|sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 >gi|146273701|dbj|BAF59450.1| translation initiation factor 2 [Pelotomaculum thermopropionicum SI] (973 aa)
Score = 1137, Expect = 4.1e-122, Identities = 245/585 (41%), Positives = 367/585 (62%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG----TNLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + Q +K    ++    V   + T+ E + K++K  AE+IK L   G+   +N  +D      L  EFGY+ + ++ ++ +  L     +D   L D RP +VT+MGHVDHGKT+LLD IR++ V ATEAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  AK PIIV INK+DK  AN +++  QL E  ++ EEWGG T+ +  SAL  +G+ +LLE I++ AE+ ELKANP R A G  IEA +DKG G VA++LVQ+GTL V D ++ G  +G+V+ M+D   + IK A PSTPV + G + +P++GD ++V  DEKL + +  +RQ   ++ +L +       +L ++ Q   IKEL +I+K D  GS+EA++  L  +     ++N++   +G+I E+D+ LA  S ++++ FN +        A +  + ++ Y +IY   ++++  + G+L+P + E  +G  EIR+++  S IG IAG  VL G+I+R+A  R+ R D  ++   K+ SL+  KD +     G ECG  LE FN+  EGDI+E + +
  S:   377 QEQAQKPAQPLEKKPIVLGESTTVQELALKMHKSPAELIKKLMQLGVMATINQEIDTDTATILAGEFGYEVEVKLPVDIEAMLMQEPEDDPVSLQD-RPCVVTVMGHVDHGKTSLLDAIRETNVTATEAGGITQHIGAYQVEHNGKKITFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVMPQTVEAINHAKEAKVPIIVAINKIDKPGANPDRVKQQLTEHGLVAEEWGGDTICVNVSALKKEGLKDLLEMILLVAEMSELKANPNRPARGTVIEAELDKGRGPVANVLVQNGTLNVGDTLIAGAAFGRVRAMMDDKGRRIKKAGPSTPVEVLGFSEVPQAGDIFVVVEDEKLARTIVARRQARKREEELKSTARVSLADLFKHIQEGQIKELGIIIKADVQGSVEALRQALERLSTDEVRVNIIHGGVGAITETDVMLASASNAIIIGFNVRPDVNARKAAENEKVDVRLYRVIYDAIEDVKAAMSGLLEPEYREVTLGRAEIRKIFRSSKIGNIAGCYVLEGKIERDASVRVIR-DGIVVHEGKLESLKRFKDDVREVVQGYECGIALEKFNEIQEGDIIEAFTV 965
>gi|42519359|ref|NP_965289.1| translation initiation factor IF-2 [Lactobacillus johnsonii NCC 533] >gi|81832203|sp|Q74IS8|IF2_LACJO Translation initiation factor IF-2 >gi|41583647|gb|AAS09255.1| translation initiation factor IF-2 [Lactobacillus johnsonii NCC 533] (880 aa)
Score = 1136, Expect = 5.2e-122, Identities = 254/570 (44%), Positives = 375/570 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDL-----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            V+   +   +  K +++  AEI+K LF+ G+  N N  LD+  +  L  E+G   + E +++ED + +D +  ++ E+       +KRPP+VTIMGHVDHGKTTLLD +R + V+  EAG ITQ IGAYQV     LITF DTPGH AFS MRA GA++TDIV+LVVAADDG+ PQT EAIDHA  A  PIIV +NK+DK  AN + +  QL +  ++ E+WGG T+ +K SA   + ++ELL+ I++ A++MELKA+P + A G  IEA +DKG G+VAD+LVQ GTL V D I+VG+ +G+V+ M +   + +K A PSTPV I+GLN +P++ DK +V +DEK  + + E+R  N  +++  N         F T   EN   +KE++++LK D  GS EA++  L  IEV G ++N++ + +G+INESD+ LA  S + +V FN + ++     A S G+ I+ YNIIY++ D++E  +KG+L+P + EK  G++ +R+ W  S IG IAG  V  G + R++  R+ R D  +  + K+ SL+  KD +     G +CG T+ENFND    D +E YE+
  S:   296 LVYEEGMNAQDLGKLLHREPAEIVKKLFMLGVMTNQNQSLDKDTIELLAAEYG--IEAEEKVHEDISDIDTLYTKEMEESKASKHQEKRPPVVTIMGHVDHGKTTLLDRLRHTNVSEHEAGGITQRIGAYQVRIDDRLITFLDTPGHAAFSNMRARGAEITDIVILVVAADDGVMPQTIEAIDHAKSAGVPIIVAVNKIDKPGANPDHVMEQLMKYGLVPEDWGGDTIFVKISAKTGKNVEELLQMILLQADVMELKADPDQKAIGTVIEARLDKGRGSVADILVQQGTLKVGDPIVVGDTFGRVRVMTNDKGRRVKKATPSTPVEITGLNDVPEAADKLVVFDDEKTARSVGEQRAKNALEKQRENVQHVTLDNLFDTMKKEN---MKEVDIVLKADVQGSAEALQQSLEKIEVEGVRVNIIHSGVGAINESDVTLAGASNAFIVGFNVRPTNTAKSQADSEGVDIRLYNIIYKVMDDVEAAMKGMLEPTYEEKVTGNLTVRETWKVSKIGTIAGAFVDNGYVTRDSGIRVIR-DGIVKYDGKVASLKRFKDDVKEVKQGFDCGITIENFNDIKVDDQLEAYEM 874
>gi|71893934|ref|YP_279380.1| translation initiation factor IF-2 [Mycoplasma hyopneumoniae J] >gi|161936256|ref|YP_116109.2| translation initiation factor IF-2 [Mycoplasma hyopneumoniae 232] >gi|93204593|sp|Q5ZZV6|IF2_MYCH2 Translation initiation factor IF-2 >gi|93204595|sp|Q4A9A2|IF2_MYCHJ Translation initiation factor IF-2 >gi|71852061|gb|AAZ44669.1| translation initiation factor IF-2 [Mycoplasma hyopneumoniae J] (599 aa)
Score = 1136, Expect = 5.9e-122, Identities = 250/592 (42%), Positives = 383/592 (64%)
  Q:    16 KNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGD 607
           K++K + N +  +IK+Q K VET + NGVF+F+  +TI E ++KIN    +II Y F +    NLN  L E ++ E+CLEFG DFKKE+QI+  NF++ +   D++  L  RPPI+T+MGHVDHGKTTLLD IRK+ +A  E G ITQ  GAYQV ++ H+I F DTPGHEAF++MRA GA +TDI+VLVVAADDG+ PQT+EAI+HA  A  PIIVF+NKMDK + ++++I ++L+  N++ EEWGG  + + GSAL  QGID L  +I++ AEI+ELKAN  R   G  IEA +   +G +A L+VQ+GTL V D+I+ G  YG+++ + + N + IK A P TPV ++GLN +P++GDK+   ++EK  K+L+ +R+   +  K+S       + ++  K LN+I+K D  G  +A+   +  +      ++++ + +G +N++DI LA+TS S++  FN ++ + +   A    + I+ + IIY+I DEI++ ++G+ +  +  ++IG+ +I   +  S +G IAG  VL+G+   N    + R  K +I + KI SL+  K+ +     G E G  +  FND   GD
  S:     3 KSQKRISNVS--EIKAQLKTVETKVHNGVFLFSGIMTIAELAQKINVSVNQIITYFFHQAKMYNLNHSLSEDEIAEICLEFGLDFKKEVQIDASNFMEEVSILDQDKDLSPRPPIITVMGHVDHGKTTLLDYIRKTNIAKNEKGGITQHTGAYQVVFQGHIINFIDTPGHEAFTQMRARGAKVTDIIVLVVAADDGVMPQTKEAINHAAAANVPIIVFVNKMDKPNKDVDRIKNELSALNIVTEEWGGSNIFVYGSALTGQGIDTLFSSILLLAEILELKANKNRYPIGTVIEAKLHHNKGTIATLMVQNGTLMVRDFIVAGYQYGRIRSLENTNGQPIKFAPPGTPVIVTGLNYVPEAGDKFFGFHEEKFAKQLALERK---QSEKISKTKVQTKQQTKE-KTLNIIIKADVAGIAQALHSTIEKLASKQVHIHILHSGVGIVNKADILLAQTSNSIIYAFNLQIPAAIKAQAKQAQVEIREHTIIYKIVDEIKKQVRGMREIRYELQQIGTAKIIAKFWFSKVGSIAGCSVLSGKFVENCKIELWRNSK-LIHSGKIESLQRDKNPVKEVQVGNEFGTHIYKFNDIEIGD 587
>gi|116073745|ref|ZP_01471007.1| translation initiation factor IF-2 [Synechococcus sp. RS9916] >gi|116069050|gb|EAU74802.1| translation initiation factor IF-2 [Synechococcus sp. RS9916] (906 aa)
Score = 1135, Expect = 6.4e-122, Identities = 240/574 (41%), Positives = 370/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+ +D E L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE     +   ITF DTPGHEAF+ MRA G  +TD+ +LVVAADDG++PQT EAI HA  A+ PIIV INK DK+ A+ +++  +L+E+N+L EEWGG  +++  SA+  + ID+LLE I++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD   K +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +  +L+        +      + S G +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG+++RN   R+ R+ K+++    ++SLR  KD +   A G ECG   + F ++ EGD +E +++V +
  S:   316 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGIIATVTQTLDMPTIEAVADEFGVPVLQDDVEEAAKKTVEMIEEQDLEHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQVEIEVNDQPRKITFLDTPGHEAFTAMRARGTKVTDVAILVVAADDGVRPQTLEAISHARAAEVPIIVAINKCDKEGASPDRVKQELSEQNLLAEEWGGDVVMVPVSAIKGENIDKLLEMILLVTEVEDLQANPDRLARGTVIEAHLDKAKGPVATLLVQNGTLKTGDVLAAGPVLGKVRAMVDDAGKRMKEAGPSFAVEALGFSEVPTAGDEFEVYPDEKSARSVVGDRASDARATRLAQQMASRRVSLTAMSGQASDGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGAKRAADATGVDVRDYDVIYKLLEDIQLAMEGLLEPELVEEALGEAEVRAVFTIGK-SAVAGCYVTTGKLQRNCKVRV-RRGKQVVYEGDLDSLRRNKDDVKEVATGFECGIGCDRFANWEEGDRIEGFKMVTQ 900
>gi|148240415|ref|YP_001225802.1| translation initiation factor IF-2 [Synechococcus sp. WH 7803] >gi|166198941|sp|A5GNJ0|IF2_SYNPW Translation initiation factor IF-2 >gi|147848954|emb|CAK24505.1| Translation initiation factor IF-2 [Synechococcus sp. WH 7803] (1123 aa)
Score = 1135, Expect = 6.6e-122, Identities = 238/574 (41%), Positives = 369/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+ +D E L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE +       +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A+ +++  +L+E+N+L EEWGG  +++  SA+ ++ ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD     +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +          R++S    +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG+++RN   R+ R  KEI+    ++SLR  KD +   A G ECG   + F ++ +GD +E +++V +
  S:   533 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGIIATVTQSLDMPTIETVAEEFGVPVLQDDVEEAAKKTVEMIEEQDLEHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQVEIEHSGEPRRLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASPDRVKQELSEQNLLAEEWGGDVVMVPVSAIKSENIDKLLEMLLLVTEVEDLQANPDRLARGTVIEAHLDKAKGPVATLLVQNGTLRTGDVVAAGPVLGKVRAMVDDASVRLKEAGPSCAVEALGFSEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLTAMSGQANDGDLKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGARKAADANGVDVRDYDVIYKLLEDIQLAMEGLLEPELVEEALGEAEVRAVFTIGK-SAVAGCYVTTGKLQRNCKVRVHR-GKEIVYAGDLDSLRRNKDDVKEVATGFECGVGTDRFANWQDGDRIEAFKMVTQ 1117
>gi|89895263|ref|YP_518750.1| hypothetical protein DSY2517 [Desulfitobacterium hafniense Y51] >gi|122997253|sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 >gi|89334711|dbj|BAE84306.1| hypothetical protein [Desulfitobacterium hafniense Y51] (971 aa)
Score = 1135, Expect = 7.2e-122, Identities = 241/567 (42%), Positives = 348/567 (61%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQM----GELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           V   +LT+ + + K+++ S E+IK L   G+   +N  +D        GE+ +      +K I + E+        ED    L  RPP+VT+MGHVDHGKT+LLD IR +KV A+EAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV INK+DK+++N +++  +L E  ++ EEWGG T+ +  SA     I++LLE +++ AEI ELKANP R A G  IEA +DKG+G VA +LV  GTL V D IL G  +G+++ MVD   + +K A PSTPV + GLN +PK+G  + V +DEK  ++++E R           T +  L +    + E    +KELNVI+K D  GS+EA+K  L  +  +  ++N +   +G+I E+DI LA  S ++++ FN +  +     A   G+ ++ Y +IY   ++++  + G+LDP F E   G  E+RQ++    +G + G  VL G+I R++  R+ R D  +I   ++ SLR  KD       G ECG  + NFND  EGDI+E +
  S:   394 VIPESLTVQDLAAKMSRKSGEVIKKLMDMGVMATINQEIDSETAVIIAGEMGVTVEVKIEKPITVIEE-------IEDDPAELRSRPPVVTVMGHVDHGKTSLLDAIRTTKVTASEAGGITQHIGAYQVEINGQKITFLDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQTVEAINHAKAADVPIIVAINKIDKEESNPDRVKQELTEYGLVVEEWGGDTIAVPVSAKARMNIEQLLEMVLLVAEIKELKANPNRSATGTVIEAELDKGKGPVATVLVSKGTLNVGDIILAGSSFGRIRAMVDDKGRRVKKAGPSTPVEVQGLNEVPKAGQVFNVVDDEKHARQIAEARANERKAEEVRQTTKVSLEDLFDRIKEGE--VKELNVIIKADVQGSIEALKQSLLRLSTSEVRVNPIHGGVGAITETDIMLAAASNAIIIGFNVRPDANTKATAELQGVDMRLYRVIYDAIEDVKAAMTGMLDPDFKEVVQGRAEVRQVFKVPKVGTVGGSYVLNGKITRHSKIRVIR-DGIVIHEGELESLRRFKDDAKEVVEGYECGIGVANFNDIKEGDIIEAF 962
>gi|194476588|ref|YP_002048767.1| translation initiation factor IF-2 [Paulinella chromatophora] >gi|171191595|gb|ACB42557.1| translation initiation factor IF-2 [Paulinella chromatophora] (1274 aa)
Score = 1135, Expect = 7.3e-122, Identities = 243/568 (42%), Positives = 373/568 (65%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           NLT+ E + K+   S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQ+E     ++  ITF DTPGHEAF+ MRA GA +TD+ VLVVAADDG++PQT EAI HA  A+ PIIV INK+DK+ A I+++  +L+++N+L EEWGG T+++  SA+  + ID+LLE I++  E+ +L+ANP R+A G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ M+D   K +K A PS  V   G + +P +GD++ V  DEK  + +  +R    +  +L+        +  T   + S+G +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S ++++ FNT ++S     A + G+ ++ Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R ++S      +AG  VL+G+I+RN   R+ R+ K++I    +NSLR  KD I   A G ECG   + F ++ +GD +E+Y++V +
  S:   690 NLTVQELADKLGTESSEIIKSLFFKGIIATVTQTLDLSTIETVSEEFGVPVLEDDVEEAAKKTVEMIEESDFKHLI-RRPPVVTVMGHVDHGKTSLLDAIRKTRVAAGEAGGITQHIGAYQIEVTHSDQQRKITFLDTPGHEAFTAMRARGAKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIIVAINKIDKEGAQIDRVKQELSDQNLLAEEWGGNTVMVPVSAIRGENIDKLLEMILLVTEVEDLQANPDRMAKGTVIEAHLDKAKGPVATLLIQNGTLRAGDVVAAGPILGKVRAMMDHAGKRVKEAGPSCAVEALGFSEVPTAGDEFEVYLDEKAARAVVGERANEARATRLAQQMASRRVSLATMSGQASEGELKELNLILKADVQGSVEAILGALEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIIGFNTSMASGAKRAADTNGVDVREYDVIYKLLEDIQMAMEGLLEPESVEETLGEAEVRAVFSIGK-SAVAGCYVLSGKIQRNTKIRV-RRGKQLIFEGDLNSLRRNKDDIKEVATGFECGIGCDRFANWEDGDRIEVYKMVTQ 1268
>gi|196237423|ref|ZP_03136200.1| translation initiation factor IF-2 [Cyanothece sp. PCC 7425] >gi|196218219|gb|EDY12861.1| translation initiation factor IF-2 [Cyanothece sp. PCC 7425] (1005 aa)
Score = 1135, Expect = 7.7e-122, Identities = 246/586 (41%), Positives = 371/586 (63%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEK----LLKELSEKRQLNTKQRKLSNFGTNLNENSQG-----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + ++ ET  +    V + +LT+ E + ++   ++EIIK LF KGI   +N +LD      +  E G + +  E++       + ++ +D E+L  +RPP+VTIMGHVDHGKTTLLD IR++KVA  EAG ITQ IGAY V    E +   + F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK  A  +++  +L E N++ EEWGG T+++  SA+N + +D LLE I++ +E+ +L ANP R A G  IEA +DK  G VA LLVQ+GTL V D +L G   GKV+ M+D   + ++ A PS  V + GL  +P +GD++ V NDE+    +  E + +++L+  Q+ LS+   +L   S       +KELN+ILK D  GS+EAI   L  I     +L ++ AA G + E+D+DLA  S ++V+ FNT ++S     A   G+ I+ YNIIY++ D+IE  ++G+L+P  VE+ +G  ++R ++     G +AG  V +G++ RN   R+ R    ++ +  +NSL+  K+      AG ECG  L++F  + EGD +E Y++V
  S:   399 RDRRQQEETQERPTSVVLSGDLTVQELANRLALPTSEIIKTLFFKGIAATINQMLDLETASMVAREMGMEVETPEVESTARKVTEMLEAQDLENL-QRRPPVVTIMGHVDHGKTTLLDAIRQTKVAQGEAGGITQHIGAYHVDVEHEDQVQQVVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVRPQTVEAISHAQAAEVPIVVAINKIDKPTAQPDRVKQELTEYNLVPEEWGGDTIMVPVSAINRENLDTLLEMILLVSEVEDLYANPDRSARGTVIEAHLDKARGPVATLLVQNGTLRVGDILLAGSALGKVRAMIDDRGQRVEAATPSFAVEVLGLGDVPAAGDEFEVFNDEREARAIANERANQQRLSRLQQALSSRRVSLTSLSDQAREGELKELNLILKADVQGSVEAILNALGQIPQNEVQLRVLYAAPGEVTETDVDLAAASNAVVIGFNTTLASGSRASADQTGVDIREYNIIYKLLDDIEGAMEGLLEPELVEEPLGQAQVRAVFPVGK-GFVAGCYVQSGKLIRNCKIRVLRSGN-LVHSGTLNSLKRIKEDAREVNAGYECGIRLDDFQGWAEGDQIEAYQMV 995
>gi|88807311|ref|ZP_01122823.1| translation initiation factor IF-2 [Synechococcus sp. WH 7805] >gi|88788525|gb|EAR19680.1| translation initiation factor IF-2 [Synechococcus sp. WH 7805] (1139 aa)
Score = 1134, Expect = 9.0e-122, Identities = 236/574 (41%), Positives = 370/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+ +DR+ L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE +       +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A+ +++  +L+E+N+L EEWGG  +++  SA+ ++ +D+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD     +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +          R++S    +   N   +KELN+ILK D   S+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG+++RN   R+ R  KEI+ +  ++SLR  KD +   A G ECG   + F ++ +GD +E +++V +
  S:   549 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGIIATVTQSLDMPTIEAVAEEFGVPVLQDDVEEAAKKTVEMIEEKDRDHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQVEIEHGGEPRKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASPDRVKQELSEQNLLAEEWGGDVVMVPVSAIKSENVDKLLEMLLLVTEVEDLQANPNRLARGTVIEAHLDKAKGPVATLLVQNGTLRTGDVVAAGPVLGKVRAMVDDASVRLKEAGPSCAVEALGFSEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLTAMSGQANEGDLKELNLILKADVQSSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGARKAADATGVDVRDYDVIYKLLEDIQLAMEGLLEPELVEEALGEAEVRAVFTIGK-SAVAGCYVTTGKLQRNCKVRVHR-GKEIVYSGALDSLRRNKDDVKEVATGFECGVGTDRFANWKDGDRIEAFKMVTQ 1133
>gi|87125352|ref|ZP_01081198.1| translation initiation factor [Synechococcus sp. RS9917] >gi|86167121|gb|EAQ68382.1| translation initiation factor [Synechococcus sp. RS9917] (1103 aa)
Score = 1133, Expect = 1.1e-121, Identities = 237/569 (41%), Positives = 366/569 (64%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+ ED   L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE +       ITF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A+ +++  +L+++N+L EEWGG  +++  SA+  + ID+LLE I++  E+ +L+ANP RLA G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD     +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +  +L+        +      + S+G +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V  G+++RN   R+ R  KEI+    ++SLR  KD +   A G ECG   + F ++ EGD +E +++V +
  S:   518 DNLTVQELADMLSVESSEIIKSLFFKGIIATVTQTLDMPTIETVAEEFGVPVLQDDVEEAAKKTVEMIEEEDLAHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQVEIEHSGEPRRITFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASPDRVKQELSDQNLLAEEWGGDVVMVPVSAIKGENIDKLLEMILLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLIQNGTLRTGDVVAAGPVLGKVRAMVDDAGARLKAAGPSCAVEALGFSEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLAAMSGQASEGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGAKRAADATGVDVRDYDVIYKLLEDIQMAMEGLLEPEMVEESLGEAEVRAVFTIGK-SAVAGCYVTNGKLQRNCKVRVHR-GKEIVFAGDLDSLRRNKDDVKEVATGFECGVGCDRFANWQEGDRIEGFKMVTQ 1097
>gi|38234058|ref|NP_939825.1| translation initiation factor IF-2 [Corynebacterium diphtheriae NCTC 13129] >gi|81829889|sp|Q6NGN2|IF2_CORDI Translation initiation factor IF-2 >gi|38200320|emb|CAE50005.1| translation initiation factor IF-2 [Corynebacterium diphtheriae] (953 aa)
Score = 1133, Expect = 1.1e-121, Identities = 251/564 (44%), Positives = 370/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL---DNIKF---EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KIN  +A +++ LF  G        ++E  +  L  E  Y  +     +ED  L    +++F   E  E+ L KRPP+VT+MGHVDHGKT LLDTIRK+ V + EAG ITQ IGAYQV          ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK  A+ +KI  QL E  ++ EE+GG TM +  SA  N  ID LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA ++VQ GTL V D ++ G+ YG+V++MVD    +++ A PS PV++ GLNG+P +GD  +V  D+++ ++++ +R       L  K RK   L +  + L E S     LN+ILK DN GS+EA++  L  IEV    +LN++   +G++ ++++ LA  S ++++ FN +   K ++ A + G+ I+ Y +IY+  +E+E+ LKG+L P++ E+EIG  EIR ++  S++G+IAG  V +G+++RNA  R+ R    +  NAKI SLR  KD     AAG ECG  L ++ D   GDI+E++E V
  S:   369 SLSDFAEKINADAAALVQALFNLGEMVTATASVNEETLQLLGEEMNYKVEVVSPEDEDRELLESFDLQFGEDEGTEEDLAKRPPVVTVMGHVDHGKTRLLDTIRKTNVGSDEAGGITQGIGAYQVTVNIDDLSRKITFLDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTVEAINHAKAADVPIVVAVNKIDKPGASPDKIRGQLTEYGLVPEEYGGDTMFVDISAKQNINIDGLLEAVLLTADASLDLRANPDMDAQGVAIEAHLDRGRGPVATVIVQRGTLRVGDSVVAGDAYGRVRRMVDEYGNDVEEAGPSRPVQMQGLNGVPGAGDNLLVVEDDRVARQIANQRNARKRNALAAKTRKRVSLEDLDSVLKETST----LNLILKGDNAGSVEALEDALLKIEVDDEVQLNIIDRGVGAVTQTNVSLAAASDAVIIAFNVRAEGKATEEANAEGVDIRYYTVIYRALEEVEQALKGMLKPIYEEREIGRAEIRAIFKASAVGLIAGCMVESGKVRRNASIRLLRDGTVVADNAKIESLRREKDDATEVAAGYECGMVL-SYPDIQVGDIIEVFEQV 948
>gi|72080912|ref|YP_287970.1| translation initiation factor IF-2 [Mycoplasma hyopneumoniae 7448] >gi|93204594|sp|Q4A7E2|IF2_MYCH7 Translation initiation factor IF-2 >gi|71914036|gb|AAZ53947.1| translation initiation factor IF-2 [Mycoplasma hyopneumoniae 7448] (599 aa)
Score = 1133, Expect = 1.2e-121, Identities = 252/592 (42%), Positives = 383/592 (64%)
  Q:    16 KNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS-EKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGD 607
           K++K + N +  +IK+Q K VET + NGVF+F+  +TI E ++KIN    +II Y F +    NLN  L E ++ E+CLEFG DFKKE+QI+  NF++ +   D++  L  RPPI+T+MGHVDHGKTTLLD IRK+ +A  E G ITQ  GAYQV ++ H+I F DTPGHEAF++MRA GA +TDI+VLVVAADDG+ PQT+EAI+HA  A  PIIVF+NKMDK + ++++I ++L+  N++ EEWGG  + + GSAL  QGID L  +I++ AEI+ELKAN  R   G  IEA +   +G +A L+VQ+GTL V D+I+ G  YG+++ + + N + IK A P TPV ++GLN +P++GDK+   ++EK  K+L+ EK+Q      K+S       + ++  K LN+I+K D  G  +A+   +  +      ++++ + +G +N++DI LA+TS S++  FN ++ + +   A    + I+ + IIY+I DEI++ ++G+ +  +  ++IG+ +I   +  S +G IAG  VL+G+   N    + R  K +I + KI SL+  K+ +     G E G  +  FND   GD
  S:     3 KSQKRISNVS--EIKAQLKTVETKVHNGVFLFSGIMTIAELAQKINVSVNQIITYFFHQAKMYNLNHSLSEDEIAEICLEFGLDFKKEVQIDASNFMEEVSILDQDKDLSPRPPIITVMGHVDHGKTTLLDYIRKTNIAKNEKGGITQHTGAYQVVFQGHIINFIDTPGHEAFTQMRARGAKVTDIIVLVVAADDGVMPQTKEAINHAAAANVPIIVFVNKMDKPNKDVDRIKNELSALNIVTEEWGGSNIFVYGSALTGQGIDTLFSSILLLAEILELKANKNRYPIGTVIEAKLHHNKGTIATLMVQNGTLMVRDFIVAGYQYGRIRSLENTNGQPIKFAPPGTPVIVTGLNYVPEAGDKFFGFHEEKFAKQLALEKKQ----SEKISKTKVQTKQQTKE-KTLNIIVKADVAGIAQALHSTIEKLASKQVHIHILHSGVGIVNKADILLAQTSNSIIYAFNLQIPAAIKAQAKQAQVEIREHTIIYKIVDEIKKQVRGMREIRYELQQIGTAKIIAKFWFSKVGSIAGCSVLSGKFVENCKIELWRNSK-LIHSGKIESLQRDKNPVKEVQVGNEFGTHIYKFNDIEIGD 587
>gi|191638558|ref|YP_001987724.1| Translation initiation factor IF-2 [Lactobacillus casei] >gi|190712860|emb|CAQ66866.1| Translation initiation factor IF-2 [Lactobacillus casei BL23] (943 aa)
Score = 1133, Expect = 1.2e-121, Identities = 248/570 (43%), Positives = 366/570 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR-EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            ++   +   +  K +++  AE+IK LF+ G+  N N  LD+  +  L  ++G D ++++  +  +     + E++ +D L  RPP+VTIMGHVDHGKTTLLD +R + V   EAG ITQ IGAYQV+ +  LITF DTPGH AF+ MRA GAD+TDIVVLVVAADDG+ PQT EAI HA  AKAPIIV +NK+DK  AN + +  QL E  ++ E+WGG T+ +K SA   + IDELLE I++ A+++ELKANP + A G  IEA +DKG+G VA +LVQ GTL   D I+VG  +G+V+ M + + + +K ALPS PV I+G+N +P+S DK++V  DE+  +   E+R        + NT    L N    + E    +KE++VI+K D  GS+EA+ G L  IEV G ++N++  A+G+INESD+ LA  S ++++ FN + ++     A    + I+ +++IY+  +E+E  +KG+L+P + EK IG+V +R+    S +G + GG V +G I R+A  R+ R D  +    K+ SLR  KD +     G E G T+EN+ND    D +E + +
  S:   362 LIYEVGMNAQDLGKILHREPAELIKKLFMLGVMVNQNQSLDKDTIELLATDYGIDAQEKVHEDISDLDKVFEEENKNQDNLQPRPPVVTIMGHVDHGKTTLLDKLRHTHVTEGEAGGITQHIGAYQVKLRDRLITFLDTPGHAAFTNMRARGADITDIVVLVVAADDGVMPQTIEAIHHAQAAKAPIIVAVNKIDKPGANPDHVMEQLTEYGLIPEDWGGDTIFVKISAKFGKNIDELLEMILLEADVLELKANPDQKAVGTVIEARLDKGKGPVATVLVQQGTLHTGDPIVVGNTFGRVRAMTNDHGRRVKDALPSMPVEITGINDVPQSADKFVVFADERTARAAGEERAKRAQEEERKNTNHVTLDNLFETMKEGQ--LKEVDVIIKADVQGSVEALAGSLEKIEVKGVRVNIIHQAVGAINESDVTLAAASNAIIIGFNVRPTALAKAQAEQDDVDIRLHSVIYKAIEEVEAAMKGMLEPTYEEKVIGTVTVRETIPVSKVGTVVGGYVDSGYITRDAGVRLVR-DGIVKYEGKLGSLRRFKDDVKEVRQGFELGLTIENYNDIKVDDQIEAFTM 937
>gi|116495055|ref|YP_806789.1| translation initiation factor 2 GTPase [Lactobacillus casei ATCC 334] >gi|122263528|sp|Q038M5|IF2_LACC3 Translation initiation factor IF-2 >gi|116105205|gb|ABJ70347.1| bacterial translation initiation factor 2 (bIF-2) [Lactobacillus casei ATCC 334] (943 aa)
Score = 1133, Expect = 1.2e-121, Identities = 248/570 (43%), Positives = 366/570 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR-EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            ++   +   +  K +++  AE+IK LF+ G+  N N  LD+  +  L  ++G D ++++  +  +     + E++ +D L  RPP+VTIMGHVDHGKTTLLD +R + V   EAG ITQ IGAYQV+ +  LITF DTPGH AF+ MRA GAD+TDIVVLVVAADDG+ PQT EAI HA  AKAPIIV +NK+DK  AN + +  QL E  ++ E+WGG T+ +K SA   + IDELLE I++ A+++ELKANP + A G  IEA +DKG+G VA +LVQ GTL   D I+VG  +G+V+ M + + + +K ALPS PV I+G+N +P+S DK++V  DE+  +   E+R        + NT    L N    + E    +KE++VI+K D  GS+EA+ G L  IEV G ++N++  A+G+INESD+ LA  S ++++ FN + ++     A    + I+ +++IY+  +E+E  +KG+L+P + EK IG+V +R+    S +G + GG V +G I R+A  R+ R D  +    K+ SLR  KD +     G E G T+EN+ND    D +E + +
  S:   362 LIYEVGMNAQDLGKILHREPAELIKKLFMLGVMVNQNQSLDKDTIELLATDYGIDAQEKVHEDISDLDKVFEEENKNQDNLQPRPPVVTIMGHVDHGKTTLLDKLRHTHVTEGEAGGITQHIGAYQVKLRDRLITFLDTPGHAAFTNMRARGADITDIVVLVVAADDGVMPQTIEAIHHAQAAKAPIIVAVNKIDKPGANPDHVMEQLTEYGLIPEDWGGDTIFVKISAKFGKNIDELLEMILLEADVLELKANPDQKAVGTVIEARLDKGKGPVATVLVQQGTLHTGDPIVVGNTFGRVRAMTNDHGRRVKDALPSMPVEITGINDVPQSADKFVVFADERTARAAGEERAKRAQEEERKNTNHVTLDNLFETMKEGQ--LKEVDVIIKADVQGSVEALAGSLEKIEVKGVRVNIIHQAVGAINESDVTLAAASNAIIIGFNVRPTALAKAQAEQDDVDIRLHSVIYKAIEEVEAAMKGMLEPTYEEKVIGTVTVRETIPVSKVGTVVGGYVDSGYITRDAGVRLVR-DGIVKYEGKLGSLRRFKDDVKEVRQGFELGLTIENYNDIKVDDQIEAFTM 937
>gi|170017451|ref|YP_001728370.1| translation initiation factor IF-2 [Leuconostoc citreum KM20] >gi|189028330|sp|B1MZH4|IF2_LEUCK Translation initiation factor IF-2 >gi|169804308|gb|ACA82926.1| Translation initiation factor IF-2 [Leuconostoc citreum KM20] (840 aa)
Score = 1132, Expect = 1.6e-121, Identities = 256/570 (44%), Positives = 371/570 (65%)
  Q:    43 GVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIK--FEDR---EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENS-------QGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
            V  +   + + + SK +++ +AEIIK LFL GI  N N  LD   +  L  ++G     E Q+ E+  + +I   FED    E  L  RPP+VTIMGHVDHGKTTLLD +R S V   EAG ITQ IGAYQ +     ITF DTPGH AF++MRA GA++TD+ +LVVAADDG+ PQT EAI+HA  A+ PIIV +NK+DK  AN +++ +QL   +++ EE+GG T+ +K SA   Q +DELLE I++ AE++ELKANP   A G  IEA +DKG G VA +LVQ GT+ V D I+VG  YG+V+ M +    E+  ALP+TPV+I+G+N +P++GD++IV  DEK  +   E+R     Q  + N G+ +  ++       + +K + VI+K D  GS+EA+ G L  IEV G +++++  A+G+INESD+ LA  S ++++ FN + +      A S  + I+ YN+IY   D++E  +KG L+PVF EK IG+V +++L+  S +G+IAG  V  G+I +++  RI R D  ++ + ++ SL+ GKDS+     G E GFT+  +ND   GD VE Y
  S:   257 AVLEYRIGMNVQDLSKLLHRDTAEIIKKLFLLGIVTNQNQSLDADTIEILAADYGI----ESQLKEEEDVADIDKFFEDDTIDESKLVARPPVVTIMGHVDHGKTTLLDYLRNSNVTEGEAGGITQHIGAYQTQLNGKTITFLDTPGHAAFTEMRARGANVTDLTILVVAADDGVMPQTIEAINHAKAAETPIIVAVNKIDKPGANPDEVMNQLMAYDLVPEEYGGDTIFVKISAKFGQNVDELLEMILLQAEVLELKANPDVPARGSVIEARLDKGRGPVATVLVQQGTMRVGDPIVVGNTYGRVRTMTNERGIELAEALPATPVQITGINEVPQAGDRFIVMADEKTARAAGEERA-KRAQEAIRNSGSVVTLDTLFSTMSEKAMKTVPVIVKADVQGSVEALSGSLKKIEVDGVRVDIIHTAVGAINESDVTLASASGAIIIGFNVRSTPLAKSQADSDKVDIRFYNVIYNAIDDVEAAMKGQLEPVFEEKVIGNVTVKELFKFSKVGIIAGAMVEEGKITKDSKVRIMR-DNVVVYDGEVASLQRGKDSVNEVKMGYEFGFTVAKYNDIRVGDTVEAY 832
>gi|16803365|ref|NP_464850.1| translation initiation factor IF-2 [Listeria monocytogenes EGD-e] >gi|23821731|sp|Q8Y7F6|IF2_LISMO Translation initiation factor IF-2 >gi|16410741|emb|CAC99403.1| infB [Listeria monocytogenes] (779 aa)
Score = 1132, Expect = 1.7e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   196 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 771
>gi|116872756|ref|YP_849537.1| translation initiation factor IF-2 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458444|sp|A0AIC6|IF2_LISW6 Translation initiation factor IF-2 >gi|116741634|emb|CAK20758.1| infB [Listeria welshimeri serovar 6b str. SLCC5334] (780 aa)
Score = 1132, Expect = 1.7e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   197 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNETVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPNRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 772
>gi|150016086|ref|YP_001308340.1| translation initiation factor IF-2 [Clostridium beijerinckii NCIMB 8052] >gi|189028309|sp|A6LSQ4|IF2_CLOB8 Translation initiation factor IF-2 >gi|149902551|gb|ABR33384.1| translation initiation factor IF-2 [Clostridium beijerinckii NCIMB 8052] (695 aa)
Score = 1131, Expect = 1.9e-121, Identities = 255/563 (45%), Positives = 374/563 (66%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFE-DREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRK-LSNFGTNL----NENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T+ E ++K+ + S ++I+ L   G+   +N  +D     ++C E+G   +++ +I E   L+ +K E D E+ L KRPPIVT+MGHVDHGKT+LLD IRK+KV  TEAG ITQ IGAY ++     ITF DTPGHEAF+ MRA GA +TD+V+LVVAADDG+ PQT+EAI+H   A  PI+V INK+DK  AN++++  +LAE+ +L E+WGG T+  + SA  N  ID+LLE +++TAE++ELKAN  R A G  IEA +DKG GAVA LLVQ+GTL V D ILVG  YG+++ M D   K+IK+A PS PV + GL+ +P++GD++    DEK  + ++E R+   K    L+N   +L    N+  +G +KEL +I+K D  GS+EAIK  L  +     K+ ++   +G+I E+DI LA  S ++V+ FN +  +  +  A   G+ IK+Y IIY   D+++  + G+L+P + E  +G+ E+R+ +  S++G IAG  VL G+++RNA  R+ R D  +I  + ++SL+  KD      AG ECG T+E FND  EGDIVE +
  S:   120 SITVKELAEKLQQPSNDVIRTLIFAGVMAAINAEIDFETAEKVCAEYGVLVERKEEIQE---LEVLKIEEDDEENLQKRPPIVTVMGHVDHGKTSLLDCIRKAKVTDTEAGGITQHIGAYTIKLNGEEITFLDTPGHEAFTAMRARGAQITDVVILVVAADDGIMPQTKEAINHCKAAGVPIVVAINKIDKPGANVDRVKQELAEQGLLAEDWGGDTICEEVSAKQNLNIDKLLEMVLLTAEMLELKANKDRRAVGTVIEAKLDKGRGAVASLLVQNGTLRVGDSILVGSTYGRIRAMFDDTGKKIKSAGPSIPVEVLGLSEVPEAGDRFNQVKDEKTARNMAESRKDKLKAETLLANHRVSLEDLYNQIKEGKVKELAIIVKADVQGSVEAIKQSLEKLSTDDVKVRVIHGGVGAITETDITLATASNAIVIGFNVRPDNNAAAQADRDGVDIKSYRIIYDAIDDVKSAMIGMLEPDYKEVILGTAEVRETYKISNVGTIAGCYVLKGKLQRNAETRVIR-DGIVIFESALSSLKRFKDDAKEVNAGYECGLTIEKFNDIKEGDIVECF 685
>gi|56419798|ref|YP_147116.1| translation initiation factor IF-2 [Geobacillus kaustophilus HTA426] >gi|81819751|sp|Q5L0I8|IF2_GEOKA Translation initiation factor IF-2 >gi|56379640|dbj|BAD75548.1| translation initiation factor IF-2 [Geobacillus kaustophilus HTA426] (709 aa)
Score = 1131, Expect = 1.9e-121, Identities = 249/535 (46%), Positives = 357/535 (66%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGK 581
           F  +LT+ E +KK+ +  +EIIK LF+ G+   +N  LD+  +  +C ++G + ++++ I+E NF + I+  D  + L +RPP+VTIMGHVDHGKTTLLD IR SKV   EAG ITQ IGAYQV      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+HA  A  PIIV INK+DK +AN +++  +L E N++ EEWGG T+  K SA   +G+D LLE I++ +E+ ELKANP R A G  IEA +DKG G VA LL+Q+GTL V D I+VG  YG+V+ MV+ + + +K A PS PV I+GL+ +P++GD+++V  DEK  ++++E R     Q + S     +      +  QG +KELN+I+K D  GS+EA+   L  I+V G ++ ++ AA+G+I ESDI LA  S ++V+ FN +  +     A S  + I+ + IIY + +EIE  +KG+LDP + EK IG  E+RQ +  S +G IAG  V  G+I R++  R+ R+   ++   +I+SL+  K
  S:   162 FEGSLTVAELAKKLGREPSEIIKKLFMLGVMATINQDLDKDAIELICSDYGVEVEEKVTIDETNF-EAIEIVDAPEDLVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAYQVTVNDKKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDGVMPQTVEAINHAKAANVPIIVAINKIDKPEANPDRVMQELMEYNLVPEEWGGDTIFCKLSAKTKEGLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLIQAGTLRVGDPIVVGTTYGRVRAMVNDSGRRVKEATPSMPVEITGLHEVPQAGDRFMVFEDEKKARQIAEARAQRQLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAMKGMLDPEYEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGI-VVYEGEIDSLKRYK 700
>gi|153179395|ref|ZP_01932614.1| translation initiation factor IF-2 [Listeria monocytogenes F6900] >gi|153183687|ref|ZP_01934504.1| translation initiation factor IF-2 [Listeria monocytogenes J0161] >gi|153190726|ref|ZP_01938089.1| translation initiation factor IF-2 [Listeria monocytogenes J2818] >gi|126943339|gb|EBA21060.1| translation initiation factor IF-2 [Listeria monocytogenes J0161] >gi|127765710|gb|EBA26055.1| translation initiation factor IF-2 [Listeria monocytogenes J2818] >gi|133732880|gb|EBA34578.1| translation initiation factor IF-2 [Listeria monocytogenes F6900] (777 aa)
Score = 1131, Expect = 2.0e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   194 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 769
>gi|172036754|ref|YP_001803255.1| translation initiation factor IF-2 [Cyanothece sp. ATCC 51142] >gi|171698208|gb|ACB51189.1| translation initiation factor IF-2 [Cyanothece sp. ATCC 51142] (1000 aa)
Score = 1131, Expect = 2.1e-121, Identities = 257/604 (42%), Positives = 384/604 (63%)
  Q:    12 KSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL--LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           K K    K  D+  +     + ++ E   K    V   NLT+ E S+ +     EIIK+LF KGI  N+   LD+    ++  E  +D + EI   +     N +  D +DL  L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V    E +   I F DTPGHEAF+ MRA GA +TD+ +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK +AN ++I  +L+E +++ EEWGG+T+++  SAL  + +DELLE +++ +E+ EL ANP RLA G  IEA++D+  G VA LLVQ+GTL V D I+ G  +GK++ M+D    +++ A PS  V I GLN +P +GD++ V   EK  + ++E    N +Q +L    ++       L+  +Q   +KELN+ILK D  GS+EAI G L  +     ++ ++ A+ G + E+D+DLA  S ++++ FNT ++S     A   G+ I+ Y+IIY++ D+IE  ++G+L+P  VE  +G  E+R +++    G +AG  V +G++ RN   R+ R DK ++    ++SL+  K+ +    +G ECG  ++ FND+ EGDI+E YE+V
  S:   375 KPKKPTLKTADSSPDRSRTERRERPEARQKPEKVVLDRNLTVRELSEHLQIAETEIIKHLFSKGIAVNITETLDQ-DTAKMVTE-AFDIEVEIPEAKSAATKNTEMLDEQDLENLQRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDITHEGETQQIVFLDTPGHEAFTAMRARGARVTDMAILVVAADDGVQPQTREAISHAQAAEVPIVVAINKIDKPEANPDRIKQELSELSLVPEEWGGETIMVPVSALKGENLDELLEMLVLVSEVEELVANPDRLAKGTVIEANLDRTRGPVATLLVQNGTLRVGDAIVAGSVFGKIRAMIDDRGNKVEEASPSFAVEILGLNSVPAAGDEFEVYPSEKEARTIAENNAENQRQTRLQQAMSSRRVTLSTLSAQAQEGELKELNLILKADVQGSVEAILGALEQLPQNEVQIRVLLASPGEVTETDVDLAAASGAVIIGFNTTLASGARAAADHEGVDIREYDIIYKLLDDIEGAMEGLLEPEEVESPLGQAEVRAVFTVGR-GAVAGCYVQSGKVVRNRQIRVHRGDK-VVYQGALDSLKRVKEDVREVNSGYECGIGVDKFNDWEEGDIIEAYELV 989
>gi|153174405|ref|ZP_01929933.1| translation initiation factor IF-2 [Listeria monocytogenes FSL N3-165] >gi|153196103|ref|ZP_01940511.1| translation initiation factor IF-2 [Listeria monocytogenes 10403S] >gi|127634385|gb|EBA23771.1| translation initiation factor IF-2 [Listeria monocytogenes 10403S] >gi|133730353|gb|EBA32051.1| translation initiation factor IF-2 [Listeria monocytogenes FSL N3-165] (781 aa)
Score = 1130, Expect = 2.4e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   198 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 773
>gi|16800430|ref|NP_470698.1| translation initiation factor IF-2 [Listeria innocua Clip11262] >gi|23821732|sp|Q92C29|IF2_LISIN Translation initiation factor IF-2 >gi|16413835|emb|CAC96593.1| infB [Listeria innocua] (782 aa)
Score = 1130, Expect = 2.5e-121, Identities = 254/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++++ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   199 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIIIGFNVRPTTQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 774
>gi|46907551|ref|YP_013940.1| translation initiation factor IF-2 [Listeria monocytogenes str. 4b F2365] >gi|153202166|ref|ZP_01943795.1| translation initiation factor IF-2 [Listeria monocytogenes HPB2262] >gi|167453952|ref|ZP_02320175.1| translation initiation factor IF-2 [Listeria monocytogenes FSL J2-064] >gi|67460687|sp|Q71ZZ7|IF2_LISMF Translation initiation factor IF-2 >gi|46880819|gb|AAT04117.1| translation initiation factor IF-2 [Listeria monocytogenes str. 4b F2365] >gi|133735449|gb|EBA37147.1| translation initiation factor IF-2 [Listeria monocytogenes HPB2262] (782 aa)
Score = 1130, Expect = 2.6e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   199 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 774
>gi|47095910|ref|ZP_00233513.1| translation initiation factor IF-2 [Listeria monocytogenes str. 1/2a F6854] >gi|47015656|gb|EAL06586.1| translation initiation factor IF-2 [Listeria monocytogenes str. 1/2a F6854] (774 aa)
Score = 1130, Expect = 2.6e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   191 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 766
>gi|78213597|ref|YP_382376.1| translation initiation factor IF-2 [Synechococcus sp. CC9605] >gi|123729668|sp|Q3AHW1|IF2_SYNSC Translation initiation factor IF-2 >gi|78198056|gb|ABB35821.1| translation initiation factor IF-2 [Synechococcus sp. CC9605] (1104 aa)
Score = 1130, Expect = 2.9e-121, Identities = 236/574 (41%), Positives = 370/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+  D+  L+ +RPP+VT+MGHVDHGKT+LLD IR+++VAA EAG ITQ IGAYQVE +    +  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ ++ E++  +L+E+N+L E+WGG  +++  SA+  + ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD NR+ +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +          R++S    +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG++ RN   R+ R  K+++    ++SLR  KD +   A G ECG   + F ++ EGD +E +++V +
  S:   514 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGIIATVTQTLDMPTIEAVADEFGVPVLQDDVEEAAKKTVEMIEEADKAHLI-RRPPVVTVMGHVDHGKTSLLDAIRQARVAAGEAGGITQHIGAYQVEIEHNNEQRKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGSSPERVKQELSEQNLLAEDWGGDVVMVPVSAIKGENIDKLLEMLLLVTEVEDLQANPDRLARGTVIEAHLDKAKGPVATLLVQNGTLKTGDVLAAGPVLGKVRAMVDDNRQRLKQAGPSFAVEALGFSEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLTAMSGQANDGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGAKKAADATGVDVRDYDVIYKLLEDIQMAMEGLLEPELVEEALGEAEVRAVFTIGK-SAVAGCYVTTGKLHRNCRVRVHR-GKQVVYEGDLDSLRRNKDDVKEVATGFECGVGTDRFANWEEGDRIEAFKMVTQ 1098
>gi|183601975|ref|ZP_02963344.1| translation initiation factor IF-2 [Bifidobacterium animalis subsp. lactis HN019] >gi|183218860|gb|EDT89502.1| translation initiation factor IF-2 [Bifidobacterium animalis subsp. lactis HN019] (944 aa)
Score = 1129, Expect = 3.1e-121, Identities = 262/599 (43%), Positives = 387/599 (64%)
  Q:    16 KNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNN---------LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK--------KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K+ K   NR  +  + ++++++  +  GV + T N          ++ + ++KIN + A ++  LF  G        LDE     L  E G++ K        KE+    D  L++ + ++  DL   RPP+VT+MGHVDHGKT LLDTIR++ V A EAG ITQ IGAYQV    E ++  ITF DTPGHEAF+ MRA GA+LTDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+D   AN EK+  QL E  ++ EE+GG TM +  SA     +D+LLEA+++TA+  ++L+ANP   A G T+EA +DKG GAVA +LVQSGTL + D I+ G  YG+V+ M+D N K +K ALPSTPV++ GL  +P +GD ++V  D++  ++++EKRQ         K+RK   L  F     E+   I  LN+++K D++GS+EA++G L  IEV+    + ++   +G+I ++D++LA   K++++ FN + + +V+D A   G+ IK Y++IY+  ++IE  LKG+L P + E      EIR+++  S  G IAG  VL GE+KR   ARI R      ++ +I+SLR  KD + S   G E G  L NFND   GD++E +E+
  S:   313 KSSKARKNR--LAKRHEYEELKAPVIGGVRIPTGNGQTIRLRQGASLADLAEKINVNPAALVTVLFHLGEMATATQSLDESTFQILGEEIGWNIKIVSAEEEDKELLQQFDIDLESEELQEEADL-KPRPPVVTVMGHVDHGKTRLLDTIRRTNVVAREAGGITQRIGAYQVTVDLEGEERKITFLDTPGHEAFTAMRARGAELTDIAILVVAADDGVMPQTVEAINHAQSAHVPIVVAVNKIDVPGANPEKVRGQLTEFGLVPEEYGGSTMFVDISAKQGTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQSGTLHIGDSIVAGTSYGRVRAMLDENGKHMKEALPSTPVQVLGLTSVPTAGDLFLVAPDDRAARQIAEKRQATERAAQLAKRRKVVSLEEFKKKFAESE--IDMLNIVIKGDSSGSVEALEGSLMKIEVSDEVGIQVIHRGVGAITQNDVNLASVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSVIYKAIEDIEASLKGMLKPEYEEVTTSHSEIREIFRSSKFGNIAGVMVLDGEVKRGTKARILRDGVTTFNDLEISSLRRFKDDVKSVTEGYEAGINLGNFNDIEIGDVIETFEM 938
>gi|116514299|ref|YP_813205.1| translation initiation factor IF-2 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274969|sp|Q049V5|IF2_LACDB Translation initiation factor IF-2 >gi|116093614|gb|ABJ58767.1| bacterial translation initiation factor 2 (bIF-2) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (825 aa)
Score = 1129, Expect = 3.1e-121, Identities = 255/607 (42%), Positives = 382/607 (62%)
  Q:     8 NVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK-----RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N   + K KNKK   +++   +K Q  + +       F +   +   +  K +++  AEI+K LF+ GI  N N  LD+  +  L  ++G +  +++  +  + +DNI  ++ E+  +      RPP+VTIMGHVDHGKTTLLD +R ++V+  EAG ITQ+IGAYQV     LITF DTPGH AFS MRA GA++TDIVVL+VAADDG+ PQT EAIDHA  A  PIIV INKMD+  AN   +  QL +  ++ E +GG T+ +  SA    GIDELLE II+ A+++ELKA+PK+ A G  +EA + +G+G VAD+L+Q GTL V D I+VG+ +G+V+ M +    ++K A PS PV I+GLN +P+S DK +V  DEK  + + E R   + Q++  N      +N       + +K ++++LK D  GS EA+      I+V G ++N++ + +G+INESD+ LA  S +L++ FN + ++     A   G+ I+ Y+IIY+  D+++  ++G+L+P + EK IG++ +R+ W  S IG IAG  V  G + R +  R+ R D  +  + K+ SLR  KD +    AG +CG T+ENFND  EGD +E YE+
  S:   207 NRSEQRKRKNKK---HQSAPQVKKQVTQRKDRPLPESFEYEVGMNAQDLGKILHREPAEIVKKLFMLGIMINQNRSLDKDTIELLAADYGIEAVEKVHEDISD-IDNIFAQEMEESKNSENQVVRPPVVTIMGHVDHGKTTLLDRLRHTRVSEHEAGGITQNIGAYQVRINDRLITFLDTPGHAAFSSMRARGAEITDIVVLIVAADDGVMPQTIEAIDHAKSAGVPIIVAINKMDRPGANPAHVTEQLMQYELIPENYGGSTIFVNISAKTGMGIDELLENIILEADMLELKADPKQKAIGTVVEARLSRGKGPVADVLIQQGTLRVGDPIVVGDTFGRVRTMTNDKGHQVKKATPSMPVEITGLNDVPESADKLVVFADEKTARAVGEARAQQSLQKQRENVQHVTLDNLFDTMKRESMKSVDIVLKADVQGSAEALAQSFQKIDVEGVRVNIIHSGVGAINESDVTLASASNALIIGFNVRPTATAKSQAAQEGVDIRLYSIIYKAIDDVKAAMQGMLEPTYEEKVIGNLTVRETWKVSKIGTIAGAFVDNGYVTRESGIRVIR-DGVVKYDGKVASLRRFKDDVKEVKAGFDCGLTIENFNDIKEGDELEAYEM 819
>gi|146297075|ref|YP_001180846.1| translation initiation factor IF-2 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|189028304|sp|A4XL70|IF2_CALS8 Translation initiation factor IF-2 >gi|145410651|gb|ABP67655.1| bacterial translation initiation factor 2 (bIF-2) [Caldicellulosiruptor saccharolyticus DSM 8903] (858 aa)
Score = 1129, Expect = 3.4e-121, Identities = 264/586 (45%), Positives = 367/586 (62%)
  Q:    29 IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGI-----KELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +K Q K V+   K  +      +T+ EF+  I K +AE+IK L + G+  N+N  +D      +  ++G+  +KEI  +E+  L   + ED E+ L  RPP+V +MGHVDHGKT+LLD IR + V   EAG ITQ IGA  VE     ITF DTPGHEAF+ MRA GA +TDI VLVVAADDG+ PQT EAI+HA  A   IIV INK+DK +AN E++  QL+E  ++ EEWGG T+ +  SA    GID LLE I++ A+++ELKANP R A G  IEA +DKG G VA +LVQ GTL V DY++VG  +G+V+ M+D   + IK A PS PV I GL  +P +GD+ +   DEK  K +++ RQ   K+ K+     +L+E  + I     KEL VI+K D  GS+EA+K  +  +      + ++ AA+G+I ESD+ LA  S ++++ FN +        A    + I+ Y IIY + ++I+  +KG+L+PV+ E  IG  E+RQ++  SS+G IAG  VL G+I R + ARI R D  ++   K+ SL+  KD +   AAG ECG T E FND  EGDIVE +E+
  S:   265 LKLQTKTVQEEKKEEIVKIPEKITVGEFANLIGKPAAEVIKKLIMLGVMANINQEIDFDVASLIAEDYGFKVEKEIIKSEEEILLEDQ-EDPEETLQPRPPVVVVMGHVDHGKTSLLDAIRNTNVTEKEAGGITQHIGASVVEVNGRKITFLDTPGHEAFTAMRARGAQVTDIAVLVVAADDGVMPQTVEAINHAKAANVTIIVAINKIDKPEANPERVKQQLSEYGLIPEEWGGDTVFVNVSAKKKIGIDHLLEMILLVADLLELKANPNRPARGRVIEAKLDKGRGPVATVLVQKGTLKVGDYVVVGSTWGRVRAMIDDKGQRIKEAGPSMPVEILGLEDVPTAGDELVCVKDEKTAKTIAQIRQERLKEEKMQQSKISLDELFERIQKGQLKELRVIIKADVQGSVEALKSAIERLSNDKVTVKVIHAAVGAITESDVTLASASDAIIIGFNVRPEVGAMSLAEKEKVDIRMYRIIYDVINDIKAAMKGLLEPVYKEVIIGHAEVRQIFKSSSVGTIAGCYVLDGKITRTSNARIIR-DGVVVYEGKLASLKRFKDDVREVAAGYECGMTFEKFNDIKEGDIVEAFEM 853
>gi|183981907|ref|YP_001850198.1| translation initiation factor IF-2 InfB [Mycobacterium marinum M] >gi|183175233|gb|ACC40343.1| translation initiation factor IF-2 InfB [Mycobacterium marinum M] (947 aa)
Score = 1129, Expect = 3.6e-121, Identities = 248/564 (43%), Positives = 372/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI----NEDNFL----DNIKFEDR--EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KIN + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+    +ED  L    D    ED   E  L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV    +  + LITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ E++GG TM +  SA     I+ L EA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +LVQ GTL V D ++ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN G++EA++  L  IEV     L ++   +G I E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE+ L+G+L P++ E E+G  EIR L+  S +G+IAG  + +G ++RNA AR+ R +  ++ N  I+SLR  KD +     G ECG TL  ++D  EGD +E YE+V
  S:   363 SLSDFADKINANPAALVQALF------NLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRELLESFDLTYGEDSGDESELQTRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVSVDHDGTERLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVAEDFGGDTMFVDISAKQGTNIEALEEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLVQRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQ----LNLILKGDNAGTVEALEEALMGIEVDDEVALRVIDRGVGGITETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSVIYQAIDEIEKALRGMLKPIYEEVELGRAEIRALFRSSKVGLIAGCMISSGVVRRNAKARLLRDNIVVVENLSIHSLRREKDDVTEVREGFECGMTL-GYSDLKEGDFIESYELV 942
>gi|163941550|ref|YP_001646434.1| translation initiation factor IF-2 [Bacillus weihenstephanensis KBAB4] >gi|163863747|gb|ABY44806.1| translation initiation factor IF-2 [Bacillus weihenstephanensis KBAB4] (688 aa)
Score = 1128, Expect = 4.0e-121, Identities = 254/566 (44%), Positives = 369/566 (65%)
  Q:    47 FTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRKLSNFGTN--LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F+ +LT+ + +KK++K  +EIIK LF+ GI   +N  LD+  +  +  ++G + ++E+ ++E  F   I  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQV+     ITF DTPGH  F+ MRA GA +TDI +LVVAADDG+ PQT EAI HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R    L  ++ + S F       +  +G +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + ++ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V+ G+I R++  RI R D  ++   K+++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:   111 FSGSLTVGDLAKKLSKEPSEIIKKLFMLGIMATINQDLDKDTIELIATDYGIEVEEEVVVSETEFETFIDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVDVNDKKITFLDTPGHAVFTTMRARGAQVTDITILVVAADDGVMPQTVEAISHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYAAGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALVAQRGEKSKFSLEDLFQQIQEGDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELEKVDVRLHRIIYKVIEEIESAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVIDGKITRDSGVRIIR-DGVVVFEGKLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 681
>gi|168265846|ref|ZP_02687811.1| translation initiation factor IF-2 [Listeria monocytogenes FSL J2-071] (781 aa)
Score = 1128, Expect = 4.2e-121, Identities = 254/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++++ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   198 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIIIGFNVRPTTQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 773
>gi|157149775|ref|YP_001449862.1| translation initiation factor IF-2 [Streptococcus gordonii str. Challis substr. CH1] >gi|189028442|sp|A8AVQ2|IF2_STRGC Translation initiation factor IF-2 >gi|157074569|gb|ABV09252.1| Translation initiation factor IF-2 [Streptococcus gordonii str. Challis substr. CH1] (953 aa)
Score = 1128, Expect = 4.4e-121, Identities = 255/568 (44%), Positives = 368/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + KK+++++  + ++    E+    ED L++RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ IDELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ  T +  L N    L      +K +NVI+K D  GS+EA+   L  IEV G K+ +V +A+G+INESD+ LA  S ++++ FN + + +    A S  + I+ ++IIY++ +E+E  +KG+LDP + EK IG   IR+ +  S +G I G  V++G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  +E +ND    D +E Y
  S:   372 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKKKVEVDAAD-IERFFVEEGYINEDALEERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVEGGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIDELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNETPMAGDHFAVYEDEKAARAAGEERAKRALLKQRQA-THRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLQKIEVEGVKVTIVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQAESDSVEIRLHSIIYKVIEEVEDAMKGMLDPEYQEKIIGEALIRETFKVSKVGTIGGFMVISGKVTRDSKVRVIR-DGVVIYDGQLASLKHFKDDVKEVTNGREGGLMIEGYNDIQVDDTIEAY 946
>gi|104774211|ref|YP_619191.1| translation initiation factor IF-2 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|123251891|sp|Q1G9P9|IF2_LACDA Translation initiation factor IF-2 >gi|103423292|emb|CAI98133.1| Translation initiation factor IF-2 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (825 aa)
Score = 1128, Expect = 4.4e-121, Identities = 255/607 (42%), Positives = 382/607 (62%)
  Q:     8 NVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK-----RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N   + K KNKK   +++   +K Q  + +       F +   +   +  K +++  AEI+K LF+ GI  N N  LD+  +  L  ++G +  +++  +  + +DNI  ++ E+  +      RPP+VTIMGHVDHGKTTLLD +R ++V+  EAG ITQ+IGAYQV     LITF DTPGH AFS MRA GA++TDIVVL+VAADDG+ PQT EAIDHA  A  PIIV INKMD+  AN   +  QL +  ++ E +GG T+ +  SA    GIDELLE II+ A+++ELKA+PK+ A G  +EA + +G+G VAD+L+Q GTL V D I+VG+ +G+V+ M +    ++K A PS PV I+GLN +P+S DK +V  DEK  + + E R   + Q++  N      +N       + +K ++++LK D  GS EA+      I+V G ++N++ + +G+INESD+ LA  S +L++ FN + ++     A   G+ I+ Y+IIY+  D+++  ++G+L+P + EK IG++ +R+ W  S IG IAG  V  G + R +  R+ R D  +  + K+ SLR  KD +    AG +CG T+ENFND  EGD +E YE+
  S:   207 NRSEQRKRKNKK---HQSAPQVKKQVTQRKDRPLPESFEYEVGMNAQDLGKILHREPAEIVKKLFMLGIMINQNLSLDKDTIELLAADYGIEAVEKVHEDISD-IDNIFAQEMEESKNSENQVVRPPVVTIMGHVDHGKTTLLDRLRHTRVSEHEAGGITQNIGAYQVRINDRLITFLDTPGHAAFSSMRARGAEITDIVVLIVAADDGVMPQTIEAIDHAKSAGVPIIVAINKMDRPGANPAHVTEQLMQYELIPENYGGSTIFVNISAKTGMGIDELLENIILEADMLELKADPKQKAIGTVVEARLSRGKGPVADVLIQQGTLRVGDPIVVGDTFGRVRTMTNDKGHQVKKATPSMPVEITGLNDVPESADKLVVFADEKTARAVGEARAQQSLQKQRENVQHVTLDNLFDTMKRESMKSVDIVLKADVQGSAEALAQSFQKIDVEGVRVNIIHSGVGAINESDVTLASASNALIIGFNVRPTATAKSQAAQEGVDIRLYSIIYKAIDDVKAAMQGMLEPTYEEKVIGNLTVRETWKVSKIGTIAGAFVDNGYVTRESGIRVIR-DGVVKYDGKVASLRRFKDDVKEVKAGFDCGLTIENFNDIKEGDELEAYEM 819
>gi|167751255|ref|ZP_02423382.1| hypothetical protein EUBSIR_02241 [Eubacterium siraeum DSM 15702] >gi|167655762|gb|EDR99891.1| hypothetical protein EUBSIR_02241 [Eubacterium siraeum DSM 15702] (938 aa)
Score = 1128, Expect = 4.4e-121, Identities = 253/564 (44%), Positives = 357/564 (63%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRK--------LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + + + E + ++   +A++IK LF  G+   +N  +D      +  EFG    KE+ ++ E+   + +  ED E+ L  R P+V +MGHVDHGKT+LLD IR + V + EAG ITQ IGAY+V+     ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A   IIV INKMDK  AN +K+  +L E  ++CEEWGG  + +  SA   +GIDELLE + +TA+++ELKANP RLA G+ IEA +DKG G +A +LVQSGTL   D I+ G   G+V+ M D   K +K A PS PV I GL  +P +GD +    DEKL +EL EKR+ + K+ +        L N  + + E S  +K+L +I+K D  GS+EA+   LS +     K+ ++  A+G++ ESD+ LA+ S +++V FN + +   +D A   G+ I+ Y +IY   +EIE  +KG+L P + E + G VE+RQ+   SS+GV+AG  VL G+++RN   R+ R D  I++  KI  LR  KD +   AAG ECG TLE F D  +GDI E +
  S:   364 DEIVVSELASRLKVTAADVIKKLFSLGVMVTINQSVDYDTACIVAEEFGAKVTKEVVVSIEERLFEEV--EDTEENLQPRSPVVVVMGHVDHGKTSLLDRIRHANVTSGEAGGITQHIGAYRVKAGGRDITFLDTPGHEAFTAMRARGALATDIAILVVAADDGIMPQTVEAINHAKAANLSIIVAINKMDKPTANPDKVKQELTEHGLVCEEWGGDVICVPVSAKTGEGIDELLEMVNLTADVLELKANPDRLAKGVVIEARIDKGRGPIATVLVQSGTLHTGDTIIAGTAVGRVRVMRDDKGKAVKEAGPSVPVEIMGLAEVPSAGDDFAAVEDEKLARELVEKRKFDAKEEQFKLYKKVSLDNLFSQIEEGS--MKKLPIIVKADVQGSVEAVSQSLSKLSNEEVKVEVIHGAVGAVTESDVMLAKASGAIIVGFNVRPNPAAADNAKRDGVDIRLYRVIYDAIEEIETAMKGMLAPKYREVDTGRVEVRQVMKLSSVGVVAGSYVLDGKVQRNGEVRVVR-DGIIVAVDKIAGLRRFKDDVKEVAAGYECGITLEKFTDIKDGDIFEAF 931
>gi|167464645|ref|ZP_02329734.1| translation initiation factor IF-2 [Paenibacillus larvae subsp. larvae BRL-230010] (795 aa)
Score = 1128, Expect = 4.4e-121, Identities = 252/567 (44%), Positives = 359/567 (63%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-SNFGTNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +    +T+ E +K ++K ++E+IK L   G+   +N  LD   +  +  EFG   + +I + ED F + ++ +D E  L  RPP+VTIMGHVDHGKTTLLD IR + V   EAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI ++VVAADDG+ PQT EAI HA  A  PIIV +NK+DK  A+  KI   L E  ++ EEWGG T+ ++ SA    G++ LLE I++ AE+ E KANP + A G  IEA +DKG+G VA +LVQ GTL V D  + G  +G+V+ M++   K +K A PS+PV I+GL  +P++GD ++V  DE+  + ++EKR +  +Q ++ +N    L++         IK+LNVI+K D  GS+EA++  L  IEV GA++ ++    G+I ESDI LA  S ++++ FN +        A    + I+ + IIY + +EIE+ +KGILDP F E  IG  E+R ++  S +G IAG  V +G+I RNA  R+ R D  +I   KI+SL+  KD +   A G ECG ++E +ND  EGD +E +
  S:   218 IVRGTMTVGEVAKALHKDASEVIKKLLFLGVMATINQELDLDAIELVATEFGVAVEVKIPVEEDKF-ELVEEQDDEKDLRDRPPVVTIMGHVDHGKTTLLDAIRHTSVTEGEAGGITQHIGAYQVEVNGKKITFLDTPGHEAFTTMRARGAQVTDITIIVVAADDGVMPQTVEAISHAKAANVPIIVAVNKIDKPTADPGKIKQALTEYELVPEEWGGDTIFVEISAKQRIGLENLLEMILLVAEVQEFKANPNKRARGTVIEAELDKGKGPVARILVQHGTLKVGDSFVAGTCFGRVRAMMNDRGKRLKEAGPSSPVEITGLAEVPQAGDPFMVFEDERKARSIAEKRAVTQRQSEMNANARVTLDDLYKHIQEGEIKDLNVIIKADVQGSVEALRSSLEKIEVEGARVKIIHTGAGAITESDIILASASNAIIIGFNVRPEPAAKATAEEEQVDIRLHRIIYNVIEEIEQAMKGILDPEFKETVIGHAEVRNIFKISGVGTIAGCMVTSGKITRNAEVRLVR-DGIVIVEGKIDSLKRFKDDVKEVAQGYECGISIEKYNDIKEGDTIEAF 788
>gi|28572760|ref|NP_789540.1| translation initiation factor IF-2 [Tropheryma whipplei TW08/27] >gi|39931268|sp|Q83HG7|IF2_TROW8 Translation initiation factor IF-2 >gi|28410893|emb|CAD67278.1| translation initiation factor IF-2 [Tropheryma whipplei TW08/27] (803 aa)
Score = 1127, Expect = 5.1e-121, Identities = 250/564 (44%), Positives = 363/564 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-----NFLDNIKFEDREDL---LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL--SNFGTNLNENSQGIKE-----LNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KI+   A ++  LF  G        LDE     L  E GY  +     +ED     +F  N+  E  ED    L  RPP+VTIMGHVDHGKT LLDTIR +   A E+G ITQ IGAYQV      +TF DTPGHEAF+ MRA GA +TDI VLVVAADDG+ PQT EA+DHA  A  PI+V +NK+DK+ AN  KI  Q+ E +V+ EE+GG  M I  SA   QG+D LLEAI++TA+  +EL+ANP R A G+TIEA +D G GAVA +LVQSGTL V D ++ G  YG+V+ MVD N   +++A PS PVR+ GL+ +PK+GD +IV  +++  ++++EKR+ N +  +L  S    +L + ++ I+E     LN+I+K D +G++EA++  LS ++V     L ++   +G+I ESD++LA    ++V+ FN +   K  D A   G+ ++ Y++IY   ++IE+ LKG+L P   E+++G   +++++  S +G IAG  V +G I RNA AR+ R    ++S+  + SLR  KD +    +G ECG  L + +D   GD +E  +IV
  S:   218 SVTDFAEKIDVLPANLLSVLFHLGEMATATESLDEATFEILAEEIGYKVQIVSPDDEDRALLESFSVNLAAEHAEDSELDLAIRPPVVTIMGHVDHGKTLLLDTIRNTNTLAEESGGITQHIGAYQVSVGDRFVTFIDTPGHEAFTAMRARGAKVTDIAVLVVAADDGIMPQTIEALDHARSADVPIVVAVNKIDKEGANPAKIRQQMTEFDVIPEEYGGDVMFIDISAKTGQGVDALLEAILLTADAALELRANPDRTARGVTIEAKLDAGRGAVATVLVQSGTLRVGDRVVTGCAYGRVRAMVDENGLPVESAPPSRPVRVQGLSSVPKAGDSFIVVAEDRQARQIAEKREANERNAQLAKSRKRVSLEDFTRAIQEGRVQSLNMIIKGDVSGAVEALEESLSKLDVGEEVSLRIIHRGVGAITESDVNLATVDNAVVIGFNVRPDRKARDRAAREGVDVRFYSVIYDAIEDIEKSLKGLLKPELEERKLGLAIVKEVFHSSRVGTIAGCSVESGSITRNAKARLIRDGVVVVSDLTVTSLRRFKDDVTEVKSGFECGVGLGSCDDIRIGDEIETIQIV 798
>gi|47094118|ref|ZP_00231841.1| translation initiation factor IF-2 [Listeria monocytogenes str. 4b H7858] >gi|47017503|gb|EAL08313.1| translation initiation factor IF-2 [Listeria monocytogenes str. 4b H7858] (782 aa)
Score = 1127, Expect = 5.1e-121, Identities = 254/567 (44%), Positives = 371/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDN----FLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +    F + +     E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   199 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDLDVYFGNELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVMQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 774
>gi|153166700|ref|ZP_01927223.1| translation initiation factor IF-2 [Listeria monocytogenes FSL N1-017] >gi|133727460|gb|EBA29158.1| translation initiation factor IF-2 [Listeria monocytogenes FSL N1-017] (778 aa)
Score = 1127, Expect = 5.3e-121, Identities = 255/567 (44%), Positives = 373/567 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR------EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT--KQRKLSNFGT--NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           VF+ +LT+ E +KK+ +  +E+IK LF+ G+   +N  LD+  +  +C ++G   ++EI+++  +   ++ FE+       E  L +RPP+VTIMGHVDHGKTTLLD++R +KV   EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN +++  +L E  ++ E WGG T+    SA   +G++ LL+ I++ +E+ ELKANP R A G  IEA +DKG G VA LLVQ GTL + D I+VG  +G+V+ MV+   + +K   PSTPV I+GLN +P++GD+++V  DEK  + + E R       QR  +N  +  NL E+ +   +KE+NVI+K D  GS+EA+   L  I+V G  + ++  A+G+INESDI LA  S ++V+ FN + +++  + A +  + I+ + +IY+  DEIE  +KG+LDP F EK IG  ++RQ  + S +G IAG  V  G+I R++  RI R D  ++   +I +L+  KD     A G ECG T++NFND  E D++E Y
  S:   195 VFSESLTVAELAKKLYREPSELIKKLFMLGVVATINQSLDKDAIELICDDYGVQVEEEIKVDVTDL--DVYFENELNEAVDESKLVERPPVVTIMGHVDHGKTTLLDSLRNTKVTLGEAGGITQHIGAYQLEIHDKKITFLDTPGHAAFTAMRARGAQITDITILVVAADDGVMPQTIEAINHAKAAGMPIIVAVNKIDKPQANPDRVIQELTEYELVPEAWGGDTIFAPISAKFGEGLENLLDMILLVSEVEELKANPDRRAIGSVIEAELDKGRGPVATLLVQDGTLNIGDPIVVGNTFGRVRAMVNDLGRRVKKVGPSTPVEITGLNDVPQAGDRFVVFEDEKTARNIGETRASRALVAQRSATNRVSLDNLFEHMKAGEMKEVNVIIKADVQGSVEALAASLRKIDVEGVNVKIIHTAVGAINESDITLAAASNAIVIGFNVRPTAQAREAAENESVDIRLHRVIYKAIDEIEAAMKGMLDPEFQEKIIGQAQVRQTINVSKVGTIAGCYVTDGKITRDSGVRIIR-DGIVVFEGEIATLKRFKDDAKEVAKGYECGITVQNFNDIKEDDVIEAY 770
>gi|113955476|ref|YP_731570.1| translation initiation factor IF-2 [Synechococcus sp. CC9311] >gi|123327604|sp|Q0I7K2|IF2_SYNS3 Translation initiation factor IF-2 >gi|113882827|gb|ABI47785.1| translation initiation factor IF-2 [Synechococcus sp. CC9311] (1129 aa)
Score = 1127, Expect = 5.5e-121, Identities = 236/574 (41%), Positives = 369/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH----LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-----------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KG+   +   LD   +  +  EFG    + +++      ++ I+ +D   L+ +RPP+VT+MGHVDHGKT+LLD IR+++VAA EAG ITQ IGAYQVE + +     +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ P++V INK+DK+ A+ +++  +L+E+N+L E+WGG  +++  SAL  + ID+LLE I++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD     +K A PS  V   G + +P +GD++ V  DEK  + +   R           Q+ +++  L+       E    +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G + E+D+DLA  S +++V FNT ++S     A +  + +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG+++RN   R+ R+ KEI+    ++SLR  KD +   A G ECG   + F ++ +GDIVE Y++V +
  S:   539 IVVPEDNLTVQELADMLSIESSEIIKSLFFKGVIATVTQTLDMPTIEAVAQEFGVPVLQDDVEEAAKKTVEMIEEKDHAHLI-RRPPVVTVMGHVDHGKTSLLDAIRQARVAAGEAGGITQHIGAYQVEIQHNDSPQRLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPVVVAINKIDKEGASPDRVKQELSEQNLLAEDWGGDVVMVPVSALRGENIDKLLEMILLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLVQNGTLRTGDVLAAGPVLGKVRAMVDDGGGRLKEAGPSCAVEALGFSEVPTAGDEFEVYPDEKSARAVVGDRASDARASRLAQQMASRRVSLTAMSGQAKEGE--LKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEVTETDVDLAAASGAVIVGFNTSMASGAKRAADANSVDVRDYDVIYKLLEDIQLAMEGLLEPELVEESLGEAEVRAVFTIGK-SAVAGCYVTTGKLQRNCKVRV-RRGKEIVFAGDLDSLRRNKDDVKDVATGFECGIGCDRFANWKDGDIVEGYKLVTQ 1123
>gi|116629471|ref|YP_814643.1| translation initiation factor IF-2 [Lactobacillus gasseri ATCC 33323] >gi|122273591|sp|Q044B7|IF2_LACGA Translation initiation factor IF-2 >gi|116095053|gb|ABJ60205.1| bacterial translation initiation factor 2 (bIF-2) [Lactobacillus gasseri ATCC 33323] (882 aa)
Score = 1127, Expect = 5.7e-121, Identities = 251/570 (44%), Positives = 372/570 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQ--INEDNFLDNIKFEDRE--DLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            V+   +   +  K +++  AEI+K LF+ G+  N N  LD+  +  L  E+G + ++++   I++ + L   + E+ +     +KRPP+VTIMGHVDHGKTTLLD +R + V+  EAG ITQ IGAYQV     LITF DTPGH AFS MRA GA++TDIVVLVVAADDG+ PQT EAIDHA  A  PIIV +NK+DK  AN + +  QL +  ++ E+WGG T+ +K SA   + ++ELL+ I++ A++MELKA+P + A G  IEA +DKG G+VAD+LVQ GTL V D I+VG+ +G+V+ M +   + +K A PS PV I+GLN +P++ DK +V  DEK  + + E+R  N  +++  N         F T   EN   +KE++++LK D  GS EA++  L  IEV G ++N++ + +G+INESD+ LA  S + +V FN + ++     A + G+ I+ YNIIY++ D++E  +KG+L+P + EK  G++ +R+ W  S IG IAG  V  G + R++  R+ R D  +  + K+ SL+  KD +     G +CG T+ENFND    D +E YE+
  S:   298 LVYEEGMNAQDLGKLLHREPAEIVKKLFMLGVMTNQNQSLDKDTIELLAAEYGIEAQEKVHEDISDIDTLYTKEMEESKASKHQEKRPPVVTIMGHVDHGKTTLLDRLRHTNVSEHEAGGITQKIGAYQVRIDDRLITFLDTPGHAAFSNMRARGAEITDIVVLVVAADDGVMPQTIEAIDHAKSAGVPIIVAVNKIDKPGANPDHVMEQLMKYGLVPEDWGGDTIFVKISAKTGKNVEELLQMILLQADVMELKADPDQKAIGTVIEARLDKGRGSVADVLVQQGTLKVGDPIVVGDTFGRVRVMTNDKGRRVKKATPSAPVEITGLNDVPEAADKLVVFEDEKTARSVGEQRAKNALEKQRENVQHVTLDNLFDTMKKEN---MKEVDIVLKADVQGSAEALQQSLEKIEVEGVRVNIIHSGVGAINESDVTLAGASNAFIVGFNVRPTNTAKSQADAEGVDIRLYNIIYKVMDDVEAAMKGMLEPTYEEKVTGNLTVRETWKVSKIGTIAGAFVDNGYVTRDSGIRVIR-DGIVKYDGKVASLKRFKDDVKEVKQGFDCGITIENFNDIKVDDQLEAYEM 876
>gi|187778989|ref|ZP_02995462.1| hypothetical protein CLOSPO_02584 [Clostridium sporogenes ATCC 15579] >gi|187772614|gb|EDU36416.1| hypothetical protein CLOSPO_02584 [Clostridium sporogenes ATCC 15579] (691 aa)
Score = 1127, Expect = 5.9e-121, Identities = 259/604 (42%), Positives = 388/604 (64%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFT---NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T  KN+ K+  +N+ +   + + +KV T     + + T   + +T+ E S K+ K  AE+IK L L G+  ++N  ++     +L  +F  +  KE +  +++  D +K  +  + L KR PI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     ITF DTPGH AF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI H   A  P+IV INK+D+  ANI+K+  +L E  ++ E+WGG T+ +  SA   +GID+LLE I++++EI+ELKANP R A G  +EA +DKG G VA LL+Q+GTL V D I+VG  YG+++ M +   K IK+A PSTPV I GL+ +P++GDK+    DEK  + +++KR+         +T +  L +    + E +  +KEL +I+K D  GS+EA+K  L  +     K+ ++   +G+INE+D+ LA  S  +++ FN +  +  +  +   G+ IK Y +IY   ++I+  + G+L+P F E  IG+ E+RQ++  SS+G IAG  V TG++ RNA AR+ R D  +I  +++ SL+  KD     A G ECG ++E FND  EGDI+E +
  S:    70 IETTGKNQIKESTNNKKSNKREDKNEKVSTENAEDMAIITMTSDTITVKEISDKLEKSYAEVIKELMLMGVMASVNQEINFEMAEKLAAKFDTEILKEDEDEDEDLEDILKDNEEGEHLQKRSPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVELNGEAITFLDTPGHAAFTAMRARGAQVTDIVILVVAADDGIMPQTQEAISHCKAANVPLIVAINKIDRPGANIDKVKQELTEYGLVAEDWGGDTICVPVSAHTKEGIDDLLEMILLSSEILELKANPNRKAKGTVVEAKLDKGRGPVATLLIQNGTLRVGDSIVVGSTYGRIRAMFNDKGKNIKSAGPSTPVEILGLSEVPEAGDKFYQVKDEKTARGIADKRKEKIRDEYLQSTHKVSLEDLYNQIQEGT--VKELGLIVKADVQGSVEALKQSLEKLSTEEVKVRVIHGGVGAINETDVTLATASNGIILGFNVRPDNNATIASERDGVDIKTYRVIYDAIEDIKSAMLGMLEPEFKEVVIGTAEVRQVYKISSVGTIAGAYVQTGKLARNAGARVIR-DGIVIFESELGSLKRFKDDAKEVAQGYECGLSIEKFNDIKEGDIIECF 681
>gi|21911031|ref|NP_665299.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS315] >gi|21905240|gb|AAM80102.1| putative initiation factor 2 [Streptococcus pyogenes MGAS315] (934 aa)
Score = 1126, Expect = 6.8e-121, Identities = 250/568 (44%), Positives = 372/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K ++++++   + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   352 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 926
>gi|114331632|ref|YP_747854.1| translation initiation factor IF-2 [Nitrosomonas eutropha C91] >gi|122313589|sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 >gi|114308646|gb|ABI59889.1| bacterial translation initiation factor 2 (bIF-2) [Nitrosomonas eutropha C91] (888 aa)
Score = 1126, Expect = 6.8e-121, Identities = 243/565 (43%), Positives = 358/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKE----LNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +++   ++K+   +AE+IK L   G    +N +LD+     +  E G+  K     N + FL+ +     E  ++ R P+VT+MGHVDHGKT+LLD IR+++VA  EAG ITQ IGAY V+  + ++TF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA+ HA  A  PI+V +NKMDK +AN+E+I  +L    V+ E+WGG  M I  SA   QGIDELLEA+++ AE++ELKA     A G+ IE+ +DKG G VA +LVQSGTL   D +L G  +GK++ M+D   K +  A  S PV I GL+ +  +G+ +I  +DE+  +E++  RQ   +  +L        E+  G +E    LN+I+K D  GS EA+   L  +E    K+N+V + +G+I ESDI+LA  SK++V+ FN +          S G+ ++ YNIIY+  DE+++ L G++ P   EK +G V+IR+++  S +GV+AG  VL G I+R+A  R+ R D  +I +  ++SL+  KD +    +G ECG +L+NFND  +GD +E+YEIV
  S:   315 ISVAVLAQKMAVKAAEVIKVLMKMGNMVTINQMLDQDTAMIVVEEMGHVAKIAAPDNPEAFLEEVDLSPDEARMESRAPVVTVMGHVDHGKTSLLDYIRRTRVAGGEAGGITQHIGAYHVKTSRGVVTFLDTPGHEAFTAMRARGAKITDIVILVVAADDGVMPQTIEAVHHAKAASIPIVVAVNKMDKPEANLERIKQELVNHGVVPEDWGGDAMFIGVSAKTGQGIDELLEAVLLQAEVLELKAVRDAPAKGVIIESRLDKGRGPVATVLVQSGTLRRGDVVLTGAVFGKIRAMLDERGKSVSEAGTSIPVEIQGLSEVAAAGEVFIALSDERKAREIALFRQGKFRDVRLDKLHVAKMEDVFGHQEDISTLNLIIKADVQGSCEALAYALKKLETDEVKINIVHSGVGAIIESDINLALASKAVVIGFNCRADLGARKLIASTGVDVRYYNIIYEAVDEVKKALSGMMTPDRKEKILGLVDIREIYRISKVGVVAGCYVLEGLIRRDAPVRVLR-DGVVIHSGSLDSLKRFKDDVKEVKSGFECGLSLKNFNDIQQGDQIEVYEIV 882
>gi|74316715|ref|YP_314455.1| translation initiation factor IF-2 [Thiobacillus denitrificans ATCC 25259] >gi|90101386|sp|Q3SKX1|IF2_THIDA Translation initiation factor IF-2 >gi|74056210|gb|AAZ96650.1| initiation factor 2 [Thiobacillus denitrificans ATCC 25259] (922 aa)
Score = 1126, Expect = 6.9e-121, Identities = 249/565 (44%), Positives = 360/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ-----LNTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +T+ E + K++  +AE+IK L   G    +N +LD+     +  E G+  K       + FL     E  E  +  RPP+VT+MGHVDHGKT+LLDTIR+++VA+ EAG ITQ IGAY VE +K +ITF DTPGHEAF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA  A  P++V +NK+DK DAN E+I  +L  + V  EEWGG T  ++ SA  N  I+ LL+AI++ AE++EL+A     A GI IEA +DKG+G VA LLVQSGTL   D +L G+ YG+V+ M+D   K +  A PS PV I GL+ +P++G+  +V  DE+  +E++  RQ     +   +++ +   +  ++  QG ++ L +ILK D  GS E +   L  I     K+N++ + +G+I ESD++LA  SK++++ FN +  +     A S G+ I+ YNIIY+  DE++  L G+L P   E  IG+VE+RQ++  S +G IAG  V  G +KR A  R+ R +  +I   +++SL+  KD +    A  ECG +L+NFND  EGDI+E++E+V
  S:   348 ITVAELAHKMSVKAAEVIKALMKLGSMVTINQVLDQETAIIVVEEMGHIGKPAALDTPEAFLIETG-EPGEAEMVARPPVVTVMGHVDHGKTSLLDTIRRTRVASGEAGGITQHIGAYHVETEKGVITFLDTPGHEAFTAMRARGAKATDIVVLVVAADDGVMPQTIEAIHHAKAAGVPLVVAVNKIDKPDANPERIRQELVAQGVTPEEWGGDTQFVEVSAKANTNINGLLDAILLQAEVLELQAPADGPAKGIVIEARLDKGKGPVATLLVQSGTLRRGDMVLAGQVYGRVRAMLDEAGKTVTEAGPSIPVEIQGLSDVPQAGEDMMVLPDERKAREIALFRQGKYRDVQLAKKQAAKLESMFDQMGQGEVQHLPIILKADMQGSYEGLAHALGKISTDEVKVNIIHSGVGAITESDVNLALASKAVLIGFNVRADASARKLAESSGVDIRYYNIIYEAVDEVKAALSGMLAPEKKESVIGTVEVRQVFVISKVGTIAGCYVTDGVVKRGAGVRLIRNNV-VIHQGELDSLKRFKDDVKEVKANFECGLSLKNFNDIQEGDILEVFEVV 916
>gi|116333941|ref|YP_795468.1| translation initiation factor 2 [Lactobacillus brevis ATCC 367] >gi|122269375|sp|Q03QT5|IF2_LACBA Translation initiation factor IF-2 >gi|116099288|gb|ABJ64437.1| bacterial translation initiation factor 2 (bIF-2) [Lactobacillus brevis ATCC 367] (780 aa)
Score = 1126, Expect = 7.7e-121, Identities = 252/569 (44%), Positives = 373/569 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRE----DLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           V V+T+ +   + +K +++ SAEI+K LF+ G+  N N  LD+  +  L  ++G   +++++++     D  KF D E    D    R P+VTIMGHVDHGKTTLLD +R S +   EAG ITQ+IGAYQV +   +ITF DTPGH AF++MRA GA++TDI VLVVAADDG+ PQT EAI HA  A  PIIV +NK+DK  AN   +  QL E  ++ E+WGG T+ ++ SA   + IDELL+ I++ ++++ELKANPK+   G  IEA +D+G+G+VA LLVQ GTL V D I+VG  +G+V+ MV+   + IK A PSTPV I+GLN +P++GD+++V +DEK  +   E+R        + NT    L N   +L E    +KE++VI+K D  GS+EA+ G L  I+V+G ++N++ +A+G+INESD+ LA  S ++++ FN + + +    A S  + I+ +N+IY   DEIE  +KG+L+P + E+ IG VE++ ++  S +G I GG V  G +   +  R+ R D  +I   K+ SL+  KD +     G E G T+EN+ND   GD++E Y
  S:   198 VLVYTDGMNAQDLAKILHRSSAEIVKKLFMLGVMVNQNQSLDKDTIEILADDYGIQAQEKVEVD---VTDIDKFFDAEMANKDFEAPRAPVVTIMGHVDHGKTTLLDHLRHSHITDGEAGGITQAIGAYQVHYNDKVITFLDTPGHAAFTEMRARGAEITDITVLVVAADDGVMPQTIEAIHHAKAAGTPIIVAVNKIDKPGANPNHVMEQLTEYELIPEDWGGDTIFVEISAKFGKNIDELLDMILLQSDVLELKANPKQNGVGSVIEARLDQGKGSVATLLVQQGTLHVGDPIVVGNTFGRVRTMVNERGRRIKDATPSTPVEITGLNDVPEAGDRFVVFDDEKTARAAGEERAKEALVKERRNTSHVTLDNLFDSLKEGE--MKEVDVIIKADVQGSVEALAGSLKKIDVSGVRVNIIHSAVGAINESDVTLAEASDAIIIGFNVRPTPQARAQADSDKVDIRLHNVIYNAIDEIETAMKGLLEPTYEEEIIGEVEVKDIFHASKVGTIVGGMVTEGYVTSESDVRLIR-DGVVIYEGKLGSLKRFKDDVKQVKMGYELGLTIENYNDVKVGDVIEAY 772
>gi|196257412|ref|ZP_03155948.1| translation initiation factor IF-2 [Cyanothece sp. PCC 7822] >gi|196201012|gb|EDX95831.1| translation initiation factor IF-2 [Cyanothece sp. PCC 7822] (1111 aa)
Score = 1125, Expect = 9.2e-121, Identities = 265/609 (43%), Positives = 383/609 (62%)
  Q:     6 AKNVKTKSKNKNKKIV--DNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +KNVK  +K +  +    D     + K Q ++ ET       V    +T+ E S++++    EIIK LF KGI  N+   L+   +  +  E G   +  E +       + I   D E+L  +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V    E ++  I F DTPGHEAF+ MRA GA +TDI VLVVAADDG++PQT+EAI HA  A  PI+V INK+DK DAN ++I  +L+E +++ EEWGG T+++  SAL  + +D LLE I++ AEI EL ANP RLA G  IEA++D+  G VA LLVQ+GTL V D I+ G   GK++ M+D    +++ A PS  V I GLN +P +GD++ V  +EK  + +S++R    +Q +L    ++       L+  +Q   +KELN+ILK D  GS+EAI G L  +     ++ ++ AA G + E+D+DLA  S +++V FNT ++S     A   GI I+ YNIIY++ D+I+  ++G+LDP  VE  +G  E+R ++     G +AG  V +G++ RN   R++RK  E+I    ++SL+  K+      AG ECG  +  FND+ EGD +E+YE+
  S:   486 SKNVKAPTKAEPGRTTKSDRSERRERKEQPQRAET------LVLDKMMTVRELSERLSVPETEIIKILFFKGIAVNITQTLEMDTITAIAEELGVTLESPEEKAAATKTTEMIDENDLENL-HRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVNVEHEGQEQQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDGVQPQTKEAISHARAAGVPIVVAINKVDKADANPDRIKQELSELSLVPEEWGGDTIMVPVSALKGENLDSLLEMILIVAEIAELSANPDRLARGTVIEANLDRTRGPVATLLVQNGTLRVGDIIVAGSVLGKIRAMIDDRGNKVEEASPSFAVEILGLNEVPAAGDEFEVFENEKEARAISQQRTDELRQSRLQQAMSSRRISLSTLSAQAQEGKLKELNLILKADVQGSVEAILGSLKQLPQNEVQIRVLLAAAGEVTETDVDLAAASGAVIVGFNTTLASGARQAADQEGIDIREYNIIYKLLDDIQGAMEGLLDPEEVESHLGFAEVRAVFQVGR-GAVAGCYVQSGKLIRNRLLRVRRKG-EVIYEGVLDSLKRVKEDAREVNAGYECGIGVNKFNDWQEGDQIEVYEM 1101
>gi|148263958|ref|YP_001230664.1| translation initiation factor IF-2 [Geobacter uraniireducens Rf4] >gi|189028322|sp|A5GF86|IF2_GEOUR Translation initiation factor IF-2 >gi|146397458|gb|ABQ26091.1| bacterial translation initiation factor 2 (bIF-2) [Geobacter uraniireducens Rf4] (882 aa)
Score = 1125, Expect = 9.2e-121, Identities = 248/605 (40%), Positives = 373/605 (61%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K K ++  K  V  +T I +    K++   IK      +  +T+ E +K++   + ++I+ L   G+   +N  LD      L  EFGY+ +  + ++ D  L++    D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA++H+  A  PIIV +NK+DK +A  E++  +L E  ++ EEWGG T+ ++ SA     +  LLE +++ A+++ELKANP++ A G  +EA +DKG G VA +LVQ GTL V DY + G ++G+V+ M +    ++ +A PS P  + G  G+P +GD ++   DEK  KE++  RQ   ++ +L+         L E  Q   +K+LNVI+K D  GS+EA+   L  +     +LN++ A++G+I E+D++LA  S ++++ FN +   K    A   G+ ++ YNIIY   D+I++ ++G+L+P   EK +G  EIR+ +S    G +AG  VL G++ RNA  R+ R D  ++   K+ SLR  KD +   A G ECG +LEN+ND   GDI+E +EI
  S:   277 KGKKRHVEKVSVGKKTEITVPKAIKRI---IK-----ISETITVGELAKRMGIKATDLIRALMKMGVMATINHPLDVDTATLLATEFGYEIEN-VALDIDEILESAP--DALESLVKRPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELNGRKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAVNHSKAAGVPIIVAVNKIDKPEAKPERVKQELMELGLVSEEWGGDTIFVEVSAKKRINLPSLLEMVLLQADVLELKANPEKAARGTIVEAKLDKGRGPVATVLVQEGTLKVGDYFVAGVHFGRVRAMQNDRGDKVLSAGPSMPAEVIGFTGVPDAGDVFVALADEKQAKEIASLRQQKLRETELAKHTKLSLEQLYEKIQMGEVKDLNVIVKGDVQGSVEAVAESLRKLSTDAIRLNVIHASVGAITETDVNLATASNAIILGFNVRPEVKAQALAEKEGVDVRLYNIIYDAVDDIKKAMEGLLEPTLREKFLGRAEIRETFSVPKHGTVAGSYVLDGKMVRNAQVRLLR-DNVVVYEGKMASLRRFKDDVKDVATGYECGISLENYNDIKVGDIIEAFEI 875
>gi|34496917|ref|NP_901132.1| translation initiation factor IF-2 [Chromobacterium violaceum ATCC 12472] >gi|39931211|sp|Q7NY13|IF2_CHRVO Translation initiation factor IF-2 >gi|34102773|gb|AAQ59137.1| translation initiation factor IF-2 [Chromobacterium violaceum ATCC 12472] (964 aa)
Score = 1125, Expect = 9.6e-121, Identities = 249/565 (44%), Positives = 355/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS--------EKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +T+ E + K+   + E+IK L   G+   +N +LD+     +  E G+  K     + + +LD    E  E +   R P+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA  AK P++V +NK+DK+ AN+E+I  +L    V+ E+WGG T  ++ SA     ID LLEAI++ AE++ELKA    LA GI +EA +DKG G VA LLVQSGTL   D +L G  +G+V+ M+D N K I +A P+ PV I GL+ +P++G+  +   DEK  +E++        + R    +  KL N    + E    ++ L++I+K D  GS EA+ G L  +     ++ ++ + +G I+ESD++LA  SK++V+ FNT+  +     A + G+ I+ YNIIY   DE++  L G+L P   E+ +G+VEIRQ+ + S +G IAG  V  G IKR+A  R+ R +  +I   ++ SL+  KD +     G ECG  L+NFND  EGD +E +EIV
  S:   389 ITVAELAHKMAVKAVEVIKTLMKMGMMVTINQVLDQETALIVVEEMGHIGKAAQADDPEAYLDVTDGETVEVVEQPRSPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGMITFLDTPGHEAFTAMRARGAKATDIVVLVVAADDGVMPQTIEAIHHAKAAKVPMVVAVNKIDKQGANVERIRQELVAHEVVPEDWGGDTQFVEVSAKMGLNIDALLEAILLQAEVLELKAPVDSLAKGIIVEARLDKGRGPVATLLVQSGTLKKGDVVLAGTAFGRVRAMMDENGKAIDSAGPAIPVEILGLSDVPQAGEDAMALADEKKAREIALFRAGKFRDVRLAKQQAAKLENMFAQMAEGE--VQTLSIIIKADVQGSYEALAGSLQKLSTEEVRVAILHSGVGGISESDVNLAIASKAIVIGFNTRADAAARKLAENEGVDIRYYNIIYDAVDEVKAALSGMLAPEKKEQILGTVEIRQVITVSKVGNIAGCMVTDGMIKRSASIRLIR-NHVVIHTGELESLKRFKDDVKEVKQGYECGLMLKNFNDIQEGDQLEAFEIV 958
>gi|168184624|ref|ZP_02619288.1| translation initiation factor IF-2 [Clostridium botulinum Bf] >gi|182672281|gb|EDT84242.1| translation initiation factor IF-2 [Clostridium botulinum Bf] (688 aa)
Score = 1125, Expect = 1.0e-120, Identities = 262/604 (43%), Positives = 389/604 (64%)
  Q:     9 VKTKSKNKNKKIVDNRTN--IDIKSQFKKVETGIKNGVFVFTNN-LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T +KN  K+ ++N+ +   D K +    E     G+   T++ +T+ E S K+ K  AE+IK L L G+  ++N  ++     +L  +F  +  KE +  E++  D +K  + E+ L KR PI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     ITF DTPGH AF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI H   A  P+IV INK+D+  ANI+K+  +L E  ++ E+WGG T+ +  SA   +GID+LLE I++++EI+ELKANP R A G  +EA +DKG GAVA LL+Q+GTL V D I+VG  YG+++ M +   + IK+A PSTPV I GL+ +P++GDK+    DEK  + +++KR+         +T +  L +    + E +  +KEL +I+K D  GS+EA+K  L  +     K+ ++   +G+INE+D+ LA  S  +++ FN +  +     +   G+ IK Y +IY   ++I+  + G+L+P F E  IG+ E+RQ++  SS+G IAG  V TG++ RNA AR+ R D  +I  +++ SL+  KD     A G ECG ++E FND  EGDI+E +
  S:    67 IETTAKNPIKESINNKKSNKRDDKKEKVNTENAEDMGIITMTSDTITVKEISDKLEKSYAEVIKELMLMGVMASVNQEINFEMAEKLAAKFDMEILKEDEDEEEDLEDILKDNEEEEHLQKRSPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVELNGEAITFLDTPGHAAFTAMRARGAQVTDIVILVVAADDGIMPQTQEAISHCKAANVPLIVAINKIDRPGANIDKVKQELTEYGLVAEDWGGDTICVPVSAHTKEGIDDLLEMILLSSEILELKANPNRKAKGTVVEAKLDKGRGAVATLLIQNGTLRVGDSIVVGSTYGRIRAMFNDKGRNIKSAGPSTPVEILGLSEVPEAGDKFYQVKDEKTARGIADKRKEKIRDEYLQSTHKVSLEDLYNQIQEGT--VKELGLIVKADVQGSVEALKQSLEKLSTEEVKVRVIHGGVGAINETDVTLATASNGIILGFNVRPDNNAIIASERDGVDIKTYRVIYDAIEDIKSAMLGMLEPEFKEVVIGTAEVRQVYKISSVGTIAGAYVQTGKLARNAGARVIR-DGIVIFESELASLKRFKDDAKEVAQGYECGLSIEKFNDIKEGDIIECF 678
>gi|139473257|ref|YP_001127972.1| translation initiation factor IF-2 [Streptococcus pyogenes str. Manfredo] >gi|166198935|sp|A2RD01|IF2_STRPG Translation initiation factor IF-2 >gi|134271503|emb|CAM29724.1| translation initiation factor IF-2 [Streptococcus pyogenes str. Manfredo] (953 aa)
Score = 1124, Expect = 1.3e-120, Identities = 250/568 (44%), Positives = 372/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K ++++++   + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   371 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKVLGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 945
>gi|94994918|ref|YP_603016.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS10750] >gi|122986821|sp|Q1J5B4|IF2_STRPF Translation initiation factor IF-2 >gi|94548426|gb|ABF38472.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Streptococcus pyogenes MGAS10750] (953 aa)
Score = 1124, Expect = 1.3e-120, Identities = 250/568 (44%), Positives = 372/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K ++++++   + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   371 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKVLGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 945
>gi|118617682|ref|YP_906014.1| translation initiation factor IF-2 [Mycobacterium ulcerans Agy99] >gi|166232562|sp|A0PQC4|IF2_MYCUA Translation initiation factor IF-2 >gi|118569792|gb|ABL04543.1| translation initiation factor IF-2 InfB [Mycobacterium ulcerans Agy99] (945 aa)
Score = 1124, Expect = 1.4e-120, Identities = 248/564 (43%), Positives = 371/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI----NEDNFL----DNIKFEDR--EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KIN + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+    +ED  L    D    ED   E  L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV    +  + LITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ E++GG TM +  SA     I+ L EA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +LVQ GTL V D ++ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN G++EA++  L  IEV     L ++   +G I E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE+ L+G+L P++ E E+G  EIR L+  S +G+IAG  + +G ++RNA AR+ R +  ++ N  I SLR  KD +     G ECG TL  ++D  EGD +E YE+V
  S:   361 SLSDFADKINANPAALVQALF------NLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRELLESFDLTYGEDSGDESELQTRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVSVDHDGTERLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVAEDFGGDTMFVDISAKQGTNIEALEEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLVQRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQ----LNLILKGDNAGTVEALEEALMGIEVDDEVALRVIDRGVGGITETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSVIYQAIDEIEKALRGMLKPIYEEVELGRAEIRALFRSSKVGLIAGCMISSGVVRRNAKARLLRDNIVVVENLSIRSLRREKDDVTEVREGFECGMTL-GYSDLKEGDFIESYELV 940
>gi|124211|sp|P18311|IF2_ENTFC Translation initiation factor IF-2 >gi|153661|gb|AAA26900.1| translational initiation factor IF2 (784 aa)
Score = 1124, Expect = 1.4e-120, Identities = 257/567 (45%), Positives = 371/567 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMV-DFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVE 610
           V  +T  + + + +KKI++  AEIIK LF+ G+  N N  LD+  +  L  ++G + +++IQ++     D  KF + E+L    L  RPP+VTIMGHVDHGKTTLLDT+R S+V + EAG ITQ IGAYQ++     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN + +  +L+E  ++ E WGG+T+ ++ SA   Q IDELLE I++ AE+ +LKA+PK+ A G  IEA +DKG+G V  LLVQ GTL V D I+VG  YG+V+ MV D  R+E K+A P+TPV I+GLN +P++GD+++V  DEK  +   E+R        +  T +  L N   +L E    +KE+NVI+K D  GS EA+   L  I+V G ++ +V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ + IIY+  +EIE  +KG+LDP F EK  G + +R+ +  S +G IAG  V  G I+R++  R+ R D  +I   ++ SL+  KD +     G ECG  +E FND    D++E
  S:   202 VLEYTEGMNVADIAKKIHREPAEIIKKLFMLGVMVNQNQALDKDTIELLATDYGMEPQEKIQVD---IADIDKFFEPEELNPDTLVSRPPVVTIMGHVDHGKTTLLDTLRHSRVTSGEAGGITQHIGAYQIDIDGKPITFLDTPGHAAFTSMRARGASITDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKIDKPGANPQHVMQELSEYELIPEAWGGETIFVEISAKFGQNIDELLEMILLVAEVEDLKADPKQRAIGTVIEARLDKGKGPVTTLLVQQGTLNVGDPIVVGNTYGRVRVMVNDLGRRE-KSAGPATPVEITGLNDVPQAGDRFVVFEDEKTARAAGEERAKRALLEHRAITSRVTLDNLFESLKEGE--LKEVNVIIKADVQGSAEALAASLQKIDVEGVRVKIVHSAVGAINESDVTLAAASNAIIIGFNVRPTPQAKIQADNEEVDIRLHRIIYKAIEEIETAMKGMLDPEFEEKITGQMIVRETFKVSKVGTIAGAYVTEGYIRRDSGVRVIR-DGIVIYEGQLASLKRFKDDVKEVKMGYECGAMIEKFNDIKVDDVIE 774
>gi|28493124|ref|NP_787285.1| translation initiation factor IF-2 [Tropheryma whipplei str. Twist] >gi|39931267|sp|Q83GT8|IF2_TROWT Translation initiation factor IF-2 >gi|28476164|gb|AAO44254.1| translation initiation factor IF-2 [Tropheryma whipplei str. Twist] (803 aa)
Score = 1124, Expect = 1.4e-120, Identities = 249/564 (44%), Positives = 363/564 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-----NFLDNIKFEDREDL---LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL--SNFGTNLNENSQGIKE-----LNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KI+   A ++  LF  G        LDE     L  E GY  +     +ED     +F  N+  E  ED    L  RPP+VTIMGHVDHGKT LLDTIR +   A E+G ITQ IGAYQV      +TF DTPGHEAF+ MRA GA +TDI VLVVAADDG+ PQT EA+DHA  A  PI+V +NK+DK+ AN  KI  Q+ E +V+ EE+GG  M I  SA   QG+D LLEAI++TA+  +EL+ANP R A G+TIEA +D G GAVA +LVQSGTL V D ++ G  YG+V+ MVD N   +++A PS PVR+ GL+ +PK+GD +IV  +++  ++++EKR+ N +  +L  S    +L + ++ I+E     LN+I+K D +G++EA++  LS ++V     L ++   +G+I ESD++LA    ++V+ FN +   K  D A   G+ ++ Y++IY   ++IE+ LKG+L P   E+++G   +++++  S +G IAG  V +G I RNA AR+ R    ++++  + SLR  KD +    +G ECG  L + +D   GD +E  +IV
  S:   218 SVTDFAEKIDVLPANLLSVLFHLGEMATATESLDEATFEILAEEIGYKVQIVSPDDEDRALLESFSVNLAAEHAEDSELDLAIRPPVVTIMGHVDHGKTLLLDTIRNTNTLAEESGGITQHIGAYQVSVGDRFVTFIDTPGHEAFTAMRARGAKVTDIAVLVVAADDGIMPQTIEALDHARSADVPIVVAVNKIDKEGANPAKIRQQMTEFDVIPEEYGGDVMFIDISAKTGQGVDALLEAILLTADAALELRANPDRTARGVTIEAKLDAGRGAVATVLVQSGTLRVGDRVVTGCAYGRVRAMVDENGLPVESAPPSRPVRVQGLSSVPKAGDSFIVVAEDRQARQIAEKREANERNAQLAKSRKRVSLEDFTRAIQEGRVQSLNMIIKGDVSGAVEALEESLSKLDVGEEVSLRIIHRGVGAITESDVNLATVDNAVVIGFNVRPDRKARDRAAREGVDVRFYSVIYDAIEDIEKSLKGLLKPELEERKLGLAIVKEVFHSSRVGTIAGCSVESGSITRNAKARLIRDGVVVVNDLTVTSLRRFKDDVTEVKSGFECGVGLGSCDDIRIGDEIETIQIV 798
>gi|146319500|ref|YP_001199212.1| translation initiation factor IF-2 [Streptococcus suis 05ZYH33] >gi|146321695|ref|YP_001201406.1| translation initiation factor IF-2 [Streptococcus suis 98HAH33] >gi|166198936|sp|A4W3R7|IF2_STRS2 Translation initiation factor IF-2 >gi|166198938|sp|A4VXH3|IF2_STRSY Translation initiation factor IF-2 >gi|145690306|gb|ABP90812.1| Translation initiation factor 2 (IF-2; GTPase) [Streptococcus suis 05ZYH33] >gi|145692501|gb|ABP93006.1| Translation initiation factor 2 (IF-2; GTPase) [Streptococcus suis 98HAH33] (940 aa)
Score = 1124, Expect = 1.5e-120, Identities = 255/568 (44%), Positives = 367/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LFL G+    N  LD   +  L +++G + K++++++    + F     + + E++ + RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TD+ +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG++  ++ SA  NQ IDELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +KTA PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESDI LA  S +LV+ FN + +++    A +  + ++ ++IIY++ +E+E  +KG+LDP + EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  ++ + K+ SL+  KD +      +E G  +EN+ND    D +E Y
  S:   359 FEYTAGMTVAEIAKRIKREPAEIVKKLFLMGVMATQNQSLDGDTIELLMVDYGIEAKEKVEVDNADIERFFVEEGYLNEEEMTE-RPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDLTILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVISTAWGGESEFVEISAKFNQNIDELLETVLLVAEIQELKADPTVRAIGTVIEAHLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKTAGPSTPVSITGLNETPMAGDHFAVYEDEKSARAAGEERAKRALLKQRQATQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALASSLQKIEVEGVRVNIVHSAVGAINESDITLAEASNALVIGFNVRPTAEARSQAEADDVEVRLHSIIYKVIEEMEDAMKGMLDPEYEEKIIGEAIIRETFKVSKVGTIGGFMVVRGKVTRDSSVRVIR-DGVVVFDGKLASLKRYKDDVKEVGNAQEGGLMIENYNDLKVDDTIEAY 933
>gi|30248765|ref|NP_840835.1| translation initiation factor IF-2 [Nitrosomonas europaea ATCC 19718] >gi|39931260|sp|Q82WD0|IF2_NITEU Translation initiation factor IF-2 >gi|30180360|emb|CAD84672.1| putative translation initiation factor protein [Nitrosomonas europaea ATCC 19718] (889 aa)
Score = 1123, Expect = 1.5e-120, Identities = 243/565 (43%), Positives = 357/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQG----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +++   ++K+   +AE+IK L   G    +N +LD+     +  E G+  K     N ++FL+ +     E  ++ R P+VT+MGHVDHGKT+LLD IR+++VA  EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI HA  A  PI+V +NKMDK +AN ++I  +L    V+ E+WGG  M I  SA    GIDELLEA+++ AE++ELKA  +  A G+ IE+ +DKG G VA +LVQSGTL   D +L G  +GK++ M++   K I  A  S PV I GL+ +  +G+ +I  +DE+  +E++  RQ   +  +L        E+  G    +  LN+I+K D  GS EA+   L  +E    K+N+V + +G+I ESDI+LA  SK++V+ FN +          S G+ ++ YNIIY+  DE+++ L G++ P   EK +G V+IR+++  S +GV+AG  VL G IKR+A  R+ R D  +I +  ++SL+  K+ +    +G ECG +L+NFND  +GD +E+YEIV
  S:   316 ISVGALAQKMAVKAAEVIKVLMKMGSMVTINQMLDQETAMVVVEEMGHIAKIAASDNPESFLEEVDVSSDEARMEPRAPVVTVMGHVDHGKTSLLDYIRRTRVAGGEAGGITQHIGAYHVETSRGVITFLDTPGHEAFTAMRARGAKITDIVILVVAADDGVMPQTIEAIHHAKAANIPIVVAVNKMDKPEANFDRIKQELVNHGVVPEDWGGDAMFIGVSAKTGLGIDELLEAVLLQAEVLELKAVREAPAKGVVIESRLDKGRGPVATVLVQSGTLRRGDAVLTGAVFGKIRAMLNERGKSISEASTSIPVEIQGLSEVAVAGEVFIALDDERKAREIALFRQGKFRDVRLDKLQVAKMEDVFGQHEDVSTLNLIIKADVQGSCEALVYALKKLETDEVKINVVHSGVGAIIESDINLALASKAVVIGFNCRADLGARKLITSTGVDVRYYNIIYEAVDEVKKALSGMMMPDRKEKILGMVDIREIYRISKVGVVAGCYVLEGLIKRDALVRLLR-DGLVIHSGSLDSLKRFKEDVREVKSGFECGLSLKNFNDIQQGDQIEVYEIV 883
>gi|153939095|ref|YP_001391716.1| translation initiation factor IF-2 [Clostridium botulinum F str. Langeland] >gi|166226272|sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2 >gi|152934991|gb|ABS40489.1| translation initiation factor IF-2 [Clostridium botulinum F str. Langeland] (688 aa)
Score = 1123, Expect = 1.8e-120, Identities = 265/604 (43%), Positives = 390/604 (64%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFT---NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-SNFGTNL----NENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T +KN  K+ ++N+ +     + +KV T     + + T   + +T+ E S K+ K  AE+IK L L G+  ++N  ++     +L  +F  +  KE Q  ED+  D +K  + E+ L KR PI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     ITF DTPGH AF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI H   A+ P+IV INK+D+  ANI+K+  +L E  ++ E+WGG T+ +  SA   +GIDELLE I++++EI+ELKANP R A G  +EA +DKG G VA LLVQ+GTL V D I+VG  YG+++ M +   + I++A PSTPV I GL+ +P++GDK+    DEK  + +++KR+   +   L S    +L    N+  +G +KEL +I+K D  GS+EA+K  L  +     K+ ++   +G+INE+D+ LA  S  +++ FN +  +     +   G+ IK Y +IY   ++I+  + G+L+P F E  IG+ E+RQ++  SS+G IAG  V TG++ RNA AR+ R D  +I  +++ SL+  KD     A G ECG ++E FND  EGDI+E +
  S:    67 IETTAKNPIKESINNKKSNKRDDKNEKVNTENAEDMAIITMTSDTITVKEISDKLEKSYAEVIKELMLMGVMASVNQEINFEMAEKLAAKFDTEILKEEQDEEDDLEDILKDSEEEENLQKRSPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVELNGESITFLDTPGHAAFTAMRARGAQVTDIVILVVAADDGIMPQTKEAISHCKAAEVPLIVAINKIDRPGANIDKVKQELTEYGLVAEDWGGDTVCVPVSAHTKEGIDELLEMILLSSEILELKANPNRKAKGTVVEAKLDKGRGPVATLLVQNGTLTVGDSIVVGSTYGRIRAMFNDKGENIQSAGPSTPVGILGLSEVPEAGDKFYQVKDEKTARGIADKRKEKIRDEYLQSTHKVSLEDLYNQIREGKVKELGLIVKADVQGSVEALKQSLEKLSTEEVKVRVIHGGVGAINETDVTLATASNGIILGFNVRPDNNAIIASERDGVDIKTYRVIYDAIEDIKSAMLGMLEPEFKEVVIGTAEVRQVYKISSVGTIAGAYVQTGKLARNAGARVIR-DGIVIFESELASLKRFKDDAKEVAQGYECGLSIEKFNDIKEGDIIECF 678
>gi|39996688|ref|NP_952639.1| translation initiation factor IF-2 [Geobacter sulfurreducens PCA] >gi|81832046|sp|Q74CT3|IF2_GEOSL Translation initiation factor IF-2 >gi|39983569|gb|AAR34962.1| translation initiation factor IF-2 [Geobacter sulfurreducens PCA] (883 aa)
Score = 1122, Expect = 2.0e-120, Identities = 244/608 (40%), Positives = 377/608 (62%)
  Q:     7 KNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K  K K + ++   +  +T I +    K++   IK      + ++T+ E +K++   + ++I+ L   G+   +N  LD      +  EFGY+ +  + I+ D  L+++   D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA++H+  A  PIIV INK+DK +A  E++  +L E  ++ EEWGG+T+ ++ SA     + ELLE +++ A++M+LKANP + A G  +EA +D+G G VA +LVQ GTL + DY + G   G+V+ M +    ++  A PS PV + G  G+P +GD +I   DEK  KE++  RQ   ++ +L+         L +  Q   +K+LN I+K D  GS+EA+   L  +     +LN++ +++G+I E+D++LA  S ++++ FN +   K S +A   G+ I+ YNIIY   ++I++ ++G+L+P   EK +G  E+R+++S   +G +AG  +  G++ RNA  R+ R D  +I   K++SLR  KD +   A G ECG  LEN+ND   GD++E +EI
  S:   275 KTGKGKKRERDMVSLGRKTEITVPKAIKRI---IK-----ISESITVGELAKRMGVKATDLIRVLMKMGMMVTINHPLDVDTATLVASEFGYEIEN-VAIDVDEMLESVP--DAPESLTKRPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELNGRKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAVNHSKAAGVPIIVAINKIDKPEAKPERVKQELMEFGLVSEEWGGETIFVEVSAKKRINLPELLEMVLLQADVMDLKANPDKDARGTIVEAKLDRGRGPVATVLVQEGTLKIGDYFVAGVNSGRVRAMQNDRGDKVNEAGPSMPVEVIGFTGVPDAGDVFISLVDEKRAKEIASHRQQKLRETELAKHSKMSLEQLYDKIQKGEVKDLNAIVKADVQGSVEAVSESLRKLSTDAVRLNVIHSSVGAITETDVNLASASNAIILGFNVRPEPKASAHAEKEGVDIRLYNIIYDAVEDIKKAMEGLLEPTLREKYLGRAEVREVFSVPKVGNVAGCYIQDGKMIRNAQVRLLR-DNVVIYEGKMSSLRRFKDDVKEVATGYECGIGLENYNDIKVGDVIEDFEI 876
>gi|15675571|ref|NP_269745.1| translation initiation factor IF-2 [Streptococcus pyogenes M1 GAS] >gi|50914803|ref|YP_060775.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS10394] >gi|71904114|ref|YP_280917.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS6180] >gi|71911222|ref|YP_282772.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS5005] >gi|94989041|ref|YP_597142.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS9429] >gi|94991039|ref|YP_599139.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS10270] >gi|94992932|ref|YP_601031.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS2096] >gi|123080184|sp|Q1JAC1|IF2_STRPB Translation initiation factor IF-2 >gi|123080374|sp|Q1JKH1|IF2_STRPC Translation initiation factor IF-2 >gi|123382402|sp|Q1JFG4|IF2_STRPD Translation initiation factor IF-2 >gi|23821735|sp|Q99YG1|IF2_STRP1 Translation initiation factor IF-2 >gi|68051959|sp|Q5XAH1|IF2_STRP6 Translation initiation factor IF-2 >gi|90101384|sp|Q48RU8|IF2_STRPM Translation initiation factor IF-2 >gi|13622775|gb|AAK34466.1| putative initiation factor 2 [Streptococcus pyogenes M1 GAS] >gi|50903877|gb|AAT87592.1| Translation Initiation Factor 2 [Streptococcus pyogenes MGAS10394] >gi|71803209|gb|AAX72562.1| bacterial protein translation initiation factor 2 (IF-2) [Streptococcus pyogenes MGAS6180] >gi|71854004|gb|AAZ52027.1| bacterial protein translation initiation factor 2 [Streptococcus pyogenes MGAS5005] >gi|94542549|gb|ABF32598.1| bacterial protein translation initiation factor 2 (IF-2) [Streptococcus pyogenes MGAS9429] >gi|94544547|gb|ABF34595.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Streptococcus pyogenes MGAS10270] >gi|94546440|gb|ABF36487.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Streptococcus pyogenes MGAS2096] (953 aa)
Score = 1122, Expect = 2.0e-120, Identities = 250/568 (44%), Positives = 372/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K ++++++   + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   371 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 945
>gi|28895284|ref|NP_801634.1| translation initiation factor IF-2 [Streptococcus pyogenes SSI-1] >gi|44888072|sp|Q8K644|IF2_STRP3 Translation initiation factor IF-2 >gi|28810530|dbj|BAC63467.1| putative initiation factor 2 [Streptococcus pyogenes SSI-1] (953 aa)
Score = 1122, Expect = 2.0e-120, Identities = 250/568 (44%), Positives = 372/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K ++++++   + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   371 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 945
>gi|170759576|ref|YP_001787729.1| translation initiation factor IF-2 [Clostridium botulinum A3 str. Loch Maree] >gi|169406565|gb|ACA54976.1| translation initiation factor IF-2 [Clostridium botulinum A3 str. Loch Maree] (688 aa)
Score = 1122, Expect = 2.0e-120, Identities = 259/604 (42%), Positives = 390/604 (64%)
  Q:     9 VKTKSKNKNKKIVDNRTN--IDIKSQFKKVETGIKNGVFVFTNN-LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T +KN  K+ ++N+ +   D K++    E     G+   T++ +T+ E S K+ K  AE+IK L L G+  ++N  ++     +L  +F  +  KE +  +++  D +K  + E+ L KR PI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     ITF DTPGH AF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI H   A  P+IV INK+D+  ANI+K+  +L E  ++ E+WGG T+ +  SA   +GID+LLE I++++EI+ELKANP R A G  +EA +DKG G VA LL+Q+GTL V D I+VG  YG+++ M +   + I++A PSTPV I GL+ +P++GDK+  T +EK  + +++KR+         +T +  L +    + E +  +KEL +I+K D  GS+EA+K  L  +     K+ ++   +G+INE+D+ LA  S  +++ FN +  +     +   G+ IK Y IIY   ++I+  + G+L+P F E  IG+ E+RQ++  SS+G IAG  + TG++ RNA AR+ R D  +I  +++ SL+  KD     A G ECG ++E FND  EGDI+E +
  S:    67 IETTAKNPIKESMNNKKSNKRDDKNEKVNTENAEDMGIITMTSDTITVKEISDKLEKSYAEVIKELMLMGVMASVNQEINFEMAEKLAAKFDMEILKEDEDEKEDLEDILKDNEEEEYLQKRSPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVELNGEAITFLDTPGHAAFTAMRARGAQVTDIVILVVAADDGIMPQTQEAISHCKAANVPLIVAINKIDRPGANIDKVKQELTEYGLVAEDWGGDTICVPVSAHTKEGIDDLLEMILLSSEILELKANPNRKAKGTVVEAKLDKGRGPVATLLIQNGTLRVGDSIVVGSTYGRIRAMFNDKGRNIESAGPSTPVEILGLSEVPEAGDKFYQTKEEKTARGIADKRKEKIRDEYLQSTHKVSLEDLYNQIQEGT--VKELGLIVKADVQGSVEALKQSLEKLSTEEVKVRVIHGGVGAINETDVTLATASNGIILGFNVRPDNNAIIASERDGVDIKTYRIIYDAIEDIKSAMVGMLEPEFKEVVIGTAEVRQVYKISSVGTIAGAYIQTGKLARNAGARVIR-DGIVIFESELASLKRFKDDAKEVAQGYECGLSIEKFNDIKEGDIIECF 678
>gi|81177041|ref|ZP_00875946.1| Initiation factor 2:Small GTP-binding protein domain [Streptococcus suis 89/1591] >gi|80976259|gb|EAP39887.1| Initiation factor 2:Small GTP-binding protein domain [Streptococcus suis 89/1591] (940 aa)
Score = 1122, Expect = 2.0e-120, Identities = 254/568 (44%), Positives = 368/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LFL G+    N  LD   +  L +++G + K++++++  + ++    E+    E+ + +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TD+ +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG++  ++ SA  NQ IDELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +KTA PSTP+ I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESDI LA  S +LV+ FN + +++    A +  + ++ ++IIY++ +E+E  +KG+LDP + EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  ++ + K+ SL+  KD +      +E G  +EN+ND    D +E Y
  S:   359 FEYTAGMTVAEIAKRIKREPAEIVKKLFLMGVMATQNQSLDGDTIELLMVDYGIEAKEKVEVDNAD-IERFFVEEGYLNEEEMTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDLTILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVISTAWGGESEFVEISAKFNQNIDELLETVLLVAEIQELKADPTVRAIGTVIEAHLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKTAGPSTPISITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALLKQRQATQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALASSLQKIEVEGVRVNIVHSAVGAINESDITLAEASNALVIGFNVRPTAEARSQAEADDVEVRLHSIIYKVIEEMEDAMKGMLDPEYEEKIIGEAIIRETFKVSKVGTIGGFMVVRGKVTRDSSVRVIR-DGVVVFDGKLVSLKRYKDDVKEVGNAQEGGLMIENYNDLKVDDTIEAY 933
>gi|71894696|ref|YP_278804.1| translation initiation factor IF-2 [Mycoplasma synoviae 53] >gi|93204596|sp|Q4A578|IF2_MYCS5 Translation initiation factor IF-2 >gi|71851484|gb|AAZ44093.1| putative translation initiation factor IF-2 [Mycoplasma synoviae 53] (602 aa)
Score = 1120, Expect = 3.5e-120, Identities = 251/599 (41%), Positives = 380/599 (63%)
  Q:    17 NKKIVDNRTNID-IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +KK  + + NID IK+Q +  +T +KNG F FT  ++I EF+ K N ++ EI+K  FL G   N+N +L+E ++ +LC+E  ++F KE +I+  NFLD I FED+ + L KR PI+TIMGHVDHGKT+L+D IR S +  +E+  ITQ  GAYQ+  K   ITF DTPGHEAFS MRA GA++TDIVVLVVAADDG+ PQT EAI H   A  PIIVF+NKMDK + +++K+  QLAE  V+ EE+GG      GSAL N+GI EL + I++  E+++LKANPKR   G  IE+ +DK  GA+  ++VQ+GTL   D++LVG  Y K++ + D N   + +  P  P  ++G    P +G K++  NDEK  K L+ ++    K   L +   + N +  G K +NVI+K+D NG+ EAIK  L  +E   AK+ ++ + +G I E+D+ LA+ S S++  FN KV   + +      IT+ ++N+IY+I ++ + +L   + P++ EK+IG   + +++++S +G IAG    TG ++  A  ++ RK+K +I    + +L+   + +     GK+ G  L++FN+    D++E YE V
  S:     2 SKKKTNRKNNIDDIKNQLQNAKTELKNGTFFFTGKMSIFEFANKTNLNANEIVKNFFLAGKLYNINHILEEEEIAQLCIENNFEFSKETKIDGTNFLDEISFEDKPEDLIKRAPIITIMGHVDHGKTSLIDKIRNSNITKSESSGITQHTGAYQIVHKNQKITFIDTPGHEAFSAMRARGANVTDIVVLVVAADDGVMPQTVEAIKHCKNANVPIIVFVNKMDKPNKDLDKLKGQLAENGVVIEEYGGSVQTAYGSALKNEGIKELFDEILLLCEVLDLKANPKRFPIGTVIESRVDKRIGALTTIIVQNGTLYKGDFLLVGSQYSKIRTLSDENGNAMDSIEPGCPAVVTGFKIPPTAGSKFVGINDEKFAKRLASEKNYQEKINNLYSLSNSNNNSG-GKKVINVIIKSDTNGTAEAIKNQLEYLENDEAKIKVISSNVGDITENDLMLAKASDSIIFTFNLKVLPTIRENLKVKKITLISHNVIYKIIEDCKLILDEHVTPIYEEKKIGQAHVIKIFTYSKLGTIAGSMQDTGVVRLGAKVKVYRKNK-LIHEGFVQTLKRNLNEVKEVEKGKDFGTHLKDFNNIEVDDVLEFYEDV 599
>gi|186685818|ref|YP_001869014.1| translation initiation factor IF-2 [Nostoc punctiforme PCC 73102] >gi|186468270|gb|ACC84071.1| translation initiation factor IF-2 [Nostoc punctiforme PCC 73102] (1056 aa)
Score = 1120, Expect = 3.7e-120, Identities = 248/568 (43%), Positives = 358/568 (63%)
  Q:    48 TNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG---TNLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           T  LT+ E S  +     EI+K LFLKG+  ++   LD   +  +  E   + +  E +       + +  ED+E  L +RPP+VTIMGHVDHGKTTLLD+IRK+KVAA EAG ITQ IGAY V    E K   I F DTPGHEAF+ MRA GA +TDI VLVVAADDG++PQT EAI HA  A  PI+V INK+DK+ A  E++  +L +  +  E+WGG+T+++  SA+  + +D LLE I++ AE+ EL ANP R A G  IEA +DK +GAVA LL+Q+GTL V D ++ G  +GKV+ MVD   K +  A PS  V + GL+ +P +GD++ V  +EK  + L+  R    +  +L       T L+  +Q   +KELN+ILK D  GS+EAI G L  I     ++ ++ A  G I E+DIDLA  S ++++ FNT  +S     A   G+ ++ YN+IY++ ++I+  L+G+L+P  VE+ +G  E+R ++     G +AG  V +G++ RN   R++R  K +I    ++SL+  K+      AG ECG  ++ FND+VEGDI+E Y++V
  S:   472 TGPLTVQELSDVLAVPDTEIVKILFLKGMAVSITQNLDIPTITLVGKELEIEVETVEREAEARKITEMVGAEDQE-YLHRRPPVVTIMGHVDHGKTTLLDSIRKTKVAAGEAGGITQHIGAYHVDVVHEGKPQQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDGVRPQTIEAISHAQAAGVPIVVAINKIDKEGAQPERVKQELTQYGLTAEDWGGETIMVPVSAIRGENLDTLLEMILLVAEVGELSANPDRTAKGTVIEAHLDKAKGAVATLLIQNGTLHVGDILVAGSAFGKVRAMVDDRGKRVDIASPSFAVEVLGLSDVPAAGDEFEVFQNEKEARSLASDRADRQRLSRLLQGRVTLTTLSAQAQEGELKELNLILKGDVQGSVEAIVGALKQIPQNEVQIRMLLATAGEITETDIDLAAASNAVIIGFNTTFASGARQAADEAGVDVREYNVIYKLLEDIQDALEGLLEPELVEEPLGQTEVRAVFPVGR-GAVAGCYVQSGKLVRNCKVRVRRGGK-VIYEGVLDSLKRMKEDAREVNAGYECGVGMDKFNDWVEGDIIESYQMV 1046
>gi|56808094|ref|ZP_00365886.1| COG0532: Translation initiation factor 2 (IF-2; GTPase) [Streptococcus pyogenes M49 591] (953 aa)
Score = 1120, Expect = 4.0e-120, Identities = 250/568 (44%), Positives = 371/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K +++++    + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  IEV G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   371 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDNADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 945
>gi|118594128|ref|ZP_01551475.1| translation initiation factor IF-2 [Methylophilales bacterium HTCC2181] >gi|118439906|gb|EAV46533.1| translation initiation factor IF-2 [Methylophilales bacterium HTCC2181] (816 aa)
Score = 1119, Expect = 4.6e-120, Identities = 260/604 (43%), Positives = 386/604 (63%)
  Q:    12 KSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNI-KFEDR-EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ-----LNTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           KS+NK+K       N+D +S F      +   + V    +++ + + K++  + E+IK L   G+   +N +LD+        E G+    + Q  EDN  +++   ED  E +L+ RPP+VT+MGHVDHGKT+LLD IR +KVA+ EAG ITQ IGAY VE  K +ITF DTPGHEAFS MRA GA  TDIVVL VA+DDG+ PQT EAI+H+  A+ P+IV INKMDK +AN EK+ S+L    V+ EE GG  + ++ SA   QGID+LL++I++ AEI+ELKA+    A GI +E  +DKG G V  LLVQSG L+  D IL G  +G+V+ M+D + K+++ A PS PV + GL+ +P +G+++IV NDEK  +E++  RQ     +   +++ S      ++ ++G IK L +I+K+D  GS EA+ G L  +     K+N++ +A+G +NESDI+LA  S ++V+ FN +        A S+ + ++ Y+IIY+  DE++  L G+L P   E  +G VEIR+++  S IG IAG  VL G I++N+  R+ R D  +I + +++SL+  KD I    +  ECG +++NFND   GD +E+YEIV
  S:   212 KSRNKHK-------NVDPESSFVAPTEFVSKEILV-PETISVADLAHKMSVKAGEVIKVLMGMGMMVTINQVLDQDTAMIAVEEMGH----QPQAAEDNDPESLLNIEDLVEPILEARPPVVTVMGHVDHGKTSLLDYIRTAKVASAEAGGITQHIGAYHVETSKGMITFLDTPGHEAFSAMRARGAKATDIVVLAVASDDGVMPQTIEAINHSKAAEVPMIVAINKMDKPEANPEKVKSELLTHEVIPEELGGDAIFVEVSAKTGQGIDDLLDSILLQAEILELKASKNTPARGIVVEGRLDKGRGPVTTLLVQSGILSPGDTILAGSAFGRVRAMIDESGKKVEEAGPSIPVEVIGLSDVPNAGEEFIVINDEKKAREVALFRQGKFRDVKFAKQQASKLENIFDQMAEGEIKVLPLIIKSDVQGSYEALAGSLGKLSTDEVKVNVIHSAVGPVNESDINLATASNAVVLAFNVRADGGARKLADSLEVDVRYYSIIYEAVDEVKAALSGMLSPEKRENILGLVEIREIFKASKIGTIAGCYVLEGLIRKNSKIRLLR-DSVVIYDGELDSLKRFKDDIKEVKSNFECGLSIKNFNDMQAGDQIEVYEIV 810
>gi|78184169|ref|YP_376604.1| translation initiation factor IF-2 [Synechococcus sp. CC9902] >gi|123770973|sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 >gi|78168463|gb|ABB25560.1| bacterial translation initiation factor 2 (bIF-2) [Synechococcus sp. CC9902] (1176 aa)
Score = 1119, Expect = 4.6e-120, Identities = 231/574 (40%), Positives = 366/574 (63%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KG+   +   LD   +  +  EF     + +++      ++ I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IR+++VAA EAG ITQ IGAYQVE +       +TF DTPGH AF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A+ +++  +L+E+N+L EEWGG  +++  SA+  + ID+LLE +++  E+ +L+ANP R A G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD NR+ +K A PS  V   G + +P +GD++ V  DEK  + +   R  N +          R++S    +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S ++++ FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  +E+ +G  E+R +++      +AG  V TG++ RN   R+ R  K+++    ++SLR  KD +   A G ECG   + F ++ EGD +E +++V +
  S:   586 IVVPEDNLTVQELADMLSIESSEIIKSLFFKGVIATVTQTLDMPTIEAVAKEFDVPVLQDDVEEAAKKTVEMIEEADLKHLI-RRPPVVTVMGHVDHGKTSLLDAIRQARVAAGEAGGITQHIGAYQVEIQHKDEARKLTFLDTPGHAAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASADRVKQELSEQNLLAEEWGGDVVMVPVSAIKGENIDKLLEMLLLVTEVEDLQANPDRPARGTVIEAHLDKAKGPVATLLIQNGTLKTGDVLAAGPVLGKVRAMVDDNRQRLKEAGPSFAVEALGFSEVPTAGDEFEVYPDEKAARAVVGDRASNARATRLAQQMASRRVSLTAMSGQANEGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIIGFNTSMASGAKKAADATGVDVRDYDVIYKLLEDIQLAMEGLLEPELIEEALGEAEVRAVFTIGK-SAVAGCYVNTGKLHRNCRVRVHR-GKQVVYTGDLDSLRRNKDDVKEVATGFECGVGADRFANWEEGDRIEAFKMVTQ 1170
>gi|19746623|ref|NP_607759.1| translation initiation factor IF-2 [Streptococcus pyogenes MGAS8232] >gi|23821723|sp|Q8NZU7|IF2_STRP8 Translation initiation factor IF-2 >gi|19748842|gb|AAL98258.1| putative initiation factor 2 [Streptococcus pyogenes MGAS8232] (953 aa)
Score = 1119, Expect = 4.7e-120, Identities = 249/568 (43%), Positives = 372/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K ++++++   + F ++  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ ++LAE  ++   WGG +  ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GA+A LLVQ GTL V D I+VG  +G+V+ MV+   + +K+A PSTPV I+GLN  P +GD + V  DEK  +   E+R        + NT++  L N    L      IK +NVI+K D  GS+EA+   L  I+V G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDPV+ EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +ENFND    D +E Y
  S:   371 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGDSEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLVKIDVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAY 945
>gi|182417581|ref|ZP_02948905.1| translation initiation factor IF-2 [Clostridium butyricum 5521] >gi|182378594|gb|EDT76122.1| translation initiation factor IF-2 [Clostridium butyricum 5521] (697 aa)
Score = 1119, Expect = 5.4e-120, Identities = 254/563 (45%), Positives = 370/563 (65%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRK-LSNFGTNL----NENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T+ E ++K+NK S ++I+ L + G+   +N  +D     ++C E+    +++ +  E   L+    ED E+ L KRPPIVT+MGHVDHGKT+LLD IRK+KV  +EAG ITQ IGAY +      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT+EAIDH   A  P++V INK+DK  AN +++  +LA+  +L E WGG  +  + SA  N  ID+LLE ++++AE++ELKANP R A G  IEA +DKG GAVA LLVQ+GTL V D ILVG  YG+++ M D   K+IK+A PS PV I GL+ +P++GD++    DEK  + ++E ++ + K    L+N   +L    N+  +G +KEL +I+K D  GS+EAIK  L+ +     K+ ++   +G+I E+DI LA  S +LV+ FN +  +  +  A   G+ IK Y IIY   ++I+  + G+L+P + E  +G+ E+R+ +  S++G IAG  VL G++KRNA  R+ R D  +I  + ++SL+  KD     AAG ECG T+E FND  EGDI+E +
  S:   122 SITVKELAEKLNKPSNDVIRTLIMSGVMAAINQEIDFATAEKVCAEYEVMVERKEESQELEVLE--IEEDDEENLQKRPPIVTVMGHVDHGKTSLLDCIRKAKVTDSEAGGITQHIGAYTITLNGEEITFLDTPGHEAFTAMRARGAQVTDIVILVVAADDGIMPQTKEAIDHCKAAGVPMVVAINKIDKPGANPDRVKQELADHGLLVESWGGDVISEEVSAKQNLNIDKLLEMVLLSAEMLELKANPNRKAVGTVIEAKLDKGRGAVASLLVQNGTLHVGDSILVGSTYGRIRAMFDDTGKKIKSAGPSIPVEILGLSEVPEAGDRFNQVKDEKTARNMAESKKDDLKAETLLANHRVSLEDLYNQIQEGKVKELAIIVKADVQGSVEAIKQSLAKLSTDDVKVRVIHGGVGAITETDITLATASNALVIGFNVRPDNNAAAQADKDGVDIKTYRIIYDAIEDIKSAMIGMLEPEYKEVILGTAEVRETYKISNVGTIAGCYVLKGKLKRNAETRVIR-DGIVIFESSLSSLKRFKDDAKEVAAGYECGLTVEKFNDIKEGDILECF 687
>gi|148992334|ref|ZP_01822057.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP9-BS68] >gi|148998229|ref|ZP_01825698.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP11-BS70] >gi|168576542|ref|ZP_02722416.1| translation initiation factor IF-2 [Streptococcus pneumoniae MLV-016] >gi|147755872|gb|EDK62916.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP11-BS70] >gi|147928960|gb|EDK79972.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP9-BS68] >gi|183577694|gb|EDT98222.1| translation initiation factor IF-2 [Streptococcus pneumoniae MLV-016] (930 aa)
Score = 1119, Expect = 5.5e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|91774423|ref|YP_544179.1| translation initiation factor 2 [Methylobacillus flagellatus KT] >gi|123078692|sp|Q1GXD6|IF2_METFK Translation initiation factor IF-2 >gi|91708410|gb|ABE48338.1| bacterial translation initiation factor 2 (bIF-2) [Methylobacillus flagellatus KT] (907 aa)
Score = 1119, Expect = 5.5e-120, Identities = 249/610 (40%), Positives = 381/610 (62%)
  Q:     6 AKNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           AK  K+KSKN          N + +  F      I + V V    +T+ + + K+   ++E+IK L   G+   +N +LD+     +  E G++ K     + + FLD  + E  E + + RPP+VT+MGHVDHGKT+LLD IR+S+VA+ EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TD+V+LVVAADDG+ PQT EA+ HA  A  PI+V +NK+DK +AN E++  +L    V+ E+WGG TM ++ SA    GID LLEA+++ AE++ELKA     A G+ IE  +DKG G V+ +LVQSGTL   D IL G  YG+V+ M+D + +++K A PS PV I GL+ +P +G++ IV NDE+  +E++  RQ   +  KL     +   +   +  +G +K L++I+K+D  GS EA+   L  +     K+N++   +G+I+ESD++LA  SK++++ FN +  +       S G+ ++ YNIIY+  DE++  L G+L P   E  IG+VEIR+++  S +G +AG  V  G ++RN+  R+ R D  +I   +++SL+  KD +    +  ECG +L+N+N+   GDI+E++E+V
  S:   300 AKGSKSKSKN----------NENQQHAFTAPTEPIVHDVLV-PETITVGDLAHKMAVKASEVIKTLMKMGMMVTINQVLDQETAIIIVEEMGHNAKAAASNDPEAFLD--EAEHAEAVQEPRPPVVTVMGHVDHGKTSLLDYIRRSRVASGEAGGITQHIGAYHVETPRGMVTFLDTPGHEAFTAMRARGAKATDVVILVVAADDGVMPQTIEAVHHAKAANVPIVVAVNKIDKPEANPERVKQELVSHEVVPEDWGGDTMFVEVSAKTGAGIDNLLEAVLLQAEVLELKAPKNIPAKGLVIEGRLDKGRGPVSTILVQSGTLQRGDMILAGTAYGRVRAMLDESGRDVKEAGPSIPVEILGLSDVPSAGEEVIVLNDERKAREIALFRQGKFRDVKLAKQQAAKLESMFEQMGEGEVKVLHLIIKSDVQGSYEALSTSLQKLSTDEVKVNIIHTGVGAISESDVNLAAASKAVLIGFNVRADAGARKLIESTGVDVRYYNIIYEAVDEVKAALGGMLSPEQKENVIGTVEIREVFRISKVGSVAGCYVQDGVVRRNSKVRLIR-DNVVIHTGELDSLKRFKDDVKEVKSNFECGLSLKNYNEIEVGDILEVFEVV 901
>gi|168485667|ref|ZP_02710175.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC1087-00] >gi|183571246|gb|EDT91774.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC1087-00] (920 aa)
Score = 1118, Expect = 5.6e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   339 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 913
>gi|149021511|ref|ZP_01835566.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP23-BS72] >gi|147930207|gb|EDK81192.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP23-BS72] (930 aa)
Score = 1118, Expect = 5.8e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|148983934|ref|ZP_01817253.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP3-BS71] >gi|168488247|ref|ZP_02712446.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP195] >gi|168492713|ref|ZP_02716856.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC3059-06] >gi|147924081|gb|EDK75193.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP3-BS71] >gi|183572921|gb|EDT93449.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP195] >gi|183576984|gb|EDT97512.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC3059-06] (930 aa)
Score = 1118, Expect = 5.9e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|149005666|ref|ZP_01829405.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP18-BS74] >gi|182683489|ref|YP_001835236.1| translation initiation factor IF-2 [Streptococcus pneumoniae CGSP14] >gi|147762606|gb|EDK69566.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP18-BS74] >gi|182628823|gb|ACB89771.1| translation initiation factor IF-2 [Streptococcus pneumoniae CGSP14] (930 aa)
Score = 1118, Expect = 5.9e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|15902525|ref|NP_358075.1| translation initiation factor IF-2 [Streptococcus pneumoniae R6] >gi|116516588|ref|YP_815988.1| translation initiation factor IF-2 [Streptococcus pneumoniae D39] >gi|168482796|ref|ZP_02707748.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC1873-00] >gi|168490554|ref|ZP_02714697.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC0288-04] >gi|122279126|sp|Q04LW0|IF2_STRP2 Translation initiation factor IF-2 >gi|39931285|sp|Q8DQV2|IF2_STRR6 Translation initiation factor IF-2 >gi|15458051|gb|AAK99285.1| Initiation factor IF2 [Streptococcus pneumoniae R6] >gi|116077164|gb|ABJ54884.1| initiation factor IF-2 [Streptococcus pneumoniae D39] >gi|172043836|gb|EDT51882.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC1873-00] >gi|183575032|gb|EDT95560.1| translation initiation factor IF-2 [Streptococcus pneumoniae CDC0288-04] (930 aa)
Score = 1118, Expect = 5.9e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|194398729|ref|YP_002037217.1| translation initiation factor IF-2 [Streptococcus pneumoniae G54] >gi|194358396|gb|ACF56844.1| translation initiation factor IF-2 [Streptococcus pneumoniae G54] (930 aa)
Score = 1118, Expect = 6.8e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|149002227|ref|ZP_01827169.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP14-BS69] >gi|147759542|gb|EDK66533.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP14-BS69] (930 aa)
Score = 1118, Expect = 6.8e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|124022123|ref|YP_001016430.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9303] >gi|166232573|sp|A2C6Q5|IF2_PROM3 Translation initiation factor IF-2 >gi|123962409|gb|ABM77165.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9303] (1124 aa)
Score = 1118, Expect = 6.9e-120, Identities = 237/566 (41%), Positives = 364/566 (64%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +I+       + I+  D   L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE     +   ITF DTPGH+AF+ MRA G  +TDI VLVVAADDG++PQT EAI HA  AK PIIV INK DK+ A+ E++  +L+++N+L EEWGG  +++  SA+  + ID+LLE I++  E+ +L+ANP RLA G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD +   +K A P+  V   G + +P +GD++ V  DEK  + +  +R  + +  +L+        +      + S G +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  + TG+++RN   R++R  K+++    ++SLR  KD +   A G ECG   + F ++ E DI+E +++V
  S:   539 NLTVQELADMLSIESSEIIKSLFFKGITATVTQSLDLPTIEAVAEEFGVPVLQDDIEEAAKKTTEMIEETDLAHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAVEAGGITQHIGAYQVEIDHGGQPRKITFLDTPGHQAFTAMRARGTKVTDIAVLVVAADDGVRPQTLEAISHARAAKVPIIVAINKTDKEGASPERVKQELSDQNLLSEEWGGDVVMVPVSAIKGENIDKLLEMILLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLIQNGTLKTGDVLAAGPVLGKVRAMVDDSGARLKQAGPADAVEALGFSEVPTAGDEFEVYPDEKSARAVVGERASDARATRLAQQMASRRVSLAAMSGQASDGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGAKRAADATGVDVRDYDVIYKLLEDIQMAMEGLLEPELVEESLGEAEVRAVFTIGK-SAVAGCYITTGKLQRNCRVRVRRA-KQVVFEGDLDSLRRNKDDVKEVATGFECGIGCDRFANWEERDIIEAHKLV 1115
>gi|114566433|ref|YP_753587.1| translation initiation factor IF-2 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122318495|sp|Q0AYI8|IF2_SYNWW Translation initiation factor IF-2 >gi|114337368|gb|ABI68216.1| bacterial translation initiation factor 2 (bIF-2) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (882 aa)
Score = 1118, Expect = 6.9e-120, Identities = 248/565 (43%), Positives = 367/565 (64%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKE-----LSEKR---QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ + + ++K+NK+ AEI+K L   GI   +N  +D  +  E+     YD K E +++E+   L+ +   D +  L  RPP+VTIMGHVDHGKT+LLD IR++ V + EAG ITQ IGAYQV  K + ITF DTPGHEAF+ MRA GA+LTDIV+LVVAADDG+ PQT EAI+H   AK P +V INK+DK  A+ E+I  QL E N++ EEWGG T+ +  SA + +GI+ LLE I++ AE+ E++ANP R A G+ +E  +DKG GAVA +LV +GTL + DYI+ G  + +V+ M+D   K +  ALPS PV I G +G+P++G K +   DEK+ KE     LSEK+   Q  + +  L  F   + +    +KEL +I+K D  GS+EA++  L  +     K+N++ +A+G+I E+D+ LA  S ++++ FN +  SK   YA    I ++ Y +IY+  D++++ + G+LDP + EK +G  E+R L+    +GVIAG  V+ G+I+RNA  R+ R D  I+   +++SL+  KD         ECG  +++FND  EGDI+E Y +
  S:   308 SIMVRDLAEKLNKNPAEIMKKLMELGIMATINQNID-FETAEIVSSL-YDVKVERELSEEEKILEELVDIDDDAELIARPPVVTIMGHVDHGKTSLLDRIRQANVVSGEAGGITQHIGAYQVTIKNNKITFIDTPGHEAFTAMRARGANLTDIVILVVAADDGVMPQTVEAINHIRAAKVPFLVAINKIDKPQADPERIKQQLTEYNIVPEEWGGDTIFVPVSAKSGEGIENLLEMILLVAEMNEIRANPDRAAYGLVVEGELDKGRGAVATVLVLNGTLNIGDYIICGTNWCRVRAMIDDRGKRVDKALPSMPVEIMGWSGVPEAGGK-VQVCDEKVAKEIIGLRLSEKKIEEQKQSSRVSLDEFFQQMKDAE--VKELTLIIKGDVQGSVEALRQSLLRLATNEVKVNVIHSAVGAITETDVMLASASNAIIIGFNVRPDSKARKYAEDEKIDVRMYRVIYEAIDDVKKAMSGLLDPEYKEKFLGRAEVRALFKVPHVGVIAGSYVIDGKIQRNASVRVLR-DGVIVYEGQLSSLKRFKDDAKEVVENYECGIGIKDFNDVKEGDIIEAYTL 875
>gi|111657278|ref|ZP_01408044.1| hypothetical protein SpneT_02001516 [Streptococcus pneumoniae TIGR4] (953 aa)
Score = 1118, Expect = 7.1e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   372 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 946
>gi|148990074|ref|ZP_01821328.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP6-BS73] >gi|147924600|gb|EDK75687.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP6-BS73] (930 aa)
Score = 1117, Expect = 7.9e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANIPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|33241098|ref|NP_876040.1| translation initiation factor IF-2 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|39931229|sp|Q7VA20|IF2_PROMA Translation initiation factor IF-2 >gi|33238627|gb|AAQ00693.1| Translation initiation factor 2 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (1134 aa)
Score = 1117, Expect = 8.0e-120, Identities = 243/574 (42%), Positives = 373/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-----------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +N+T+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + +I+      ++ I+  D + L  +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE     K   +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  AK PI+V INK+DK+ A+ +++  +L+E+ ++ EEWGG  +++  SA+  + ID+LLE I++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD N K +K A PS PV   G N +P +GD++ V  DEK  + +  +R           Q+ +++  LS     +N+    +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S ++++ FNT ++S     A +  + +++Y +IY++ ++I+  ++G+L+P  VE++IG  E+R +++      +AG  +  G+++RN   R+KR D +I+ N  ++SLR  KD +   ++G ECG   + F ++ EGD +E Y++V +
  S:   544 IVVPEDNITVQELADKLSVESSEIIKSLFFKGITATVTQSLDLSTIETVAEEFGVPVLQDDIEEAAKKTVEMIEETDIKHL-TRRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQVEVEHEKKLRTLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAKVPIVVAINKIDKEGASPDRVKQELSEQELVAEEWGGDVVMMPVSAIKGENIDKLLEMILLVTEVEDLQANPARLAKGTVIEAHLDKAKGPVATLLVQNGTLKAGDVVAAGPVLGKVRAMVDENGKRLKEAGPSCPVEALGFNEVPTAGDEFEVYPDEKSARSVVGERASDARATRLAQQMASRRVSLSAMSGQVNDGD--LKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIIGFNTSMASGAKKAADANSVDVRDYEVIYKLLEDIQLAMEGLLEPDLVEEKIGEAEVRAIFTIGK-SAVAGCYITNGKLQRNCKVRVKRAD-QIVFNGDLDSLRRNKDVVKDVSSGFECGIGCDRFANWKEGDTIEGYKLVTQ 1128
>gi|148380373|ref|YP_001254914.1| translation initiation factor IF-2 [Clostridium botulinum A str. ATCC 3502] >gi|153933214|ref|YP_001384593.1| translation initiation factor IF-2 [Clostridium botulinum A str. ATCC 19397] >gi|153936032|ref|YP_001388109.1| translation initiation factor IF-2 [Clostridium botulinum A str. Hall] >gi|168180703|ref|ZP_02615367.1| translation initiation factor IF-2 [Clostridium botulinum NCTC 2916] >gi|166226270|sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 >gi|166226271|sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 >gi|148289857|emb|CAL83965.1| translation initiation factor IF-2 [Clostridium botulinum A str. ATCC 3502] >gi|152929258|gb|ABS34758.1| translation initiation factor IF-2 [Clostridium botulinum A str. ATCC 19397] >gi|152931946|gb|ABS37445.1| translation initiation factor IF-2 [Clostridium botulinum A str. Hall] >gi|182668599|gb|EDT80578.1| translation initiation factor IF-2 [Clostridium botulinum NCTC 2916] (688 aa)
Score = 1117, Expect = 8.1e-120, Identities = 257/604 (42%), Positives = 389/604 (64%)
  Q:     9 VKTKSKNKNKKIVDNRTN--IDIKSQFKKVETGIKNGVFVFTNN-LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           ++T +KN  K+ ++N+ +   D K++    E     G+   T++ +T+ E S K+ K  AE+IK L L G+  ++N  ++     +L  +F  +  KE +  +++  D +K  + E+ L KR PI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     ITF DTPGH AF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI H   A  P+IV INK+D+  ANI+K+  +L E  ++ E+WGG T+ +  SA   +GID+LLE I++++EI+ELKANP R A G  +EA +DKG G VA LL+Q+GTL V D I+VG  YG+++ M +   + I++A PSTPV I GL+ +P++GDK+    +EK  + +++KR+         +T +  L +    + E +  +KEL +I+K D  GS+EA+K  L  +     K+ ++   +G+INE+D+ LA  S  +++ FN +  +     +   G+ IK Y +IY   ++I+  + G+L+P F E  IG+ E+RQ++  SS+G IAG  + TG++ RNA AR+ R D  +I  +++ SL+  KD     A G ECG ++E FND  EGDI+E +
  S:    67 IETTAKNPIKESMNNKKSNKRDDKNEKVNTENAEDMGIITMTSDTITVKEISDKLEKSYAEVIKELMLMGVMASVNQEINFEMAEKLAAKFDMEILKEDEDEKEDLEDILKDNEEEEYLQKRSPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVELNGEAITFLDTPGHAAFTAMRARGAQVTDIVILVVAADDGIMPQTQEAISHCKAANVPLIVAINKIDRPGANIDKVKQELTEYGLVAEDWGGDTICVPVSAHTKEGIDDLLEMILLSSEILELKANPNRKAKGTVVEAKLDKGRGPVATLLIQNGTLRVGDSIVVGSTYGRIRAMFNDKGRNIESAGPSTPVEILGLSEVPEAGDKFYQVKEEKTARGIADKRKEKIRDEYLQSTHKVSLEDLYNQIQEGT--VKELGLIVKADVQGSVEALKQSLEKLSTEEVKVRVIHGGVGAINETDVTLATASNGIILGFNVRPDNNAIIASERDGVDIKTYRVIYDAIEDIKSAMLGMLEPEFKEVVIGTAEVRQVYKISSVGTIAGAYIQTGKLARNAGARVIR-DGIVIFESELASLKRFKDDAKEVAQGYECGLSIEKFNDIKEGDIIECF 678
>gi|81300829|ref|YP_401037.1| translation initiation factor IF-2 [Synechococcus elongatus PCC 7942] >gi|123769211|sp|Q31LL9|IF2_SYNP7 Translation initiation factor IF-2 >gi|81169710|gb|ABB58050.1| bacterial translation initiation factor 2 (bIF-2) [Synechococcus elongatus PCC 7942] (1030 aa)
Score = 1117, Expect = 8.1e-120, Identities = 240/605 (39%), Positives = 377/605 (62%)
  Q:    11 TKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           TK +   ++    R +   + + ++ +  ++  +    +++T+ E ++ +     +IIK LF KGI   +   LD   + ++  EFG   ++E + +       +  +   + L  RPP+VT+MGHVDHGKTTLLD IRK++VAA EAG ITQ IGAY V+ +    +H I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  A+ P+IV INK DK++A  +++  +L E  ++ EEWGG+T+++  SA+  + ID+LLE I++  E+ EL ANP R A G  IEA +DK  G VA LLVQ+GTL V D ++ G   GKV+ MVD     ++ A PS  V + GL  +P +GD++ V +DEK  + ++  R    +Q +L         + GT   +  +G +KELN+ILK D  GS+EAI G L  +     ++ ++ AA G I E+D+DLA  S +++V FNT ++S     A   G+ +++Y+IIY++ ++I+  ++G+L+P  VE+ +G VE+R ++S    G +AG  V +G+  RN   R+ R+   ++    ++SL+  K+ +    +G ECG  L++F+ + EGDI+E Y +V
  S:   410 TKGRKPRRESARERQH---RRRMEREQKPVRPELISLRSSMTVQELAQLMVVPETDIIKSLFFKGIAATVTQSLDVATIEQVAEEFGILVEQETEESGARKTTQMVEDADAESLQTRPPVVTVMGHVDHGKTTLLDAIRKTRVAAGEAGGITQHIGAYHVDVEHNGDQHQIVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVRPQTLEAISHAKAAEVPLIVAINKCDKEEAQPDRVKQELTEYGLVPEEWGGETVMVPVSAIKGENIDQLLEMILLVTEVEELVANPDRAARGTVIEAHLDKARGPVATLLVQNGTLRVGDVLVAGSVLGKVRAMVDDRGDRVEAATPSFAVEVLGLGDVPAAGDEFEVYSDEKSARAVATSRADEQRQSRLQQAMASRRVSLGTVSAQAQEGELKELNLILKADVQGSVEAILGSLEQLPQKQVQVRVLLAAPGEITETDVDLAAASGAVIVGFNTTLASGAKRAADEAGVDVRDYDIIYKLLEDIQAAMEGLLEPELVEEPLGQVEVRAVFSIGR-GAVAGCYVQSGKAIRNCNIRV-RRGSNLVYTGTLDSLKRMKEDVKEVNSGYECGIGLDSFSAWQEGDIIETYRMV 1022
>gi|15900468|ref|NP_345072.1| translation initiation factor IF-2 [Streptococcus pneumoniae TIGR4] >gi|149012570|ref|ZP_01833567.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP19-BS75] >gi|23821733|sp|Q97S57|IF2_STRPN Translation initiation factor IF-2 >gi|14972030|gb|AAK74712.1| translation initiation factor IF-2 [Streptococcus pneumoniae TIGR4] >gi|147763375|gb|EDK70312.1| translation initiation factor IF-2 [Streptococcus pneumoniae SP19-BS75] (958 aa)
Score = 1117, Expect = 8.5e-120, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   377 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 951
>gi|125718690|ref|YP_001035823.1| translation initiation factor IF-2 [Streptococcus sanguinis SK36] >gi|166198937|sp|A3CQ18|IF2_STRSV Translation initiation factor IF-2 >gi|125498607|gb|ABN45273.1| Translation initiation factor IF-2, putative [Streptococcus sanguinis SK36] (930 aa)
Score = 1117, Expect = 9.0e-120, Identities = 253/568 (44%), Positives = 366/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + KK+++++  + ++    E+    +D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ ID LLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ  T +  L N    L      +K +NVI+K D  GS+EA+   L  IEV G K+ +V +A+G+INESD+ LA  S + ++ FN + +S+    A +  + I+ ++IIY++ +E+E  +KG+LDP + EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D +E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKKKVEVDTAD-IERFFVEEGYINQDALVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEESGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAADVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIDSLLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNETPMAGDHFAVYEDEKAARAAGEERAKRALLKQRQA-THRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALSASLQKIEVEGVKITIVHSAVGAINESDVTLAEASNAFIIGFNVRPTSQARQQAEADDVEIRLHSIIYKVIEEMEDAMKGMLDPEYEEKIIGEALIRETFKVSKVGTIGGFMVINGKVTRDSKVRVIR-DGVVIYDGELASLKHFKDDVKEVTNGREGGLMIDGYNDIQVDDTIEAY 923
>gi|126657167|ref|ZP_01728333.1| translation initiation factor IF-2 [Cyanothece sp. CCY0110] >gi|126621438|gb|EAZ92149.1| translation initiation factor IF-2 [Cyanothece sp. CCY0110] (1007 aa)
Score = 1117, Expect = 9.4e-120, Identities = 248/570 (43%), Positives = 374/570 (65%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL--LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           V   NLT+ E S+++     EIIK+LF KGI  N+   LD+    ++  E  +D + EI   +     N +  D +DL  L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V+     +   I F DTPGHEAF+ MRA GA +TD+ +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK +AN ++I  +L+E +++ EEWGG+T+++  SAL  + +DELLE +++ +E+ EL ANP RLA G  IEA++D+  G VA LL+Q+GTL V D I+ G  +GK++ M+D    +++ A PS  V I GLN +P +GD++ V   EK  + ++E    N +Q +L    ++       L+  +Q   +KELN+ILK D  GS+EAI G L  +     ++ ++ A+ G + E+D+DLA  S ++++ FNT ++S     A   G+ I+ Y+IIY++ D+IE  ++G+L+P  VE  +G  E+R ++S    G +AG  V +G++ RN   R+ R + +++    ++SL+  K+ +    +G ECG  ++ FND+ EGDI+E YE+V
  S:   416 VLERNLTVRELSEQLQIAETEIIKHLFSKGIAVNITETLDQ-DTAKMVTE-SFDIEVEIPEAKSAATKNTEMLDEQDLENLQRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDIDHGGETQQIVFLDTPGHEAFTAMRARGARVTDMAILVVAADDGVQPQTREAISHAQAAEVPIVVAINKIDKPEANADRIKQELSELSLVPEEWGGETIMVPVSALKGENLDELLEMLVLVSEVEELVANPDRLAKGTVIEANLDRTRGPVATLLIQNGTLRVGDAIVAGSVFGKIRAMIDDRGNKVEEASPSFAVEILGLNSVPAAGDEFDVYPSEKEARTVAEDNAENQRQTRLQQAMSSRRVTLSTLSAQAQEGELKELNLILKADVQGSVEAILGSLEQLPQNEVQIRVLLASPGEVTETDVDLAAASGAVIIGFNTTLASGARAAADHEGVDIREYDIIYKLLDDIEGAMEGLLEPEEVESPLGRAEVRAVFSVGR-GAVAGCYVQSGKVVRNRQIRVHR-NNQVVYQGALDSLKRVKEDVREVNSGYECGIGVDKFNDWEEGDIIEAYELV 996
>gi|78222796|ref|YP_384543.1| translation initiation factor IF-2 [Geobacter metallireducens GS-15] >gi|90101361|sp|Q39VA6|IF2_GEOMG Translation initiation factor IF-2 >gi|78194051|gb|ABB31818.1| bacterial translation initiation factor 2 (bIF-2) [Geobacter metallireducens GS-15] (884 aa)
Score = 1116, Expect = 1.1e-119, Identities = 242/608 (39%), Positives = 373/608 (61%)
  Q:     7 KNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K  K + + +       +T I +    K++   IK      + ++T+ E +K++   + ++I+ L   G+   +N  LD      +  EF Y+ +  + I+ D  L++    D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+H+  A  PII+ INK+DK +A  E++  +L E  ++ EEWGG+T+ ++ SA     + ELLE +++ A++M+LKANP + A G  +EA +D+G G VA +LVQ GTL V DY + G + G+V+ M +    ++  A PS PV + G  G+P +GD +I  +DEK  KE++  RQ   ++ +L+         L +  Q   +K+LN I+K D  GS+EA+   L  +     +LN++ +++G+I E+D++LA  S ++++ FN +   K S  A   G+ ++ YNIIY   ++I++ ++G+L+P   EK +G  EIR+++S   +G + G  +  G++ RNA  R+ R D  ++   K++SLR  KD +   A G ECG  LEN+ND   GDI+E +EI
  S:   276 KTGKGRRRERESVTFGKKTEITVPKAIKRI---IK-----ISESITVGELAKRMGVKATDLIRVLMKMGMMATINHPLDVDTATLIAAEFSYEIEN-VAIDTDEMLESAP--DTPESLKKRPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELNGRKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAINHSKAAGVPIIIAINKIDKPEAKPERVKQELMEFGLVSEEWGGETIFVEVSAKKRINLPELLEMVLLQADVMDLKANPDKEARGTIVEAKLDRGRGPVATVLVQEGTLKVGDYFVAGVHSGRVRAMQNDRGDKVLAAGPSMPVEVIGFTGVPDAGDVFISLSDEKKAKEIASHRQQKLRETELAKHSKMSLEQLYDKIQKGEVKDLNAIVKADVQGSVEAVSDSLRKLSTDAVRLNVIHSSVGAITETDVNLASASNAIILGFNVRPEPKASAMAEKEGVDVRLYNIIYDAVEDIKKAMEGLLEPTLREKYLGRAEIREVFSVPKVGNVGGCYIQDGKVLRNASVRLLR-DNVVVYEGKMSSLRRFKDDVKEVATGYECGIGLENYNDIKVGDIIEAFEI 877
>gi|161507681|ref|YP_001577635.1| translation initiation factor IF-2 [Lactobacillus helveticus DPC 4571] >gi|172048308|sp|A8YVQ7|IF2_LACH4 Translation initiation factor IF-2 >gi|160348670|gb|ABX27344.1| translation initiation factor [Lactobacillus helveticus DPC 4571] (870 aa)
Score = 1114, Expect = 1.7e-119, Identities = 250/570 (43%), Positives = 369/570 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQ--INEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            V+   +   +  K I++  AEI+K LF+ G+  N N  LD+  +  L  E+G + K+++   I++ + L N + E  +   +  KRPP+VTIMGHVDHGKTTLLD +R + V+A EAG ITQ IGAYQV     LITF DTPGH AFS MRA GA++TDIVVLVVAADDG+ PQT EAIDHA  A  PIIV INKMDK  AN + +  +L + N++ E++GG T+ +  SA   Q +D+LL+ I++ A++MELKANP  +A G  IEA + +G G VAD+L+Q GTL + D I+VG+ +G+V+ M +   +++K A PS PV I+GLN +P+S DK +   DEK  + + E R     Q+   N         F T   EN   +KE++++LK D  GS+EA++  L  IEV G ++N++ + +G+INESD+ LA  S + ++ FN + ++     A + G+ I+ Y+IIY+  D++   +KG+L+P + EK IG++ +R+ W  S +G IAG  V  G +K +A  RI R D  +  + +I SL+  KD +     G +CG T++++ND   GD  E+YE+
  S:   286 LVYEKGMNAQDIGKLIHREPAEIVKKLFMLGVMTNQNRSLDKDTIELLAAEYGINAKQKVHEDISDIDTLYNKRMEASKKSKNQVKRPPVVTIMGHVDHGKTTLLDRLRHTHVSAHEAGGITQKIGAYQVRLDDRLITFLDTPGHAAFSNMRARGAEITDIVVLVVAADDGVMPQTVEAIDHAKSANVPIIVAINKMDKPGANPQHVTEELMKYNLIPEDYGGDTIFVNISARTGQNVDDLLQMILLQADMMELKANPTEMAIGTVIEARLSRGRGPVADVLIQQGTLNIGDPIVVGDTFGRVRTMTNDRGRQVKKATPSEPVEITGLNDVPESADKLVEFKDEKTARSVGEARAQQALQKSRENVQHVTLDNLFDTMKKEN---MKEVDIVLKADVQGSVEALQQSLEKIEVEGVRVNIIHSGVGAINESDVTLAGASNAFIIGFNVRPTATAKSQAETEGVDIRLYSIIYKAIDDVTAAMKGMLEPTYEEKVIGNLTVRETWKVSKVGTIAGSFVDKGLVKSDAKIRIIR-DGIVKYDGEIASLKRFKDDVKEVKQGNDCGLTIKDYNDIKVGDEFEVYEM 864
>gi|169834351|ref|YP_001694043.1| translation initiation factor IF-2 [Streptococcus pneumoniae Hungary19A-6] >gi|168996853|gb|ACA37465.1| translation initiation factor IF-2 [Streptococcus pneumoniae Hungary19A-6] (930 aa)
Score = 1114, Expect = 1.7e-119, Identities = 253/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T+ +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K++++++  + ++    ED    ED L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+H+     PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA  NQ I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK  +   E+R       Q    QR  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+ +V +A+G+INESD+ LA  S + +V FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + ++ SL+H KD +     G+E G  ++ +ND    D++E Y
  S:   349 FEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNAD-IERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAVNVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGE--LKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKVRVIR-DGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAY 923
>gi|110601938|ref|ZP_01390097.1| translation initiation factor IF-2:Small GTP-binding protein domain [Geobacter sp. FRC-32] >gi|110547347|gb|EAT60614.1| translation initiation factor IF-2:Small GTP-binding protein domain [Geobacter sp. FRC-32] (908 aa)
Score = 1113, Expect = 2.7e-119, Identities = 241/605 (39%), Positives = 370/605 (61%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K K +   K  +  +T I +    K++   IK      +  +T+ E +K++     ++I+ L   G+   +N  LD      L  +FGY+ +  + ++ D  L++    D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY V      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA++H+  A  PIIV +NK+DK +A  E++  +L E  ++ EEWGG+T+ +  SA     +  LLE +++ A+++ELKAN  + A G  +EA +DKG G VA +LVQ GTL V DY + G ++G+V+ M +   +++ +A PS PV + G  G+P +GD ++   DEK  KE++  RQ   ++ +L+         L E  Q   +K+LN I+K D  GS+EA+   L  +     +LN++ A++G+I E+D++LA  S ++++ FN +   K    A   G+ I+ YNIIY   D+I++ ++G+L+P   EK +G  E+R+ +S    G +AG  VL G++ RN+  R+ R D  ++   K+ SLR  KD +   A+G ECG ++EN+ND   GDI+E +E+
  S:   303 KGKKRQAEKIQIGKKTEITVPKAIKRI---IK-----ISETITVGELAKRMGIKXNDLIRALMKMGVMATINHALDFDTATILATDFGYEIEN-VALDIDEILESTP--DTPESLVKRPPVVTIMGHVDHGKTSLLDAIRQTNVIAGEAGGITQHIGAYDVTLNGRKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAVNHSKAAGVPIIVAVNKIDKPEAKPERVKQELMELGLVSEEWGGETIFVDVSAKKRVNLPTLLEMVLLQADVLELKANEDKAARGTIVEAKLDKGRGPVATVLVQEGTLKVGDYFVAGIHFGRVRAMQNDRAEKVLSAGPSMPVEVIGFTGVPDAGDVFVALADEKQAKEIASLRQQKVRETELAKHSKLSLEQLYEKIQMGEVKDLNTIVKGDVQGSVEAVSESLRKLSTDAIRLNVIHASVGAITETDVNLATASNAIILGFNVRPEVKAQALAEKEGVDIRLYNIIYDAVDDIKKAMEGLLEPTLREKFLGRAEVRETFSVPKHGTVAGSYVLDGKMIRNSQVRLLR-DNVVVFEGKMGSLRRFKDDVKEVASGYECGISIENYNDIKVGDIIESFEM 901
>gi|163722485|ref|ZP_02130023.1| translation initiation factor IF-2 [Desulfatibacillum alkenivorans AK-01] >gi|161404239|gb|EDQ28469.1| translation initiation factor IF-2 [Desulfatibacillum alkenivorans AK-01] (1040 aa)
Score = 1113, Expect = 2.7e-119, Identities = 238/562 (42%), Positives = 358/562 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + + + +K++   +AE+IK L   GI   +N +LD      L  EFGY+ +K     E+  L     ED  + L  RPP+VTIMGHVDHGKT+LLD IR+S V   EAG ITQ IGAY V+  +  I F DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA++H+  A  PIIV +NKMDK+ A+ +++  +L++  ++ E+WGG T+ ++ SA   QG+D+LLE +++ AE++EL+ANP +LA G  +EA +D G G VA +L+Q GTL   D ++ G +YGKV+ M +  R+ +  A P+ P  I GL+G+P +GD+ I  +DEK+ K++S  R    +  +L+        NL +  Q   +K+LN+I+K D  GS+EA++  L  +     K+++V AA G++ ESD+ LA  S +++V FN + S KVSD A    + I+ Y+IIY   +EI+  + G+++  + E   G  E+R  ++   +G IAG  V  G+++R+   R+ R D  +I + K++SLR  KD +   A G ECG  +ENFND   GD++E+Y
  S:   467 IAVADLAKRLGIKAAELIKNLMGMGIMATVNQMLDYDTAVLLAAEFGYEVEKA-NFEEETVLK--AEEDAPETLSNRPPVVTIMGHVDHGKTSLLDAIRESNVTGGEAGGITQHIGAYLVDSPRGRIAFLDTPGHEAFTAMRARGAQVTDIVILVVAADDGVMPQTVEAVNHSKAAGVPIIVAVNKMDKEGADPDRVMRELSDHGLVPEDWGGDTIFVQVSAKQRQGLDDLLEMVLLQAEVLELQANPDKLARGHVVEAKVDPGRGPVATVLIQEGTLHAGDVVVCGIHYGKVRAMYNEKRQPLDAAGPACPAEILGLSGVPMAGDEIIAVDDEKVAKQVSSHRAQKQRATELAKSSKLSLDNLFDQMQAGNVKDLNLIIKADVQGSIEALRESLEKLSGDEVKIHVVHAATGTVLESDVALAAVSNAIIVAFNVRPSPKVSDMAAEEHVDIRFYDIIYNAINEIKDAIVGLMESTYKEHVSGRAEVRDTFTIPKVGTIAGCYVTDGKVERHNQVRLLR-DGVVIFDGKLSSLRRFKDDVKEVATGYECGMGIENFNDIKIGDVLELY 1030
>gi|58337534|ref|YP_194119.1| translation initiation factor IF-2 [Lactobacillus acidophilus NCFM] >gi|81311452|sp|Q5FJN6|IF2_LACAC Translation initiation factor IF-2 >gi|58254851|gb|AAV43088.1| translation initiation factor IF-2 [Lactobacillus acidophilus NCFM] (877 aa)
Score = 1112, Expect = 2.9e-119, Identities = 248/571 (43%), Positives = 371/571 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQ--INEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + V+   +   +  K I++  AEI+K LF+ G+  N N  LD+  +  L  E+G D K+++   I++ + L + + E  +   +  KRPP+VTIMGHVDHGKTTLLD +R + V+A EAG ITQ IGAYQV     LITF DTPGH AFS MRA GA++TDIVVLVVAADDG+ PQT EAIDHA  A  PIIV INKMDK  AN + +  +L + N++ E++GG T+ +  SA   Q +D+LL+ I++ A++MELKANP  +A G  IEA + +G G VAD+L+Q GTL + D I+VG+ +G+V+ M +   +++K A PS PV I+GLN +P+S DK +   DEK  + + E R   + Q+   N         F T   EN   +KE++++LK D  GS+EA++  L  IEV G ++N++ + +G+INESD+ LA  S + ++ FN + ++     A + G+ I+ Y+IIY+  D++   +KG+L+P + EK IG++ +R+ W  S +G IAG  V  G +K ++  R+ R D  +  + +I SL+  KD +     G +CG T++++ND   GD  E+YE+
  S:   292 ILVYEEGMNAQDIGKLIHREPAEIVKKLFMLGVMTNQNQSLDKDTIELLAAEYGIDAKQKVHEDISDIDTLYDKRMEASKKSKNQIKRPPVVTIMGHVDHGKTTLLDRLRHTHVSAHEAGGITQRIGAYQVRLDDRLITFLDTPGHAAFSNMRARGAEITDIVVLVVAADDGVMPQTVEAIDHAKSANVPIIVAINKMDKPGANPQHVTEELMKYNLIPEDYGGDTIFVNISAKTGQNVDDLLQMILLQADVMELKANPDEMAIGTVIEARLSRGRGPVADVLIQQGTLNIGDPIVVGDTFGRVRTMTNDRGRQVKKATPSEPVEITGLNDVPESADKLVEFKDEKTARSVGEARAQQSLQKSRENVQHVTLDNLFDTMKKEN---MKEVDIVLKADVQGSVEALQQSLEKIEVEGVRVNIIHSGVGAINESDVTLAGASNAFIIGFNVRPTATAKSQAETDGVDIRLYSIIYKAIDDVTAAMKGMLEPTYEEKVIGNLTVRETWKVSKVGTIAGSFVDKGIVKNDSKIRVIR-DGIVKYDGEIASLKRFKDDVKEVKQGNDCGLTIKDYNDIKVGDEFEVYEM 871
>gi|169183626|ref|ZP_02844128.1| translation initiation factor IF-2 [Thauera sp. MZ1T] >gi|169009262|gb|EDS56042.1| translation initiation factor IF-2 [Thauera sp. MZ1T] (968 aa)
Score = 1111, Expect = 3.6e-119, Identities = 250/587 (42%), Positives = 363/587 (61%)
  Q:    28 DIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           D +S F+     I   V V    +T+ + + K+   + E+IK L   G    +N +LD+     +  E G+        + D FL+  +     D+L  R P+VT+MGHVDHGKT+LLD IR++KVAA E G ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA  A  P++V INK+DK DAN E++  +L  ++V+ E +GG TM +  SA    GIDELLEA+++ AE++EL A     A G+ IEA +DKG G VA LLVQSGTL   D +L G  +G+++ M+D N K+I  A PS PV I GL+ +P +GD+ I   DEK  +E++  RQ   +  KL     +   T + + S+G +K L +I+K D  GS EA+   L  +     ++N++  A+G+I+ESD++LA+ S ++++ FNT+  +     A + G+ I+ YNIIY   DE++  L G+L P   E+  G VEIRQ+++ S +G IAG  VL G ++RN+  R+ R +  ++   ++ SL+  KD +     G ECG  L N+ND  EGD +E++EI
  S:   372 DDRSSFQAPTEPIVREVHV-PETITVADLAHKMAVKATEVIKVLMKMGSMVTINQVLDQETAMIIVEEMGHLAVAAKLDDPDAFLEESEAHKDADVL-PRAPVVTVMGHVDHGKTSLLDYIRRAKVAAGEFGGITQHIGAYHVETARGMLTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTREAIHHAKAAGVPLVVAINKIDKPDANPERVTQELIAESVIPEAYGGDTMFVPVSAKKGTGIDELLEAVLLQAEVLELTAPKDTPAKGLIIEARLDKGRGPVASLLVQSGTLRKGDVLLAGATFGRIRAMLDENGKQIDEAGPSIPVEILGLSDVPSAGDEAIALADEKKAREIALFRQGKFRDVKLAKQQAAKLETLMEQMSEGEVKSLALIIKADVQGSQEALVQSLQKLSTDEVRVNVIHGAVGAISESDVNLAQASGAVIIGFNTRADAGARKLAETFGVDIRYYNIIYDAVDEVKAALSGMLAPEKREEVTGLVEIRQVFTISKVGSIAGCYVLEGVVRRNSHVRLLR-NHTVLWTGELESLKRFKDDVKEVKFGYECGLQLRNYNDIQEGDQLEVFEI 961
>gi|78779971|ref|YP_398083.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9312] >gi|123768931|sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 >gi|78713470|gb|ABB50647.1| bacterial translation initiation factor 2 (bIF-2) [Prochlorococcus marinus str. MIT 9312] (1128 aa)
Score = 1111, Expect = 3.7e-119, Identities = 249/572 (43%), Positives = 373/572 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-----------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + V  +NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + +IQ   +  +D I+ +D + L+ KRPP++T+MGHVDHGKT+LLD+IR+S+VA+ EAG ITQ IGAYQVE+K    K  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG +PQT EAI HA  AK PI+V INK+DK+ A+ E++  +L+EK+++ E+WGG T+++  SA+  Q ID+LLE I++ +E+ +L+ANP R A G  IEA +DK +G VA LLVQ+GTL   D +  G   GK++ MVD +   IK A PS PV   G + +P +GD++ V  DEK  + +   R           Q+ +++  LS+  T  N+    +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+DIDLA  S S+++ FNT ++S     A +  + I+ Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R  ++    G IAG  + TG+++RN   R+ R DK +I    ++SL+  KD +     G ECG   + F+ + EGDI+E ++ V
  S:   538 IIVPEDNLTVQELADKLSLESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDIQEAAEKTVDMIESDDFDSLI-KRPPVITVMGHVDHGKTSLLDSIRESRVASGEAGGITQHIGAYQVEFKHESKKKKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGCRPQTLEAISHARAAKVPIVVAINKIDKEGASPERVKQELSEKDLIAEDWGGDTVMVPVSAIKKQNIDKLLEMILLVSEVEDLQANPDRSAKGTVIEAHLDKAKGPVATLLVQNGTLKSGDVLAAGSVLGKIRAMVDEHGNRIKEAGPSFPVEALGFSEVPTAGDEFEVYPDEKTARAIVGDRATDARATKLAQQMASRRVTLSSLSTQANDGE--LKELNLILKADVQGSVEAILGSLEQLPKNEVQVRVLLSAPGEITETDIDLAAASGSVIIGFNTSLASGAKRAADANDVDIREYEVIYKLLEDIQLAMEGLLEPDLVEESLGKAEVRATFAVGK-GAIAGCYIQTGKLQRNCSLRVIRSDK-VIFEGNLDSLKRSKDDVKEVNTGFECGVGCDKFSSWTEGDIIEAFKFV 1120
>gi|33863795|ref|NP_895355.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9313] >gi|39931225|sp|Q7V5M4|IF2_PROMM Translation initiation factor IF-2 >gi|33635378|emb|CAE21703.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9313] (1125 aa)
Score = 1111, Expect = 4.0e-119, Identities = 237/566 (41%), Positives = 363/566 (64%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +I+       + I+  D   L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE     +   ITF DTPGH+AF+ MRA G  +TDI VLVVAADDG++PQT EAI HA  AK PIIV INK DK+ A+ E++  +L+++N+L EEWGG  +++  SA+  + ID+LLE I++  E+ +L+ANP RLA G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD +   +K A PS  V   G + +P +GD++ V  DEK  + +  +R  + +  +L+        +      + S G +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  +  G+++RN   R++R  K+++    ++SLR  KD +   A G ECG   + F ++ E DI+E +++V
  S:   540 NLTVQELADMLSIESSEIIKSLFFKGITATVTQSLDLPTIEAVAEEFGVPVLQDDIEEAAKKTTEMIEETDLAHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAVEAGGITQHIGAYQVEIDHGGQPRKITFLDTPGHQAFTAMRARGTKVTDIAVLVVAADDGVRPQTLEAISHARAAKVPIIVAINKTDKEGASPERVKQELSDQNLLSEEWGGDVVMVPVSAIKGENIDKLLEMILLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLIQNGTLKTGDVLAAGPVLGKVRAMVDDSGARLKEAGPSGAVEALGFSEVPTAGDEFEVYPDEKSARVVVGERASDARATRLAQQMASRRVSLAAMSGQASDGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIVGFNTSMASGAKRAADATGVDVRDYDVIYKLLEDIQMAMEGLLEPELVEESLGEAEVRAVFTIGK-SAVAGCYITAGKLQRNCRVRVRRA-KQVVFEGDLDSLRRNKDDVKEVATGFECGIGCDRFANWEERDIIEAHKLV 1116
>gi|110636254|ref|YP_676462.1| translation initiation factor IF-2 [Mesorhizobium sp. BNC1] >gi|123352953|sp|Q11BC8|IF2_MESSB Translation initiation factor IF-2 >gi|110287238|gb|ABG65297.1| bacterial translation initiation factor 2 (bIF-2) [Mesorhizobium sp. BNC1] (856 aa)
Score = 1111, Expect = 4.2e-119, Identities = 237/569 (41%), Positives = 356/569 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE--------NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    +TI E ++++ + + +++KY   +G       ++D      + +EFG+  K+  + + +  L NI  EDR + L  RPP+VTIMGHVDHGKT+LLD IRK+ V A EAG ITQ IGAYQVE   + ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK DAN +K+ ++L +  V  E  GG  + ++ SA+    +D+LLEAI++ AEI+ELKANP R A G+ +EA +D+G G+VA +LVQ+GTL   D I+ G  +G+V+ +V+   + +K A PSTPV + GL G P++GD++ V + E   +E+SE RQ   +++ ++                 S G+KE  +I+K D  GS+EAI   L  +     +  +V +  G+I ESDI LA TS + ++ FN + + +  D A   GI I+ YNIIY + D+I+  + G+L P   E  +G+ EI ++++ + +G +AG RV  G+++R A  R+ R D  +I   K+ +L+  KD ++   AG+ECG   EN+ D   GD++E + +
  S:   276 VIPETITIQELAQRMAERAVDVVKYFMKQGQIMKPGDVIDADTAELVAVEFGHTAKRVAESDVEEGLFNI--EDRPEDLKPRPPVVTIMGHVDHGKTSLLDAIRKANVVAGEAGGITQHIGAYQVEQDGNTITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTVESINHAKAAGVPIIVAINKIDKPDANPQKVRTELLQHEVFVESMGGDVLDVEVSAIKGTNLDKLLEAILLQAEILELKANPDRTAEGVVVEAKLDRGRGSVATVLVQAGTLKPGDVIVAGSEWGRVRALVNERGEAVKVAPPSTPVEVLGLQGPPQAGDRFAVVDTEARAREISEYRQRKAREKAVARQAGQRGSLEQMMSQLQSSGMKEFPLIIKGDVQGSIEAIVNALEKLGTEEVRARIVHSGAGAITESDISLAETSDAAIIGFNVRANKQARDAAEQAGIEIRYYNIIYDLVDDIKAAMSGLLSPERRETFLGNAEILEVFNITKVGKVAGCRVTEGKVERGAGVRLIR-DNVVIHEGKLKTLKRFKDEVSEVPAGQECGMAFENYEDIRVGDVIEAFRV 849
>gi|69246865|ref|ZP_00604157.1| Initiation factor 2:Small GTP-binding protein domain [Enterococcus faecium DO] >gi|68195046|gb|EAN09509.1| Initiation factor 2:Small GTP-binding protein domain [Enterococcus faecium DO] (768 aa)
Score = 1110, Expect = 5.2e-119, Identities = 252/567 (44%), Positives = 368/567 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRE----DLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMV-DFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR--------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVE 610
           V  +T  + + + +KKI++  AEIIK LF+ G+  N N  LD+  +  L  ++G + ++++Q++     D  KF + E    D L  RPP+VTIMGHVDHGKTTLLDT+R S+V + EAG ITQ IGAYQ++     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PIIV +NK+DK  AN + +  +L+E  ++ E WGG+T+ ++ SA   Q I+ELLE I++ AE+ +LKA+P + A G  IEA +DKG+G V+ LLVQ GTL V D I+VG  YG+V+ M  D  R++ K A P+TPV I+GLN +P++GD+++V  DEK  +   E+R        +  T +  L N   +L E    +KE+NVI+K D  GS EA+   L  I+V G ++ +V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ + IIY+  +EIE  +KG+LDP F EK  G + +R+ +  S +G IAG  V  G I+R++  R+ R D  +I   ++ SL+  KD +     G ECG  +E FND    D++E
  S:   186 VLEYTEGMNVADIAKKIHREPAEIIKKLFMLGVMVNQNQALDKDTIELLATDYGMEPQEKVQVD---IADIDKFFEAEEVDPDKLVSRPPVVTIMGHVDHGKTTLLDTLRHSRVTSGEAGGITQHIGAYQIDIDGKPITFLDTPGHAAFTSMRARGASITDITILVVAADDGVMPQTVEAINHAKAAGVPIIVAVNKIDKPGANPQHVMQELSEYELIPEAWGGETIFVEISAKFGQNIEELLEMILLVAEVEDLKADPTQRAIGTVIEARLDKGKGPVSTLLVQEGTLHVGDPIVVGNTYGRVRVMTNDLGRRD-KEAGPATPVEITGLNDVPQAGDRFVVFEDEKTARAAGEERAKRALLENRAATSRVTLDNLFESLKEGE--LKEVNVIIKADVQGSAEALAASLKKIDVEGVRVKIVHSAVGAINESDVTLAAASNAIIIGFNVRPTPQAKVQADTEEVDIRLHRIIYKAIEEIETAMKGMLDPEFEEKITGQMIVRETFKVSKVGTIAGAYVTEGYIRRDSGVRVIR-DGIVIYEGQLASLKRFKDDVKEVKMGYECGAMIEKFNDIKVDDVIE 758
>gi|191164942|ref|ZP_03026793.1| translation initiation factor IF-2 [Geobacter sp. M21] >gi|190993952|gb|EDV69429.1| translation initiation factor IF-2 [Geobacter sp. M21] (564 aa)
Score = 1109, Expect = 6.3e-119, Identities = 236/551 (42%), Positives = 353/551 (64%)
  Q:    64 SAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + ++I+ L   G+   +N  LD      L  +FGY+ +  + ++ D  L+     D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EA++H+  A  PIIV INK+DK DA+  K+  +L E  ++ EEWGG+T+ ++ SA     ++ LLE +++ A+++EL+ANP++ A G  +EA +DKG G VA +LVQ GTL   DY + G +YG+V+ M +   +++  A P+ PV + G NG+P +GD ++   DEK  KE++  RQ+  ++ +L+         L E  Q   +K+LN I+K D  GS+EA+   L  +     +LN++ A++G+I E+D++LA  S ++++ FN +   K +  A   G+ ++ YNIIY   D+I++ ++G+L+P F EK +G  EIR+++S    G++AG  V  G+I RNA  R+ R D  ++   K+ SLR  KD +   A G ECG +LEN+ND   GDI E +E+
  S:     5 ATDLIRALMKLGVMATINHPLDFDTATLLATDFGYEIEN-VALDVDEILE--AEPDAPESLLKRPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELNGKKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAVNHSKAAGVPIIVAINKIDKPDASPGKVKQELMEFGLVSEEWGGETIFVEVSAKKRINLESLLEMVLLQADVLELRANPEKAARGTVVEAKLDKGRGPVATILVQEGTLKSGDYFVAGVHYGRVRAMQNDRGEKVLAAGPAMPVEVIGFNGVPDAGDIFVAMGDEKQAKEIANHRQMKLRESELAKHSKLSLEQLYEKIQKGEVKDLNAIVKGDVQGSVEAVAESLRKLSTDAIRLNVLHASVGAITETDVNLASASNAIILGFNVRPEVKAAALAEKEGVDVRLYNIIYDAVDDIKKAMEGLLEPTFKEKYLGRAEIREVFSVPKAGMVAGSYVTDGKIVRNAQVRLLR-DNMVVYEGKLGSLRRFKDDVKEVATGYECGMSLENYNDLKVGDIFECFEM 557
>gi|168187908|ref|ZP_02622543.1| translation initiation factor IF-2 [Clostridium botulinum C str. Eklund] >gi|169294252|gb|EDS76385.1| translation initiation factor IF-2 [Clostridium botulinum C str. Eklund] (680 aa)
Score = 1109, Expect = 6.3e-119, Identities = 257/601 (42%), Positives = 382/601 (63%)
  Q:    14 KNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           KNK K+I     N D  S  +++       V    + +T+   + K+ K + E+IK L   G+   +N  LD     +L  +F       I   EDN +   + ED ++  +KRPP+VT+MGHVDHGKT++LD IRK+KV +TEAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+H   A+ P+IV INK+DK  AN++++  +L E N++ E+WGG  + +  SA   +G+D LLE II+TAE+ EL+A+P+R A G  IEA +DKG G VA LLVQ+GTL V D I+VG  YG+++ M D   K IK A PS PV I GL+ +P +GD++ V  DEK  + +++KR+   +++++ +  TN        N+  +G +KEL+VI+K D  GS+EA+   L  +     K+ ++  A+G+I+E+D+ L+  S ++++ FN + S+  +  A   G+ ++ Y +IY   D+I+  + G+L+P + E  +GS E+R ++  SS+G IAG  VL G+I R++  RI R D  +I  ++I+SL+  KD     A G ECG ++E FND  EGDI+E + +
  S:    79 KNKKKEIKRGNKNSDNDSSEEEI-------VIEMEDTITVKALADKLKKPTTEVIKQLMFMGVMAAINQELDLSTAEKLAEKF----NAVIMQKEDNTITK-EIEDEDEGTEKRPPVVTVMGHVDHGKTSILDAIRKAKVTSTEAGGITQHIGAYTVEVNGEKITFLDTPGHEAFTTMRARGAQITDIVILVVAADDGIMPQTIEAINHCRAAEVPMIVAINKIDKPAANLDRVKQELTEHNLIPEDWGGDVITVPVSAHTKEGLDSLLEMIILTAEMEELRADPERKAKGTVIEAKLDKGRGPVASLLVQNGTLKVGDSIIVGNTYGRIRAMFDDKGKNIKVAGPSIPVEILGLSEVPDAGDRFNVVKDEKTARNMADKRKEKLREKRMQS--TNRVSLEDLYNQIQEGKVKELDVIVKADVQGSVEAVIQSLEKLSTDSVKVRVIHGAVGAISETDVTLSAASNAIIIGFNVRPSNNATVLAEKEGVNVRTYRVIYDALDDIKAAMVGMLEPEYKEVVLGSAEVRVVYKISSVGTIAGCYVLNGKITRDSSVRIIR-DGIVIFESEISSLKRFKDDAKEVAKGYECGLSVEKFNDIKEGDIIEAFTM 672
>gi|78358202|ref|YP_389651.1| translation initiation factor IF-2 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|90101359|sp|Q30WJ0|IF2_DESDG Translation initiation factor IF-2 >gi|78220607|gb|ABB39956.1| bacterial translation initiation factor 2 (bIF-2) [Desulfovibrio desulfuricans G20] (984 aa)
Score = 1109, Expect = 6.9e-119, Identities = 239/559 (42%), Positives = 354/559 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIV 609
           + + +F+ ++   + EIIK L   GI   +N  LD      +  EFGY+ +K +  +ED FL   K  D ++LL  RPP+VTIMGHVDHGKT+LLD IRKS V   EAG ITQ IGAY V  K+  I F DTPGHEAF+ MRA GA +TD+V+LVVAADDG+  QT EAI HA  A  PI+V +NK+DK+ AN +++  +LAE++++ EEWGG T+    SA   +G+D+LLE + + AE++ELKANP + A G  +EA +DKG GAV  +L+Q GTL   D  + G + G+V+ M +   K+ K A PS PV + G  G+P +G+++I   DEK+ + ++E+R +  ++R L+         F      +++  + LN++LK D  GS+ AI   L  ++    K++++ +  G+I ESDI LA  S ++++ FN + ++KV D A    + I+ Y+IIY++ +EI+  + G+L PV  E+ +G  E+R+ +S   +G +AG  V  G+I RN   R+ R D  +I   +INSL+  KD +   A G ECG  LEN+ND   GDI+
  S:   409 IRVSDFAHQMGVKAPEIIKILMSLGIMATINQSLDIDTATVVAAEFGYEVEK-VGFSEDEFLLP-KEVDADELLLPRPPVVTIMGHVDHGKTSLLDAIRKSSVTTGEAGGITQHIGAYHVSTKRGDIVFLDTPGHEAFTAMRARGAQVTDLVILVVAADDGVMEQTREAISHAKAAGVPIVVAVNKIDKEGANRDRVMRELAEQDLVPEEWGGDTIFSYVSAKTREGLDDLLEMLALQAEVLELKANPDKPARGRIVEAKLDKGRGAVGTVLIQEGTLKHGDAFVCGVFSGRVRAMFNDQGKKAKQAGPSIPVEVQGFEGVPVAGEEFICVKDEKVARRIAEQRAIKQRERDLARESKVTLETFLARRKTDAE-TQTLNLVLKADVQGSVGAITDALRKMQTEKVKVDIIHSGAGAITESDILLASASDAIIIGFNVRPTAKVKDVAEQEKVEIRFYDIIYKLSEEIKSAMAGLLAPVVREQYLGQAEVRETFSVPKVGTVAGCHVADGKIIRNTKVRLLR-DGVVIYTGRINSLKRFKDDVKEVAKGFECGMGLENYNDIKIGDII 971
>gi|152990170|ref|YP_001355892.1| translation initiation factor IF-2 [Nitratiruptor sp. SB155-2] >gi|166232565|sp|A6Q226|IF2_NITSB Translation initiation factor IF-2 >gi|151422031|dbj|BAF69535.1| translation initiation factor IF-2 [Nitratiruptor sp. SB155-2] (843 aa)
Score = 1108, Expect = 9.9e-119, Identities = 255/563 (45%), Positives = 371/563 (65%)
  Q:    55 EFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-NFGTNLNENSQGIKE-----LNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI-FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           EF++KI K   E+IK LF  G+    N  LD+  +  L  EF  + K +  + E   LD +K  D   +D L++RPP++TIMGHVDHGKT+LLD IR SK+A  EAG ITQ IGAY +E     ITF DTPGHEAF++MRA GA  TDI ++VVAADDG+KPQT EA++HA  A  P+IV INK+DK +AN + + SQLAE  +   EWGG+   ++ SA   QG+D+LL+ I++ AEIMELKANPKR A  + IE+S++KG G VA ++V++GTL V D+++ G  +G+V+ ++D   K IK   PS P  + GL+ +P +G+  +   D +  +  +E+R    +Q++LS     +L E SQ +KE     L VI+K D  GSLEAIKG L  ++    K++++ A +G+I+ESD+ LA  S++ V++ FN + +  V + A  +G+ IK Y+IIY + D+++ LL G+L P+  E+ IG  E+R+ ++   IG +AG  V  G I+RNA AR+ R D  +I ++KI+SL+  K+ +     G ECG  +ENFND   GD++E Y+ V E
  S:   272 EFAEKIGKSVGEVIKVLFNLGMMATKNDFLDKETLEILAEEFDVEIKIKNVLEE---LDYVKVYDAVEDDYLEERPPVITIMGHVDHGKTSLLDYIRNSKIAEREAGGITQHIGAYMIEKDGKRITFIDTPGHEAFTEMRARGAQATDIAIIVVAADDGVKPQTVEAVNHAKTADVPMIVAINKIDKPEANPDLVKSQLAEIGITPTEWGGEYEFVEVSAKTGQGVDDLLDTILLQAEIMELKANPKREAKAVVIESSLEKGRGPVATVIVKNGTLRVGDHVVCGVAFGRVRAIIDDLGKMIKERKPSEPGVVVGLDKVPPAGEILVAVKDAEEARMYAERRAEYERQKELSKTTKVSLEELSQLVKEGQLKKLPVIIKADTQGSLEAIKGSLEKLKNEEVKVDIIHAGVGAISESDVTLADASENAVILGFNVRPTGAVKEKAKQLGVNIKTYSIIYDLIDDVKALLSGMLSPIIKEEVIGQAEVRETFNVPKIGTVAGCLVTDGVIERNAKARVIR-DGVVIYDSKISSLKRFKEDVREVTKGYECGLMIENFNDIKVGDVIEAYKEVEE 839
>gi|163839412|ref|YP_001623817.1| translation initiation factor IF-2 [Renibacterium salmoninarum ATCC 33209] >gi|189028345|sp|A9WPV8|IF2_RENSM Translation initiation factor IF-2 >gi|162952888|gb|ABY22403.1| translation initiation factor IF-2 [Renibacterium salmoninarum ATCC 33209] (956 aa)
Score = 1108, Expect = 1.0e-118, Identities = 256/579 (44%), Positives = 370/579 (63%)
  Q:    36 VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY--------DFKKEIQINED-NFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  G  N V       +I +F+ KI  + A ++  LF  G        LDE     L  E GY        D ++E+    D +F   ++ E  EDL   RPP+VT+MGHVDHGKT LLD IR S V A E G ITQ IGAYQV    E +   ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK+ AN EKI  QL E  ++ EE+GG+TM +  SA  NQ ID LLEA+++TA+  ++L+ANP + A GI IEA++DKG G+VA +LVQSGTLAV D I+ G  +G+V+ M D +   +  A PS PV++ GL+ +P++GD + VT DE+  ++++EKR+         K+RK   L +F   + +    +  LN+ILK D +G++EA++  L  I+V  G +L ++   +G+I ++D++LA    ++++ FN K + +V++ A   G+ ++ Y++IY   D+IE  LKG+L P + E ++G+ EIR+++  S  G IAG  V +G I+RNA AR+ R    I  N  ++SL+  KD       G ECG  L +FND    DI+E +E+
  S:   351 VPRGDGNTVVRLRRGSSITDFADKIEANPAALVTVLFHLGEMATATQSLDEETFALLGEELGYKLQVVSPEDEERELLSTFDIDFDAELEAEGDEDL-QARPPVVTVMGHVDHGKTRLLDAIRNSDVVAGEHGGITQHIGAYQVNHVHEGEVRKITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMPQTVEALNHAQAAGVPIVVAVNKIDKEGANPEKIRGQLTEYGLVPEEYGGETMFVDVSARQNQNIDALLEAVMLTADAALDLRANPNKDARGIAIEANLDKGRGSVATVLVQSGTLAVGDTIVAGTAHGRVRAMFDDDGTAVTEAGPSRPVQVLGLSSVPRAGDTFFVTGDERTARQIAEKREAADRNAALAKRRKRISLEDFDQAVADGK--VDTLNLILKGDVSGAVEALEDSLLKIDVGEGVQLRVIHRGVGAITQNDVNLATVDSAIIIGFNVKPAERVAELADREGVDMRFYSVIYAAIDDIELALKGMLKPEYEEVQLGTAEIREIFRSSKFGNIAGSIVRSGLIRRNAKARVLRAGVLIGDNLTVDSLKRVKDDATEVREGFECGIGLGSFNDLQLEDIIETFEM 950
>gi|82702985|ref|YP_412551.1| translation initiation factor IF-2 [Nitrosospira multiformis ATCC 25196] >gi|123768184|sp|Q2Y7W2|IF2_NITMU Translation initiation factor IF-2 >gi|82411050|gb|ABB75159.1| bacterial translation initiation factor 2 (bIF-2) [Nitrosospira multiformis ATCC 25196] (876 aa)
Score = 1107, Expect = 1.2e-118, Identities = 234/564 (41%), Positives = 361/564 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++   ++K++  +AE+IK L   G    +N +LD+     +  E G+  K     + ++FL + +    E  ++ R P+VT+MGHVDHGKT+LLD IR+++VA+ EAG ITQ IGAY VE ++ ++TF DTPGHEAF+ MRA GA +TD+V+LVVAADDG+ PQT EAI HA   K PI+V + K+DK +AN E+I  +L  + V+ E+WGG+TM ++ SA   QGID+LLE++++ AE++ELKA     A GI IE+ +DKG G VA +LVQSGTL   D +L G  YG+V+ M+D + K+++ A PS PV I GL+ +P +G+  +   DE+  +E++  RQ   +  KL+        N+ E    +K L++I+K D  GS EA+   L  +     K+N++ + +G+I ESDI+LA  SK++V+ FN++  +       S G+ ++ Y+IIY+  DEI+  L G++ P   E   G +EIR+++  S +G +AG  V  G ++R +  R+ R + ++I   +++SL+  KD +    AG ECG +L+NFND   GD +E YEI
  S:   303 ISVGALAQKMSIKAAEVIKALMKMGNMVTINQMLDQETAMIVVEELGHVAKYAALDSPESFLADTEIAPSELKMEARAPVVTVMGHVDHGKTSLLDYIRRTRVASGEAGGITQHIGAYHVETERGMVTFLDTPGHEAFTAMRARGAKVTDLVILVVAADDGVMPQTVEAIHHAKAGKVPIVVAMTKIDKPEANPERIRQELVTQEVVPEDWGGETMFVEVSAKTGQGIDDLLESVLLQAEVLELKAPKDAPAKGIVIESRLDKGRGPVATMLVQSGTLKRGDILLAGAAYGRVRAMLDESGKQVEQAGPSIPVEIQGLSEVPVAGESVVALTDERKAREIALFRQGKFRDVKLAKQQAAKLENVFEQRGEVKVLSLIIKADVQGSYEALTHALQQLSTDEVKVNIIHSGVGAITESDINLALASKAVVIGFNSRADAVARKLINSAGVDVRYYSIIYEAVDEIKAALSGMMAPERKENITGLLEIREVFRISKVGAVAGCLVQEGFVRRGSLVRVIR-NGQVIHTGELDSLKRFKDDVKEVRAGFECGLSLKNFNDIQVGDQLETYEI 869
>gi|116669977|ref|YP_830910.1| translation initiation factor IF-2 [Arthrobacter sp. FB24] >gi|189028280|sp|A0JUU0|IF2_ARTS2 Translation initiation factor IF-2 >gi|116610086|gb|ABK02810.1| bacterial translation initiation factor 2 (bIF-2) [Arthrobacter sp. FB24] (968 aa)
Score = 1107, Expect = 1.4e-118, Identities = 250/579 (43%), Positives = 368/579 (63%)
  Q:    36 VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY--------DFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  G  N V       +I +F+ KI  + A ++  LF  G        LDE     L  E GY        D ++E+    D   D     + ++ L+ RPP+VT+MGHVDHGKT LLD IR S V A E G ITQ IGAYQ+    E  +  ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK+ AN +K+  QL E  ++ EE+GG TM ++ SA  N  IDELLEA+++TA+  ++++ANP + A GI IEA++DKG GAVA +LVQSGTL V D I+ G  +G+V+ M D +   +  A PS PV++ GL+ +P++GD + VT DE+  ++++EKR+         K+RK   L +F   + E    I  LN+ILK D +G++EA++  L  I+V  G +L ++   +G+I ++D++LA    ++++ FN K + +V++ A   G+ ++ Y++IY   D+IE  LKG+L P + E ++G+ E+R+++  S  G IAG  V +G I+RN+ ARI R  K I  N  + +L+  KD         ECG  L ++ND  EGDI+E +E+
  S:   363 VPRGDGNTVVRLRRGSSITDFADKIEANPAALVTVLFHLGEMATATQSLDEETFALLGEELGYKLQVVSPEDEERELLSGFDIDFDAELEAEGDEELEARPPVVTVMGHVDHGKTRLLDAIRNSDVVAGEHGGITQHIGAYQITTEHEGAERKITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMPQTVEALNHAQAANVPIVVAVNKIDKEGANPDKVRGQLTEYGLVPEEYGGDTMFVEVSARQNLNIDELLEAVLLTADAALDMRANPNKDARGIAIEANLDKGRGAVATVLVQSGTLHVGDTIVAGTAHGRVRAMFDDDGSVLTEAGPSRPVQVLGLSNVPRAGDTFFVTADERTARQIAEKREAADRNAALAKRRKRISLEDFDQAVAEGK--IDTLNLILKGDVSGAVEALEDALLKIDVGEGVQLRVIHRGVGAITQNDVNLATVDSAVIIGFNVKPAERVAELADREGVDMRFYSVIYAAIDDIEMALKGMLKPEYEEVQLGTAEVREVFRSSKFGNIAGSIVRSGVIRRNSKARISRDGKIIGDNLTVETLKRFKDDATEVRTDFECGIGLGSYNDINEGDIIETFEM 962
>gi|119898398|ref|YP_933611.1| translation initiation factor IF-2 [Azoarcus sp. BH72] >gi|189028281|sp|A1K7B9|IF2_AZOSB Translation initiation factor IF-2 >gi|119670811|emb|CAL94724.1| translation initiation factor IF-2 [Azoarcus sp. BH72] (940 aa)
Score = 1106, Expect = 1.4e-118, Identities = 241/564 (42%), Positives = 356/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ + + K++  + E+IK L   G    +N +LD+     +  E G+        + D FL+        +LL  R P+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LV AADDG+ PQT EAI HA  A  P++V I K+DK +AN E++  +L  ++V+ EE+GG TM +  SA    G+DELLEA+++ AE++EL A     A G+ +EA +DKG G VA LLVQSGTL   D +LVG  +G+++ M+D N K +  A PS PV I GL+ +P +GD+ IV  DEK  +E++  RQ   +  KL     +   +   + ++G +K L +I+K D  GS EA+   L+ +     ++N++  A+G+I+ESD++LA+ S ++++ FNT+  +     A S G+ I+ YNIIY   DE++  L G+L P   E+ IG VEIRQ+++ S +G +AG  VL G +KR +  R+ R +  ++   ++ SL+  KD +     G ECG  L+N+ND   GD +E++EI
  S:   366 ITVADLAHKMSVKATEVIKTLMKMGSMVTINQVLDQETAMIVVEELGHKALAAKLDDPDAFLEETDAHKDAELL-PRAPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVITFLDTPGHEAFTAMRARGAKATDIVILVCAADDGVMPQTREAIHHAKAAGVPVVVAITKIDKPEANAERVKQELVSESVIPEEYGGDTMFVPVSAKTGTGVDELLEAVLLQAEVLELTAAVDAPAKGLIVEARLDKGRGPVASLLVQSGTLRKGDVLLVGATFGRIRAMLDENGKPVDEAGPSIPVEILGLSDVPAAGDEAIVLGDEKKAREIALFRQGKFRDVKLAKQQAAKLESMFEQMAEGEVKSLPLIIKADVQGSQEALAQSLAKLSNDEVRVNVIHGAVGAISESDVNLAQASGAVIIGFNTRADAGARKLAESFGVDIRYYNIIYDAVDEVKSALSGMLAPEKREEVIGMVEIRQVFTISKVGSVAGCYVLEGLVKRGSSVRLIR-NHTVVWTGELESLKRFKDDVKEVKFGYECGLQLKNYNDIQVGDQLEVFEI 933
>gi|195977584|ref|YP_002122828.1| translation initiation factor IF-2 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974289|gb|ACG61815.1| translation initiation factor IF-2 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (947 aa)
Score = 1106, Expect = 1.4e-118, Identities = 249/568 (43%), Positives = 369/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F ++  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G + K +++++E   + F  +  + + E++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  ++   WGG+   ++ SA  N+ IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K+A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      IK +NVI+K D  GS+EA+   L  I+V G ++N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +E FND    D +E Y
  S:   365 FEYSEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDEADIERFFTDDSYLNPENIVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLHVQDPIVVGNTFGRVRAMTNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLDNLFDTLKAGE--IKTVNVIIKADVQGSVEALAASLLKIDVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRLHSIIYKVIEEVEEAMKGKLDPEYQEKVLGEAIIRETFKVSKVGTIGGFMVVNGKVTRDSSVRVIR-DSVVIFDGKLASLKHYKDDVKEIGNAQEGGLMIEGFNDIKVDDTIEAY 939
>gi|159904157|ref|YP_001551501.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9211] >gi|159889333|gb|ABX09547.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9211] (1113 aa)
Score = 1106, Expect = 1.4e-118, Identities = 242/572 (42%), Positives = 366/572 (63%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY----DFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-----------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + +   NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG     D  +E        LD    E  +D L +RPP+VT+MGHVDHGKT+LLD IRK++VA+ EAG ITQ IGAYQVE     KK  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  AK PI+V INK+DK+ A+ +++  +L+E+ ++ EEWGG+ +++  SA+  + ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD N   +K A PS PV   G N +P +GD++ V  DEK  + +   R           Q+ +++  LS+     NE    +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G + E+D+DLA  S +++V FNT ++S     A +  + +++Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R ++S      +AG  +  G+++RN   R+KR   +I+    ++SLR  KD +    +G ECG   + F ++ EGDI++ Y++V
  S:   523 IIIPEGNLTVQELADKLSVESSEIIKSLFFKGITATVTQSLDLSTIETVAEEFGVPVLQDDIEEAATKTAEMLD----EADKDHLIRRPPVVTVMGHVDHGKTSLLDAIRKARVASGEAGGITQHIGAYQVELEHEKKKRKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAKVPIVVAINKIDKEGASPDRVKQELSEQELVAEEWGGEVVMVPVSAIKGENIDKLLEMVLLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLIQNGTLKSGDVLAAGPVLGKVRAMVDENGIRLKEAGPSCPVEALGFNEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLSSMSGQANEGD--LKELNIILKADVQGSIEAILGSLEQLPKDEVQVRVLLSAPGEVTETDVDLAAASGAVIVGFNTSMASGAKKAADANSVDVRDYEVIYKLLEDIQLAMEGLLEPDMVEESLGEAEVRAIFSIGK-SAVAGCYITNGKLQRNCKVRVKR-GSQIVFEGDLDSLRRNKDVVKDVGSGFECGVGCDRFANWKEGDIIQGYKLV 1105
>gi|41409005|ref|NP_961841.1| translation initiation factor IF-2 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|81831678|sp|Q73VV4|IF2_MYCPA Translation initiation factor IF-2 >gi|41397364|gb|AAS05224.1| InfB [Mycobacterium avium subsp. paratuberculosis K-10] (925 aa)
Score = 1106, Expect = 1.5e-118, Identities = 244/564 (43%), Positives = 373/564 (66%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI----NED-NFLDNIKF-----EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KI+ + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+    +ED   L++        E  E+ L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV  +    +  ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+D + A+ +KI  QL E  ++ EE+GG TM +  SA     ID+LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D I+ G+ YG+V++MVD +  +++ ALPS PV++ G   +P +GD  +V +++++ +++++KR       L  + RK   L +  + L E SQ    LN+ILK DN G++EA++  L  I++     L ++   +G I E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE+ L+G+L P++ E ++G  EIR ++  S +G+IAG  + +G ++RNA AR+ R +  +  N  INSLR  KD +     G ECG TL  ++D  EGD++E YE+V
  S:   341 SLSDFAEKIDANPASLVQALF------NLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRELLESFDLTYGEDEGTEEDLQTRPPVVTVMGHVDHGKTRLLDTIRKANVREAEAGGITQHIGAYQVTVEHDGVERPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDVEGADPQKIRGQLTEYGLVPEEFGGDTMFVDISAKQGTNIDQLLEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGDDVEEALPSRPVQVIGFTSVPGAGDNLLVVDEDRIARQIADKRSARKRNALAARSRKRISLEDLDSALKETSQ----LNLILKGDNAGTVEALEEALMGIQIDDEVALRVIDRGVGGITETNVNLASASDAVIIGFNVRAEGKATELANREGVEIRYYSVIYQAIDEIEKALRGMLKPIYEENQLGRAEIRAIFRSSKVGIIAGCMITSGVVRRNAKARLLRDNVVVSENLTINSLRREKDDVTEVREGFECGMTL-GYSDIKEGDVIESYELV 920
>gi|177670873|ref|ZP_02943963.1| translation initiation factor IF-2 [Micrococcus luteus NCTC 2665] >gi|172072301|gb|EDT58338.1| translation initiation factor IF-2 [Micrococcus luteus NCTC 2665] (930 aa)
Score = 1106, Expect = 1.8e-118, Identities = 252/580 (43%), Positives = 371/580 (63%)
  Q:    35 KVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY--------DFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT--NLNENSQGIKE-----LNVILKTDNNGSLEAIKGLLSSIEV--TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           KV  G    V       ++ +F++KI    A+++K LF  G   + N  LDE     L  E GY        D  KE+    D  L+  +  + E  L+ RP +VT+MGHVDHGKT LLD IR S V   EAG ITQ IGAYQV    E ++  +TF DTPGHEAF+ MRA GA +TDI VLVVAADDG+ PQT EA++HA  A  PI+V +NK+DK  A  +KI  QL E  ++ EE+GG TM +  SA NN  ID+LLEAI++TA+  +EL ANP + A G+ IEA++DKG GAV  +LVQ+GTL V D ++VG  +G+V+ M D N   ++ A PS PV++ GL+ +P++GD ++VT+DE+  ++++E+R+   +  +L+       L +  Q + E     LN+I+K D +G++EA++  L  IEV     +L ++   +G+I ++D++LA    ++++ FN + + +V+D A   G+ ++ YN+IY   D+IE  LKG+L P + E E+GS E+R+++  S  G IAG  V +G I+RNA AR+ R    +  + +I SLR  K+       G ECG  L +FND  EGD++E +E+
  S:   323 KVPKGDGTTVLRLRRGASLADFAEKIRADVADLVKVLFTLGEMASANQSLDEETFQLLGDELGYKVQIVSPEDEDKELLEAFDIDLEAEEANEDEADLEPRPAVVTVMGHVDHGKTRLLDAIRSSNVIEGEAGGITQHIGAYQVPVEHEGEQRRLTFIDTPGHEAFTAMRARGAKVTDIAVLVVAADDGVMPQTVEALNHAQSAGVPIVVAVNKIDKDTAAPDKIRGQLTEYGLVPEEYGGDTMFVDVSARNNINIDQLLEAILLTADAALELTANPHKAARGVAIEANLDKGRGAVVTVLVQTGTLRVGDTMVVGSAHGRVRAMFDENGNAVEAADPSRPVQVLGLSSVPRAGDSFLVTDDERTARQIAERREAADRNAQLAKRRKRITLEDFDQAVAEGKLDTLNLIIKGDASGAVEALEDSLLKIEVGEDEVQLRVIHRGVGAITQNDVNLATVDNAIIIGFNVRPAERVADLADREGVDMRFYNVIYDAIDDIENALKGMLKPEYEEVELGSAEVREVFRSSKWGNIAGSLVRSGLIRRNAQARLVRDGVVVSEHLRIESLRRFKEDATEVREGYECGIGLGSFNDIKEGDVIETFEM 924
>gi|15609976|ref|NP_217355.1| translation initiation factor IF-2 [Mycobacterium tuberculosis H37Rv] >gi|15842380|ref|NP_337417.1| translation initiation factor IF-2 [Mycobacterium tuberculosis CDC1551] >gi|31794016|ref|NP_856509.1| translation initiation factor IF-2 [Mycobacterium bovis AF2122/97] >gi|121638719|ref|YP_978943.1| translation initiation factor IF-2 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662680|ref|YP_001284203.1| translation initiation factor IF-2 [Mycobacterium tuberculosis H37Ra] >gi|148824029|ref|YP_001288783.1| translation initiation factor IF-2 [Mycobacterium tuberculosis F11] >gi|194544986|ref|YP_002080015.1| translation initiation factor IF-2 infB [Mycobacterium tuberculosis C] >gi|166232558|sp|A1KMI2|IF2_MYCBP Translation initiation factor IF-2 >gi|166232561|sp|A5U6J1|IF2_MYCTA Translation initiation factor IF-2 >gi|54037378|sp|P65132|IF2_MYCBO Translation initiation factor IF-2 >gi|54041108|sp|P65131|IF2_MYCTU Translation initiation factor IF-2 >gi|1648881|emb|CAB03670.1| PROBABLE TRANSLATION INITIATION FACTOR IF-2 INFB [Mycobacterium tuberculosis H37Rv] >gi|13882679|gb|AAK47231.1| translation initiation factor IF-2 [Mycobacterium tuberculosis CDC1551] >gi|31619610|emb|CAD95049.1| PROBABLE TRANSLATION INITIATION FACTOR IF-2 INFB [Mycobacterium bovis AF2122/97] >gi|121494367|emb|CAL72848.1| Probable translation initiation factor IF-2 infB [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124601993|gb|EAY61003.1| translation initiation factor IF-2 infB [Mycobacterium tuberculosis C] >gi|148506832|gb|ABQ74641.1| translation initiation factor IF-2 [Mycobacterium tuberculosis H37Ra] >gi|148722556|gb|ABR07181.1| translation initiation factor IF-2 infB [Mycobacterium tuberculosis F11] (900 aa)
Score = 1105, Expect = 1.9e-118, Identities = 245/564 (43%), Positives = 371/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI----NED-NFLDNIKF-----EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KI+ + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+    +ED   L++        E  E+ L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV    +  + LITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ EE+GG TM +  SA     I+ L EA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +LVQ GTL V D ++ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN G++EA++  L  I+V     L ++   +G I E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE+ L+G+L P++ E ++G  EIR L+  S +G+IAG  V +G ++RNA AR+ R +  +  N  I SLR  KD +     G ECG TL  + D  EGD++E YE+V
  S:   316 SLSDFADKIDANPAALVQALF------NLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRELLESFDLSYGEDEGGEEDLQVRPPVVTVMGHVDHGKTRLLDTIRKANVREAEAGGITQHIGAYQVAVDLDGSQRLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVPEEFGGDTMFVDISAKQGTNIEALEEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLVQRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEVALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQ----LNLILKGDNAGTVEALEEALMGIQVDDEVVLRVIDRGVGGITETNVNLASASDAVIIGFNVRAEGKATELASREGVEIRYYSVIYQAIDEIEQALRGLLKPIYEENQLGRAEIRALFRSSKVGLIAGCLVTSGVMRRNAKARLLRDNIVVAENLSIASLRREKDDVTEVRDGFECGLTL-GYADIKEGDVIESYELV 895
>gi|56752084|ref|YP_172785.1| translation initiation factor IF-2 [Synechococcus elongatus PCC 6301] >gi|81820570|sp|Q5N0A5|IF2_SYNP6 Translation initiation factor IF-2 >gi|56687043|dbj|BAD80265.1| translation initiation factor IF-2 [Synechococcus elongatus PCC 6301] (1030 aa)
Score = 1105, Expect = 2.2e-118, Identities = 239/605 (39%), Positives = 375/605 (61%)
  Q:    11 TKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           TK +   ++    R +   + + ++ +  ++  +    +++T+ E ++ +     +IIK LF KGI   +   LD   + ++  EFG   ++E + +       +  +   + L   PP+VT MGHVDHGKTTLLD IRK++VAA EAG ITQ IGAY V+ +    +H I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  A+ P+IV INK DK++A  +++  +L E  ++ EEWGG+T+++  SA+  + ID+LLE I++  E+ EL ANP R A G  IEA +DK  G VA LLVQ+GTL V D ++ G   GKV+ MVD     ++ A PS  V + GL  +P +GD++ V +DEK  + ++  R    +Q +L         + GT   +  +G +KELN+ILK D  GS+EAI G L  +     ++ ++ AA G I E+D+DLA  S +++V FNT ++S     A   G+ +++Y+IIY++ ++I+  ++G+L+P  VE+ +G VE+R ++S    G +AG  V +G+  RN   R+ R+   ++    ++SL+  K+ +    +G ECG  L++F+ + EGDI+E Y +V
  S:   410 TKGRKPRRESARERQH---RRRMEREQKPVRPELISLRSSMTVQELAQLMVVPETDIIKSLFFKGIAATVTQSLDVATIEQVAEEFGILVEQETEESGARKTTQMVEDADAESLQTLPPVVTAMGHVDHGKTTLLDAIRKTRVAAGEAGGITQHIGAYHVDVEHNGDQHQIVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVRPQTLEAISHAKAAEVPLIVAINKCDKEEAQPDRVKQELTEYGLVPEEWGGETVMVPVSAIKGENIDQLLEMILLVTEVEELVANPDRAARGTVIEAHLDKARGPVATLLVQNGTLRVGDVLVAGSVLGKVRAMVDDRGDRVEAATPSFAVEVLGLGDVPAAGDEFEVYSDEKSARAVATSRADEQRQSRLQQAMASRRVSLGTVSAQAQEGELKELNLILKADVQGSVEAILGSLEQLPQKQVQVRVLLAAPGEITETDVDLAAASGAVIVGFNTTLASGAKRAADEAGVDVRDYDIIYKLLEDIQAAMEGLLEPELVEEPLGQVEVRAVFSIGR-GAVAGCYVQSGKAIRNCNIRV-RRGSNLVYTGTLDSLKRMKEDVKEVNSGYECGIGLDSFSAWQEGDIIETYRMV 1022
>gi|86608605|ref|YP_477367.1| translation initiation factor IF-2 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123765489|sp|Q2JMD7|IF2_SYNJB Translation initiation factor IF-2 >gi|86557147|gb|ABD02104.1| translation initiation factor IF-2 [Synechococcus sp. JA-2-3B'a(2-13)] (1054 aa)
Score = 1104, Expect = 2.4e-118, Identities = 247/572 (43%), Positives = 368/572 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           V +   +LT+ E + ++     EIIK LF KG+   +N +LDE     +  E GY+ ++     E    + +  ED + L+  RPP+VTIMGHVDHGKTTLLD IR +KVA  EAG ITQ IGAY V    E +K  I F DTPGH+AF+ MRA GA +TDI VLVVAADDG++PQT EAI HA  A+ PIIV INK+DK  +  E+I  QLAE  +L EEWGG T +++ SAL  + +D LLE I++ A++ EL+ANP R A G  IEA +DK  G VA LLVQ+GTL V D ++ G   G+VK M+D   + ++ A PS+ V++ GL+ +P +GD++ V  DEK  + ++++R    +Q +L         + G+   +  +G +KELN+I+KTD  GS EAI+  L  +     +L ++ AA G I E+D+DLA  S ++++ FNT ++      A   G+ ++ Y+IIY + D++   ++G+L+P  VE+ +G  E+R +      G +AG  VL+G+++RNA  R++R+ + +    +++SL+  KD +   AAG ECG  ++ F  + EGDI+E+Y++V
  S:   464 VLLLDGSLTVQELAHRLRVAETEIIKTLFFKGVMVTINQVLDESLAESVAKELGYEIRRPKAEPEAKKTEMLDVEDIDHLV-SRPPVVTIMGHVDHGKTTLLDAIRDTKVAQGEAGGITQRIGAYHVDVNFEGQKRRIVFLDTPGHQAFTAMRARGARVTDIAVLVVAADDGVQPQTLEAISHARAAQVPIIVAINKIDKPGSQPERIKQQLAEHGLLPEEWGGDTPMVEVSALTRRNLDALLEMILLVADVAELQANPNRPARGTVIEAHLDKARGPVATLLVQNGTLRVGDTLVAGAVLGRVKAMMDDRGQRLQEAGPSSAVQLLGLDEVPAAGDEFQVYTDEKEARRIAQERAEVLRQTRLQQALLSRRVSLGSVSAKAQEGQLKELNLIIKTDVQGSAEAIQTALRDLPQEEVQLRVLLAAPGEITETDVDLAAASDAIILGFNTTLAPGARQAADDKGVDVREYDIIYNLLDDLRAAMEGLLEPEEVEEPLGQAEVRLVIPIGR-GAVAGSYVLSGKVQRNALVRVRRRGEVVYE-GRLDSLKRFKDDVREVAAGFECGIGIDKFQSWQEGDIIEVYQMV 1045
>gi|77408773|ref|ZP_00785503.1| translation initiation factor IF-2 [Streptococcus agalactiae COH1] >gi|77172618|gb|EAO75757.1| translation initiation factor IF-2 [Streptococcus agalactiae COH1] (908 aa)
Score = 1104, Expect = 2.6e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   326 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 900
>gi|77411669|ref|ZP_00788009.1| translation initiation factor IF-2 [Streptococcus agalactiae CJB111] >gi|77162313|gb|EAO73284.1| translation initiation factor IF-2 [Streptococcus agalactiae CJB111] (908 aa)
Score = 1104, Expect = 2.6e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   326 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 900
>gi|45658540|ref|YP_002626.1| translation initiation factor IF-2 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|59798051|sp|Q72NX3|IF2_LEPIC Translation initiation factor IF-2 >gi|45601783|gb|AAS71263.1| translation initiation factor 2 IF-2 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (891 aa)
Score = 1104, Expect = 2.7e-118, Identities = 251/565 (44%), Positives = 361/565 (63%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT-----------NLNE--NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N+ + E +KK+N    ++I  L   G+   +N ++D      L  E+G   K  + + E+  ++  K +++ED ++ RPP+VTIMGHVDHGKT LLDTIR+S V  TE+G ITQ IGAYQV   + LITF DTPGHEAF+ MRA GA +TDIVVLVVAADDG+ PQT EAI HA  A+ PI+V INK+D   AN EKI  +LA   +  EEWGG+TM  K SA  N GID+LLE I++ AE+M+LKANPKR A G  IEA +D G G+VA +L+Q+GTL V D  + G + G+V+ M +   + I+ A P+ P +++G++G+P +G  +    DEK  + +S+ R    +  ++ N G            N+NE      +KEL VI+K D  GS EAIK  L  +     KLN++++  G+I + D+ LA  S +L++ F+ + + K    A   G+ IK YNIIYQ+ DEI+  ++G+L+P  +E+ IG+ EIR+++  S IG IAG  VL+G+I+++A  R+   D       K+ SL+  KD +    AG ECG  ++ +NDF  GD +E Y +
  S:   313 NVQVGELAKKMNLKPGDVIGKLMKMGMMVTINNIIDAETAALLADEYGCKVKV-VSLYEETIIEEEK-DNQEDYIN-RPPVVTIMGHVDHGKTKLLDTIRRSSVIDTESGGITQHIGAYQVRTARGLITFLDTPGHEAFTSMRARGAKVTDIVVLVVAADDGVMPQTLEAISHAKAAEVPILVAINKIDLPAANPEKIMQELANHGLQSEEWGGETMYAKISARENIGIDKLLEMILLQAEVMDLKANPKRRAKGTIIEAKLDPGRGSVATVLIQNGTLRVGDPFVAGVFSGRVRAMYNDLGQLIQEAGPAFPAQVTGIDGVPDAGAPFDAMADEKEARNISQHR---IEFERIGNAGAATGTSSKVTLENMNEFIKQGALKELKVIIKADVRGSAEAIKESLEKLSTPEVKLNVIQSGAGAIVDMDVMLASASNALIIGFHVRANPKTIALAEKEGVQIKYYNIIYQVVDEIKLAMEGLLEPEKIEEVIGTAEIREIFKVSKIGNIAGCMVLSGKIQKSANIRVI-GDGVTKFEGKLKSLKRVKDDVNDVVAGFECGIQVDGYNDFKVGDTIEAYNV 883
>gi|163814223|ref|ZP_02205615.1| hypothetical protein COPEUT_00377 [Coprococcus eutactus ATCC 27759] >gi|158450672|gb|EDP27667.1| hypothetical protein COPEUT_00377 [Coprococcus eutactus ATCC 27759] (708 aa)
Score = 1104, Expect = 3.0e-118, Identities = 261/611 (42%), Positives = 371/611 (60%)
  Q:     5 MAKNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELS--------EKRQLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +AKNVK+K + K +   ++   I                       +T+ + +  +      +IK LFL G   N+N+     +  E+ LE+    ++E +++    L     ED +D++  RPP+V +MGHVDHGKT+LLD IR++KV + EAG ITQ+IGA  V+     ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI+HA  A   IIV INK+DK+ ANIE++  +L E  ++ E+WGG T+    SA   +GID LLE I++TA+++ELKANP R A GI IEA +DKG G VA +LVQ GTL V DYI VG  +GKV+ M +   + +  ALPSTPV+I GLN +P +G+ ++  ++EK  + +S        EK   +TKQR  L +  + +   +  +KEL +I+K D  GS+EA+K  L  +      +  + A +G+INESDI LA  S ++V+ FN +  ++  D A S G+ ++ Y +IY   ++I+  +KG+LDP++ EK IG  EIRQ +  S IGVIAG  VL G I RN   RI R +  +I   K+ SL+  KD +    +G ECG   ENF D  E D +E YE+V
  S:   103 LAKNVKSKPQKKQQTPQEDPDAIR---------------TITLPETVTLKDLADAVKTPVTALIKKLFLAGKMVNVNSEFSFDEASEIALEYNCIAEEEEKVDVIEELLKEDEEDEKDMV-SRPPVVCVMGHVDHGKTSLLDAIRQTKVTSGEAGGITQAIGASVVDVNGQTITFLDTPGHEAFTAMRMRGAQSTDIAILVVAADDGVMPQTVEAINHAKAAGIEIIVAINKIDKESANIERVKQELTEYELIPEDWGGSTIFCPVSAHTKEGIDNLLEMILLTADVLELKANPNRKARGIVIEAELDKGRGPVATMLVQKGTLHVGDYIAVGASHGKVRAMTNSRGERVTEALPSTPVQIQGLNTVPDAGEIFMAVDNEKEARTISETYISQGKEKLLADTKQRMSLDDLYSQIQAGN--LKELKIIIKADVQGSVEAVKQSLLKLSNDEVVIKCIHAGVGAINESDIILASASNAIVIGFNIRPDARAKDMADSEGVDVRLYRVIYNAIEDIDSAMKGMLDPIYEEKVIGHAEIRQTYKASGIGVIAGSYVLDGTINRNCSVRITR-EGNLIFEGKLASLKRFKDDVKEVKSGFECGMVFENFQDVAEEDQIEAYEMV 703
>gi|15827818|ref|NP_302081.1| translation initiation factor IF-2 [Mycobacterium leprae TN] >gi|7531143|sp|Q9Z5I9|IF2_MYCLE Translation initiation factor IF-2 >gi|4455678|emb|CAB36570.1| putative protein synthesis initiation factor 2 [Mycobacterium leprae] >gi|13093370|emb|CAC30507.1| initiation factor IF-2 [Mycobacterium leprae] (924 aa)
Score = 1103, Expect = 3.2e-118, Identities = 244/564 (43%), Positives = 372/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI----NEDNFL----DNIKFEDR--EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KI+ + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+    +ED  L    D    ED+  ED L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV    +  + LITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ E++GG TM I  SA     I+ LLEA+++TA+  ++L+AN    A G+ IEA +D+G G VA +LVQ GTL + D ++ G+ YG+V++MVD +  +I+ ALPS+PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN G++EA++  L  I+V     L ++   +G I E++++LA  S ++++ FN +   K ++ A   G+ I+ Y +IYQ  D+IE+ L+G+L P++ E ++G  EIR L+  S +G+IAG  + +G ++RNA  R+ R +  +  N  + SLR  KD +     G ECG TL  ++D  EGD++E YE+V
  S:   340 SLSDFAEKIDANPAALVQALF------NLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRELLEPFDLTYGEDQGDEDELQVRPPVVTVMGHVDHGKTRLLDTIRKANVREAEAGGITQHIGAYQVGVDLDGSERLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVAEDFGGDTMFIDISAKVGTNIEALLEAVLLTADAALDLRANSGMEAQGVAIEAHLDRGRGPVATVLVQRGTLRIGDSVVAGDAYGRVRRMVDEHGVDIEAALPSSPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQ----LNLILKGDNAGTVEALEEALMGIQVDDEVALRVIDRGVGGITETNVNLASASDAIIIGFNVRAEGKATELASREGVEIRYYLVIYQAIDDIEKALRGMLKPIYEENQLGRAEIRALFRSSKVGIIAGCIISSGVVRRNAKVRLLRDNIVVTDNLTVTSLRREKDDVTEVREGFECGMTL-GYSDIKEGDVIESYELV 919
>gi|160940467|ref|ZP_02087812.1| hypothetical protein CLOBOL_05357 [Clostridium bolteae ATCC BAA-613] >gi|158437047|gb|EDP14814.1| hypothetical protein CLOBOL_05357 [Clostridium bolteae ATCC BAA-613] (1102 aa)
Score = 1103, Expect = 3.2e-118, Identities = 243/565 (43%), Positives = 351/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           LTI E ++K+    + I+K LFLKG    LN  +D  Q  E+ +EF    ++E++++    L     E  ED++  R P+V +MGHVDHGKT+LLD IR++ V A EAG ITQ IGA  +E     ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI+HA  A   IIV INK+DK  AN++K+  +LAE  ++ E+WGG T+ +  SA   +GI +LLE +++TA+++ELKANP R   G+ IEA +DKG+G VA +LVQ GTL V + I  G  +GK++ M+D   + +K A PSTPV I GLN +P +G+ ++ T +EK  +  +E      K + + +    L+ +       +  +KEL +I+K D  GS+EA+K  L+ +      + ++   +G+INESD+ LA  S ++++ FN +  +     A    + I+ Y +IYQ  +++E  +KG+LDPVF EK IG   IRQ +  S IG IAG  VL G+ +RN   R+KR+ ++I     + SL+  KD +   AAG ECG   E FND  E D +E Y +V
  S:   529 LTIKELAEKMKLQPSVIVKKLFLKGQVVTLNQEIDYEQAEEIAMEFDVLCEREVKVDVIAELLKEDEESTEDMV-PRSPVVCVMGHVDHGKTSLLDAIRETNVTAREAGGITQHIGASVIEINDRKITFLDTPGHEAFTAMRMRGAQSTDIAILVVAADDGVMPQTVEAINHAKAANVEIIVAINKIDKPSANVDKVKQELAEYELIPEDWGGSTIFVPVSAHTKEGIKDLLEMVLLTADVLELKANPNRKGRGLVIEAELDKGKGPVATVLVQKGTLRVGETIAAGACFGKIRAMMDDRGRRVKEAGPSTPVEILGLNDVPNAGEVFVATENEKEARNFAETFISEGKSKLIEDTKAKLSLDDLFSQIQAGNVKELPIIVKADVQGSVEAVKQSLTKLSNEEVMVKVIHGGVGAINESDVSLASASNAIIIGFNIRPDATAKSIAEREKVDIRLYKVIYQAIEDVEAAMKGMLDPVFEEKVIGHAVIRQTFKASGIGTIAGSYVLDGKFQRNCSCRVKREGEQIFE-GPLASLKRFKDDVKEVAAGYECGLVFEKFNDLQEDDEIEAYIMV 1098
>gi|121535262|ref|ZP_01667076.1| translation initiation factor IF-2 [Thermosinus carboxydivorans Nor1] >gi|121306147|gb|EAX47075.1| translation initiation factor IF-2 [Thermosinus carboxydivorans Nor1] (836 aa)
Score = 1103, Expect = 3.5e-118, Identities = 244/564 (43%), Positives = 359/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           LT+ E + K+ +  +E+IK L + G+  ++N  +D      L  EFG   K E+   E++  +  + ED    L  RPP+VTIMGHVDHGKT+LLD IR++ V ATEAG ITQ IGAYQV ++   I F DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  AK PIIV INK+D+  AN +++  QLAE  ++ E+WGG T+++  SAL   G+ +LLE I++ AE+ ELKANP R A G  IEA +DKG G VA +LVQ GTL V D I+ G  YGKV+ MV+    ++K A P+TPV + GL+ +P++GD  +  +DEK  + ++EKR       +L   Q+  L +    + E +  IK+LN+++K D  GS+EA++  L +++    ++N+V   +G+INESD+ LA  S +L++ FN +  +     A +  + I+ Y +IY   +++E  + G+L P + E   G VE+RQ+ S    G++AG  VL G+I  ++  R+ R +  ++   K+ SLR  KD +    AG ECG T+E + D   GDI+E + +
  S:   267 LTVKELAGKLGREVSEVIKKLMMLGVMASINQEVDLDTATILAEEFG--VKVEVLPPEEDPTEIPEIEDDPGSLLPRPPVVTIMGHVDHGKTSLLDAIRQTHVTATEAGGITQHIGAYQVNYQGKKIVFLDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQTIEAINHAKAAKVPIIVAINKIDRPGANPDRVKQQLAEHGLIAEDWGGDTIMVPVSALKKTGLADLLEMILLVAEMQELKANPNRPAYGTIIEAQLDKGRGPVATVLVQKGTLRVGDIIIAGTAYGKVRAMVNDRGDKVKKAEPATPVEVLGLSDVPQAGDILVAVDDEKKARSIAEKRLAKKRSEELQQAQKVSLDDLFKQIQEGN--IKDLNIVIKADVQGSVEALRQALVNLKNKEVRVNIVHGGVGAINESDVMLASASNALIIGFNVRPDANARKAAEAEKVDIRTYRVIYDAINDVEAAMTGMLAPEYKEVLQGRVEVRQVISIPK-GLVAGSYVLEGKITNSSQVRVIR-NGVVVHEGKVESLRRFKDDVKEVTAGFECGITIERYRDIKVGDIIEAFAM 832
>gi|153004008|ref|YP_001378333.1| translation initiation factor IF-2 [Anaeromyxobacter sp. Fw109-5] >gi|166226246|sp|A7H9F3|IF2_ANADF Translation initiation factor IF-2 >gi|152027581|gb|ABS25349.1| translation initiation factor IF-2 [Anaeromyxobacter sp. Fw109-5] (970 aa)
Score = 1102, Expect = 4.4e-118, Identities = 232/565 (41%), Positives = 352/565 (62%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDF-KKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++++ E S+ +   ++++I+ L   G    +N  +D      L  EFGY   KK  ++ E  ++  ++ ++ + ++  RPP+VT+MGHVDHGKT+LLD IR++ VAA EAG ITQ IGAY V+  +  ITF DTPGHEAF+ MR  GA +TD+VVLVVAADDG+ PQT E+I  A  A   I+V INK+DK  A  E++  QL E  ++ E+WGG T+++  SA   QGI ELLE I + +E++ELKANP+ LA+G  IEA ++KG G VA +LV+ GTL V D ++ G +YG+V+ M++   +++K   P  PV + GL+G+P +GD++ V  DEK  KE++E R    ++++L        E+      S G K LNV++K D  GS EA+   L         + ++ + +G+I +SD+  A     ++V FNTK  S++   A   G+ I  ++IIY+  D+I   + G+L+P+  EK +G  E+R L+S   +G IAG  V  G IKR A  R+ R D++++ + KI SL+  KD +     G ECG  +E F+D   GD++E YE+
  S:   396 SISVSELSQAMGVKASDLIRKLMQAGTMATINQQIDADTAAFLATEFGYTLEKKGFEVEE--YIPEVEVDESKLVI--RPPVVTVMGHVDHGKTSLLDAIRQADVAAGEAGGITQHIGAYAVQTPQGPITFLDTPGHEAFTAMRQRGAQVTDLVVLVVAADDGVMPQTVESIKAAKAAGVTILVAINKIDKPGATPERVMQQLTEYELVAEQWGGSTIMLPVSARTKQGIPELLEYIALQSEVLELKANPEMLASGRVIEAKLEKGRGPVATVLVEEGTLRVGDALVTGIHYGRVRAMMNERGEQVKEVPPGYPVEVLGLSGVPVAGDEFDVVQDEKAAKEVAEHRAEKQRKKELGASRKATLEDLFAKAKSGGGKVLNVVVKADVQGSSEAVTQALQKAATKKVGVKILDSGVGAITKSDVLTAAAGNGIIVGFNTKPESEIESIASQQGVKILLFDIIYEAVDKIREEMAGLLEPIIREKPLGKAEVRALFSIPKLGNIAGSAVTEGVIKRAANVRVLR-DRKVVYSGKIGSLKRLKDDVREVQTGFECGIGIEGFSDVKPGDVIEAYEL 962
>gi|189424728|ref|YP_001951905.1| translation initiation factor IF-2 [Geobacter lovleyi SZ] >gi|189420987|gb|ACD95385.1| translation initiation factor IF-2 [Geobacter lovleyi SZ] (949 aa)
Score = 1102, Expect = 4.5e-118, Identities = 239/567 (42%), Positives = 358/567 (63%)
  Q:    48 TNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQG--IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +  +TI E +K++   + ++IK +   G    +N +LD      L  ++GY+ +  + ++ D  L+     D  +LL +RPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI+H+  A  PIIV INK+DK DA  EK+  +L E  ++  EWGG   +++ SA     ++ELLE I++ A++M+LKANP + A G  +E  +DKG G VA +LVQ GTL   DY +VG + G+V+ M +   + +  A P+ PV + GL G+P +GD ++   DEK  KE++  RQ+  ++ +L+         L E  Q   +K+LNVI+K D  GS+EA+   L  +     +LN++  A+G+I E+D++LA  S ++++ F+ +   K    A   G+ I+ YN+IY   D++ + ++G+L+PVF EK +G  EIR+++S   +G +AG  +  G+I RNA  R+ R D  ++   K+ +LR  KD +   A G ECG  LEN+ND   GDI+E +E+
  S:   374 SETITIGELAKRMGIKATDLIKAMMKMGSMVTINHVLDHDAAVLLASDYGYEVEN-VAVDLDEILEFTP--DAPELLQERPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELHGRKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTKEAINHSKAAGVPIIVAINKIDKPDARPEKVKQELTEHGIVSSEWGGDVTMVEVSAKKRLNLEELLEMILLQADLMDLKANPDKAAKGTIVEGKLDKGRGPVATVLVQEGTLRTGDYCVVGVHSGRVRAMQNDRGERVLAAGPAMPVEVVGLPGVPDAGDIFVAMTDEKQAKEIATLRQIKQRELELAKHAKMSLEQLYEKIQKGEVKDLNVIVKADVQGSVEAVAESLRKLSTEAVRLNVIHTAVGAITETDVNLATASNAIIIGFSIRPEVKAQAMAEKEGVDIRLYNVIYDAVDDVRKAMEGLLEPVFKEKYLGRAEIREIFSVPKVGNVAGCYIQDGKILRNAQVRLLR-DNVVVYQGKLGTLRRFKDDVKEVATGYECGMGLENYNDIKVGDIIEAFEM 942
>gi|171778098|ref|ZP_02919355.1| hypothetical protein STRINF_00190 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283080|gb|EDT48504.1| hypothetical protein STRINF_00190 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (884 aa)
Score = 1102, Expect = 4.8e-118, Identities = 250/568 (44%), Positives = 370/568 (65%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE---DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LFL G+    N  LD   +  L +++G +  K+++++E   + F  +  + + +++++ R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+      ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  ++   WGG    ++ SA   + IDELLE +++ AE+ ELKA+P   A G  IEA +DKG+G VA LLVQ GTL V D I+VG  +G+V+ MV+   + +K A PSTPV I+GLN +P +GD + V  DEK           + L ++RQ+ T++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+++V +A+G+INESD+ LA  SK+ ++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP + EK IG   IR+ +  S +G I G  V +G+I R+A AR+ R D  +I + ++ SL+H KD +     G+E G  +EN+ND    D++E Y
  S:   303 FEYTEGMTVAEIAKRIKREPAEIVKKLFLMGVMATQNQSLDSDTIELLMVDYGIEAHKKVEVDEADIERFFADEGYLNPDEMVE-RAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASITDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVIGELAEHGIISTAWGGDCEFVEISAKFGKNIDELLETVLLVAEMEELKADPTVRAIGTVIEARLDKGKGPVATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKVAEPSTPVSITGLNDVPMAGDHFAVYEDEKAARAAGEERAKRALMKQRQV-TQRVSLENLFDTLKAGE--VKTVNVIIKADVQGSVEALAASLLKIDVEGVKVSVVHSAVGAINESDVTLAEASKAFIIGFNVRPTPQARQQAETDEVEIRLHSIIYKVIEEVEDAMKGMLDPEYKEKIIGEAIIRETFKVSKVGTIGGFMVTSGKITRDANARVIR-DGVVIFDGRLASLKHFKDDVKEIGNGQEGGLRIENYNDIKVDDVIEAY 877
>gi|24213643|ref|NP_711124.1| translation initiation factor IF-2 [Leptospira interrogans serovar Lai str. 56601] >gi|39931289|sp|Q8F7K1|IF2_LEPIN Translation initiation factor IF-2 >gi|24194445|gb|AAN48142.1|AE011278_3 Translation initiation factor IF-2 [Leptospira interrogans serovar Lai str. 56601] (880 aa)
Score = 1102, Expect = 4.8e-118, Identities = 251/565 (44%), Positives = 361/565 (63%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT-----------NLNE--NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N+ + E +KK+N    ++I  L   G+   +N ++D      L  E+G   K  + + E+  ++  K +++ED ++ RPP+VTIMGHVDHGKT LLDTIR+S V  TE+G ITQ IGAYQV   + LITF DTPGHEAF+ MRA GA +TDIVVLVVAADDG+ PQT EAI HA  A+ PI+V INK+D   AN EKI  +LA   +  EEWGG+TM  K SA  N GID+LLE I++ AE+M+LKANPKR A G  IEA +D G G+VA +L+Q+GTL V D  + G + G+V+ M +   + I+ A P+ P +++G++G+P +G  +    DEK  + +S+ R    +  ++ N G            N+NE      +KEL VI+K D  GS EAIK  L  +     KLN++++  G+I + D+ LA  S +L++ F+ + + K    A   G+ IK YNIIYQ+ DEI+  ++G+L+P  +E+ IG+ EIR+++  S IG IAG  VL+G+I+++A  R+   D       K+ SL+  KD +    AG ECG  ++ +NDF  GD +E Y +
  S:   302 NVQVGELAKKMNLKPGDVIGKLMKMGMMVTINNIIDAETAALLADEYGCKVKV-VSLYEETIIEEEK-DNQEDYIN-RPPVVTIMGHVDHGKTKLLDTIRRSSVIDTESGGITQHIGAYQVRTARGLITFLDTPGHEAFTSMRARGAKVTDIVVLVVAADDGVMPQTLEAISHAKAAEVPILVAINKIDLPAANPEKIMQELANHGLQSEEWGGETMYAKISARENIGIDKLLEMILLQAEVMDLKANPKRRAKGTIIEAKLDPGRGSVATVLIQNGTLRVGDPFVAGVFSGRVRAMYNDLGQLIQEAGPAFPAQVTGIDGVPDAGAPFDAMADEKEARNISQHR---IEFERIGNAGAATGTSSKVTLENMNEFIKQGALKELKVIIKADVRGSAEAIKESLEKLSTPEVKLNVIQSGAGAIVDMDVMLASASNALIIGFHVRANPKTIALAEKEGVQIKYYNIIYQVVDEIKLAMEGLLEPEKIEEVIGTAEIREIFKVSKIGNIAGCMVLSGKIQKSANIRVI-GDGVTKFEGKLKSLKRVKDDVNDVVAGFECGIQVDGYNDFKVGDTIEAYNV 872
>gi|170756036|ref|YP_001781961.1| translation initiation factor IF-2 [Clostridium botulinum B1 str. Okra] >gi|169121248|gb|ACA45084.1| translation initiation factor IF-2 [Clostridium botulinum B1 str. Okra] (688 aa)
Score = 1102, Expect = 5.0e-118, Identities = 247/560 (44%), Positives = 364/560 (65%)
  Q:    53 IDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + E S K+ K  AE+IK L L G+  ++N  ++     +L  +F  +  +E +  ED+  D ++  + E+ L KR PI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     ITF DTPGH AF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI H   A  P+IV INK+D+  ANI+K+  +L E  ++ E+WGG T+ +  SA   +GID+LLE I++++EI+ELKANP R A G  +EA +DKG G VA LL+Q+GTL V D I+VG  YG+++ M +   + IK+A PSTPV I GL+ +P++GDK+    +EK  + +++KR+         +T +  L +    + E +  +KEL +I+K D  GS+EA+K  L  +     K+ ++   +G+INE+D+ LA  S  +++ FN +  +     +   G+ IK Y +IY   ++I+  + G+L+P F E  IG+ E+RQ++  SS+G IAG  + TG++ RNA AR+ R D  +I  +++ SL+  KD     A G ECG ++E FND  EGDI+E +
  S:   114 VKEISDKLEKSYAEVIKELMLMGVMASVNQEINFEMAEKLAAKFDTEILREDEDEEDDLEDILRDNEEEEYLQKRSPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVELNGEAITFLDTPGHAAFTAMRARGAQVTDIVILVVAADDGIMPQTQEAISHCKAANVPLIVAINKIDRPGANIDKVKQELTEYGLVAEDWGGDTICVPVSAHTKEGIDDLLEMILLSSEILELKANPNRKAKGTVVEAKLDKGRGPVATLLIQNGTLRVGDSIVVGSTYGRIRAMFNDKGRNIKSAGPSTPVEILGLSEVPEAGDKFYQVKEEKTARSIADKRKEKIRDEYLQSTHKVSLEDLYNQIQEGT--VKELGLIVKADVQGSVEALKQSLEKLSTGEVKVRVIHGGVGAINETDVTLATASNGIILGFNVRPDNNAIIASEKDGVDIKTYRVIYDAIEDIKSAMLGMLEPEFKEVVIGTAEVRQVYKISSVGTIAGAYIQTGKLARNAGARVIR-DGIVIFESELASLKRFKDDAKEVAQGYECGLSIEKFNDIKEGDIIECF 678
>gi|9558369|emb|CAC00485.1| initiation Factor 2 [Streptococcus agalactiae] >gi|9558372|emb|CAC00487.1| initiation factor 2 [Streptococcus agalactiae] (927 aa)
Score = 1101, Expect = 5.4e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|62548349|gb|AAX86820.1| translation initiation factor B [Streptococcus agalactiae] (927 aa)
Score = 1101, Expect = 5.4e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|25010490|ref|NP_734885.1| translation initiation factor IF-2 [Streptococcus agalactiae NEM316] >gi|76787439|ref|YP_329101.1| translation initiation factor IF-2 [Streptococcus agalactiae A909] >gi|61226330|sp|P0A3K6|IF2_STRA3 Translation initiation factor IF-2 >gi|61226331|sp|P0A3K7|IF2_STRAG Translation initiation factor IF-2 >gi|90101383|sp|Q3K302|IF2_STRA1 Translation initiation factor IF-2 >gi|3947714|emb|CAA05919.1| initiation factor IF2 [Streptococcus agalactiae] >gi|9558375|emb|CAC00489.1| initiation factor 2 [Streptococcus agalactiae] >gi|9558378|emb|CAC00491.1| initiation factor 2 [Streptococcus agalactiae] >gi|18031897|gb|AAL12495.1| translation initiation factor B [Streptococcus agalactiae] >gi|23094843|emb|CAD46061.1| initiation factor 2 [Streptococcus agalactiae NEM316] >gi|62548347|gb|AAX86819.1| translation initiation factor B [Streptococcus agalactiae] >gi|76562496|gb|ABA45080.1| translation initiation factor IF-2 [Streptococcus agalactiae A909] (927 aa)
Score = 1101, Expect = 5.4e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|2497280|sp|P55875|IF2_STIAU Translation initiation factor IF-2 >gi|1934983|emb|CAA61162.1| initiation factor 2 (IF2) [Stigmatella aurantiaca] (1054 aa)
Score = 1101, Expect = 5.5e-118, Identities = 229/571 (40%), Positives = 348/571 (60%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNL-------NENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V      +++ +  +++   +++IIK L   G     N ++D   +  +  ++G+   + +    +++L  +    R +    RPP+VT+MGHVDHGKT+LLD IR + VA+ EAG ITQ IGAY V   +  ITF DTPGHEAF+ MRA GA++TDIV+LVVAADDG+ PQT EAI HA  A+ PI+V +NKMD   AN +++   LA   ++ EEWGG+T+++  SA    GID LLE +++ AE++EL +NP R A G  IE  +D+G G VA +LVQ GTL V D ++ G  YG+V+ M +   + +K  LP     + GL+G+P +GD   V  DEK  K+++E R +  +Q +LS              +   G KEL V++K D  GS EA+K  +  +     K+ ++   +G+I ESD+  A  SK +V+ FN K  S     A + G+ +++++IIY++ D +   ++ +L+P+  E+++G  E+R  ++   +G IAG  VL G IKR AF R+ R++K++ +  K+ SLR  KD +   A G ECG  +ENFND   GDI+E YEI
  S:   473 VIKLQEGISVSDLGQRMGVRTSDIIKKLMGLGKMATANQMVDADTVELIASDYGWKVDR-VGFEVEDYLPEVV--ARPEDARTRPPVVTVMGHVDHGKTSLLDAIRAANVASGEAGGITQHIGAYSVTTARGDITFLDTPGHEAFTSMRARGANVTDIVILVVAADDGVMPQTIEAIKHAKAAEVPIVVALNKMDVPGANPDRVKKDLANHELVPEEWGGETIMVPVSAKQKMGIDLLLENVVLQAEVLELTSNPSRPAVGAIIEGELDRGRGPVATVLVQEGTLRVGDAVVTGTDYGRVRAMNNSRGESVKEVLPGYCAEVIGLSGVPSAGDTINVVADEKAAKQIAEHRGMKERQSELSKVSRETLDQLFAKTKAGGGPKELRVVIKADVQGSAEAVKQAVQKLTTHKVKVEVIDTGVGAITESDVMRAAASKGVVLGFNVKPESGAESAAKAEGVMLRSFSIIYELIDGVRSSMEELLEPIRTERKLGRAEVRNTFNVPKLGTIAGAAVLDGVIKRGAFVRLMRENKQLFA-GKMASLRRFKDDVKEVAQGFECGIGIENFNDLKAGDIIEAYEI 1046
>gi|118579399|ref|YP_900649.1| translation initiation factor IF-2 [Pelobacter propionicus DSM 2379] >gi|166232570|sp|A1AMM1|IF2_PELPD Translation initiation factor IF-2 >gi|118502109|gb|ABK98591.1| bacterial translation initiation factor 2 (bIF-2) [Pelobacter propionicus DSM 2379] (921 aa)
Score = 1101, Expect = 5.6e-118, Identities = 243/604 (40%), Positives = 373/604 (61%)
  Q:    11 TKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ K K +     +T I I    K++   IK      +  +++ E +K++   + ++IK L   G+   +N  LD      L  E+GY+ +  + ++ D  L++    D  + L KRPP+VTIMGHVDHGKT+LLD IR++ V A EAG ITQ IGAY VE     ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+H+  A  PI+V INK+DK +A  E++  +L E  ++  EWGG   +++ SA     ++ LLE +++ A++MELKANP + A G  +EA +D+G G VA +LVQ GTL   DY +VG + G+V+ + +   +++  A PS PV + GL+G+P +GD ++   DEK  KE++  RQ+  ++ +++       E+      S  +K+LNVI+K D  GS+E +      +     +LN++ + +G+I E+D++LA  S ++++ FN +   K    A   G+ I+ Y+IIY   +++++ ++G+LDP   EK +G  EIR+++S   IG IAG  V  G++ RNA AR+ R D  +I   K++SLR  KD +   AAG ECG  LEN+N+   GDI+E +EI
  S:   317 SRKKVKERASETRKTEITIPKAIKRI---IK-----ISETISVGELAKRMGIKANDLIKSLMKMGMMVTINHALDFETTVILASEYGYEVEN-MAVDLDEILESTP--DAPETLVKRPPVVTIMGHVDHGKTSLLDAIREANVIAGEAGGITQHIGAYDVELNGRKITFLDTPGHEAFTAMRARGAKVTDIVILVVAADDGVMPQTREAINHSKAAGVPIVVAINKIDKPEAKPERVKQELMEFGLVASEWGGDATMVEVSAKKRLNLEGLLEMVLLQADLMELKANPDKEAKGTIVEAKLDRGRGPVATVLVQEGTLKNGDYCVVGVHSGRVRAIHNDRGEKVNEAGPSMPVEVIGLSGVPDAGDVFVSLKDEKQAKEIATLRQIKQREIEMAKHSKVTLEDLYKQIQSGDVKDLNVIVKGDVQGSVEVVSDSFRKLSTDAVRLNVIHSGVGAITETDVNLAAASNTIIIGFNVRPEVKAQAMAEKEGVDIRLYSIIYDAVEDVKKAMEGLLDPTLKEKYLGRAEIREVFSVPKIGNIAGSYVQDGKMLRNAQARLLR-DNVVIYEGKLSSLRRIKDDVKEVAAGYECGIGLENYNNIRIGDIIEAFEI 914
>gi|24378914|ref|NP_720869.1| translation initiation factor IF-2 [Streptococcus mutans UA159] >gi|39931286|sp|Q8DVP9|IF2_STRMU Translation initiation factor IF-2 >gi|24376797|gb|AAN58175.1|AE014888_13 translation initiation factor 2 [Streptococcus mutans UA159] (916 aa)
Score = 1101, Expect = 5.7e-118, Identities = 254/568 (44%), Positives = 365/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD-----KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +  ++++++     D  +F   +D L+     +R P+VTIMGHVDHGKTTLLDT+R S++A  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++  +LAE  V+   WGG +  ++ SA   Q I+ELLE +++ AEI ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQL T +  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESDI LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG+LDP F EK IG   IR+ +  S +G I G  V  G+I R++ AR+ R D  ++ + K+ SL+H KD +     G+E G  +EN+ND    D +E Y
  S:   335 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDADTIELLMVDYGIEAHQKVEVDT---ADIERFFVEDDYLNPKNMVERAPVVTIMGHVDHGKTTLLDTLRNSRIATGEAGGITQHIGAYQIEEGGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAADVPIIVAINKIDKPGANPERVIGELAEYGVISTAWGGDSEFVEISAKFGQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLHVQDPIVVGNTFGRVRAMTNDLGRRVKVAAPSTPVSITGLNEAPMAGDHFAVYEDEKAARAAGEERAKRALLKQRQL-THRVSLDNLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDITLAEASNAVIIGFNVRPTPQARQQAEADEVEIRLHSIIYKVIEEVEDAMKGMLDPEFEEKIIGEALIRETFKVSKVGTIGGFMVTNGKITRDSSARVIR-DGVVVFDGKLASLKHYKDDVKEVGNGQEGGLMIENYNDIKIDDTIEAY 909
>gi|148556717|ref|YP_001264299.1| translation initiation factor IF-2 [Sphingomonas wittichii RW1] >gi|166198933|sp|A5VCZ5|IF2_SPHWW Translation initiation factor IF-2 >gi|148501907|gb|ABQ70161.1| bacterial translation initiation factor 2 (bIF-2) [Sphingomonas wittichii RW1] (856 aa)
Score = 1101, Expect = 6.6e-118, Identities = 245/564 (43%), Positives = 350/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRE--DLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL-ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ E + ++ +  A+++K LF  G+   +N  +D+     L  EFG++ K+      D+ +D I  +D +  + L  RPP+VTIMGHVDHGKT+LLD +R + VA+ EAG ITQ IGAYQV+ K    ITF DTPGHEAFS+MRA GA++TDIVV+VVA DDGL+PQT EAI H   A  P+I+ INKMDK  +N +++   L + +V  E  GG    ++ SAL   G+DEL+E I + AE++ELKANP R A G  +EA++DKG GAVA +LV  GTL V D  +VG   GKV+ ++D   + IK A PS PV I GL+G+P +GD+  V  +E   +E++  R     Q++ +    +L         Q  ++  V++K D  GS+EAI G L+ I     ++ ++ A +G I ESD+ LA  SK+ ++ FN + ++K  + A   G+ +K Y++IY + DEI   + G L P ++E  +G  EIR+++S    G  AG  VL G I++   ARI R D  II N  I+SLR  KD +    AG ECG TLE   D   GDIVE +E+
  S:   283 ITVGELANRMAERGADLVKALFKMGMPVTVNQSIDQDTAELLVTEFGHNIKRV----SDSDVDLITSDDVDAAETLQPRPPVVTIMGHVDHGKTSLLDALRGTDVASGEAGGITQHIGAYQVQVKSGAKITFLDTPGHEAFSEMRARGANITDIVVIVVAGDDGLRPQTIEAISHTRAAGVPMIIAINKMDKPGSNAQRVREALLQHDVQVESMGGDVQEVEVSALKKTGLDELIEKIELQAELLELKANPDRPAEGTVVEATLDKGRGAVATILVGRGTLKVGDIFVVGAESGKVRALIDDKGRNIKEAGPSLPVEILGLSGVPSAGDQLSVVENEARAREVAAYRAGVIHQKRTTAAPASLESMFSALREQKAQQYPVVVKADAQGSVEAIVGSLNKISTDLIQVRILHAGVGGITESDVSLAAASKAPIIGFNVRANAKAREIATRDGVALKYYDVIYDLLDEIRAAMAGQLGPEYLEHVVGRAEIREVFSAGKHGKAAGLLVLEGYIRQKLRARIMRDDV-IIYNGSISSLRRFKDDVPEVRAGLECGITLEATTDIKPGDIVETFEV 849
>gi|22536564|ref|NP_687415.1| translation initiation factor IF-2 [Streptococcus agalactiae 2603V/R] >gi|29427455|sp|Q8E1H3|IF2_STRA5 Translation initiation factor IF-2 >gi|22533398|gb|AAM99287.1|AE014208_27 translation initiation factor IF-2 [Streptococcus agalactiae 2603V/R] (927 aa)
Score = 1101, Expect = 6.7e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|55820437|ref|YP_138879.1| translation initiation factor IF-2 [Streptococcus thermophilus LMG 18311] >gi|81820513|sp|Q5M5V5|IF2_STRT2 Translation initiation factor IF-2 >gi|55736422|gb|AAV60064.1| translation initiation factor IF-2 [Streptococcus thermophilus LMG 18311] (943 aa)
Score = 1100, Expect = 7.1e-118, Identities = 259/568 (45%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +  K+ +++  +       ED   +D + +R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI VL+VAADDG+ PQT EAI+H+  A  PIIV INK+DK DAN E++  +LAE  V+   WGG +  ++ SA   Q I+ELLE I++ AE+ ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + IKTA PS PV I+GLN  P +GD + V  DEK           + L ++RQ  T +  L N    L      +K +NVI+K D  GS+EA+   L  I+V G ++N+V +A+G+INESDI LA  S ++V+ FN + + +    A +  + I+ ++IIY++ +EIE  +KG+LDP F EK IG   IR+ +  S +G I G  V  G+I R++ AR+ R D  +I + K+ SL+H KD +      +E G T+EN+ND    D++E Y
  S:   362 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEATKKEEVDNADIERFFVDEDYLNKDAMVERAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEGGKKITFLDTPGHAAFTSMRARGASVTDITVLIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPDANPERVIGELAEHGVISTAWGGDSEFVEISAKFGQNIEELLETILLVAEVEELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRIKTAGPSAPVSITGLNEAPMAGDHFAVYEDEKAARAAGEERAKRALMKQRQ-QTHRVSLDNLFDTLKAGE--MKTVNVIIKADVQGSVEALAASLLKIDVEGVRVNVVHSAVGAINESDITLAEASDAVVIGFNVRPTPQARQQAETDEVEIRLHSIIYKVIEEIEDAMKGMLDPEFEEKIIGEAVIRETFKVSKVGTIGGFMVTNGKITRDSSARVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLTIENYNDIKVDDVIEAY 936
>gi|145295889|ref|YP_001138710.1| translation initiation factor IF-2 [Corynebacterium glutamicum R] >gi|166232542|sp|A4QEZ2|IF2_CORGB Translation initiation factor IF-2 >gi|140845809|dbj|BAF54808.1| hypothetical protein [Corynebacterium glutamicum R] (1003 aa)
Score = 1100, Expect = 7.7e-118, Identities = 246/564 (43%), Positives = 364/564 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDL-----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KI   +A +++ LF  G        + +  +  L  E  Y  +     +ED   L++   +  ED      L KRPP+VT+MGHVDHGKT LLDTIRK+ V + EAG ITQ IGAYQV    E  +  ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK +A+ EKI  QL E  ++ EE+GG T+ +  SA     IDELL ++ +TA+  ++L ANP+  A G+ IEA +D+G G VA ++VQ GTL V D I+ G+ YG+V++MVD   ++++ A PS PV++ GLNG+P +GD  +V  D+++ ++++ +R       L  + RK   L +  + L E+S     LN+ILK DN GS+EA++  L  IE+    +LN++   +G++ ++++ LA  S ++++ FN +   K ++ A + G+ ++ Y IIY+  +E+E  LKG+L P++ E+ IG  EIR ++  SS+G+IAG  V  G+++RNA  RI R    I  NAKI SLR  KD     +AG ECG  L ++ D    D +E+YE+V
  S:   418 SLADFADKIGADAAALVQALFNLGEMVTATASVSDETLQLLGEEMNYKVQVVSPEDEDRELLESFDLQFGEDEGGEADLAKRPPVVTVMGHVDHGKTRLLDTIRKANVGSDEAGGITQGIGAYQVKVNVEDTERTITFLDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTVEAINHAKAADVPIVVAVNKIDKPEASPEKIRGQLTEYGLIPEEYGGDTIFVDISAKQGLNIDELLASVCLTADAELDLVANPEMDAQGVAIEAHLDRGRGPVATVIVQRGTLRVGDSIVAGDTYGRVRRMVDEYGRDVEEAGPSRPVQVQGLNGVPGAGDNLLVVEDDRIARQIANQRNARKRNALAARSRKRVSLEDLDSVLKEHST----LNLILKGDNAGSVEALEEALLKIEMDDEVQLNIIDRGVGAVTQTNVTLAAASDAVIIAFNVRAEGKATEEANAEGVDVRYYTIIYRAIEEVEAALKGMLKPIYEERVIGHAEIRAIFKASSVGLIAGCMVEDGKVRRNATVRITRDGNVIAENAKIVSLRREKDDATEVSAGYECGMVL-SYPDISVDDKIEVYEMV 997
>gi|77406356|ref|ZP_00783418.1| translation initiation factor IF-2 [Streptococcus agalactiae H36B] >gi|77175025|gb|EAO77832.1| translation initiation factor IF-2 [Streptococcus agalactiae H36B] (908 aa)
Score = 1100, Expect = 7.7e-118, Identities = 250/568 (44%), Positives = 363/568 (63%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +   EI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   326 FEYTEGMTVAEIAKRIKREPVEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 900
>gi|55822321|ref|YP_140762.1| translation initiation factor IF-2 [Streptococcus thermophilus CNRZ1066] >gi|81820350|sp|Q5M1B9|IF2_STRT1 Translation initiation factor IF-2 >gi|55738306|gb|AAV61947.1| translation initiation factor IF-2 [Streptococcus thermophilus CNRZ1066] (943 aa)
Score = 1100, Expect = 7.9e-118, Identities = 259/568 (45%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +  K+ +++  +       ED   +D + +R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI VL+VAADDG+ PQT EAI+H+  A  PIIV INK+DK DAN E++  +LAE  V+   WGG +  ++ SA   Q I+ELLE I++ AE+ ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + IKTA PS PV I+GLN  P +GD + V  DEK           + L ++RQ  T +  L N    L      +K +NVI+K D  GS+EA+   L  I+V G ++N+V +A+G+INESDI LA  S ++V+ FN + + +    A +  + I+ ++IIY++ +EIE  +KG+LDP F EK IG   IR+ +  S +G I G  V  G+I R++ AR+ R D  +I + K+ SL+H KD +      +E G T+EN+ND    D++E Y
  S:   362 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEATKKEEVDNADIERFFVDEDYLNKDAMVERAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEGGKKITFLDTPGHAAFTSMRARGASVTDITVLIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPDANPERVIGELAEHGVISTAWGGDSEFVEISAKFGQNIEELLETILLVAEVEELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRIKTAGPSAPVSITGLNEAPMAGDHFAVYEDEKAARAAGEERAKRALMKQRQ-QTHRVSLDNLFDTLKAGE--MKTVNVIIKADVQGSVEALAASLLKIDVEGVRVNVVHSAVGAINESDITLAEASDAVVIGFNVRPTPQARQQAETDEVEIRLHSIIYKVIEEIEDAMKGMLDPEFEEKIIGEAVIRETFKVSKVGTIGGFMVTNGKITRDSSARVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLTIENYNDIKVDDVIEAY 936
>gi|116627261|ref|YP_819880.1| translation initiation factor IF-2 [Streptococcus thermophilus LMD-9] >gi|122268136|sp|Q03M88|IF2_STRTD Translation initiation factor IF-2 >gi|116100538|gb|ABJ65684.1| bacterial translation initiation factor 2 (bIF-2) [Streptococcus thermophilus LMD-9] (943 aa)
Score = 1100, Expect = 8.1e-118, Identities = 259/568 (45%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +  K+ +++  +       ED   +D + +R P+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI VL+VAADDG+ PQT EAI+H+  A  PIIV INK+DK DAN E++  +LAE  V+   WGG +  ++ SA   Q I+ELLE I++ AE+ ELKA+P   A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + IKTA PS PV I+GLN  P +GD + V  DEK           + L ++RQ  T +  L N    L      +K +NVI+K D  GS+EA+   L  I+V G ++N+V +A+G+INESDI LA  S ++V+ FN + + +    A +  + I+ ++IIY++ +EIE  +KG+LDP F EK IG   IR+ +  S +G I G  V  G+I R++ AR+ R D  +I + K+ SL+H KD +      +E G T+EN+ND    D++E Y
  S:   362 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEATKKEEVDNADIERFFVDEDYLNKDAMVERAPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEGGKKITFLDTPGHAAFTSMRARGASVTDITVLIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPDANPERVIGELAEHGVISTAWGGDSEFVEISAKFGQNIEELLETILLVAEVEELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRIKTAGPSAPVSITGLNEAPMAGDHFAVYEDEKAARAAGEERAKRALMKQRQ-QTHRVSLDNLFDTLKAGE--MKTVNVIIKADVQGSVEALAASLLKIDVEGVRVNVVHSAVGAINESDITLAEASDAVVIGFNVRPTPQARQQAETDEVEIRLHSIIYKVIEEIEDAMKGMLDPEFEEKIIGEAVIRETFKVSKVGTIGGFMVTNGKITRDSSARVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLTIENYNDIKVDDVIEAY 936
>gi|123969230|ref|YP_001010088.1| translation initiation factor IF-2 [Prochlorococcus marinus str. AS9601] >gi|189028342|sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 >gi|123199340|gb|ABM70981.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. AS9601] (1126 aa)
Score = 1100, Expect = 8.3e-118, Identities = 245/572 (42%), Positives = 372/572 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + V  +NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + +IQ   +  +D I+ ED ++L+ +RPP++T+MGHVDHGKT+LLD+IR+S++A+ EAG ITQ IGAYQVE+    +K  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG +PQT EAI HA  AK PI+V INK+DK+ A+ E++  +L+EK+++ E+WGG T+++  SA+  Q ID+LLE I++ +++ +L+ANP R A G  IEA +DK +G VA LLVQ+GTL   D +  G   GK++ MVD +   IK A PS PV   G + +P +GD++ V  DEK  + +  +R  + +  KL+             +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+DIDLA  S S++V FNT ++S     A +  + I+ Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R  +S    G IAG  + TG+++RN   R+ R +K +I    ++SL+  KD +     G ECG   + F+ +VEGD++E ++ V
  S:   536 IIVPEDNLTVQELADKLSLESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDIQEAAEKTVDMIESEDIDNLI-RRPPVITVMGHVDHGKTSLLDSIRESRIASGEAGGITQHIGAYQVEFEHESQKKKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGCRPQTLEAISHARAAKVPIVVAINKIDKEGASPERVKQELSEKDLIAEDWGGDTVMVPVSAIKKQNIDKLLEMILLVSDVEDLQANPDRFAKGTVIEAHLDKAKGPVATLLVQNGTLKSGDVLAAGSVLGKIRAMVDEHGNRIKEAGPSFPVEALGFSEVPTAGDEFEVYPDEKTARAIVGERATDARATKLAQQMASRRVSLSSLSTQANDGELKELNLILKADVQGSVEAILGSLEQLPKNEVQVRVLLSAPGEITETDIDLAAASGSVIVGFNTSLASGAKRAADANDVDIREYEVIYKLLEDIQLAMEGLLEPDLVEESLGQAEVRATFSVGK-GAIAGCYIQTGKLQRNCSLRVIRSEK-VIFEGNLDSLKRVKDDVKEVNTGFECGVGCDKFSSWVEGDVIEAFKFV 1118
>gi|9558387|emb|CAC00497.1| initiation factor 2 [Streptococcus agalactiae] (927 aa)
Score = 1100, Expect = 8.5e-118, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|9558381|emb|CAC00493.1| initiation factor 2 [Streptococcus agalactiae] >gi|9558384|emb|CAC00495.1| initiation factor 2 [Streptococcus agalactiae] (927 aa)
Score = 1099, Expect = 1.0e-117, Identities = 251/568 (44%), Positives = 364/568 (64%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +   + +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALVASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|62390825|ref|YP_226227.1| translation initiation factor IF-2 [Corynebacterium glutamicum ATCC 13032] >gi|41326163|emb|CAF20326.1| Translation initiation factor 2 (GTPase) [Corynebacterium glutamicum ATCC 13032] (1004 aa)
Score = 1099, Expect = 1.0e-117, Identities = 246/564 (43%), Positives = 364/564 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDL-----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KI   +A +++ LF  G        + +  +  L  E  Y  +     +ED   L++   +  ED      L KRPP+VT+MGHVDHGKT LLDTIRK+ V + EAG ITQ IGAYQV    E  +  ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK +A+ EKI  QL E  ++ EE+GG T+ +  SA     IDELL ++ +TA+  ++L ANP+  A G+ IEA +D+G G VA ++VQ GTL V D I+ G+ YG+V++MVD   ++++ A PS PV++ GLNG+P +GD  +V  D+++ ++++ +R       L  + RK   L +  + L E+S     LN+ILK DN GS+EA++  L  IE+    +LN++   +G++ ++++ LA  S ++++ FN +   K ++ A + G+ ++ Y IIY+  +E+E  LKG+L P++ E+ IG  EIR ++  SS+G+IAG  V  G+++RNA  RI R    I  NAKI SLR  KD     +AG ECG  L ++ D    D +E+YE+V
  S:   419 SLADFADKIGADAAALVQALFNLGEMVTATASVSDETLQLLGEEMNYKVQVVSPEDEDRELLESFDLQFGEDEGGEADLAKRPPVVTVMGHVDHGKTRLLDTIRKANVGSDEAGGITQGIGAYQVKVNVEDTERTITFLDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTVEAINHAKAADVPIVVAVNKIDKPEASPEKIRGQLTEYGLIPEEYGGDTIFVDISAKQGLNIDELLASVCLTADAELDLVANPEMDAQGVAIEAHLDRGRGPVATVIVQRGTLRVGDSIVAGDTYGRVRRMVDEYGRDVEEAGPSRPVQVQGLNGVPGAGDNLLVVEDDRIARQIANQRNARKRNALAARSRKRVSLEDLDSVLKEHST----LNLILKGDNAGSVEALEEALLKIEMDDEVQLNIIDRGVGAVTQTNVTLAAASDAVIIAFNVRAEGKATEEANAEGVDVRYYTIIYRAIEEVEAALKGMLKPIYEERVIGHAEIRAIFKASSVGLIAGCMVEDGKVRRNATVRIIRDGNVIAENAKIVSLRREKDDATEVSAGYECGMVL-SYPDISVDDKIEVYEMV 998
>gi|186460899|ref|ZP_02971192.1| translation initiation factor IF-2 [bacterium Ellin514] >gi|184202376|gb|EDT99588.1| translation initiation factor IF-2 [bacterium Ellin514] (886 aa)
Score = 1099, Expect = 1.1e-117, Identities = 240/570 (42%), Positives = 359/570 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLD------NIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV-----EWKKHL--ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK--------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           + + E ++++     ++I  L   G+  N+N  +DE     +C ++GY F+ E +      +        +  ED+ + L  R P+VTIMGHVDHGKTTLLD IRKS V A EAG ITQ IGAY +     E K  L  ITF DTPGH AFS MRA GA++TDIVVLVVAA+DG+ PQT EA+ HA  AKA I+V +NK+D  +AN  ++  QL EK ++CEEWGGKT+ +  SA+  QG+D+LLEAI++ AEIMELKANP R A G  IE+ ++ G G  A +LV+ GTL + D ++ G +YGKV+ +++   K +K A PS  V++ GLNG+P++G ++ V  +EK  ++++EKR +  +        +  L N    ++  S   K L +++K D  GS+EAI   L  IE     L ++ +A+G+I ESD+ LA  S ++++ F+T++ + VSD A   G+ IK Y IIY++ D+++  + G+LDP++ +  +G+ E+R+++  S    +AG  +  G I R     ++RK   +I      SLR  +D +    AG ECG  L+ F DF  GD +E Y +   T +
  S:   300 IVVRELAEQLKLKPFKLIADLMELGVFANVNQAIDESVAQRICAKYGYRFEVEKRERGSGIIHAPIKKIEVDIEDKPEQLKPRAPVVTIMGHVDHGKTTLLDVIRKSDVVAGEAGGITQHIGAYTISFPHPERKNELQQITFLDTPGHAAFSAMRARGANVTDIVVLVVAANDGVMPQTLEALSHAQAAKAEIMVAVNKVDHPNANPMRVRQQLQEKGLVCEEWGGKTLFVDVSAITKQGVDKLLEAILLQAEIMELKANPDRRAKGNVIESGLEPG-GPTATVLVRKGTLHLGDVVICGPFYGKVRALINEENKRLKEAGPSVAVKLLGLNGVPEAGLEFTVEENEKEARDIAEKRTMEARAMGQEARAKVTLENLFATMSSTSA--KVLKLVVKADTQGSVEAIVEALKKIESDKVSLEVIHSAVGTITESDVALASASNAVILGFHTRIDNGVSDEAKREGVQIKLYAIIYELIDQVKESMAGLLDPLYKDVVVGTAEVRKIFELSKGIPVAGCMITNGRIVRGKVRVMRRKG--LIFEGVTQSLRRFQDEVNEVRAGMECGIRLDGFGDFQIGDTIECYTVEKTTQK 885
>gi|19553189|ref|NP_601191.1| translation initiation factor IF-2 [Corynebacterium glutamicum ATCC 13032] >gi|39931293|sp|Q8NP40|IF2_CORGL Translation initiation factor IF-2 >gi|21324755|dbj|BAB99378.1| Translation initiation factor 2 (GTPase) [Corynebacterium glutamicum ATCC 13032] (1004 aa)
Score = 1099, Expect = 1.1e-117, Identities = 246/564 (43%), Positives = 364/564 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDL-----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KI   +A +++ LF  G        + +  +  L  E  Y  +     +ED   L++   +  ED      L KRPP+VT+MGHVDHGKT LLDTIRK+ V + EAG ITQ IGAYQV    E  +  ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK +A+ EKI  QL E  ++ EE+GG T+ +  SA     IDELL ++ +TA+  ++L ANP+  A G+ IEA +D+G G VA ++VQ GTL V D I+ G+ YG+V++MVD   ++++ A PS PV++ GLNG+P +GD  +V  D+++ ++++ +R       L  + RK   L +  + L E+S     LN+ILK DN GS+EA++  L  IE+    +LN++   +G++ ++++ LA  S ++++ FN +   K ++ A + G+ ++ Y IIY+  +E+E  LKG+L P++ E+ IG  EIR ++  SS+G+IAG  V  G+++RNA  RI R    I  NAKI SLR  KD     +AG ECG  L ++ D    D +E+YE+V
  S:   419 SLADFADKIGADAAALVQALFNLGEMVTATASVSDETLQLLGEEMNYKVQVVSPEDEDRELLESFDLQFGEDEGGEADLAKRPPVVTVMGHVDHGKTRLLDTIRKANVGSDEAGGITQGIGAYQVKVNVEDTERTITFLDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTVEAINHAKAADVPIVVAVNKIDKPEASPEKIRGQLTEYGLIPEEYGGDTIFVDISAKQGLNIDELLASVCLTADAELDLVANPEMDAQGVAIEAHLDRGRGPVATVIVQRGTLRVGDSIVAGDTYGRVRRMVDEYGRDVEEAGPSRPVQVQGLNGVPGAGDNLLVVEDDRIARQIANQRNARKRNALAARSRKRVSLEDLDSVLKEHST----LNLILKGDNAGSVEALEEALLKIEMDDEVQLNIIDRGVGAVTQTNVTLAAASDAVIIAFNVRAEGKATEEANAEGVDVRYYTIIYRAIEEVEAALKGMLKPIYEERVIGHAEIRAIFKASSVGLIAGCMVEDGKVRRNATVRIIRDGNVIAENAKIVSLRREKDDATEVSAGYECGMVL-SYPDISVDDKIEVYEMV 998
>gi|77919155|ref|YP_356970.1| translation initiation factor IF-2 [Pelobacter carbinolicus DSM 2380] >gi|90101366|sp|Q3A4A7|IF2_PELCD Translation initiation factor IF-2 >gi|77545238|gb|ABA88800.1| bacterial translation initiation factor 2 (bIF-2) [Pelobacter carbinolicus DSM 2380] (947 aa)
Score = 1098, Expect = 1.3e-117, Identities = 239/564 (42%), Positives = 355/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNI----KFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-----SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ E +K++   S ++I  L  +G    +N  LD      L  EF Y+ +  +  +E+N L +     +  D E+    RPP+VTIMGHVDHGKT+LLD IR + V   EAG ITQ IGAY V      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT+EAI+H+  A  PIIV +NKMDK DAN +++  +L E  ++ EEWGG T+ ++ SA N   +D LLE +++ AE++ELKANP + A G  +EA +D+G G VA +LV+ GTL + D I+ G +YGKV+ M +   + ++ A P+ PV ++GL+G P +GD +     EK  KE++  RQ   ++++L++      E       +G ++EL VI+K D  GS+EA++  L  +     +L ++  A+G INESD+ LA  S ++++ FN +  SK +  A + G+ I+ YN+IY   ++I   ++G+L P   EK +G VE+R+ +  S +G IAG  V  G++ RNA  R+ R D  +I   K+ SL+  KD       G ECG +LEN+ND   GDI+E++E+
  S:   369 ITVGELAKRMGVKSKDLITELMRQGQMVTINHPLDFETAAILASEFNYEVEN-VAFDEENLLADTAAVTEEGDSEEGCVPRPPVVTIMGHVDHGKTSLLDAIRATNVTGGEAGGITQHIGAYDVSVDDKKITFLDTPGHEAFTSMRARGAKVTDIVILVVAADDGVMPQTKEAINHSKAAGVPIIVAVNKMDKPDANSDRVKQELTEFEMIPEEWGGDTIFVEVSAKNRTNLDSLLEMVLLQAEVLELKANPNKRAKGAIVEARLDRGRGPVATVLVEEGTLRIGDPIVSGLHYGKVRTMTNDRGERLEEAGPACPVEVTGLSGTPTAGDSFHAVESEKDAKEVATHRQRKVREQELASTSKISLEQLYARMQEGEVQELKVIIKADVQGSVEAVRDSLVKLSTDACRLVVIHTAVGGINESDVSLASASDAIILGFNVRAESKAAALAETEGVDIRFYNVIYDAVNDIRDAMEGLLAPTLREKHLGKVEVRETFHVSKVGTIAGCYVTEGKVLRNAQVRLIR-DHVVIWEGKLASLKRFKDDAREVQNGYECGLSLENYNDIKVGDIIEVFEM 940
>gi|75908088|ref|YP_322384.1| translation initiation factor IF-2 [Anabaena variabilis ATCC 29413] >gi|123745194|sp|Q3MBZ7|IF2_ANAVT Translation initiation factor IF-2 >gi|75701813|gb|ABA21489.1| bacterial translation initiation factor 2 (bIF-2) [Anabaena variabilis ATCC 29413] (1038 aa)
Score = 1098, Expect = 1.3e-117, Identities = 250/592 (42%), Positives = 371/592 (62%)
  Q:    24 RTNIDIKSQFKKVETGIKNG---VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG---TNLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           R++ + + Q ++ ET +K         T  +T+ E +  +     EI+K LF+KG+  ++   LD   +  +  E   + +  E +       + I+  D E LL +RPP+VTIMGHVDHGKTTLLD+IRK+KVAA EAG ITQ IGAY V+     K+  I F DTPGHEAF+ MRA GA +TDI VLVVAADDG++PQT EAI HA  A  PI+V INK+DK+ A  +++  +L +  +  EEWGG+T+++  SA+  + +D LLE I++ AE+ EL ANP R A G  IEA +DK +GAVA LL+Q+GTL V D +L G  +GKV+ MVD   + +  A PS  V + GL+ +P +GD++ V ++EK  + L+  R    +  +L       T L+  +Q   +KELN+ILK D  GS+EAI G L  I     ++ ++  A G I E+DIDLA  S ++++ FNT  +S     A   G+ ++ YNIIY++ ++I+  L+G+L+P  VE+ +G  E+R ++     G +AG  V +G++ RN   R++R  K +I    ++SL+  KD      AG ECG  ++ F+D+ EGDI+E Y++V
  S:   427 RSSHNNRDQNRRQETEVKRERPEKVAVTGPMTVQELADLLAVADTEIVKILFMKGMAVSITQNLDIPTITLVGKELEIEVETAEPEAEARKVTEMIEVGDLEHLL-RRPPVVTIMGHVDHGKTTLLDSIRKTKVAAGEAGGITQHIGAYHVDIVHDGKEQQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDGVRPQTVEAISHAQAAGVPIVVAINKIDKEGAQPDRVKQELTQYGLTPEEWGGETIMVPVSAIKGENLDTLLEMILLVAEVGELSANPDRNARGTVIEAHLDKAKGAVATLLIQNGTLHVGDILLAGSAFGKVRAMVDDRGRRVDIAGPSFAVEVLGLSDVPAAGDEFEVFDNEKEARALASDRADKQRLSRLLQGRVTLTTLSAQAQEGELKELNLILKGDVQGSVEAIVGSLKQIPQNEVQIRMLLTAAGEITETDIDLAAASGAVIIGFNTTFASGARQAADEAGVDVREYNIIYKLIEDIQGALEGLLEPELVEEPLGQTEVRAVFPVGR-GAVAGCYVQSGKLVRNCKVRVRRAGK-VIYEGVLDSLKRMKDDAREVNAGYECGIGVDKFHDWAEGDIIESYQMV 1028
>gi|118444571|ref|YP_878209.1| translation initiation factor IF-2 [Clostridium novyi NT] >gi|166918483|sp|A0Q0Q7|IF2_CLONN Translation initiation factor IF-2 >gi|118135027|gb|ABK62071.1| translation initiation factor IF-2 [Clostridium novyi NT] (683 aa)
Score = 1098, Expect = 1.4e-117, Identities = 247/566 (43%), Positives = 368/566 (65%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + +T+   + K+ K + E+IK L   G+   +N  LD     +L  +F       I   ED+ +   + ED ++  +KRPP+VT+MGHVDHGKT++LD IRK+KV +TEAG ITQ IGAY V      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+H   A+ P+IV INK+DK  AN++++  +L E N++ E+WGG  + +  SA   +G+D LLE II+TAE+ ELKA+P+R A G  IEA +DKG G VA LLVQ+GTL V D I+VG  YG+++ M D   K IK A PS PV I GL+ +P +GD++ V  DEK  + +++KR+   +++++ +  TN        N+  +G +KEL+VI+K D  GS+EA+   L  +     K+ ++  A+G+I+E+D+ LA  S ++++ FN + S+  +  A   G+ ++ Y +IY   D+I+  + G+L+P + E  +GS E+R ++  SS+G IAG  VL G+I R++  R+ R D  +I  ++I+SL+  KD     A G ECG ++E FND  EGDI+E + +
  S:   110 DTITVKALADKLKKPTTEVIKQLMFMGVMAAINQELDFNTAEKLAEKF----NAVIMQKEDDTITK-EIEDEDEGTEKRPPVVTVMGHVDHGKTSILDAIRKAKVTSTEAGGITQHIGAYTVNVNGEKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDGIMPQTIEAINHCKAAEVPMIVAINKIDKPAANLDRVKQELTEHNLIPEDWGGDVITVPVSAHTKEGLDTLLEMIILTAEMEELKADPERKAKGTVIEAKLDKGRGPVASLLVQNGTLKVGDSIIVGNTYGRIRAMFDDKGKNIKVAGPSIPVEILGLSEVPDAGDRFNVVKDEKTARNMADKRKEKLREKRMQS--TNKVSLEDLYNQIQEGKVKELDVIVKADVQGSVEAVIQSLEKLSTDSVKVRVIHGAVGAISETDVTLAAASNAVIIGFNVRPSNNATVLAEKEGVNVRTYRVIYDALDDIKAAMVGMLEPEYKEVVLGSAEVRVVYKISSVGTIAGCYVLNGKITRDSSVRVIR-DGIVIFESEISSLKRFKDDAKEVAKGYECGLSVEKFNDIKEGDIIEAFTM 675
>gi|33862050|ref|NP_893611.1| translation initiation factor IF-2 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|39931223|sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 >gi|33634268|emb|CAE19953.1| Translation initiation factor IF-2 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (1169 aa)
Score = 1098, Expect = 1.4e-117, Identities = 243/572 (42%), Positives = 368/572 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + +  +NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + ++Q      +D I+ +D E L+ KRPP++T+MGHVDHGKT+LLD+IR+S+VA+ EAG ITQ IGAYQVE+    KK  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG +PQT EAI HA  AK PI+V INK+DK+ A+ +++  +L+EK+++ E+WGG  +++  SA+  Q ID+LLE I++ +E+ +L+ANP+RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GK++ MVD +   IK A PS PV   G + +P +GD++ V  DEK  + +   R  + +  KL+             +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+DIDLA  S S+++ FNT ++S     A +  + I+ Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R  ++    G IAG  + +G+++RN   R+ R DK +I    ++SL+  KD +     G ECG   + F+ + EGDI+  ++ V
  S:   579 IIIPEDNLTVQELADKLSLESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDVQEAAKKTVDMIETDDIESLI-KRPPVITVMGHVDHGKTSLLDSIRESRVASGEAGGITQHIGAYQVEFEHESKKKKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGCRPQTLEAISHARAAKVPIVVAINKIDKEGASPDRVKQELSEKDLIAEDWGGDVVMVPVSAIKKQNIDKLLEMILLVSEVEDLQANPERLAKGTVIEAHLDKAKGPVATLLVQNGTLKAGDVLAAGSVLGKIRAMVDEHGNRIKEAGPSCPVEALGFSEVPTAGDEFEVYRDEKSARAIVGDRATDARATKLAQQMASRRVSLSSLSTQANDGELKELNLILKADVQGSVEAILGSLEQLPKNEVQVRVLLSAPGEITETDIDLAAASGSVIIGFNTSLASGAKRAADANDVDIREYEVIYKLLEDIQSAMEGLLEPDLVEESLGQAEVRATFAVGK-GAIAGCYIQSGKLQRNCSLRVLRSDK-VIFEGNLDSLKRSKDDVKEVNTGFECGVGCDKFSTWSEGDIISAFKFV 1161
>gi|118587521|ref|ZP_01544945.1| translation initiation factor 2 [Oenococcus oeni ATCC BAA-1163] >gi|118431972|gb|EAV38714.1| translation initiation factor 2 [Oenococcus oeni ATCC BAA-1163] (829 aa)
Score = 1097, Expect = 1.6e-117, Identities = 238/564 (42%), Positives = 361/564 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK--EIQINE-DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + + + +K I++   EI+K LFL G+  N N  LD   +  L  ++  + K+  E+ +++ D F D    +  +  L  R PIVTIMGHVDHGKTTLLD +R + V   EAG ITQ IGAYQ      LITF DTPGHEAF++MRA GA++TDI +LVVAADDG+ PQT EAI HA  AK PIIV INK+D    +   + ++L + +++ EE+GG T+ +  SA   Q +D+LLE I++ A++M+LK++P   + G  IEA +DKG GAVA LL+Q GTL   D I+VG  +G+V+ M D + K++ +ALP+TPV I+GLN +P++GD ++V + EK  +E  E R     + + +N      +        Q +K +++I+K D  GS+EA+   L  I+V G +++++ AA+G+INESDI+LA  S ++++ FN +   +    A    + ++ YN+IY   +E+E  +KG L+PV+ EK +G+V +R+L+  S IG IAGG V  G I  ++  R+ R D  ++ + ++ SL+HGKD +     G E G T+ N+ND   GD++E Y +
  S:   251 MNVQDIAKIIHRDVTEILKKLFLLGVVVNQNKSLDADTIELLAADYNIEAKQKEEVDVSDIDRFFDKTDNDIDQSKLVSRAPIVTIMGHVDHGKTTLLDYLRHTHVTEGEAGGITQHIGAYQARLHDRLITFLDTPGHEAFTEMRARGANVTDITILVVAADDGIMPQTIEAIHHAQAAKTPIIVAINKIDIPGVDPNNVINELMKYDLVPEEYGGSTIEVPISAKTGQNVDKLLEMILLQADMMDLKSDPTAKSRGSVIEARLDKGRGAVATLLIQQGTLKTGDPIVVGNTFGRVRTMNDASHKKLDSALPATPVEITGLNEVPQAGDHFVVMDSEKDAREAGESRAKKAMEEERNNGAVVTLDTLFSTMAKQDMKTVSLIVKADVQGSVEALSASLKKIKVEGVRVDILHAAVGAINESDINLAEASGAIIIGFNVRPVGQAKTDAEQKHVDVRLYNVIYDAINEVEAAMKGQLEPVYKEKTLGTVSVRELFHFSKIGTIAGGLVTDGIITSDSKVRLVR-DGVVVYDGQLGSLKHGKDDVKEVKKGFELGLTIANYNDEKVGDVIEAYTM 822
>gi|37993693|gb|AAR06930.1| translation initiation factor B [Streptococcus agalactiae] (927 aa)
Score = 1097, Expect = 1.6e-117, Identities = 251/568 (44%), Positives = 363/568 (63%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFED--REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLL---------KELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           F +T  +T+ E +K+I +  AEI+K LF+ G+    N  LD   +  L +++G +   +++++E +       ED    D L +RPP+VTIMGHVDHGKTTLLDT+R S+VA  EAG ITQ IGAYQ+E     ITF DTPGH AF+ MRA GA +TDI +L+VAADDG+ PQT EAI+H+  A  PIIV INK+DK  AN E++ S+LAE  V+   WGG++  ++ SA   + I ELLE +++ AE+ ELKA+    A G  IEA +DKG+GAVA LLVQ GTL V D I+VG  +G+V+ M +     +K A PSTPV I+GLN  P +GD + V  DEK           + L ++RQ NT++  L N    L      +K +NVI+K D  GS+EA+   L  I+V G K+N+V +A+G+INESD+ LA  S ++++ FN + + +    A +  + I+ ++IIY++ +E+E  +KG LDP + EK +G   IR+ +  S +G I G  V+ G++ R++  R+ R D  +I + K+ SL+H KD +      +E G  +EN+ND  E D +E Y
  S:   345 FEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIEAHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQTVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKFGKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGCRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGEERAKRALLKQRQ-NTQRVSLENLFDTLKAGE--VKSVNVIIKADVQGSVEALAASLLKIDVEGVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYKVIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR-DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAY 919
>gi|124026600|ref|YP_001015715.1| translation initiation factor IF-2 [Prochlorococcus marinus str. NATL1A] >gi|166232572|sp|A2C4P1|IF2_PROM1 Translation initiation factor IF-2 >gi|123961668|gb|ABM76451.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. NATL1A] (1183 aa)
Score = 1097, Expect = 1.6e-117, Identities = 240/574 (41%), Positives = 374/574 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IRKS+VAA EAG ITQ IGAYQ+E +       +TF DTPGHEAF+ MRA G  +TD+ +LVVAADDG++PQT EAI HA  AK PI+V INK+DK+ ++ +++  +L+E+++L EEWGG  +++  SA+ ++ ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD N   IK A PS PV   G + +P +GD++ V  DEK  + +  +R  + +  +L+        +  +   + S+G +KELN+ILK D  GSLEAI G L  +     ++ ++ +A G I E+DIDLA  S +++V FNT ++S     A + G+ +++Y +IY++ ++I+  ++G+L+P  +E+ +G  E+R ++S      +AG  V  G+I+RN  AR+KR  K+I+    ++SL+  KD +   + G ECG   + F ++ EGD +E +++V +
  S:   593 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDVEEAAKKTVEMIEEGDLKYLI-RRPPVVTVMGHVDHGKTSLLDAIRKSRVAAGEAGGITQHIGAYQIETEHDGSTKKLTFLDTPGHEAFTAMRARGTRVTDVAILVVAADDGVRPQTLEAISHARAAKVPIVVAINKIDKEGSSPDRVKQELSEQDLLSEEWGGDVVMVPVSAIKSENIDKLLEMVLLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLVQNGTLKSGDVVAAGPVLGKVRAMVDENGSRIKEAGPSCPVEALGFSEVPTAGDEFEVYPDEKAARAVVGERATDARAARLAQQMASRRVSLSSMSGQASEGELKELNIILKADAQGSLEAILGSLEQLPKDEVQVRVLLSAPGEITETDIDLAAASGAVIVGFNTSMASGAKRAADANGVDVRDYEVIYKLLEDIQLAMEGLLEPEMIEEALGVAEVRAIFSIGK-SAVAGCYVTNGKIQRNCRARVKR-GKQIVFEGDLDSLKRNKDDVKDVSTGFECGIGCDRFANWEEGDQIEAFKLVTQ 1177
>gi|123966907|ref|YP_001011988.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9515] >gi|166232574|sp|A2BYM0|IF2_PROM5 Translation initiation factor IF-2 >gi|123201273|gb|ABM72881.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9515] (1161 aa)
Score = 1097, Expect = 1.6e-117, Identities = 252/612 (41%), Positives = 386/612 (63%)
  Q:     4 FMAKNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           F  KN +T  + + ++ ++ R   D K    ++       + V  +NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      +D I+ +D E L+ KRPP++T+MGHVDHGKT+LLD+IR+S+VA+ EAG ITQ IGAYQVE+    KK  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG +PQT EAI HA  AK PI+V INK+DK+ A+ +++  +L+EK+++ E+WGG  +++  SA+  Q ID+LLE I++ +E+ +L+ANP+RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GK++ MVD +   IK A PS PV   G + +P +GD++ V  DEK  + +  +R  + +  KL+             +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+DIDLA  S S+++ FNT ++S     A S  + I+ Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R  ++    G IAG  + +G+++RN   R+ R DK +I    ++SL+  KD +     G ECG   + F+ + EGDI+E ++ V
  S:   538 FKKKNKETTRQRQKRRAMELRAAKDAKQVRPEM-------IIVPEDNLTVQELADKLSLESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDVEEAAKKTVDMIETDDIESLI-KRPPVITVMGHVDHGKTSLLDSIRESRVASGEAGGITQHIGAYQVEFEHESKKKKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGCRPQTLEAISHARAAKVPIVVAINKIDKEGASPDRVKQELSEKDLIAEDWGGDVVMVPVSAIKKQNIDKLLEMILLVSEVEDLQANPERLAKGTVIEAHLDKAKGPVATLLVQNGTLKAGDVLAAGSVLGKIRAMVDEHGNRIKEAGPSCPVEALGFSEVPTAGDEFEVYPDEKTARGIVGERATDARATKLAQQMASRRVSLSSLSTQANDGELKELNLILKADVQGSVEAILGSLEQLPKNEVQVRVLLSAPGEITETDIDLAAASGSVIIGFNTSLASGAKRAADSNNVDIREYEVIYKLLEDIQSAMEGLLEPDLVEESLGQAEVRATFAVGK-GAIAGCYIQSGKLQRNCSLRVLRSDK-VIFEGNLDSLKRSKDDVKEVNTGFECGVGCDKFSTWNEGDIIEAFKFV 1153
>gi|17231324|ref|NP_487872.1| translation initiation factor IF-2 [Nostoc sp. PCC 7120] >gi|39931299|sp|Q8YQJ1|IF2_ANASP Translation initiation factor IF-2 >gi|17132966|dbj|BAB75531.1| translation initiation factor IF-2 [Nostoc sp. PCC 7120] (1039 aa)
Score = 1097, Expect = 1.7e-117, Identities = 250/592 (42%), Positives = 371/592 (62%)
  Q:    24 RTNIDIKSQFKKVETGIKNG---VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG---TNLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           R++ + + Q ++ ET +K         T  +T+ E +  +     EI+K LF+KG+  ++   LD   +  +  E   + +  E +       + I+  D E LL +RPP+VTIMGHVDHGKTTLLD+IRK+KVAA EAG ITQ IGAY V+     K+  I F DTPGHEAF+ MRA GA +TDI VLVVAADDG++PQT EAI HA  A  PI+V INK+DK+ A  +++  +L +  +  EEWGG+T+++  SA+  + +D LLE I++ AE+ EL ANP R A G  IEA +DK +GAVA LL+Q+GTL V D +L G  +GKV+ MVD   + +  A PS  V + GL+ +P +GD++ V ++EK  + L+  R    +  +L       T L+  +Q   +KELN+ILK D  GS+EAI G L  I     ++ ++  A G I E+DIDLA  S ++++ FNT  +S     A   G+ ++ YNIIY++ ++I+  L+G+L+P  VE+ +G  E+R ++     G +AG  V +G++ RN   R++R  K +I    ++SL+  KD      AG ECG  ++ F+D+ EGDI+E Y++V
  S:   428 RSSHNNRDQNRRQETEVKRERPEKVAVTGAMTVQELADLMAVADTEIVKILFMKGMAVSITQNLDIPTITLVGKELEIEVETAEPEAEARKVTEMIEVGDLEHLL-RRPPVVTIMGHVDHGKTTLLDSIRKTKVAAGEAGGITQHIGAYHVDIVHDGKEQQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDGVRPQTVEAISHAQAAGVPIVVAINKIDKEGAQPDRVKQELTQYGLTSEEWGGETIMVPVSAIRGENLDTLLEMILLVAEVGELSANPDRNARGTVIEAHLDKAKGAVATLLIQNGTLHVGDILLAGSAFGKVRAMVDDRGRRVDIAGPSFAVEVLGLSDVPAAGDEFEVFDNEKEARALASDRADKQRLSRLLQGRVTLTTLSAQAQEGELKELNLILKGDVQGSVEAIVGSLKQIPQNEVQIRMLLTAAGEITETDIDLAAASGAVIIGFNTTFASGARQAADEAGVDVREYNIIYKLIEDIQGALEGLLEPELVEEPLGQTEVRAVFPVGR-GAVAGCYVQSGKLVRNCKVRVRRAGK-VIYEGVLDSLKRMKDDAREVNAGYECGIGVDKFHDWAEGDIIESYQMV 1029
>gi|115372788|ref|ZP_01460094.1| translation initiation factor IF-2, putative [Stigmatella aurantiaca DW4/3-1] >gi|115370269|gb|EAU69198.1| translation initiation factor IF-2, putative [Stigmatella aurantiaca DW4/3-1] (1056 aa)
Score = 1097, Expect = 1.8e-117, Identities = 230/571 (40%), Positives = 349/571 (61%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNL-------NENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V      +++ +  +++   +++IIK L   G     N ++D   +  +  ++G+   + +    +++L  +    R +    RPP+VT+MGHVDHGKT+LLD IR + VA+ EAG ITQ IGAY V   +  ITF DTPGHEAF+ MRA GA++TDIV+LVVAADDG+ PQT EAI HA  A+ PI+V +NKMD   AN +++   LA   ++ EEWGG+T+++  SA    GID LLE +++ AE++EL +NP R A G  IEA +D+G G VA +LVQ GTL V D ++ G  YG+V+ M +   + +K  LP     + GL+G+P +GD   V  DEK  K+++E R +  +Q +LS              +   G KEL V++K D  GS EA+K  +  +     K+ ++   +G+I ESD+  A  SK +V+ FN K  S     A + G+ +++++IIY++ D +   ++ +L+P+  E+++G  E+R  ++   +G IAG  VL G IKR AF R+ R++K++ +  K+ SLR  KD +   A G ECG  +ENFND   GDI+E YEI
  S:   475 VIKLQEGISVSDLGQRMGVRTSDIIKKLMGLGKMATANQMVDADTVELIASDYGWKVDR-VGFEVEDYLPEVV--ARPEDARTRPPVVTVMGHVDHGKTSLLDAIRAANVASGEAGGITQHIGAYSVTTARGDITFLDTPGHEAFTSMRARGANVTDIVILVVAADDGVMPQTIEAIKHAKAAEVPIVVALNKMDVPGANPDRVKKDLANHELVPEEWGGETIMVPVSAKQKMGIDLLLENVVLQAEVLELTSNPSRPAVGAIIEAKLDRGRGPVATVLVQEGTLRVGDAVVTGTDYGRVRAMNNSRGESVKEVLPGYCAEVIGLSGVPSAGDTINVVADEKAAKQIAEHRGMKERQSELSKVSRETLDQLFAKTKAGGGPKELRVVIKADVQGSAEAVKQAVQKLTTHKVKVEVIDTGVGAITESDVMRAAASKGVVLGFNVKPESGAESAAKAEGVMLRSFSIIYELIDGVRSSMEELLEPIRTERKLGRAEVRNTFNVPKLGTIAGAAVLDGVIKRGAFVRLMRENKQLFA-GKMASLRRFKDDVKEVAQGFECGIGIENFNDLKAGDIIEAYEI 1048
>gi|56478755|ref|YP_160344.1| translation initiation factor IF-2 [Azoarcus sp. EbN1] >gi|81821025|sp|Q5NZS1|IF2_AZOSE Translation initiation factor IF-2 >gi|56314798|emb|CAI09443.1| translation initiation factor IF-2 [Azoarcus sp. EbN1] (945 aa)
Score = 1097, Expect = 1.9e-117, Identities = 238/564 (42%), Positives = 356/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  +AE+IK L   G    +N +LD+     L  E G+        + D +L++ +    +  ++ R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA  A  P++V +NK+DK DAN +++  +L  + VL EE+GG  M I  SA    GID LLEA+++ AE++EL A     A G+ IEA +DKG G VA LLV SGTL   D +LVG  +G+++ M+D N K I  A PS PV + GL+ +P +GD+ I   DEK  +E++  RQ   ++ KL     +   +   + ++G +K L +I+K D  GS EA+   L+ +     ++N + +A+G+I+ESD++LA+ S ++++ FNT+  +     A + G+ I+ YNIIY   DE++  L G+L P   E  IG VE+RQ++    +G +AG  VL G +KR +  R+ R +  +I N ++ SL+  KD +     G ECG ++ NFND  EGD +E++EI
  S:   371 ISVADLAHKMSVKAAEVIKILMKMGSMVTINQVLDQETAMILVEEMGHKAFAAKLDDPDTYLESAE-AHHDAAVEPRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETPRGMLTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTREAIHHAKAANVPLVVAVNKIDKPDANPDRVKQELVAEGVLPEEYGGDVMFINVSAKTGVGIDSLLEAVLLQAEVLELTAPVDSPAKGLIIEARLDKGRGPVASLLVLSGTLRKGDVMLVGATFGRIRAMLDENGKAIDHAGPSIPVEVLGLSDVPAAGDEAIALADEKKAREIALFRQGKYREVKLAKQQAAKLESMFEQMAEGEVKTLPLIIKADVQGSQEALVQALNKLSTDEVRVNAIHSAVGAISESDVNLAQASGAVIIGFNTRADAGARKLAETFGVDIRYYNIIYDAVDEVKAALSGMLAPERRENVIGLVEVRQVFKVPKVGTVAGCYVLEGVVKRGSQVRVLR-NHVVIHNGELESLKRFKDDVKEVKFGFECGLSIRNFNDVQEGDQLEVFEI 938
>gi|196180749|gb|EDX75739.1| translation initiation factor IF-2, putative [Microcoleus chthonoplastes PCC 7420] (984 aa)
Score = 1096, Expect = 2.0e-117, Identities = 243/584 (41%), Positives = 365/584 (62%)
  Q:    34 KKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK-KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL----SNFGTNLNENSQG-----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           +K E   +    V  ++LT+ E + K+N    E+IK LF KG+  N+   LD      +  E G D + +E +       + +   D E L+ +RPP+VTIMGHVDHGKTTLLD IR++KVA  EAG ITQ IGAY V    E K   + F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  A+ PI+V +NK+DK+ A  +++  +L E  ++ EEWGG T+++  SA+  + +D LLE I++ ++I EL ANP RLA G  IEA++DK  G VA LLVQ+GTL V D ++ G  +GKV+ M D   K +  A PS  V + GL+ +P +GD++ V   EK  + +++ R    ++ +L    S+   +LN  S       +KELN+ILK D  GS+EAI G L  +     ++ ++ A  G + E+D+DLA  S ++++ FNT ++      A    + ++ YNIIY + D+I+  ++G+L+P  VE+ +G VE+R ++     G +AG  V +G+  RN   R++R+  ++I    ++SL+  KD +    AG ECG  ++ FND+ EGDI+E Y++V +
  S:   383 EKQEVAERPEQIVLNDSLTVRELANKLNLAETEVIKQLFFKGLAVNITQTLDLPTAQMVAEELGVDVQTQEAESEATKVTEMLDAADLEYLV-RRPPVVTIMGHVDHGKTTLLDAIRETKVAQGEAGGITQHIGAYHVDVEHEDKVQQVVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVQPQTREAISHAKAAEVPIVVAVNKIDKEGAQPDRVKQELMEHGLVPEEWGGDTIMVPVSAIQKENLDTLLEMILLVSDIEELSANPARLAKGTVIEANLDKSRGPVATLLVQNGTLRVGDTLVAGSVFGKVRAMTDDRGKRVDEAAPSFAVEVLGLSDVPAAGDEFDVFAQEKEARAVADTRSQEQRESRLQQVMSSRRVSLNSLSAKAQEGELKELNLILKADVQGSVEAILGSLKQLPQNEVQIRVLLATAGEVTETDVDLAAASGAVIIGFNTTLAHGARYAAEQESVDVREYNIIYNLLDDIQAAMEGLLEPELVEEPLGQVEVRAVFPVGR-GAVAGCYVQSGKAVRNCKIRVQRRG-QMIYEGVLDSLKRMKDDVKEVNAGFECGIRVDRFNDWTEGDIIETYKMVSK 977
>gi|116490513|ref|YP_810057.1| translation initiation factor 2 [Oenococcus oeni PSU-1] >gi|122277300|sp|Q04GN0|IF2_OENOB Translation initiation factor IF-2 >gi|116091238|gb|ABJ56392.1| bacterial translation initiation factor 2 (bIF-2) [Oenococcus oeni PSU-1] (829 aa)
Score = 1096, Expect = 2.3e-117, Identities = 239/564 (42%), Positives = 362/564 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK--EIQINE-DNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + + + +K I++   EI+K LFL G+  N N  LD   +  L  ++  + K+  E+ +++ D F D    +  +  L  R PIVTIMGHVDHGKTTLLD +R + V   EAG ITQ IGAYQ      LITF DTPGHEAF++MRA GA++TDI +LVVAADDG+ PQT EAI HA  AK PIIV INK+D    +   + ++L + +++ EE+GG T+ +  SA   Q +D+LLE I++ A++M+LK++P   + G  IEA +DKG GAVA LL+Q GTL   D I+VG  +G+V+ M D + K++ +ALP+TPV I+GLN +P++GD ++V + EK  +E  E R     + + +N         F T    +   +K +++I+K D  GS+EA+   L  I+V G +++++ AA+G+INESDI+LA  S ++++ FN +   +    A    + ++ YN+IY   +E+E  +KG L+PV+ EK +G+V +R+L+  S IG IAGG V  G I  ++  R+ R D  ++ + ++ SL+HGKD +     G E G T+ N+ND   GD++E Y +
  S:   251 MNVQDIAKIIHRDVTEILKKLFLLGVVVNQNQSLDADTIELLAADYNIEAKQKEEVDVSDIDRFFDKTDNDIDQSKLVSRAPIVTIMGHVDHGKTTLLDYLRHTHVTEGEAGGITQRIGAYQARLHDRLITFLDTPGHEAFTEMRARGANVTDITILVVAADDGIMPQTIEAIHHAQAAKTPIIVAINKIDIPGVDPNNVINELMKYDLVPEEYGGSTIEVPISAKTGQNVDKLLEMILLQADMMDLKSDPTAKSRGSVIEARLDKGRGAVATLLIQQGTLKTGDPIVVGNTFGRVRTMNDASHKKLDSALPATPVEITGLNEVPQAGDHFVVMDSEKDAREAGESRAKKAMEEERNNGAVVTLDTLFSTMAKRD---MKTVSLIVKADVQGSVEALSASLKKIKVEGVRVDILHAAVGAINESDINLAEASGAIIIGFNVRPVGQAKTDAEQKHVDVRLYNVIYDAINEVEAAMKGQLEPVYKEKTLGTVSVRELFHFSKIGTIAGGLVTDGIITSDSKVRLVR-DGVVVYDGQLGSLKHGKDDVKEVKKGFELGLTIANYNDEKVGDVIEAYTM 822
>gi|83644101|ref|YP_432536.1| translation initiation factor IF-2 [Hahella chejuensis KCTC 2396] >gi|123726450|sp|Q2SML3|IF2_HAHCH Translation initiation factor IF-2 >gi|83632144|gb|ABC28111.1| translation initiation factor IF-2 [Hahella chejuensis KCTC 2396] (861 aa)
Score = 1096, Expect = 2.4e-117, Identities = 247/604 (40%), Positives = 379/604 (62%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK--KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNEN--SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           + + + K  K+V +R+   ++   ++V         V ++ +T+ E ++K++    E+IK L   GI   LN  +D+     +  E G+  K  +E  + E   L++I FE        R P+V++MGHVDHGKT+LLD IR++KVAA E+G ITQ IGAY VE  + +I+F DTPGH AF+ MRA GA  TDIV+LVVAADDG+ PQT+EA+ HA  A  P++V +NKMDK+ A+ +++ ++L+  +V+ EEWGG    +  SA    GID+LLEA+++ +E++EL A P     G+ IE+S+D+G G+VA +LVQ+GTL   D +L GEYYG+V+ MV+ N + ++ A PS PV I GLNG P +GD++IV  DEK  +E++E RQ   +Q +L         NL EN    G+KELN++LKTD  GSLEA+ G L+ I     ++ ++ + +G I E+D +LA ++++++V FN +  +         GI ++ Y++IY I D++++ L G+L P F E  +G+ E+R  +     G +AG  VL G + RN   R+ R D  +I   ++ SLR  KD +A   AG ECG  + N+   V GDI+E+++
  S:   260 RARQRKKKSKVVQDRS---VQPIVREV---------VISDTITVAELAQKMSVKGVEVIKRLMGMGIMATLNQSIDQDVAQLVAEEMGHKVKLLQEDAV-ETEVLESISFEGESK---SRAPVVSVMGHVDHGKTSLLDYIRRAKVAAQESGGITQHIGAYHVETPRGMISFLDTPGHAAFTAMRARGAQCTDIVILVVAADDGVMPQTQEAVQHAKAAGVPLVVAVNKMDKEQADPDRVKNELSALDVIPEEWGGDVQFVPVSAHTGDGIDDLLEAVLLQSEMLELTAVPDAPGKGVVIESSLDRGRGSVATVLVQNGTLRHGDIVLAGEYYGRVRAMVNENGQNVQEAGPSIPVEILGLNGTPDAGDEFIVVPDEKKAREVAEFRQNKERQTRLQRQQAASLENLFENMGKGGVKELNIVLKTDVRGSLEALIGALAEIGNEEVQVKIIASGVGGITETDANLALSTQAIIVGFNVRADASARKIVEKEGIELRYYSVIYNIIDDVKKALTGMLAPEFREDIVGTAEVRDTFKSPKFGQVAGCMVLEGAVYRNKPIRVLR-DNVVIFEGELESLRRFKDDVAEVRAGTECGIGVRNYEVKV-GDIIEVFD 853
>gi|157414096|ref|YP_001484962.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9215] >gi|166918489|sp|A8G6Z5|IF2_PROM2 Translation initiation factor IF-2 >gi|157388671|gb|ABV51376.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9215] (1119 aa)
Score = 1095, Expect = 2.7e-117, Identities = 246/572 (43%), Positives = 372/572 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + V  +NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + +IQ   +  +D I+ ED ++L+ KRPP++T+MGHVDHGKT+LLD+IR+S+VA+ EAG ITQ IGAYQVE+    KK  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG +PQT EAI HA  AK PI+V INK+DK+ A+ +++  +L+EKN++ E+WGG T+++  SA+  Q I++LLE I++ +E+ +L+ANP R A G  IEA +DK +G VA LLVQ+GTL   D +  G   GK++ MVD +   IK A PS PV   G + +P +GD++ V  DEK  + +  +R  + +  KL+             +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+DIDLA  S S+++ FNT ++S     A +  + ++ Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R  +S    G IAG  + TG+++RN   R+ R +K +I    ++SL+  KD +     G ECG   + F+ ++EGDI+E ++ V
  S:   528 IIVPEDNLTVQELADKLSLESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDIQEAAEKTVDMIESEDLDNLI-KRPPVITVMGHVDHGKTSLLDSIRESRVASGEAGGITQHIGAYQVEFEHESKKKKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGCRPQTLEAISHARAAKVPIVVAINKIDKEGASPDRVKQELSEKNLIAEDWGGDTVMVPVSAIKKQNINKLLEMILLVSEVEDLQANPDRFAKGTVIEAHLDKAKGPVATLLVQNGTLKSGDVLAAGSVLGKIRAMVDEHGNRIKDAGPSFPVEALGFSEVPTAGDEFEVYPDEKTARAIVGERATDARATKLAQQMASRRVSLSSLSTQANDGELKELNLILKADVQGSVEAILGSLEQLPKNEVQVRVLLSAPGEITETDIDLAAASGSVIIGFNTSLASGAKKAADANDVDVREYEVIYKLLEDIQLAMEGLLEPDLVEESLGKAEVRATFSVGK-GAIAGCYIQTGKLQRNCSLRVIRSEK-VIFEGNLDSLKRSKDDVKEVNTGFECGVGCDKFSSWIEGDIIEAFKFV 1110
>gi|50954463|ref|YP_061751.1| translation initiation factor IF-2 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|71648687|sp|Q6AG49|IF2_LEIXX Translation initiation factor IF-2 >gi|50950945|gb|AAT88646.1| translation initiation factor IF-2 [Leifsonia xyli subsp. xyli str. CTCB07] (916 aa)
Score = 1095, Expect = 2.8e-117, Identities = 254/563 (45%), Positives = 358/563 (63%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY--------DFKKEIQINEDNFLD-NIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH-----LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQRKLS--NFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGA-KLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +I +F+ KI+ + A ++  LF  G        LDE     L  E GY        D  KE+    D  LD  ++ E  EDL + RPP+VT+MGHVDHGKT LLD IR + V   EAG ITQ IGAYQV W +H      ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK +AN  K+  QL E +++ EE+GG  M +  SA NN GI ELL+A+++TA+  ++L+ANP + A G+ IEA +DKG GAVA +L+QSGTL V D I+ G  YG+V+ M D N   +  A PS PV++ GL+ +P++GD +IVT +++  ++++EKR       QL   ++++S  +F   L E    ++ LN+I+K D +G++EA++  L  IEV  +  L ++   +G+I ESDIDLA    ++V+ FN +   K  + A   G+ ++ Y++IY   D+IE  LKG+L P F E + G  +IR+++  S  G IAG  V +G I RNA AR+ R    I  N  I SLR  KD +       ECG  L  +ND   GD +E  E+
  S:   327 SISDFADKIDANPASLVTVLFHLGEMATATESLDEATFQILGEELGYKVQVVSPEDEDKELLEGFDIDLDAELEGESDEDL-EIRPPVVTVMGHVDHGKTRLLDAIRSANVVEGEAGGITQHIGAYQV-WTEHEGIERAITFIDTPGHEAFTAMRARGAQVTDIAILVVAADDGIMPQTIEALNHAQAANVPIVVAVNKVDKPEANPAKVRQQLTEFSLVAEEYGGDVMFVDVSARNNIGIQELLDAVLLTADAGLDLRANPNKDARGVAIEAKLDKGRGAVATVLIQSGTLRVGDAIVAGTAYGRVRAMADENGDPVLEAAPSRPVQVQGLSSVPRAGDTFIVTEEDRTARQIAEKREAAERNAQLAKARKRISLEDFTRALEEGK--VEALNLIIKGDVSGAVEALEESLMKIEVDDSVSLRILHRGVGAITESDIDLATIDNAIVIGFNVRPDVKARERAAREGVDVRFYSVIYNAIDDIESSLKGMLKPEFEEVQSGVADIREVFRSSKFGNIAGVIVRSGTITRNAKARVIRDGVVIADNLAIESLRRFKDDVTEVRTDFECGIGLGKYNDIQVGDEIETIEM 910
>gi|117928722|ref|YP_873273.1| translation initiation factor IF-2 [Acidothermus cellulolyticus 11B] >gi|166226241|sp|A0LV27|IF2_ACIC1 Translation initiation factor IF-2 >gi|117649185|gb|ABK53287.1| bacterial translation initiation factor 2 (bIF-2) [Acidothermus cellulolyticus 11B] (879 aa)
Score = 1094, Expect = 3.7e-117, Identities = 234/563 (41%), Positives = 357/563 (63%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDLLDK-----RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F+ KI  + A +++  F  G        ++E  +  L  E GY+ +     +ED   L++   E   D  D+     RPP+VT+MGHVDHGKT LLD IR + VAA E G ITQ IGAYQV  +       ITF DTPGHEAF+ MRA GA +TDI VLVVAADDG+ PQT EA++HA  A  PI+V +NK+DK  A+  K+  QL E  ++ EE+GG TM +  SAL  QGID+LLEAI++TA+  ++L+ANP + A G+ IEA +D+G G VA +LVQ GTL V D I+ GE +G+V+ M+D   + ++ A PS PV++ G   +P +GD ++V  ++++ ++++E+R    +  +L+           L    +G + EL +ILK D +GS+EA++  L  I+V   A++ ++   +G+I E+++ LA  S ++++ FN +   K  + A   G+ ++ Y++IYQ  +++E  LKG+L PV+ E ++G+ E+R+++  S  G IAG  V +G I R A AR+ R    + ++  I SLR  KD +     G ECG  L +FND   GD++E YE+
  S:   292 SLADFADKIGANPASLVQVAFHLGEMVTATQSVNEETLQLLGAELGYEVQIVSPEDEDRELLESFDIELGTDQGDEAALVPRPPVVTVMGHVDHGKTKLLDAIRNTNVAAREHGGITQHIGAYQVTAQTADGPRQITFIDTPGHEAFTAMRARGAQVTDIAVLVVAADDGVMPQTVEALNHAKAADVPIVVAVNKIDKPGADPVKVRGQLTEYGLVAEEYGGDTMFVDVSALTGQGIDDLLEAILLTADAALDLRANPNQPAQGVAIEAHLDRGRGPVATVLVQRGTLRVGDSIVAGEAFGRVRAMLDEFGQPVEEAGPSRPVQVLGFTSVPDAGDTFLVVPEDRVARQIAERRAARERNAQLAASRRRRTLEDILERMEKGEVAELRLILKGDVSGSVEALEDALLKIDVGDEARIRVIDRGVGAITENNVMLAVASDAIIIGFNVRPEGKARELAEREGVDVRYYSVIYQAIEDVEAALKGLLKPVYEEVQLGTAEVREVFRSSKFGNIAGCLVRSGTITRGAKARVVRDGVVVANDVSIASLRRFKDDVTEVREGFECGVGLGSFNDIRVGDVIETYEM 873
>gi|169630213|ref|YP_001703862.1| translation initiation factor IF-2 (InfB) [Mycobacterium abscessus] >gi|169242180|emb|CAM63208.1| Translation initiation factor IF-2 (InfB) [Mycobacterium abscessus] (912 aa)
Score = 1093, Expect = 4.5e-117, Identities = 247/563 (43%), Positives = 371/563 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI----NEDNFL----DNIKFEDR--EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F++KI+ + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+    +ED  L    D    ED   E+ L  RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV    +  +  ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI +QL E N++ E++GG TM +  SA     I++LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D I+ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD  +V +++++ ++++++R       L  + RK   L +    L E SQ    LN+ILK DN G++EA++  L  I +    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE  LKG+L PV+ E E+G  EIR ++  S +G IAG  V +G I+RNA AR+ R +  +     I+SLR  KD +     G ECG TL  +ND  EGD++E YE+
  S:   328 SLSDFAEKIDANPASLVQALF------NLGEMVTATQSVGDETLELLGGEMNYVVQVVSPEDEDRELLESFDLTYGEDEGGEEDLRTRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVAVEHDGTERPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRAQLTEYNLVAEDFGGDTMFVDISARQGTNIEQLLEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNLLVVDEDRIARQIADRRSARKRNALAARSRKRISLDDLDAALKETSQ----LNLILKGDNAGTVEALEEALLGIAIDDEVQLRVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELANREGVDIRYYSVIYQAIDEIESALKGMLKPVYEEVELGRAEIRAMFRSSKVGNIAGCLVTSGIIRRNAKARLLRDNIVVAETVTISSLRREKDDVVEVRDGYECGLTL-TYNDIKEGDVIEAYEL 906
>gi|118469118|ref|YP_886965.1| translation initiation factor IF-2 [Mycobacterium smegmatis str. MC2 155] >gi|118170405|gb|ABK71301.1| translation initiation factor IF-2 [Mycobacterium smegmatis str. MC2 155] (610 aa)
Score = 1093, Expect = 4.5e-117, Identities = 246/564 (43%), Positives = 368/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL----DNIKFEDR--EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVE----WKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KIN + A +++ LF  G        + +  +  L  E  Y+ +     +ED  L    D    ED   E+ L+ RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQVE         ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ EE+GG TM +  SA     I+ LLEA+I+TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D ++ G+ YG+V++M+D + ++++ ALPS PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN G++EA++  L  I+V    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DEIE  LKG+L PV+ EKE+G  EIR ++  S +G IAG  V +G ++RNA AR+ R +  +  N  ++SLR  KD +     G ECG TL  +ND  EGD++E YE+V
  S:    26 SLSDFAEKINANPASLVQALFNLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRELLESFDLTYGEDAGDEEDLEVRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVEVDLDGTVRPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLIPEEYGGDTMFVDISAKQGTNIEALLEAVILTADASLDLRANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSVVAGDAYGRVRRMIDEHGEDVEEALPSRPVQVVGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQ----LNLILKGDNAGTVEALEEALMGIQVDDEVELRVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSVIYQAIDEIEAALKGMLKPVYEEKELGRAEIRAIFRSSKVGNIAGCLVTSGIMRRNAKARLLRDNVVVAQNLTVSSLRREKDDVTEVRDGYECGLTL-TYNDIKEGDVIETYELV 605
>gi|153954056|ref|YP_001394821.1| translation initiation factor IF-2 [Clostridium kluyveri DSM 555] >gi|189028310|sp|A5N842|IF2_CLOK5 Translation initiation factor IF-2 >gi|146346937|gb|EDK33473.1| InfB [Clostridium kluyveri DSM 555] (694 aa)
Score = 1093, Expect = 4.8e-117, Identities = 263/606 (43%), Positives = 380/606 (62%)
  Q:     9 VKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-SNFGTNL----NENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           VK   KNK+K+   ++   D+  Q  K     +N      + +T+ EFS+KI K   E+IK L   G+   +N  +D     +L  +F     K+ +  +    +  + ED +  ++KRPP+VT+MGHVDHGKT+LLD IRKSKV ATEAG ITQ IGAY V      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI+H   A  PI+V INK+D+  AN++K+  +L E  ++ E+WGG T+ I  SA   +GID LLE +++TAE+ ELKAN  R   G  +EA +DKG GAVA LL+Q+GTL+V D I+VG  YG+++ M D    +IK+A PS PV I GL+ +P +GD++    DEK  ++++EKR+   ++  L S    +L    N+  +G +KELN+I+K D  GS+EA+K  L  +     K+ ++  A+G+I E+D+ LA  S ++++ FN +  S     A    + +K Y +IY   ++I+  + G+L+P + E  +G  EIRQ++  S+IG IAG  V  G++ RN   RI R D  +I  +++ SL+  KD +  AA G ECG ++E FND  EGDIVE Y+I
  S:    84 VKIADKNKSKQ---DKAVKDLNEQVSK-----ENHKVEIEDTITVKEFSEKIGKPITEVIKQLIFMGVMAAINQEIDFSTAEKLGEKFDITVLKKKEDIDKGVAEQDEDEDEDTNVEKRPPVVTVMGHVDHGKTSLLDAIRKSKVTATEAGGITQHIGAYTVTINGEKITFLDTPGHEAFTAMRARGAQITDIVILVVAADDGIMPQTAEAINHCKAANVPIVVAINKIDRPGANVDKVKQELTEYQLVPEDWGGDTICIPVSAHTKEGIDTLLEMVLLTAEMQELKANSNRNGKGTVVEAKLDKGRGAVATLLIQNGTLSVGDSIIVGSTYGRIRAMFDDKGNKIKSAGPSIPVEILGLSEVPAAGDRFHQVKDEKTARDIAEKRKQKIREEYLQSTHKVSLEDLYNQIKEGKVKELNIIVKADVQGSIEALKQSLQKLSNEEVKVRVIHGAVGAITETDVTLASASNAIIIGFNVRPDSNAQAAAEKESVDVKTYRVIYNAIEDIKAAMVGMLEPDYKEVILGKAEIRQIYKISNIGTIAGCYVQEGKMVRNCKVRIIR-DGIVIFESELASLKRFKDDVKEAAEGYECGLSIEKFNDIKEGDIVEAYDI 686
>gi|111023603|ref|YP_706575.1| translation initiation factor IF-2 [Rhodococcus sp. RHA1] >gi|123045435|sp|Q0S219|IF2_RHOSR Translation initiation factor IF-2 >gi|110823133|gb|ABG98417.1| translation initiation factor IF-2 [Rhodococcus sp. RHA1] (980 aa)
Score = 1093, Expect = 5.1e-117, Identities = 238/563 (42%), Positives = 366/563 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKF-----EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F++KI+ + A +++ LF  G        +++  +  L  E  Y  +     +ED   LD+        E  E+ L+ RPP+VT+MGHVDHGKT LLDTIRK+ V   EAG ITQ IGAYQV    +  + L+TF DTPGHEAF+ MRA GA  TD+ +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ AN +KI  QL E  ++ EE+GG TM +  SA     ID LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D I+ G+ YG+V++MVD +  ++  ALPS PV++ G   +P +GD  +V +++++ ++++++R       L  K RK   L +  + L E SQ    LN+ILK DN+G++EA++  L  IE+    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y++IYQ  DE+E+ LKG+L P++ E E+G  EIR ++  S +G IAG  V +G I+RNA AR+ R +  +     I+SL+  K+ +     G ECG T+  ++D   GD++E YE+
  S:   396 SLSDFAEKIDANPAALVQALFNLGEMVTATQSVNDETLELLGGEMNYVVQVVSPEDEDRELLDSFDLTYGEDEGGEEDLESRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAYQVLTELDGNERLVTFIDTPGHEAFTAMRARGAKATDLAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGANPDKIRQQLTEYGLVAEEYGGDTMFVDISAKLGTNIDALLEAVLLTADAALDLRANPDMDAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGDDVLEALPSRPVQVVGFTSVPGAGDNLLVVDEDRIARQIADRRNARKRNALAAKSRKRISLEDLDSALKETSQ----LNLILKGDNSGTVEALEEALHGIEIDDEVQLRVIDRGVGGVTETNVNLAAASNAIIIGFNVRAEGKATELANREGVDIRYYSVIYQAIDEVEKALKGMLKPIYEEVELGKAEIRAMFRSSKVGNIAGCLVTSGTIRRNAKARLLRDNTVVAETVTISSLKREKEDVVEVREGYECGLTV-TYSDIKVGDVIEAYEL 974
>gi|167758068|ref|ZP_02430195.1| hypothetical protein CLOSCI_00406 [Clostridium scindens ATCC 35704] >gi|167663965|gb|EDS08095.1| hypothetical protein CLOSCI_00406 [Clostridium scindens ATCC 35704] (900 aa)
Score = 1092, Expect = 6.4e-117, Identities = 254/606 (41%), Positives = 370/606 (61%)
  Q:    10 KTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEK-------RQLNTKQRKLS--NFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           K K KN+ K+ +        + + +KVE  IK+   +    LTI E + K+    + I+K LFL+G    +N  +D     E+ LEF    +KE ++ +       + E+ E  + KRPP+V +MGHVDHGKT+LLD IR + V   EAG ITQ IGAY VE     ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI+HA  A   I+V +NK+DK  ANI+++  +L E  ++ E+WGG T+ +  SA   +G+++L+E I++TAE+MELKANP R A G+ +EA +DKG G+VA +LVQ GTL V D I  G  +GKV+ M+D   + +K A PS PV I GLN +P +G+ ++   ++K  +  +E        R L   + KLS  +  T + E +  +KEL +++K D  GS+EAIK  L  +      + ++   +G+INESD+ LA  S ++++ FN +  +   + A   G+ ++ Y +IY   +++E  +KG+LDPVF EK +G  E+RQ++  S +G IAG  VL G  +R+   RI R D  +I    + SL+  KD +    AG ECGF   NFND  EGDIVE +++V
  S:   293 KGKKKNEPKQPLQKP-----QQRVQKVEEQIKS--IIIPEVLTIQELADKMKIVPSVIVKKLFLQGKIVTVNQEIDYETAEEIALEFDVLCEKE-EVIDVIEELLKEEEEDEKKMKKRPPVVCVMGHVDHGKTSLLDAIRHTNVIDREAGGITQHIGAYVVEVNGEKITFLDTPGHEAFTAMRMRGASSTDIAILVVAADDGVMPQTVEAINHAKAAGVEIVVAVNKIDKPSANIDRVKQELTEYELIPEDWGGSTIFVPVSAKTGEGLEDLMEMIVLTAEVMELKANPNRRARGLVLEAELDKGRGSVATVLVQKGTLRVGDSIAAGSAHGKVRAMMDDKGRRVKEAGPSMPVEILGLNDVPNAGEVFVGCANDKEARSFAETFISQSKVRLLEDTKSKLSLDDLFTQIQEGN--LKELGIVVKADVQGSVEAIKQSLLKLSNDEVVVKIIHGGVGAINESDVSLASASNAIIIGFNVRPDATAKETADREGVDLRLYRVIYNAIEDVEAAMKGMLDPVFEEKVLGHAEVRQIFKASGVGTIAGSYVLDGTFERDCSVRITR-DGIVIFEGPLASLKRFKDDVKEVRAGYECGFVFANFNDVKEGDIVEAFKMV 896
>gi|169191230|ref|ZP_02851096.1| translation initiation factor IF-2 [Paenibacillus sp. JDR-2] >gi|169002144|gb|EDS49041.1| translation initiation factor IF-2 [Paenibacillus sp. JDR-2] (944 aa)
Score = 1092, Expect = 6.8e-117, Identities = 242/567 (42%), Positives = 367/567 (64%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-SNFGTNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +    +T+ + +K ++K ++E+IK L   G+   +N  LD   +  +  EFG + + +I + ED F + ++  D E  L  RPP+VTIMGHVDHGKTTLLD IR + V   EAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI ++VVAADDG+ PQT EA++HA  A  PIIV +NK+DK DA+ +KI   L E  ++ EEWGG T+ +  SA    G++ELLE I++ AE+ + KAN  + A G  IEA +DKG+G VA +LVQ G+L + D  + G  +G+V+ MV+   + IK A PSTPV I+GL  +P +GD ++V  DE+  + ++++R +  +Q +L +N    L++         IK+LN+I+K+D  GS EA+KG L+ IE+ G ++ ++ + +G+I ESDI+LA  S ++V+ FN +   +    A    + ++ + +IY + +EIE+ +KG+LDP+F E   G  E+R ++  S +G IAG  V++G+I RN+  R+ R    ++   K+++++  KD +   A G ECG T+E F+DF EGDI+E +
  S:   367 IVRGTMTVGDLAKLLHKDASEVIKKLISLGVMATINQELDMDTILLIAQEFGVEVEVKIPVEEDTF-ETVEEVDDEADLTTRPPVVTIMGHVDHGKTTLLDAIRHTNVTGGEAGGITQHIGAYQVEINHKKITFLDTPGHEAFTLMRARGAQVTDITIIVVAADDGVMPQTVEAVNHAKAAGVPIIVAVNKIDKPDADPDKIKQALTEYELVPEEWGGDTIFVNVSAKQRLGLEELLEMILLVAEVNDYKANADKRARGTVIEAELDKGKGPVARVLVQHGSLKIGDAFVAGNCFGRVRAMVNDKGRRIKEAGPSTPVEITGLTEVPLAGDPFMVFEDERKARAIADRRSIKQRQSELGANSRVTLDDLFKHIQEGEIKDLNIIIKSDVQGSTEALKGSLAKIEIEGVRIKIIHSGVGAITESDINLAAASNAIVIGFNVRPEPQADLAAQQEKVDVRLHRVIYNVIEEIEQAMKGMLDPIFKEVVQGQAEVRNIFKLSKVGAIAGCMVISGKITRNSEVRVIRSGI-VVFEGKMDTVKRFKDDVKEVAQGYECGITIERFSDFKEGDIIEAF 937
>gi|152980794|ref|YP_001354185.1| translation initiation factor IF-2 [Janthinobacterium sp. Marseille] >gi|166232552|sp|A6T0Y8|IF2_JANMA Translation initiation factor IF-2 >gi|151280871|gb|ABR89281.1| translation initiation factor IF-2 [Janthinobacterium sp. Marseille] (937 aa)
Score = 1092, Expect = 6.9e-117, Identities = 254/587 (43%), Positives = 365/587 (62%)
  Q:    28 DIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK-----------RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           D +S F+     +   V V    +T+ E + K++  ++E+IK+L   G  C +N +LD+     L  E G+                 K +D E LL++           R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  P++V INK+DK  AN++++  +L  + V+ EE+GG +  +  SA   +GID LLE +++ AE++ELKA     A G+ +EA +DKG G VA +LVQSGTL   D +L G  YG+V+ M+D N K I  A PS PV I GL  +P +G++ +V  DE+  +E+   RQ           +  KL N   N+ E    +K L +I+KTD  GS EA+ G L  +  +  ++ +V AA+G I+ESD++LA  SK++++ FNT+  +     A + G+ I+ YNIIY   DEI+  + G+L P   E+ +G VEIRQ+   S +G IAG  VL G  KR +  R+ R D  ++   +++SL+  KD +    AG ECG TL+NFND  EGD +E++E+
  S:   341 DRESNFQAPTEAVVKDVHV-PETITVAELAHKMSVKASEVIKHLMKLGQMCTINQVLDQETAMILVEEMGHTAHAA------------KLDDPEALLEQGEEHADIEALPRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETPRGMITFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHAKAAGVPLVVAINKIDKPGANMDRVKQELIAEQVVPEEYGGDSPFVPVSAKTGEGIDALLEQVLLQAEVLELKAPVDAPARGLVVEAKLDKGRGPVATILVQSGTLKRGDVVLAGSAYGRVRAMLDENGKSITEAGPSIPVEIQGLTEVPNAGEEVMVMADERKAREIGLFRQGKFRDVKLAKQQAAKLENMFENMGEGE--VKNLPMIIKTDVQGSQEALVGSLQKLSTSEVRVQVVHAAVGGISESDVNLAVASKAVIIGFNTRADASARKLAEANGVDIRYYNIIYDAVDEIKAAMSGMLAPEKREQALGLVEIRQVILVSKVGAIAGCYVLEGVAKRGSSVRLLR-DNVVVWTGELDSLKRFKDDVKEVKAGFECGLTLKNFNDIKEGDQLEVFEV 930
>gi|119025372|ref|YP_909217.1| translation initiation factor IF-2 [Bifidobacterium adolescentis ATCC 15703] >gi|166226250|sp|A1A0A2|IF2_BIFAA Translation initiation factor IF-2 >gi|118764956|dbj|BAF39135.1| translation initiation factor IF-2 [Bifidobacterium adolescentis ATCC 15703] (931 aa)
Score = 1092, Expect = 6.9e-117, Identities = 253/599 (42%), Positives = 383/599 (63%)
  Q:    16 KNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNN---------LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK--------KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K+ K   NR  +  + +F++++  +  GV + T N          ++ + ++KIN + A ++  LF  G        LDE     L  E G++ K        KE+    D  LD  + ++  DL   RPP+VT+MGHVDHGKT LLDTIR++ V   EAG ITQ IGAYQV    E +   ITF DTPGHEAF+ MRA GA+LTD+ +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK  AN +K+  QL E  ++ EE+GG TM +  SA     +D+LLEA+++TA+  ++L+ANP   A G T+EA +DKG GAVA +LVQSGTL + D I+ G  YG+V+ M+D N   ++ A PSTPV++ GL  +P +GD ++V +D++  ++++EKRQ         K+RK+ +  +   + ++  +  LN+++K D++GS+EA++  L  IEV+    + ++   +G+I ++D++LA   K++++ FN + + +V+D A   G+ IK Y+IIY+  ++IE  LKG+L P + E      EIR+++  S  G IAG  V  GE+KR    RI R     +++ +I+SLR  KD + S   G E G  L  FND   GDI+E +E+
  S:   300 KSSKARKNR--LAKRQEFQEMKAPVIGGVRIPTGNGQEVRLRQGASLADLAEKINVNPAALVTVLFHLGEMATATQSLDEATFQILGEEIGWNIKIVSAEEEDKELLQQFDINLDEEELQEDGDL-KPRPPVVTVMGHVDHGKTRLLDTIRRTNVIEGEAGGITQRIGAYQVTVNLEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVAADDGVMPQTVEAINHAQAAHVPIVVAVNKIDKPGANPDKVRGQLTEYGLVPEEYGGNTMFVDISAKQGTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQSGTLHIGDAIVAGTSYGRVRAMLDENGNHMQEAGPSTPVQVLGLTSVPTAGDLFLVASDDRTARQIAEKRQATERAAQLAKRRKVVSLESLKEQFAKSEVDMLNIVIKGDSSGSVEALEDSLMKIEVSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSIIYKAIEDIEASLKGMLKPEYEEVVTSHSEIREIFRSSKFGNIAGVMVQDGEVKRGTKCRILRNGIATVNDLEISSLRRFKDDVTSVKEGYEAGINLGTFNDIEIGDIIETFEM 925
>gi|72382863|ref|YP_292218.1| translation initiation factor IF-2 [Prochlorococcus marinus str. NATL2A] >gi|90101369|sp|Q46J13|IF2_PROMT Translation initiation factor IF-2 >gi|72002713|gb|AAZ58515.1| bacterial translation initiation factor 2 (bIF-2) [Prochlorococcus marinus str. NATL2A] (1183 aa)
Score = 1091, Expect = 8.8e-117, Identities = 239/574 (41%), Positives = 372/574 (64%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQ+E +       +TF DTPGHEAF+ MRA G  +TD+ +LVVAADDG++PQT EAI HA  AK PI+V INK+DK+ ++ +++  +L+E+++L EEWGG  +++  SA+  + ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD N   IK A PS PV   G + +P +GD++ V  DEK  + +  +R  + +  +L+        +  +   + S+G +KELN+ILK D  GSLEAI G L  +     ++ ++ +A G I E+DIDLA  S +++V FNT ++S     A + G+ ++ Y +IY++ ++I+  ++G+L+P  +E+ +G  E+R ++S      +AG  V  G+I+RN  AR+KR  K+I+    ++SL+  KD +   + G ECG   + F ++ EGD +E +++V +
  S:   593 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDVEEAAKKTVEMIEEGDLKYLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQIETEHDGSTKKLTFLDTPGHEAFTAMRARGTRVTDVAILVVAADDGVRPQTLEAISHARAAKVPIVVAINKIDKEGSSPDRVKQELSEQDLLSEEWGGDVVMVPVSAIKGENIDKLLEMVLLVTEVEDLQANPDRLAKGTVIEAHLDKAKGPVATLLVQNGTLKSGDVVAAGPVLGKVRAMVDENGSRIKEAGPSCPVEALGFSEVPTAGDEFEVYPDEKAARAVVGERATDARAARLAQQMASRRVSLSSMSGQASEGELKELNIILKADVQGSLEAILGSLEQLPKDEVQVRVLLSAPGEITETDIDLAAASGAVIVGFNTSMASGAKRAADANGVDVREYEVIYKLLEDIQLAMEGLLEPEMIEEALGVAEVRAIFSIGK-SAVAGCYVTNGKIQRNCRARVKR-GKQIVFEGDLDSLKRNKDDVKDVSTGFECGIGCDRFANWEEGDQIEAFKLVTQ 1177
>gi|167644006|ref|YP_001681669.1| translation initiation factor IF-2 [Caulobacter sp. K31] >gi|189028306|sp|B0T167|IF2_CAUSK Translation initiation factor IF-2 >gi|167346436|gb|ABZ69171.1| translation initiation factor IF-2 [Caulobacter sp. K31] (1045 aa)
Score = 1091, Expect = 9.1e-117, Identities = 221/564 (39%), Positives = 351/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE--------NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ E S ++     EIIK+L  +G+   +N ++D      +  EFG+  ++  + + E+ F   I  ED +D L+ RPP+VT+MGHVDHGKT+LLD +RK+ VA+ E G ITQ IGAYQV  +    +TF DTPGH AFS+MRA GA++TD+V+LVVA DDG+ PQT EAI HA  A+ PIIV +NKMDK  A+  ++ ++L +  ++ E  GG T +++ SA   QG+DEL+E I++ AE+M+LKANP R A+G+ IEA +DKG GAV+ +LV+ GTL   D ++ G  +G+V+ +++   +++  A P+TPV I GL+G+P  GD + V  +E   +EL+E R    +++ +   G               +  +EL +++K D  GS EAI G L ++     +  ++ +  G+I+ESD+ LA+ + + ++ FN + S++    A   G+ I+ Y IIY + D+I+ +L G+L P+  E  +G+ E+ Q +  S +G +AG RV  G +++ A  RI R D  ++    + +L+  KD +    +G+ECG     F D   GD +E + +
  S:   467 ITVQELSNRMAVRGVEIIKFLMRQGVMLKINDVIDNDTAELVATEFGHTVRRVSEADVEEGF---IGAEDVDDHLEPRPPVVTVMGHVDHGKTSLLDALRKADVASGEHGGITQHIGAYQVRLESGQKVTFLDTPGHAAFSQMRARGANITDLVILVVAGDDGVMPQTVEAIKHARAAEVPIIVAVNKMDKPGADSTRVVNELLQHEIVVESLGGDTQIVEVSAKTGQGLDELIERILLLAEVMDLKANPDRTADGVVIEAKLDKGRGAVSTVLVKRGTLKRGDIVVAGSQFGRVRALLNERNEQLTEAGPATPVEILGLDGVPSPGDPFAVVENEARARELTEYRIRLKREKSMHPVGAGATSMADMMAKLQDKKYRELPLVIKADVQGSAEAIIGSLDAMSTDEVRARIILSGAGAISESDVMLAKGAGAPLIGFNVRASAQARALAEREGVEIRYYAIIYDLLDDIKGVLSGMLAPIQRETFLGNAEVLQAFDISKVGKVAGCRVTEGVVRKGAKVRIIRNDIVVLELGTLQTLKRFKDEVPEVPSGQECGMMFAGFQDIKVGDTIECFTV 1037
>gi|42523054|ref|NP_968434.1| translation initiation factor IF-2 [Bdellovibrio bacteriovorus HD100] >gi|81829232|sp|Q6MMS6|IF2_BDEBA Translation initiation factor IF-2 >gi|39575259|emb|CAE79427.1| translation initiation factor IF-2 [Bdellovibrio bacteriovorus HD100] (975 aa)
Score = 1091, Expect = 9.1e-117, Identities = 237/564 (42%), Positives = 352/564 (62%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           N + + + + ++   + ++++ L  +G+  N+N  LD   +  +  EFG++ +   +   D   +   F D +     RPP+VT+MGHVDHGKT+LLD IR + VA  EAG ITQ IGAY V+ +   LITF DTPGHEAF+ MRA GA+ TDI ++VVAADDG+ PQT+EAI+HA  A  PIIV +NK+DK  AN E+I  QL E  ++ EEWGG T+  + SAL   GI ELLE I + AE+ ELKANPKR   G+ IEA M+KG+G VA LLV+ GT+ V  YI+ G   G+V+ + +   + +++A P  PV + GL  +P +GDK+ +  DE    ++SE R+        T   KLS         +  +KEL ++LK D +GSLEAI G+L+ +     K  ++ +A+G INE DI LA T+K +V+ FN +        A  MG+ ++ Y+I+Y++ D+++  + G+L P  VE+ +G  E+R +++   +G IAG  V+ G+++RNA  R+ R++K I+   KI SL+  KD     A+G ECG  +EN+ND   GD +E +
  S:   393 NTMKLSDLAMEMGLKAPQLVRELMKQGVMANMNMDLDFDTIALIVPEFGWEAQNVFK-TADEVAEQTAFGDLDAAPVTRPPVVTVMGHVDHGKTSLLDAIRNADVAKGEAGGITQHIGAYSVKIEDGSLITFLDTPGHEAFTAMRARGANATDIAIIVVAADDGMMPQTQEAINHAKAAGVPIIVAVNKIDKPGANPERIKQQLTELEIVPEEWGGSTIFCEVSALKKTGITELLEQIKLVAEVAELKANPKRSGTGLVIEAKMEKGKGPVATLLVKDGTVEVGQYIVAGTMKGRVRSLTNDRGERVQSAGPGIPVEVLGLEAVPAAGDKFDIVKDEVTATKVSELRKEQAEKAAATPAAKLSLDEVFAKVKAGDVKELAIVLKADVHGSLEAINGMLAKLSTPEVKARVIHSAVGGINEGDIVLANTAKGIVLGFNVRPDLGAQAKAKQMGVDVRTYSIVYELIDQMKAAMGGLLSPDIVEEVLGRAEVRNVFTVPKVGTIAGCFVIDGKVQRNASIRLLRENK-IVYEGKIASLKRFKDDAKEVASGYECGIGIENYNDVKVGDQMEAF 961
>gi|28210961|ref|NP_781905.1| translation initiation factor IF-2 [Clostridium tetani E88] >gi|39931276|sp|Q895J8|IF2_CLOTE Translation initiation factor IF-2 >gi|28203400|gb|AAO35842.1| bacterial protein translation initiation factor 2 [Clostridium tetani E88] (685 aa)
Score = 1090, Expect = 1.3e-116, Identities = 244/571 (42%), Positives = 362/571 (63%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEF-GYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    + +T+ E S ++ K  AE+IK L + G+   +N  +D     +L  +F     ++E+ + E++    I+ E+ E  + KRPP+VT+MGHVDHGKT+LLD IRK +VAA+EAG ITQ IGAY +      ITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQTEEAI+H   A  P++V INKMD+  AN +K+  QLAEK ++ E+WGG T+ +  SA   +GID LLE +++TAE+ ELK+NP R A G  ++A +DKG G VA L+VQ+GTL   D I+VG  YG+++ M D   ++I +A PS P  I GL+ +P +GD++ V  DEK  +E++EKR+  T+   L+    +L +         IKELN+I+K D  G++EAI+  L  +     K+ ++   +G+I E+D+ LA  S ++++ FN +  S     A    + IK Y +IY   ++I++ + G+L+P + E   G  E+R  +  S++G +AG  V +G+I RN+  RI R D  +I  ++++SL+  KD     AAG ECG  +E FND  EGD +E Y +
  S:   103 VIEMEDTITVKELSDRLKKTYAEVIKELMMMGVMAAVNQEIDFEAAEKLGEKFEAIVVQREVDVLEESVEQYIEEEEEEGTV-KRPPVVTVMGHVDHGKTSLLDAIRKEEVAASEAGGITQHIGAYTITINGEKITFLDTPGHEAFTSMRARGAQITDIVILVVAADDGIMPQTEEAINHCKAANVPMVVAINKMDRAGANPDKVKQQLAEKGLVAEDWGGDTITVPVSAHTKEGIDTLLEMVLLTAEMQELKSNPNRKAKGTVVDAKLDKGRGPVASLIVQNGTLNSGDSIIVGTTYGRIRAMFDDKGRKINSAGPSIPAEILGLSEVPSAGDRFYVVKDEKTAREMAEKRKEKTRSEYLATSKVSLEDLYSQIKEGKIKELNIIVKADVQGTIEAIRQSLEKLSTDEVKVRVIHGGVGAITETDVILANASSAVIIGFNVRPDSNAIVSAEKENVEIKTYRVIYSAIEDIKKAMIGMLEPEYKEVIQGRAEVRMTYKISNVGTVAGCYVQSGKITRNSGVRIIR-DGIVIFESELSSLKRFKDDAKEVAAGYECGIMVEKFNDIKEGDTIEAYTM 677
>gi|110803523|ref|YP_698973.1| translation initiation factor IF-2 [Clostridium perfringens SM101] >gi|123341721|sp|Q0SSD4|IF2_CLOPS Translation initiation factor IF-2 >gi|110684024|gb|ABG87394.1| translation initiation factor IF-2 [Clostridium perfringens SM101] (679 aa)
Score = 1089, Expect = 1.3e-116, Identities = 243/564 (43%), Positives = 363/564 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR--------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ E ++K+NK   ++IK L   G+   +N  +D     ++  ++     ++ + N     +     + E+L  KRPPI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     +TF DTPGHEAF+ MRA GA +TD+V+LVVAADDG+ PQT EAI+H   A  P+IV INKMD++ AN +++  +L E  ++ E+WGG  + +  SA   + ID LLE +++T+E+ ELKA+  R A G  +EA +DKG GAVA LLVQ+GTL + D I+VG  YG+++ M D + K+IK+A PS PV + GL+ +P +GD++ V  DEK  + ++E R+   +Q          L +  + + E S  +KEL+VI+K D  GS+EAIK  L  +     K+ ++  A+G+I+E+DI LA  S ++V+ FN +  +     +   G+ +K Y +IY   ++I+  + G+LDP + E  +G+ EIR  +  S++G IAGG VLTG++ RNA  R+ R+   +I  +K+ SL+  KD +    AG ECGF++E FND  EGDI+E Y +
  S:   104 ITVKELAEKLNKPVNDVIKTLIFTGVMAAINQEIDFETAEKVAEKYEVAVYEKEEENTLEEFEEETDVEEENLA-KRPPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVEVNGETLTFLDTPGHEAFTAMRARGAQITDVVILVVAADDGIMPQTVEAINHCKAANVPMIVAINKMDREGANPDRVKQELTEHGLVVEDWGGDIIAVPVSAKTRENIDTLLEMVLLTSEMQELKADAGRKAKGTVVEAKLDKGRGAVATLLVQNGTLHMGDSIIVGSTYGRIRAMFDDSGKKIKSAGPSIPVEVLGLSEVPAAGDRFTVVKDEKTARNMAEARKEKIRQESFATSHRVSLEDLYSQIKEGS--VKELSVIVKADVQGSVEAIKASLEKLSTDDVKVRVIHGAVGAISETDITLAAASNAIVIGFNVRPDNNAVAASERDGVEVKTYRVIYDAIEDIKSAMIGMLDPEYKEVVLGTAEIRATYKISNVGTIAGGYVLTGKLVRNADVRVIREGI-VIFESKLASLKRFKDDVKEVNAGYECGFSVEKFNDIKEGDIIEAYTM 671
>gi|84498577|ref|ZP_00997340.1| translation initiation factor IF-2 [Janibacter sp. HTCC2649] >gi|84381110|gb|EAP96995.1| translation initiation factor IF-2 [Janibacter sp. HTCC2649] (789 aa)
Score = 1089, Expect = 1.3e-116, Identities = 246/563 (43%), Positives = 362/563 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINE-----DNFLDNIKF---EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL-----ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT-----NLNEN-SQG-IKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F+ +IN     ++  +F  G        LDE     L  E GYD +      E     D+F  N++     + ED L  RPP+VT+MGHVDHGKT LLD IR   VA  E+G ITQ IGAYQ+  K+H      ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+D + AN  KI  QL E N++ EE+GG+TM +  SA   + ID LLEA+++TA+  ++L+ANP+R A G+ IEA++DKG GA A +L+QSGTL V D I+ G  YG+V+ M+D +   +  A PS PV++ GL+ +P++GD ++V  D++  ++++E+R+   +Q  L+         +LNE  +QG +  LN+ILK D +GS+EA++  L  I+V     L ++   +G+I  ++I+LA  S ++++ FN +     +DYA   G+ I+ Y++IYQ  +EIE+ LKG+L P + E E+G+ EIR+++  S  G IAG  V +GEIKR   +RI R    +  N +I  LR  KD +     G ECG  L ++ND   GD++  YE+
  S:   200 SLTDFADRINASPGSLVTVMFHLGEMATATQSLDEDTFRLLGAELGYDIRMVSPEEEEKELFDSFDINLEIGVDSEDEDDLAARPPVVTVMGHVDHGKTRLLDAIRNENVAGGESGGITQHIGAYQIH-KEHEGVDRPITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMPQTIEALNHAQAADVPIVVAVNKIDVEGANPSKIRQQLTEYNLVAEEYGGETMFVDVSAKQGENIDALLEAVLLTADAALDLRANPERDARGVAIEANLDKGRGATATVLIQSGTLHVGDAIVTGSSYGRVRAMLDEHGNNLTEAGPSRPVQVLGLSSVPRAGDTFVVAPDDRTARQIAERRESADRQASLAKARKRISLEDLNEAIAQGKVDTLNLILKGDVSGSVEALEDALLQIDVGEDVDLRIIDRGVGAITMNNINLAVASNAIIIGFNVRAEGLNADYADREGVEIRYYSVIYQAIEEIEQSLKGMLKPEYEEVELGTAEIREIFRSSKFGNIAGSIVRSGEIKRGTRSRITRAGVVVSENVEIAGLRRFKDDVTEVRDGFECGINLGSYNDLQIGDLIATYEM 783
>gi|16329288|ref|NP_440016.1| translation initiation factor IF-2 [Synechocystis sp. PCC 6803] >gi|2497281|sp|P72689|IF2_SYNY3 Translation initiation factor IF-2 >gi|1651769|dbj|BAA16696.1| initiation factor IF-2 [Synechocystis sp. PCC 6803] (1001 aa)
Score = 1089, Expect = 1.3e-116, Identities = 246/574 (42%), Positives = 357/574 (62%)
  Q:    41 KNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQ---------RKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K  V +   +LT+ + +  +     +IIK LFLKG+   +   LDE     +   F    +   ++        +  E   D L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY VE     K   I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT+EAI HA  A  P+IV INK+DK +AN ++I  +L+E  +L EEWGG T+++  SALN   +D LLE I++ +E+ EL ANP R A G  IEA++D+  G VA LL+Q+GTL V D I+VG  YGK++ M+D    +++ A PS  V I GL  +P +GD++ V  +EK  +  +E R +  +Q         RK++    +       +KELN+ILK D  GSL AI G L  +     ++ ++ A+ G + E+D+DLA  S ++++ FNT ++S     A   G+ I+ Y+IIY++ D+I+  ++G+LDP  +E  +G+ E+R ++     G IAG  V +G+I RN   R++R D +++    I+SL+  K+ +    AG ECG     FND+ EGDI+E YE+
  S:   408 KPEVIMLDRSLTVRDLADLLKISETDIIKRLFLKGVAVQITQTLDEETARMVAESFEVAVETPERVAAAAKTTEMLDEADLDNLVRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVEVEHNDKTEQIVFLDTPGHEAFTAMRARGAKVTDIAILVVAADDGVQPQTKEAISHAKAAGVPLIVAINKVDKPEANPDRIKQELSELGLLAEEWGGDTIMVPVSALNGDNLDGLLEMILLVSEVEELVANPNRQAKGTVIEANLDRTRGPVATLLIQNGTLRVGDAIVVGAVYGKIRAMIDDRGDKVEEASPSFAVEILGLGDVPAAGDEFEVFTNEKDARLQAEARAMEDRQTRLQQAMSSRKVTLSSISAQAQEGELKELNIILKADVQGSLGAILGSLEQLPQGEVQIRVLLASPGEVTETDVDLAAASGAIIIGFNTTLASGARQAADQEGVDIREYDIIYKLLDDIQGAMEGLLDPEEIESSLGTAEVRAVFPVGR-GNIAGCYVQSGKIIRNRNLRVRRGD-QVLFEGNIDSLKRIKEDVREVNAGYECGIGCSKFNDWKEGDIIEAYEM 992
>gi|167772655|ref|ZP_02444708.1| hypothetical protein ANACOL_04036 [Anaerotruncus colihominis DSM 17241] >gi|167665133|gb|EDS09263.1| hypothetical protein ANACOL_04036 [Anaerotruncus colihominis DSM 17241] (848 aa)
Score = 1089, Expect = 1.4e-116, Identities = 242/566 (42%), Positives = 355/566 (62%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-----SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + +T+ E + +++  ++E+IK L   G+   +N ++D      + +E G   +KE+ +  ++ L  +  ED ++ L +RPPIV +MGHVDHGKT+LLD IR++ V   EAG ITQ IGAYQVE     +TF DTPGH AF+ MRA GA +TDI VLVVAADDG+ PQT EAI+HA  A   IIV INKMDK  AN +K+  +L E  ++ E WGG    I  SA   +GI++LLE I + A+  ELKANP R A G  +EA +D+G G VA +LVQ+GTL V D ++ G  +G+V+ M++   + ++ A PS PV I+GL  +P +GD      DE+L KEL ++R+   KQ + S++     +N     SQG +KEL VI+K D  GS+EA++  L  +     ++ ++  A+G+I+ESD+ LA  S +++V FN +      + A   G+ ++ Y IIY   +++E  +KG+L P   E ++G  E+RQ++  + +G +AG  VL G+I R+A  R+ R D  II++ K+ SL+  KD +   A G ECG  L  FND  EGDI E YEI
  S:   273 DEITVGELAARLHLTASEVIKRLMGLGVMAAVNDVIDYDTAAMVSMEIGAKVEKEVVVTIEDRLFKVDEEDGDENLVERPPIVVVMGHVDHGKTSLLDAIRQTNVTEGEAGGITQHIGAYQVEVNGRPVTFLDTPGHAAFTAMRARGAQVTDIAVLVVAADDGIMPQTIEAINHAKAAGVSIIVAINKMDKPHANPDKVMQELTEYELVPEAWGGDVPCIPVSAKTREGIEDLLEMIQLVADTNELKANPDRAARGTVVEAKLDRGRGPVATILVQTGTLNVGDAVIAGTTFGRVRVMLNDKGERVEHAGPSMPVEITGLGDVPAAGDVLNAVADERLAKELVDQRKHEQKQEQFSSYEKVTLDNLFSHISQGDVKELPVIVKADVQGSVEAVRQSLEKLSNDEVRVKVIHGAVGAISESDVMLADASNAIIVGFNVRPDPVAKENAERDGVELRLYRIIYDAINDVETAMKGMLAPKTREVDLGRAEVRQVYKITGVGAVAGCYVLEGKITRSAEIRVVR-DGIIIADDKLASLKRFKDDVKEVAKGYECGMGLTKFNDIKEGDIFEAYEI 843
>gi|67923761|ref|ZP_00517225.1| Initiation factor 2:Small GTP-binding protein domain [Crocosphaera watsonii WH 8501] >gi|67854388|gb|EAM49683.1| Initiation factor 2:Small GTP-binding protein domain [Crocosphaera watsonii WH 8501] (1003 aa)
Score = 1089, Expect = 1.6e-116, Identities = 248/604 (41%), Positives = 381/604 (63%)
  Q:    12 KSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK-KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           K K    K  DN    +   + ++ E   K    V   NLT+ E S+++     EIIK+LF KGI  N+   LD+     +   FG + +  EIQ       + +  +D E+L  +RPP+VTIMGHVDHGKTTLLD+IR++KVA  EAG ITQ IGAY V    E K   I F DTPGHEAF+ MRA G  +TD+ +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK +AN ++I  +L+E +++ EEWGG T+++  SAL  + +D LLE +++ +E+ EL ANP RLA G  IEA++D+  G VA LL+Q+GTL V D I+ G  +GK++ M+D    +++ A PS  V I GLN +P +GD++ V   EK  + ++E+   N +Q +L    ++       L+  +Q   +KELN+I+K D  GS+EAI G L  +     ++ ++ A+ G + E+D+DLA  S ++++ FNT ++S     A + G+ I+ Y+IIY++ D+IE  ++G+L+P  VE  +G  ++R ++     G +AG  V +G++ RN + R+ R +K ++    ++SL+  K+ +    +G ECG  ++ F+D+ E D +E YE+V
  S:   378 KPKKPTLKAADNSGESNRTERKERTEVRQKPEKIVLDRNLTVRELSEQLCLAETEIIKHLFSKGIAVNITETLDQDTAKIVTEAFGIEVEIPEIQSAATKSTEMLDEQDLENL-QRRPPVVTIMGHVDHGKTTLLDSIRQTKVAQGEAGGITQHIGAYHVDIDHEDKTQQIVFLDTPGHEAFTAMRARGTRVTDMAILVVAADDGVQPQTREAISHARAAEVPIVVAINKIDKPEANPDRIKQELSELSLVPEEWGGDTIMVPVSALKGENLDGLLEMLVLVSEVEELVANPDRLAKGTVIEANLDRTRGPVATLLIQNGTLRVGDAIVAGSVFGKIRAMIDDRGNKVEEASPSFAVEILGLNSVPAAGDEFDVYPSEKEARLVAEENAENQRQTRLQQAMSSRRVTLSTLSAQAQEGELKELNLIIKADVQGSIEAILGSLEQLPQDEVQIRVLLASPGEVTETDVDLAAASGAVIIGFNTTLASGARGAADNEGVDIREYDIIYKLLDDIEGAMEGLLEPEEVESSLGQAQVRAVFPVGR-GAVAGCYVQSGKVVRNRYIRVLRGNK-VVYEGTLDSLKRIKEDVREVNSGYECGIGIDKFSDWQESDTIEAYEMV 992
>gi|18310668|ref|NP_562602.1| translation initiation factor IF-2 [Clostridium perfringens str. 13] >gi|110799694|ref|YP_696373.1| translation initiation factor IF-2 [Clostridium perfringens ATCC 13124] >gi|168207530|ref|ZP_02633535.1| translation initiation factor IF-2 [Clostridium perfringens E str. JGS1987] >gi|168211426|ref|ZP_02637051.1| translation initiation factor IF-2 [Clostridium perfringens B str. ATCC 3626] >gi|168214481|ref|ZP_02640106.1| translation initiation factor IF-2 [Clostridium perfringens CPE str. F4969] >gi|168216973|ref|ZP_02642598.1| translation initiation factor IF-2 [Clostridium perfringens NCTC 8239] >gi|169342661|ref|ZP_02863702.1| translation initiation factor IF-2 [Clostridium perfringens C str. JGS1495] >gi|182626382|ref|ZP_02954136.1| translation initiation factor IF-2 [Clostridium perfringens D str. JGS1721] >gi|123049757|sp|Q0TPR7|IF2_CLOP1 Translation initiation factor IF-2 >gi|39931296|sp|Q8XJR8|IF2_CLOPE Translation initiation factor IF-2 >gi|18145349|dbj|BAB81392.1| translation initiation factor IF-2 [Clostridium perfringens str. 13] >gi|110674341|gb|ABG83328.1| translation initiation factor IF-2 [Clostridium perfringens ATCC 13124] >gi|169299167|gb|EDS81237.1| translation initiation factor IF-2 [Clostridium perfringens C str. JGS1495] >gi|170661117|gb|EDT13800.1| translation initiation factor IF-2 [Clostridium perfringens E str. JGS1987] >gi|170710562|gb|EDT22744.1| translation initiation factor IF-2 [Clostridium perfringens B str. ATCC 3626] >gi|170714056|gb|EDT26238.1| translation initiation factor IF-2 [Clostridium perfringens CPE str. F4969] >gi|177908333|gb|EDT70881.1| translation initiation factor IF-2 [Clostridium perfringens D str. JGS1721] >gi|182380863|gb|EDT78342.1| translation initiation factor IF-2 [Clostridium perfringens NCTC 8239] (679 aa)
Score = 1088, Expect = 1.7e-116, Identities = 243/564 (43%), Positives = 363/564 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR--------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+ E ++K+NK   ++IK L   G+   +N  +D     ++  ++     ++ + N     +     + E+L  KRPPI+T+MGHVDHGKT+LLD IRKSKV +TEAG ITQ IGAY VE     +TF DTPGHEAF+ MRA GA +TD+V+LVVAADDG+ PQT EAI+H   A  P+IV INKMD++ AN +++  +L E  ++ E+WGG  + +  SA   + ID LLE +++T+E+ ELKA+  R A G  +EA +DKG GAVA LLVQ+GTL + D I+VG  YG+++ M D + K+IK+A PS PV + GL+ +P +GD++ V  DEK  + ++E R+   +Q          L +  + + E S  +KEL+VI+K D  GS+EAIK  L  +     K+ ++  A+G+I+E+DI LA  S ++V+ FN +  +     +   G+ +K Y +IY   ++I+  + G+LDP + E  +G+ EIR  +  S++G IAGG VLTG++ RNA  R+ R+   +I  +K+ SL+  KD +    AG ECGF++E FND  EGDI+E Y +
  S:   104 ITVKELAEKLNKPVNDVIKTLIFTGVMAAINQEIDFETAEKVAEKYEVAVYEKEEENTLEEFEEETDVEEENLA-KRPPIITVMGHVDHGKTSLLDAIRKSKVTSTEAGGITQHIGAYTVEVNGETLTFLDTPGHEAFTAMRARGAQITDVVILVVAADDGIMPQTVEAINHCKAANVPMIVAINKMDREGANPDRVKQELTEHGLVVEDWGGDIIAVPVSAKTRENIDTLLEMVLLTSEMQELKADAGRKAKGTVVEAKLDKGRGAVATLLVQNGTLHMGDSIIVGSTYGRIRAMFDDSGKKIKSAGPSIPVEVLGLSEVPAAGDRFTVVKDEKTARNMAEARKEKIRQESFATSHRVSLEDLYSQIKEGS--VKELSVIVKADVQGSVEAIKASLEKLSTDDVKVRVIHGAVGAISETDITLAAASNAIVIGFNVRPDNNAVAASERDGVEVKTYRVIYDAIEDIKSAMIGMLDPEYKEVVLGTAEIRATYKISNVGTIAGGYVLTGKLVRNADVRVIREGI-VIFESKLASLKRFKDDVKEVNAGYECGFSVEKFNDIKEGDIIEAYTM 671
>gi|134095610|ref|YP_001100685.1| translation initiation factor IF-2 [Herminiimonas arsenicoxydans] >gi|166232551|sp|A4G7S7|IF2_HERAR Translation initiation factor IF-2 >gi|133739513|emb|CAL62564.1| Translation initiation factor IF-2 [Herminiimonas arsenicoxydans] (941 aa)
Score = 1088, Expect = 1.8e-116, Identities = 253/587 (43%), Positives = 361/587 (61%)
  Q:    28 DIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           D +S F+     +   V V    +T+ E + K++  ++E+IK L   G  C +N +LD+     L  E G+      ++++   L  I  E  +     R P+VT+MGHVDHGKT+LLD IR++KVA  EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  P++V INK+DK  AN++++  +L  + V+ EE+GG +  +  SA   +GID LLE +++ AE++ELKA     A G+ +EA +DKG G VA +LVQSGTL   D +L G  YG+V+ M+D N K I  A PS PV I GL  +P +G++ +V  DE+  +E+   RQ           +  KL N   N+ E    +K L +I+KTD  GS EA+ G L  +     ++ +V AA+G I+ESD++LA  SK++++ FNT+  +     A + G+ I+ YNIIY   DEI+  + G+L P   E+ +G VEIRQ+   S +G IAG  VL G +KR A  R+ R D  +I   +++SL+  KD       G ECG TL+NFND  EGD +E++E+
  S:   345 DRESNFQAPTEAVVKDVQV-PETITVAELAHKMSVKASEVIKQLMKLGQMCTINQVLDQETAMILVEEMGH-VAHAAKLDDPEALLEIGAEQADVEALPRAPVVTVMGHVDHGKTSLLDYIRRAKVATGEAGGITQHIGAYHVETPRGMITFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHAKAAGVPLVVAINKIDKPSANLDRVKQELIAEQVVPEEYGGDSPFVPVSAKTGEGIDALLEQVLLQAEVLELKAPVVSPARGLVVEAKLDKGRGPVATILVQSGTLRRGDVVLAGSAYGRVRAMLDENGKSISEAGPSIPVEIQGLTEVPNAGEEVMVMADERKAREIGLFRQGKFRDVKLAKQQAAKLENMFENMGEGE--VKNLPMIIKTDVQGSQEALVGSLQKLSTGEVRVQVVHAAVGGISESDVNLAVASKAVIIGFNTRADASARKLAEANGVDIRYYNIIYDAVDEIKAAMSGMLSPEKREQALGLVEIRQVILVSKVGAIAGCYVLEGVVKRGASVRLLR-DNVVIWTGELDSLKRFKDDAKEVKFGFECGLTLKNFNDIKEGDQLEVFEV 934
>gi|119485071|ref|ZP_01619456.1| translation initiation factor IF-2 [Lyngbya sp. PCC 8106] >gi|119457299|gb|EAW38424.1| translation initiation factor IF-2 [Lyngbya sp. PCC 8106] (1050 aa)
Score = 1088, Expect = 1.9e-116, Identities = 242/570 (42%), Positives = 353/570 (61%)
  Q:    45 FVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQ-----GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
            V + ++T+ E +  +     EIIK LF +GI  N+   LD   +  +C +F    + E Q +     DNI  E   + L +RPP+VTIMGHVDHGKTTLLD+IR +KVA  EAG ITQ IGAY V    E K   + F DTPGHEAF+ MRA G  +TDI +LVVAADDG++PQT EAI HA  A  PIIV INK+DK+ A  +++  +L E N++ EEWGG+T+++  SA+N + +D LLE II+ +E+ +L+ANP R A G  IEA +DK  G +A LLVQ+GTL V D ++ G   GKV+ MVD   +++  A PS  V I GL  +P +GD++ V   E+    L++ R    +Q +L     +L+  S       +KELN+ILK D  GS+EAI   L  +     +L L+ AA G + E+DIDLA  S ++++ FNT +++     A  +G+ I+ YNIIY + D+++  ++G+L+P  VE+ +G  E+R ++       +AG  + +G++ RN   R+ RK   +I    ++SL+  ++      AG ECG  L+ FND+ EGDI+E Y +
  S:   465 LVISGSMTVQELANALGLQETEIIKRLFERGIAVNITETLDFNIIEMVCQDFEVILETEQQKSGAEKPDNIFNEHDLEHLKRRPPVVTIMGHVDHGKTTLLDSIRTTKVAQGEAGGITQHIGAYHVDVEHEGKMQQVVFLDTPGHEAFTAMRARGTRVTDIAILVVAADDGVRPQTIEAISHAKAAGVPIIVAINKIDKEAAQPDRVKQELMEHNLVPEEWGGETIMVPVSAINKENLDLLLEMIILVSEVEDLEANPDRAARGTVIEAHLDKARGPIATLLVQNGTLRVGDIVVAGSALGKVRAMVDDRGEKVDAASPSFAVEILGLREVPAAGDEFEVFESEREASALADVRAQAQRQSRLLQGRISLSTLSARAQEGELKELNIILKGDMQGSVEAIVNALKKLPQKEVQLRLLLAAPGEVTETDIDLATASDAVLIGFNTTLANGARQAADQLGVDIREYNIIYNLLDDVQAAMEGLLEPELVEEALGQAEVRAVFPVGR-SKVAGCYIQSGKVVRNCKVRVLRKGN-VIHEGILDSLKRMREDAKEVNAGYECGMGLDTFNDWEEGDILEAYRM 1041
>gi|75763907|ref|ZP_00743544.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74488603|gb|EAO52182.1| Bacterial Protein Translation Initiation Factor 2 (IF-2) [Bacillus thuringiensis serovar israelensis ATCC 35646] (552 aa)
Score = 1088, Expect = 2.0e-116, Identities = 243/538 (45%), Positives = 345/538 (64%)
  Q:    75 GINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           GI   +N  LD+  +  +  ++G + ++EI ++E  F   +  +D E+ L +RP +VTIMGHVDHGKTTLLD+IR SKV A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI +LVVAADDG+ PQT EAI HA  A  PIIV +NKMDK  AN +++  +L E  ++ E WGG T+ +  SA+  +GID LLE I++ +E+ E KANP R A G  IEA +DKG+G +A LLVQ+GTL V D I+VG  +G+V+ MV    + +K A PSTPV I+GLN +P++GD+++   DEK  +++ E R          ++ KLS            +KE+N+I+K D  GS+EA+   L  I+V G K+ ++   +G+I ESDI LA  S ++V+ FN +        A    + ++ + IIY++ +EIE  ++G+LDP F EK IG  E+RQ +  + +G IAG  V+ G+I R++  RI R D  +I   ++++L+  KD +   A   ECG T+E +ND  EGDI+E Y
  S:     3 GIMATINQDLDKDTIELIATDYGIEVEEEIVVSETEFETFMDEQDDEENLKERPAVVTIMGHVDHGKTTLLDSIRNSKVTAGEAGGITQHIGAYQVEVNDKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTVEAISHAKAAGVPIIVAVNKMDKPAANPDRVMQELTEYELVPEAWGGDTIFVPISAIQGEGIDNLLEMILLVSEVEEYKANPNRYATGTVIEAQLDKGKGTIATLLVQNGTLRVGDPIVVGTSFGRVRAMVSDIGRRVKVAGPSTPVEITGLNEVPQAGDRFMAFADEKKARQIGESRAQEALVAQRGEKSKLSLEDLFQQIQESDVKEINLIVKADVQGSVEAMAASLRKIDVEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDVNAKRTAELENVDVRLHRIIYKVIEEIELAMQGMLDPEFEEKVIGQAEVRQTFKVTKVGTIAGCYVIDGKITRDSGVRIIR-DGIVIFEGQLDTLKRFKDDVKEVAQNYECGITIERYNDLKEGDIIEAY 545
>gi|33865131|ref|NP_896690.1| translation initiation factor IF-2 [Synechococcus sp. WH 8102] >gi|39931218|sp|Q7U8L9|IF2_SYNPX Translation initiation factor IF-2 >gi|33638815|emb|CAE07112.1| translation initiation factor IF-2 [Synechococcus sp. WH 8102] (650 aa)
Score = 1087, Expect = 2.3e-116, Identities = 234/569 (41%), Positives = 369/569 (64%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           +NLT+ E +  ++  S+EIIK LF KGI   +   LD   +  +  EFG    + +++      ++ I+  D+E L+ +RPP+VT+MGHVDHGKT+LLD IRK++VAA EAG ITQ IGAYQVE     +   +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A+ +++  +L+E+N+L E+WGG  +++  SA+  + ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LLVQ+GTL   D +  G   GKV+ MVD NR+ +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +          R++S    +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G + E+D+DLA  S +++V FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG+++RN   R+ R   +++ +  ++SLR  KD +   A G ECG   + F ++ +GD +E +++V +
  S:    65 DNLTVQELADMLSVESSEIIKSLFFKGIIATVTQTLDMNTIETVAEEFGVPVLQDDVEEAAKKTVEMIEEADKEHLI-RRPPVVTVMGHVDHGKTSLLDAIRKARVAAGEAGGITQHIGAYQVEIDHNDEARKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASPDRVKQELSEQNLLAEDWGGDVVMVPVSAIKGENIDKLLEMLLLVTEVEDLQANPDRLARGTVIEAHLDKAKGPVATLLVQNGTLKTGDVVAAGPVLGKVRAMVDDNRQRLKEAGPSFAVEALGFSEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLTAMSGQANEGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEVTETDVDLAAASGAVIVGFNTSMASGAKKAADATGVDVRDYDVIYKLLEDIQLAMEGLLEPELVEEALGEAEVRAVFTIGK-SAVAGCYVTTGKLQRNCKVRVHR-GSQVVYDGDLDSLRRNKDDVKEVATGFECGVGTDRFANWEDGDRIEAFKMVTQ 644
>gi|121604912|ref|YP_982241.1| translation initiation factor IF-2 [Polaromonas naphthalenivorans CJ2] >gi|189028340|sp|A1VNU2|IF2_POLNA Translation initiation factor IF-2 >gi|120593881|gb|ABM37320.1| bacterial translation initiation factor 2 (bIF-2) [Polaromonas naphthalenivorans CJ2] (992 aa)
Score = 1087, Expect = 2.3e-116, Identities = 251/603 (41%), Positives = 372/603 (61%)
  Q:    12 KSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL-DNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ---LNTK-----QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + +  + + V   +N    ++FK +E  +          +T+ E + K++  S+E+IK+L   G    +N  LD+     +  E G+        + + F  D+++ +  E L   R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY V+  + +++F DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  PI+V INK+DK   N+E++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA+   LA G+ IEA +DKG G VA +LVQSGTL   D +L G  YG+V+ M+D N K IKTA PS PV I GL  +P++GD ++V  DE+ ++E++  R     NTK       KL N  +++N     +K L +I+K D  GS EA+   L  +     K+ LV + +G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E+ IG+ EIR ++  S IG IAG  V  G ++R A  R+ R +  +I   +++SL+  KD       G ECG  L+N+ND   GDI+E +EI
  S:   386 RGRRSSGRDVRPESNFVAPTEFKVLEVHVPE-------TITVSELAHKMSIKSSEVIKHLMKLGQMVTINQPLDQDTAMIVVEEMGHTALTAALDDPEAFTADDVQGQQAEAL--PRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVQTPRGMVSFLDTPGHEAFTAMRARGAQATDIVILVVAADDGVMPQTKEAIKHARAAGVPIVVAINKIDKPGINLERVKGELVTEGVVPEEFGGDSPFVPVSAHTGAGIDDLLEQVLLQAEVLELKASVDSLAKGLVIEARLDKGRGPVATVLVQSGTLKAGDVVLAGSTYGRVRAMLDENGKPIKTAGPSIPVEIQGLTEVPQAGDDFMVMTDERRVREIATYRAGKFRNTKLAKQQASKLENMFSDINAGE--VKMLPIIIKADVQGSQEALAQSLLKLSTDEVKVQLVYSGVGGISESDVNLAIASKAVLIGFNTRADAQARKQAENNGIDIRYYNIIYDAVDELKAAMSGMLTPDKKEEIIGNAEIRNIFKVSKIGSIAGCMVTAGVVRRTAKVRLLRGNV-VIFTGELDSLKRFKDDAKEVKEGFECGLNLKNYNDIEVGDILEFFEI 985
>gi|154497683|ref|ZP_02036061.1| hypothetical protein BACCAP_01659 [Bacteroides capillosus ATCC 29799] >gi|150273181|gb|EDN00326.1| hypothetical protein BACCAP_01659 [Bacteroides capillosus ATCC 29799] (798 aa)
Score = 1087, Expect = 2.5e-116, Identities = 241/564 (42%), Positives = 355/564 (62%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQ------RKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + + + E + ++ K  AE++K L   G+  +L+ ++D      +  E G   +KE+ +  E+  +D    ED+E+ L  R P+V +MGHVDHGKT+LLD IR S VAA EAG ITQ IGAYQV+ +   ITF DTPGHEAF+ MRA GA +TD+ +LVVAADDG+ PQT E+I+HA  A  PIIV INKMDK  AN E+I  QL    ++ EEWGG+T++   SA    GID LL+ +I+TAE+ ELKANP R A+G  IEA +DKG G VA LLVQ+GTL   D I+ G   G+V+ M +   +++  A PS PV I G+  +P +GD +    DE++ +EL E+R+ + K       ++  +     ++  QG IK+LNVI+K D  GS EA+K  L  +     ++ ++  A+G+I+ESD+ LA TS +++V FN +  +   D A    + ++ Y +IY   +EI+  +KG+L P F E  +G  E+R+++  + +G++AG  V  G+++R A  R+ R D  +I +  I SL+  KDS+   A G ECG T E F D  +GD++E +
  S:   223 DEIGVGELASRMKKTGAEVVKCLIKNGVMASLSDIIDFDTAAIIAEEMGCKVEKEVIVTIEEKLIDTA--EDKEEDLVPRAPVVVVMGHVDHGKTSLLDYIRNSHVAAGEAGGITQHIGAYQVDVQGKPITFLDTPGHEAFTAMRARGAMITDVAILVVAADDGIMPQTVESINHAKAAGIPIIVAINKMDKPTANPERIKEQLTNYELVPEEWGGETIICPISAKTGDGIDNLLDMVILTAEMQELKANPNRTAHGAVIEARLDKGRGPVATLLVQNGTLKQGDIIIAGTAVGRVRAMTNARGEKLTEAGPSVPVEIIGMGEVPGAGDDFHAVADERMARELVEQRKHDQKMAASGGVKQKVSLDDLFSQIQQGEIKDLNVIVKADVQGSAEAVKSSLEKLSNEEVRVRVIHCAVGAISESDVMLATTSNAIIVGFNVRPDNNAKDTAARNKVDMRMYRVIYDCIEEIQTAMKGMLAPKFKEVFLGQAEVREVFRITGVGMVAGCYVTNGKMQRGAQMRLLR-DNIVIYDGSIASLQRFKDSVKEVAQGYECGITFEKFQDIKQGDVIEAF 791
>gi|108804248|ref|YP_644185.1| translation initiation factor 2 [Rubrobacter xylanophilus DSM 9941] >gi|123177370|sp|Q1AW55|IF2_RUBXD Translation initiation factor IF-2 >gi|108765491|gb|ABG04373.1| translation initiation factor IF-2 [Rubrobacter xylanophilus DSM 9941] (689 aa)
Score = 1087, Expect = 2.6e-116, Identities = 225/513 (43%), Positives = 341/513 (66%)
  Q:   103 EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG---TNLNE--NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           E+   E+   + I  ED  + L ++PP++T+MGHVDHGKT+LLD IR++ V + EAG ITQ IGAYQVE +   ITF DTPGHEAF++MRA GA +TDIVVLVVAADDG+ PQTEEAI+HA  A  PI+V INK+D  +AN +++  +LAE+ +  E+WGG+T+ +  SA   +GI++LLE I+V AE+ EL+ANPK  A+G  IE+ +D G G VA LL+  GTL   D +L G  YG+V+ M D+  + IK A P TPV I GL+G+P++G ++ V  +E+  +  +++ +   ++++L+  G   T L E     G +ELN+++K D  GS+EA+K  L+ +     ++N+VR+ +G++ +SDI LA  S  +V+ FN + ++     A   G+ I+ Y++IY++ +EIE  +KG+L P   E+E  + E+R  +   ++G +AG  V +GEI+RN       +D  ++ + +I SL+  KD + +   G ECG  +ENFND  EGD++E YE+V
  S:   169 EVGALEEPAPEEIGPEDSPEDLVEKPPVITVMGHVDHGKTSLLDRIRRTNVVSGEAGGITQHIGAYQVEHEGRRITFIDTPGHEAFTEMRARGARVTDIVVLVVAADDGVMPQTEEAIEHARAAGVPIVVAINKIDVPNANPDRVMGELAERGLTPEQWGGETVTVPVSAKTGEGIEDLLENILVVAELEELRANPKAPASGYVIESRLDPGRGPVATLLLNRGTLHRGDVVLAGTAYGRVRAMFDYTGQRIKEAGPGTPVEILGLSGVPEAGTRFEVAENERAARSRAQQAEERLRRQELAASGPRRTTLEELLGEGGAEELNLVVKADVAGSVEALKEALAKLSTDEVRVNVVRSGVGAVTDSDIMLASASGGIVIGFNVRPTNTAKQVAEREGVEIRTYDVIYKVIEEIEAAMKGMLAPETAERETATAEVRATFRVPNVGTVAGCYVTSGEIRRNN-RVRVVRDGTVVYDGQIASLKRFKDDVRTVREGFECGVGIENFNDVKEGDVLEFYEVV 685
>gi|152965411|ref|YP_001361195.1| translation initiation factor IF-2 [Kineococcus radiotolerans SRS30216] >gi|189028327|sp|A6W7Z2|IF2_KINRD Translation initiation factor IF-2 >gi|151359928|gb|ABS02931.1| translation initiation factor IF-2 [Kineococcus radiotolerans SRS30216] (1044 aa)
Score = 1087, Expect = 2.8e-116, Identities = 240/563 (42%), Positives = 356/563 (63%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGY--------DFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F+++I+   A ++  LF  G        LDE     L  E GY        D ++E+       LD     + +D L  RPP+VT+MGHVDHGKT LLD IR S V A EAG ITQ IGAYQV    E  +  ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK+ AN +K+  QL E N++ EE+GG TM +  SA    G+D LLEA+++TA+  ++L+AN  + A GI IE ++DKG G VA +LVQSGTL V D I+ G  YG+V+ M+D N   ++ A PS PV++ GL  +P +GD ++V  D++  ++++EKR+         K RK   L +F   L +    ++ LN+ILK D  GS+EA++  L  I+V    +L ++   +G++ +++++LA  S ++++ FN +   +  +YA   G+ I+ Y++IY   +++E  LKG+L P F E ++G+ E+R+++  S  G IAG  V +G I+RN+ AR+ R+      N  I SLR  KD       G ECG  L ++ND    D++E YE+
  S:   455 SLSDFAERIDADPAALVTILFHLGEMATATQSLDEDTFQLLGGELGYVIEVVSPEDEERELLAGFSIDLDAELEAEGDDDLSARPPVVTVMGHVDHGKTKLLDAIRSSDVVAKEAGGITQHIGAYQVVKEHEGIERPITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMPQTIEALNHAQAADVPIVVAVNKVDKEGANPDKVRQQLTEYNLVAEEYGGDTMFVDVSARQGTGLDSLLEAVLLTADASLDLRANSDKDARGIAIEGNLDKGRGPVATVLVQSGTLHVGDAIVAGTGYGRVRAMLDENGDAVQEATPSRPVQVLGLTSVPGAGDTFLVAPDDRTARQIAEKREAQERNAALAKARKRITLEDFTKALQQGK--VETLNLILKGDGAGSVEALEDALFKIDVGDEVELRVIDRGVGAVTKNNVNLAVASNAIIIGFNVRPEQQTKEYADREGVDIRFYSVIYAAIEDVEASLKGLLKPEFEEVQLGTAEVREIFRSSKFGNIAGTLVRSGLIRRNSKARVLRRGVVHGDNLTIESLRRFKDDATEVREGYECGIGLGSYNDLQVDDVIETYEM 1038
>gi|16124298|ref|NP_418862.1| translation initiation factor IF-2 [Caulobacter crescentus CB15] >gi|13421134|gb|AAK22030.1| translation initiation factor IF-2 [Caulobacter crescentus CB15] (1037 aa)
Score = 1086, Expect = 2.9e-116, Identities = 227/569 (39%), Positives = 353/569 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE-------NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  + +T+ E S ++     +IIK+L  +G+   +N ++D      +  EFG+  K+  + + E+ F   I  +D ++ +D RPP+VTIMGHVDHGKT+LLD +R + VAA EAG ITQ IGAYQV  K    +TF DTPGH AFS MRA GA++TDIVVLVVA DDG+ PQT EAI HA  A+ PIIV +NKMDK  ++  ++ ++L +  ++ E  GG T +I+ SA    G+D LLEAI++ AE+++LKANP R A+G+ IEA +DKG GAV+ +LV  GTL   D ++ G  +GKV+ +++   ++++ A P+TPV I GL+G+P  GD + V  +E   +EL+E R    +++ ++  G   +          + +KEL +++K D  GS EAI G L  +     +  ++ +  G+I+ESD+ LA+ + + V+ FN + S++    A   G+ I+ Y IIY + D+I+ +L G+L P+  E  +G+ E+ Q +  S IG +AG +V  G +++ A  RI R+D  ++    + +L+  KD +     G+ECG     F D   GD +E + +
  S:   455 VIPDVITVQELSNRMAVRGVDIIKFLMRQGVMLKINDVIDNDTAELVATEFGHTVKRVSEADVEEGF---IGADDHDEHMDLRPPVVTIMGHVDHGKTSLLDALRSTDVAAGEAGGITQHIGAYQVRLKDGQRVTFLDTPGHAAFSSMRARGANITDIVVLVVAGDDGVMPQTIEAIKHAKAAEVPIIVAVNKMDKPGSDPTRVVNELLQHEIVVESLGGDTQLIEVSAKARTGLDNLLEAILLQAEVLDLKANPDRSADGVVIEAKLDKGRGAVSTVLVNRGTLKRGDIVVAGSQWGKVRALLNERNEQLQEAGPATPVEILGLDGVPSPGDAFAVVENEARARELTEYRIRLKREKSMAPVGAGASMADMMAKLQDKKLKELPLVIKADVQGSAEAIIGSLDKMATDEVRARIILSGAGAISESDVMLAKGAGAPVIGFNVRASAQARALAEREGVEIRYYAIIYDLLDDIKGVLSGMLAPIQRETFLGNAEVLQAFDISKIGKVAGCKVTEGVVRKGAKVRIIRQDIVVLELGTLQTLKRFKDEVNEVPVGQECGMMFAGFQDIKVGDTIECFTV 1029
>gi|126697023|ref|YP_001091909.1| translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9301] >gi|166232571|sp|A3PEY3|IF2_PROM0 Translation initiation factor IF-2 >gi|126544066|gb|ABO18308.1| Translation initiation factor IF-2 [Prochlorococcus marinus str. MIT 9301] (1114 aa)
Score = 1086, Expect = 3.0e-116, Identities = 243/572 (42%), Positives = 372/572 (65%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW----KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN---------FGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + V  +NLT+ E + K++  S+EIIK LF KGI   +   LD   +  +  EFG    + +IQ   +  +D I+ +D ++L+ +RPP++T+MGHVDHGKT+LLD+IR+S+VA+ EAG ITQ IGAYQVE+    +K  +TF DTPGHEAF+ MRA G  +TD+ VLVVAADDG +PQT EAI HA  AK PI+V INK+DK+ A+ +++  +L+EK+++ E+WGG T+++  SA+  Q ID+LLE I++ +E+ +L+ANP R A G  IEA +DK +G VA LLVQ+GTL   D +  G   GK++ MVD +   IK A PS PV   G + +P +GD++ V  DEK  + +  +R  + +  KL+             +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G I E+DIDLA  S S+++ FNT ++S     A +  + I+ Y +IY++ ++I+  ++G+L+P  VE+ +G  E+R  +S    G IAG  + TG+++RN   R+ R +K +I    ++SL+  KD +     G ECG   + F+ ++EGD++E ++ V
  S:   524 IIVPEDNLTVQELADKLSLESSEIIKSLFFKGITATVTQSLDLATIETVAEEFGVPVLQDDIQEAAEKTVDMIESDDIDNLI-RRPPVITVMGHVDHGKTSLLDSIRESRVASGEAGGITQHIGAYQVEFEHESQKKKLTFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGCRPQTLEAISHARAAKVPIVVAINKIDKEGASPDRVKQELSEKDLIAEDWGGDTVMVPVSAIKKQNIDKLLEMILLVSEVEDLQANPDRFAKGTVIEAHLDKAKGPVATLLVQNGTLKSGDVLAAGSVLGKIRAMVDEHGNRIKEAGPSFPVEALGFSEVPTAGDEFEVYPDEKAGRAIVGERATDARATKLAQQMASRRVSLSSLSTQANDGELKELNLILKADVQGSVEAILGSLEQLPKNEVQVRVLFSAPGEITETDIDLAAASGSVIIGFNTSLASGAKRAADANDVDIREYEVIYKLLEDIQLAMEGLLEPDLVEESLGQAEVRATFSVGK-GAIAGCYIQTGKLQRNCSLRVIRSEK-VIFEGNLDSLKRAKDDVKEVNTGFECGVGCDKFSSWIEGDVIEAFKFV 1106
>gi|114705357|ref|ZP_01438265.1| translation initiation factor IF-2 [Fulvimarina pelagi HTCC2506] >gi|114540142|gb|EAU43262.1| translation initiation factor IF-2 [Fulvimarina pelagi HTCC2506] (995 aa)
Score = 1086, Expect = 3.1e-116, Identities = 225/569 (39%), Positives = 357/569 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQ--------GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +    +TI E + ++++ S ++IKYL  +G       ++D+     +  EFG+  K+  + + +  + N+  ED+E+ L  RPP+VTIMGHVDHGKT+LLD IRK+KVA+ E+G ITQ IGAYQVE     ++F DTPGH AF+ MRA GA  TDI VLVVAADD + PQT E+I+HA  A  PIIV INKMDK DA+  K+ + L +  V  E  GG+ + ++ SA N   +D+LLEAI++ AEI++LKA+P R A G+ IEA +DKG G+VA +L+Q+GTL   D ++ G+ +G+V+ +V+   +++  A PS PV + G+ G P +GD++ V   E   +E+S+ RQ  T++++++          Q        G+K   +++K D  GS+EAI G L  +     +  ++ +  G+I ESDI LA+ S + ++ FN + + +  D A   GI I+ YN+IY + D+++  + G+L P   E  IG  EI++++  + +G +AG  V  GE++R A  R+ R+D  +I    + +L+  KD ++   +G+ECG   +N+ D  +GD++E + +
  S:   415 IIPETITIQELANRMSERSVDVIKYLMKEGQMMKPGDIIDQDLAELIASEFGHTIKRVAESDVEEGIFNV--EDKEENLQSRPPVVTIMGHVDHGKTSLLDAIRKTKVASGESGGITQHIGAYQVEQGGQKVSFIDTPGHAAFTSMRARGAQATDIAVLVVAADDSVMPQTVESINHAKAAGVPIIVAINKMDKPDADAAKVRNGLLQHEVFVESMGGEVLDVEVSAKNGTNLDKLLEAILLQAEILDLKADPDRTAEGVVIEAQLDKGRGSVATVLIQTGTLKRGDIVVAGDEWGRVRALVNDRGEQMSEAPPSMPVEVLGMQGTPMAGDRFAVVESEAKAREISDYRQRLTREKQVAKSAGQRGSLEQMMSQLTDSGLKTFPLLIKGDVQGSIEAIDGALEKLGTDEVQARIIHSGAGAITESDIALAKASNASIIGFNVRANKQARDAAAQEGIEIRYYNVIYDLVDDVKDAMSGLLAPERRETFIGYAEIKEVFQITKVGKVAGCLVTEGEVERGAGVRLLREDV-VIHEGTLKTLKRYKDEVSKVQSGQECGMAFQNYEDIRQGDVIECFRV 988
>gi|15963992|ref|NP_384345.1| translation initiation factor IF-2 [Sinorhizobium meliloti 1021] >gi|39931300|sp|Q92SW4|IF2_RHIME Translation initiation factor IF-2 >gi|15073168|emb|CAC41676.1| Probable translation initiation factor IF-2 protein [Sinorhizobium meliloti 1021] (889 aa)
Score = 1086, Expect = 3.4e-116, Identities = 236/585 (40%), Positives = 356/585 (60%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR----------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +SQ ++    I   V V    +TI E S+++++ + ++IK+L  +G       L+D      +  EFG+  K+  + + +  + NI   D +D +  RPPIVTIMGHVDHGKT+LLD IR + V A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI VLVVAADD + PQT E+I+HA  A  PIIV INK+DK  AN +K+ ++L +  V  E  GG+ + ++ SA N   +D+LLEAI++ +EI++LKANP R A G  +EA +D+G GAVA +LVQ GTL     I+ G+ +G+V+ +V+   + +K A PSTPV + GL+G P +GD++ V   E   +E+SE RQ   +++           L    T L   + G+KE  +++K D  GS+EAI G L  +     +  +V +  G I ESD+ LA  S + ++ FN + + +  D +   GI I+ YNIIY + D+++  + G+L P   E  +G+ EI ++++ + +G +AG RV  G+++R    R+ R D  +I   K+ +L+  KD ++   +G+ECG   EN+ D   GD +E + +
  S:   294 RSQMQETREKISREV-VLPETITIQELSQRMSERAVDVIKFLMKEGQMMKPGDLIDADLAELIAGEFGHTVKRVSESDVEEGIFNI--SDVDDDMQSRPPIVTIMGHVDHGKTSLLDAIRHANVVAGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAVLVVAADDSVMPQTIESINHAKAAGVPIIVAINKIDKPSANPQKVRTELLQHEVFVESMGGEVLDVEVSAKNQTNLDKLLEAILLQSEILDLKANPNRTAEGTVVEAELDRGRGAVATVLVQKGTLTPGQIIVAGDQWGRVRALVNDKGEHVKAAGPSTPVEVLGLSGTPAAGDRFAVVESESRAREISEYRQRLAREKAVARQSGSRGSLEQMMTQL--QTSGVKEFPLVIKGDVQGSIEAISGALDKLGTDEVRARIVHSGAGGITESDVSLAEASNAAIIGFNVRANKQARDASERAGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFLGNAEILEVFNITKVGKVAGCRVTEGKVERGVGVRLVR-DNVVIHEGKLKTLKRFKDEVSEVQSGQECGMAFENYEDIRAGDTIECFRV 882
>gi|62424974|ref|ZP_00380113.1| COG0532: Translation initiation factor 2 (IF-2; GTPase) [Brevibacterium linens BL2] (1004 aa)
Score = 1086, Expect = 3.7e-116, Identities = 255/563 (45%), Positives = 354/563 (62%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL------------------LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH----LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTKQRK------LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F++KIN     ++  LF  G    +   LDE     L  E GY  K EI   ED        EDRE L                  L  RPP+VT+MGHVDHGKT LLD IR + VAA EAG ITQ IGAYQ E +       ITF DTPGHEAF+ MRA GA  TD+ +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK+ AN  K+  QL E N++ EE+GG+TM +  SAL  +GID+LLE++++T +  ++L+ANP + A GI IEA +DKG GAVA +LV SGTL   D I+ G  YG+V+ M D N   ++ A PS PV++ GL+ +P++GD +I T D++  ++++EKR   + N  Q +      L +F   L E    +  LN+ILK D +G++EA++  L  I+V     L ++   +G+I E+DI+LA    ++V+ FN +  +K  D A   G+ ++ Y++IYQ  D+IE  LKG+L P + E + G+ EIR+++  S  G IAG  V  G I RNA AR+ R    +    KI SLR  KD       G ECG  L +FND   GDI+E  E+
  S:   415 SLADFAEKINTDPTNLVTVLFHLGEMATITQSLDEGTFEVLGEELGY--KIEIVSPED--------EDRELLETFDIDLDAEAADEDDEDLAARPPVVTVMGHVDHGKTKLLDAIRSANVAAREAGGITQHIGAYQAEVEHEGADRKITFLDTPGHEAFTAMRARGAKSTDLAILVVAADDGVMPQTVEALNHAQAANIPIVVAVNKIDKEGANPSKVMQQLTEYNLVAEEYGGETMFVPISALKREGIDQLLESVLLTTDAALDLRANPDKSARGIAIEAKLDKGRGAVATVLVDSGTLRQGDAIVCGTAYGRVRAMFDENGNLVEEAGPSRPVQVLGLSSVPRAGDTFISTEDDRTARQIAEKRDAIERNAAQARGRKRISLEDFTKALAEGK--VDMLNLILKGDVSGAVEALEDSLLKIDVGDDVDLRIIHRGVGAITENDINLATVDNAIVLGFNVRPEAKARDLAEREGVDVRYYSVIYQAIDDIESSLKGMLKPEYEEVQTGTAEIREVFRSSKFGNIAGSIVRDGHITRNASARVTRDGVVVGDKVKIESLRRFKDDATEVREGFECGIGLGSFNDLRVGDIIETVEM 998
>gi|177664426|ref|ZP_02940228.1| translation initiation factor IF-2 [Cyanothece sp. PCC 8801] >gi|172076262|gb|EDT61674.1| translation initiation factor IF-2 [Cyanothece sp. PCC 8801] (992 aa)
Score = 1085, Expect = 3.8e-116, Identities = 249/570 (43%), Positives = 364/570 (63%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDF----KKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH----LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN-------LNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +  +NLT+ E + ++     EIIK LF KGI  N+   LD +    +  E G +     +K     +   LD    E+    L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V+   +     I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  AK PI+V INK+DK  AN ++I  +L+E  +L EEWGG+T+++  SAL  + +D LLE I++ +E+ EL ANP R A G  IEA++D+  G VA LLVQ+GTL V D I+VG  +GK++ M+D    +++ A PS  V I GLN +P +GD++ V  +EK  + ++E+     +Q +L    ++       L+  +Q   +KELN+ILK D  GS+EAI G L  +     ++ ++ AA G I E+D+DLA  S ++VV F+T ++S     A   G+ I+ Y+IIY++ D+I+  ++G+L+P  VE  +G  ++R +++    G +AG  V +G++ RN      R+ K+I+    ++SL+  K+      AG ECG   + FND+ EGDI+E YE+V
  S:   403 ILDSNLTVRELANRLEIPETEIIKNLFSKGIAVNITQTLDLQTARLVTEELGVEVITPEEKAAATKDRELLDEYDLEN----LQRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDLDHNGVPEQIVFLDTPGHEAFTAMRARGAKVTDIAILVVAADDGVQPQTREAISHAQAAKVPIVVAINKIDKPQANSDRIKQELSELGLLSEEWGGETIMVPVSALTGENLDTLLEMILLVSEVEELVANPDRRAKGTVIEANLDRTRGPVATLLVQNGTLRVGDAIVVGSVFGKIRAMIDDRGNKVEAASPSFAVEILGLNSVPSAGDEFEVYENEKEARAIAEQLAQEQRQTRLQQAMSSRRVTLSTLSAQAQEGELKELNLILKADVQGSVEAILGALEQLPQGEVQIRVLLAAPGEITETDVDLAAASGAVVVGFSTTLASGARAAADREGVDIREYDIIYKLLDDIQGAMEGLLEPEEVESPLGQAQVRAVFTVGR-GAVAGCYVQSGKVVRNR-LVRVRRGKDIVYQGNLDSLKRIKEDAREVNAGYECGIGTDKFNDWQEGDIIEAYEMV 983
>gi|113477413|ref|YP_723474.1| translation initiation factor 2 [Trichodesmium erythraeum IMS101] >gi|123056247|sp|Q10XM3|IF2_TRIEI Translation initiation factor IF-2 >gi|110168461|gb|ABG53001.1| bacterial translation initiation factor 2 (bIF-2) [Trichodesmium erythraeum IMS101] (1059 aa)
Score = 1085, Expect = 4.0e-116, Identities = 247/608 (40%), Positives = 379/608 (62%)
  Q:     8 NVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEK----LLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           N+K KS   ++ +          ++ K VE        V + ++T+ E +  +     EII+ LF+KGI  N+   LD   +  +  E G   +   + +       I  E     L +RPP+VTIMGHVDHGKT+LLD+IR +KVAA EAG ITQ IGAY V    E +   + F DTPGHEAF+ MRA GA +TD+ VLVVAADDG++PQT EAI HA  A+ P+IV INK+DK++AN +++  +L E  ++ EEWGG  +++  SA+  Q +D LLE I++ +E+ +L+ANP+RLA G  IEA++DK  G VA LLVQ+GTL V D I+ G  YGKV+ M+D     +  A PS  V + GL  +P++GD++ V  +EK    +  E ++ ++ +   R+ S    ++      +KELN+ILK D  GS+EAI   L  +     +L L+ +  G + E+DIDLA  S+++++ FNT ++S     A + G+ ++ YN+IY++ D+I+  ++G+LDP  +E+ +G VE+R +++ +  G +AG  VL+G++ RN   R+ R++ EI+    ++SLR  KD +    AG ECG + +NFN++ EGDI+E Y++V
  S:   444 NLKKKSSQSHESVQSESNEQTQSAELKPVEK------LVISASMTVQELALALAIPETEIIRRLFMKGIAVNITESLDIPTIEMVVKEEGIPIEVPEEQSAAKKTTEILEETDLASLQRRPPVVTIMGHVDHGKTSLLDSIRATKVAAGEAGGITQHIGAYHVDVEHEGQMQQVVFLDTPGHEAFTAMRARGARVTDVAVLVVAADDGVQPQTIEAISHAKAAEVPLIVAINKIDKEEANPDRVKQELMEHGLVPEEWGGDAIMVPVSAIQKQNLDTLLEMILLVSEVEDLQANPERLAKGTVIEANLDKARGPVATLLVQNGTLKVGDIIVAGSVYGKVRAMIDDRGYRVDKASPSFAVEVLGLRDVPQAGDEFKVFKNEKEASAITTERADAKRESRIMRRTSLGAVSVRAQEGELKELNLILKGDVQGSIEAIVAALRQLPQKEVQLRLLLSGAGEVTETDIDLAAASEAVIIGFNTTMASGARQAADAAGVDVREYNVIYKLLDDIQGAMEGLLDPELIEEPLGQVEVRAVFTINR-GAVAGCYVLSGKVVRNCKVRV-RRNGEIVYQGILDSLRRMKDDVKEVNAGYECGVSFDNFNNWSEGDIIEAYQMV 1051
>gi|145224619|ref|YP_001135297.1| translation initiation factor IF-2 [Mycobacterium gilvum PYR-GCK] >gi|189028334|sp|A4TCF8|IF2_MYCGI Translation initiation factor IF-2 >gi|145217105|gb|ABP46509.1| bacterial translation initiation factor 2 (bIF-2) [Mycobacterium gilvum PYR-GCK] (930 aa)
Score = 1085, Expect = 4.0e-116, Identities = 243/564 (43%), Positives = 367/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL----DNIKFEDR--EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F+ KIN + A +++ LF  G        +++  +  L  E  Y  +     +ED  L    D    ED   ED L+ RPP+VT+MGHVDHGKT LLDTIR + V   EAG ITQ IGAYQV    +  +  ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EA++HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ EE+GG TM +  SA     I+ LLEA+++TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D ++ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN+G++EA++  L  I+V    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y+IIYQ  DEIE  LKG+L P++ EKE+G  EIR ++  S +G IAG  V +G ++RNA AR+ R +  +  N  ++SL+  KD       G ECG TL  +ND  EGD++E YE+V
  S:   346 SLSDFADKINANPASLVQALFNLGEMVTATQSVNDETLELLGGEMNYVVQVVSPEDEDRELLQSFDLSYGEDEGGEDDLEFRPPVVTVMGHVDHGKTRLLDTIRDATVREGEAGGITQHIGAYQVTVDLDGNERPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAVNHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVPEEYGGDTMFVDISAKAGTNIEALLEAVVLTADASLDLRANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARTRKRISLEDLDSALKETSQ----LNLILKGDNSGTVEALEEALLGIQVDDEVQLRVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSIIYQAIDEIESALKGMLKPIYEEKELGRAEIRAIFRSSKVGNIAGCLVQSGIMRRNAKARLLRDNVVVAQNLTVSSLKREKDDATEVREGYECGLTL-TYNDIKEGDVIETYELV 925
>gi|154506279|ref|ZP_02043017.1| hypothetical protein RUMGNA_03821 [Ruminococcus gnavus ATCC 29149] >gi|153793418|gb|EDN75838.1| hypothetical protein RUMGNA_03821 [Ruminococcus gnavus ATCC 29149] (855 aa)
Score = 1085, Expect = 4.2e-116, Identities = 248/565 (43%), Positives = 354/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED-----LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEK-------RQLNTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           LTI E + K+    + I+K LF++G    +N  +D     E+ +EF      EI   ++  +D I+   +ED      + KRPP+V +MGHVDHGKT+LLD IR + V   EAG ITQ IGA  VE     ITF DTPGHEAF+ MR  GA+ TDI +LVVAADDG+ PQT EAI+HA  A   IIV INK+DK  ANIE++  +L E  ++ E+WGG T+ +  SA   +GI ELLE +++TAE+MELKANP R+A G+ IEA +DKG+G+VA +LVQ GTL V D I  G  +GKV+ M+D   + +K A PS PV I GLN +P++G+ ++    EK  +  +E        + L   + K+S      N+  +G +KELN+++K D  GS+EAIK  L  +      + ++   +G+INESD+ LA  S ++++ FN +  +   + A   G+ ++ Y +IY   +++E  +KG+LDPVF EK +G  E+RQ +  S +G IAG  V  G  +RN   R+ R D  +I +  + SL+  KD +    AG ECGF  EN+ND  EGD+VE Y++V
  S:   281 LTIQELADKMKVVPSVIVKKLFMQGKIVTVNQEIDFETAEEIAMEF------EILCEKEEVVDVIEELLKEDEEDEATMVKRPPVVCVMGHVDHGKTSLLDAIRDTSVTDREAGGITQHIGASVVEINGEKITFLDTPGHEAFTAMRMRGANSTDIAILVVAADDGVMPQTIEAINHAKAAGIEIIVAINKIDKPSANIERVKQELTEYELIPEDWGGSTIFVPVSAHTKEGIQELLEMVLLTAEVMELKANPNRVARGLVIEAELDKGKGSVATVLVQKGTLRVGDAIAAGSAHGKVRAMMDDRGRRVKEAGPSQPVEILGLNEVPQAGEVFVGCESEKEARNFAETFISQHRVKMLEETKSKMS-LDDLFNQIQEGNLKELNIVVKADVQGSVEAIKQSLIKLSNEEVVIKIIHGGVGAINESDVILASASNAIIIGFNVRPDATAKEIADREGVDLRLYRVIYNAIEDVEAAMKGMLDPVFEEKVLGHAEVRQTFKASGVGTIAGSYVQDGTFERNCSVRLTR-DGIVIFDGPLASLKRFKDDVKEVRAGYECGFVFENYNDIKEGDLVEAYKMV 850
>gi|86355776|ref|YP_467668.1| translation initiation factor IF-2 [Rhizobium etli CFN 42] >gi|123765880|sp|Q2KDZ5|IF2_RHIEC Translation initiation factor IF-2 >gi|86279878|gb|ABC88941.1| translation initiation factor IF-2 protein [Rhizobium etli CFN 42] (916 aa)
Score = 1085, Expect = 4.4e-116, Identities = 237/585 (40%), Positives = 358/585 (61%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR----------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +SQ ++    I   V V    +TI E S+++++ + ++IKYL  +G       ++D      +  EFG+  K+  + + +  + NI   D E     RPP+VTIMGHVDHGKT+LLD IR + V A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK +A+ +K+ +QL +  V  E  GG+T+ ++ SA   + +D+LLEA+++ AEI++LKANP R A G  IEA +D+G GAVA +LVQ+GTL     I+ G+ +G+V+ +V+   + +K A P+ PV + GL+G P++GDK+ V   E   +E+SE RQ   + +           L    T +   S GIKE  +++K D  GS+EAI G L  +     +  +V    G I ESDI LA  S + ++ FN + +++   +A   GI I+ YNIIY + D+++  + G+L P   E  IG+ EI ++++ + +G +AG RV+ G+++R A  R+ R D  ++   K+ +L+  KD ++    G+ECG   EN+ D   GD++E + +
  S:   321 RSQVQETREKISREV-VLPETITIQELSQRMSERAVDVIKYLMKEGQMMKPGDVIDADLAELIAGEFGHTVKRVSESDVELGIFNIA--DVEGDRVSRPPVVTIMGHVDHGKTSLLDAIRHANVVAGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKIDKHEADPQKVRNQLLQHEVFVESMGGETLDVEVSAKTGKNLDKLLEAVLLQAEILDLKANPNRTAEGTVIEAQLDRGRGAVATVLVQNGTLKPGQIIVAGDVWGRVRALVNDKGEHMKEAPPAMPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAARQSGQRGSLEQMMTQM--QSTGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHLGAGGITESDISLAEASNAAIIGFNVRANAQARQFAERQGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDV-VVHEGKLKTLKRFKDEVSEVPMGQECGMAFENYEDMRVGDVIECFRV 909
>gi|17546008|ref|NP_519410.1| translation initiation factor IF-2 [Ralstonia solanacearum GMI1000] >gi|39931297|sp|Q8XZV6|IF2_RALSO Translation initiation factor IF-2 >gi|17428303|emb|CAD14991.1| putative translation initiation factor if-2 protein [Ralstonia solanacearum] (964 aa)
Score = 1085, Expect = 4.4e-116, Identities = 248/592 (41%), Positives = 366/592 (61%)
  Q:    23 NRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           NR   D ++ F+     +   V V    +++ E + K+   +AE+IK +   G    +N +LD+     +  E G+        + +  L     E +    + RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  PI+V INK+DK +AN +++  +L  ++V+ EE+GG +  +  SA   QGI+ LLE +++ AE++ELKA     A G+ +EA +DKG+G +A +LVQSGTL   D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   T L + S+G +K L +I+K D  GS EA+   L+ +     ++ +V  A+G I+ESD++LA  SK++++ FNT+  +     A   GI I+ YNIIY   DE++  + G+L P   E+  G VE+RQ++    +G +AG  VL G +KR++  R+ R++  I S  ++ SL+  KD +     G ECG +++NFND  EGD +EIYEI
  S:   362 NRHGDDNRNAFQAPTEPVVREVHV-PETISVAELAHKMAVKAAEVIKQMMKLGQMVTINQVLDQETAMIVVEEMGHQAVAAKLDDPEALLVEGVQEQQNVEAEARPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVITFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHAKAAGVPIVVAINKIDKPEANPDRVKQELVSESVIPEEYGGDSPFVPVSAKTGQGIENLLENVLLQAEVLELKAPINAAAKGLVVEAQLDKGKGPIATVLVQSGTLKRGDVVLAGTAYGRVRAMLDENGKPAKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLARQQAAKLETMLEQMSEGEVKTLPLIIKADVQGSQEALVHALNKLSTGEVRVQVVHGAVGGISESDVNLATASKAVIIGFNTRADAGARKLAEHQGIDIRYYNIIYDAVDEVKAAMSGMLSPEKKEETTGLVEVRQVFHVPKVGAVAGCMVLDGVVKRSSLVRVLRENVVIFS-GELESLKRFKDDVKEVKQGFECGLSIKNFNDVKEGDQLEIYEI 957
>gi|196190613|gb|EDX85577.1| translation initiation factor IF-2, putative [Synechococcus sp. PCC 7335] (1026 aa)
Score = 1084, Expect = 5.3e-116, Identities = 235/577 (40%), Positives = 367/577 (63%)
  Q:    41 KNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH--------LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN----LNENSQG-----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           K  + V T  +++ + +++++    +IIK LF KGI  N+N  LD      +  EFG +     +  E   +  +  +   D L  RPP+VTIMGHVDHGKT+LLD IR++KV   EAG ITQ IGAY V+ K +         I F DTPGHEAF+ MRA G  +TDI +LVVAADDG++PQT EAI HA  A  PI+V INK+DK+ AN +++  +L E  ++ EE+GG T+++  SA+  + +D +LE +++ AE+ +L+ANP+RLA G  IEA +DK  G VA LLVQ+GTL + D    G  +G+VK M+D      +   PS  V + GLN +P +G+++ V ++E+  +  ++++ +  +Q +L+    +    LN  S+      +KELN+ILK D  GSLEAI G L  +     ++ ++ AA G I+E+D+DLA  S ++++ FNT VS+     A +MG+ I++Y+IIY++ ++IE  ++G+L+P  VE+ +G VE+R ++     G +AG  VL+G++ RN   R+ R   +++    ++SL+  KD      AG ECG  +  FND+ EGDI++ +++V +
  S:   428 KPEMIVLTGGISVHDLAEQLSVPQTDIIKLLFFKGIATNVNQTLDMPTAEMVATEFGVEAVTAEEAPEARKVTEMIDDQDLDNLVARPPVVTIMGHVDHGKTSLLDYIRQAKVTEGEAGGITQHIGAYHVDLKSNPNSDRKSGQIVFLDTPGHEAFTAMRARGTRVTDIAILVVAADDGVRPQTIEAISHAKAAGVPIVVAINKIDKEAANPDRVKQELMEYELVPEEYGGDTIMVPVSAITGENVDTILEMLLLVAEVEDLQANPERLARGTVIEAHLDKARGPVATLLVQNGTLKIGDAFAAGPVFGRVKAMIDDRGHRSEEVKPSFAVEVLGLNDVPPAGEEFEVYSEERNARAAADEKAIEQRQSRLAQTMASRRVTLNSLSEQAKEGELKELNLILKADVQGSLEAILGSLQQLPQNEVQIRVLMAAPGEISETDVDLAAASGAVIIGFNTTVSNSARLEADNMGVDIQDYDIIYKLLEDIEGAMEGLLEPEMVEESLGQVEVRAVFPVRK-GTVAGCYVLSGKVTRNCRVRVNR-GGDVVYVGNLDSLKRMKDDAKEVNAGFECGIAVGGFNDWKEGDIIDAFKMVSQ 1019
>gi|190889785|ref|YP_001976327.1| translation initiation factor IF-2 protein [Rhizobium etli CIAT 652] >gi|190695064|gb|ACE89149.1| translation initiation factor IF-2 protein [Rhizobium etli CIAT 652] (917 aa)
Score = 1084, Expect = 5.8e-116, Identities = 236/585 (40%), Positives = 358/585 (61%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR----------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +SQ ++    I   V V    +TI E S+++++ + ++IK+L  +G       ++D      +  EFG+  K+  + + +  + NI   D E     RPP+VTIMGHVDHGKT+LLD IR + V A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK +A+ +K+ +QL +  V  E  GG+T+ ++ SA   + +D+LLEA+++ AEI++LKANP R A G  IEA +D+G G+VA +LVQ+GTL     I+ G+ +G+V+ +V      +K A P+TPV + GL+G P++GDK+ V   E   +E+SE RQ   + +           L    T +   S GIKE  +++K D  GS+EAI G L  +     +  +V +  G I ESDI LA  S + ++ FN + +++   +A   GI I+ YNIIY + D+++  + G+L P   E  IG+ EI ++++ + +G +AG RV+ G+++R A  R+ R D  ++   K+ +L+  KD ++    G+ECG   EN+ D   GD++E + +
  S:   322 RSQMQETREKISREV-VLPETITIQELSQRMSERAVDVIKFLMKEGQMMKPGDVIDADLAELIAGEFGHTVKRVSESDVELGIFNIA--DVEGDRVSRPPVVTIMGHVDHGKTSLLDAIRHANVVAGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKIDKHEADPQKVRNQLLQHEVFVESMGGETLDVEVSAKTGKNLDKLLEAVLLQAEILDLKANPNRTAEGTVIEAQLDRGRGSVATVLVQNGTLKPGQIIVAGDVWGRVRALVTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAARQSGQRGSLEQMMTQM--QSTGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHSGAGGITESDISLAEASNAAIIGFNVRANAQARQFAERQGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDV-VVHEGKLKTLKRFKDEVSEVPMGQECGMAFENYEDMRVGDVIECFRV 910
>gi|196244734|ref|ZP_03143460.1| translation initiation factor IF-2 [Cyanothece sp. PCC 8802] >gi|196207478|gb|EDY02271.1| translation initiation factor IF-2 [Cyanothece sp. PCC 8802] (992 aa)
Score = 1084, Expect = 6.4e-116, Identities = 249/570 (43%), Positives = 362/570 (63%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDF----KKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH----LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSN--------FGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +  +NLT+ E + ++     EIIK LF KGI  N+   LD +    +  E G +     +K     +   LD    E+    L +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V+   +     I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  AK PI+V INK+DK  AN ++I  +L+E  +L EEWGG+T+++  SAL  + +D LLE I++ +E+ EL ANP R A G  IEA++D+  G VA LLVQ+GTL V D I+VG  +GK++ M+D    +++ A PS  V I GLN +P +GD++ V  +EK  + ++E+     +Q +L            T   +  +G +KELN+ILK D  GS+EAI G L  +     ++ ++ AA G I E+D+DLA  S ++VV F+T ++S     A   G+ I+ Y+IIY++ D+I+  ++G+L+P  VE  +G  ++R +++    G +AG  V +G++ RN      R+ K+I+    ++SL+  K+      AG ECG   + FND+ EGDI+E YE+V
  S:   403 ILDSNLTVRELANRLEIPETEIIKNLFSKGIAVNITQTLDLQTARLVTEELGVEVITPEEKAAATKDRELLDEHDLEN----LQRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDLDHNGVPEQIVFLDTPGHEAFTAMRARGAKVTDIAILVVAADDGVQPQTREAISHAQAAKVPIVVAINKIDKPQANSDRIKQELSELGLLSEEWGGETIMVPVSALTGENLDTLLEMILLVSEVEELVANPDRRAKGTVIEANLDRTRGPVATLLVQNGTLRVGDAIVVGSVFGKIRAMIDDRGNKVEAASPSFAVEILGLNSVPSAGDEFEVYENEKEARAIAEQLAQEQRQTRLQQAMSSRRVTLSTLSAQAQEGELKELNLILKADVQGSVEAILGALEQLPQGEVQIRVLLAAPGEITETDVDLAAASGAVVVGFSTTLASGARAAADREGVDIREYDIIYKLLDDIQGAMEGLLEPEEVESPLGQAQVRAVFTVGR-GAVAGCYVQSGKVVRNR-LVRVRRGKDIVYQGNLDSLKRIKEDAREVNAGYECGIGTDKFNDWQEGDIIEAYEMV 983
>gi|56551450|ref|YP_162289.1| translation initiation factor IF-2 [Zymomonas mobilis subsp. mobilis ZM4] >gi|81820914|sp|Q5NQ27|IF2_ZYMMO Translation initiation factor IF-2 >gi|56543024|gb|AAV89178.1| translation initiation factor 2 [Zymomonas mobilis subsp. mobilis ZM4] (989 aa)
Score = 1084, Expect = 6.4e-116, Identities = 249/593 (41%), Positives = 352/593 (59%)
  Q:    22 DNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIK-----ELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           D R N +   Q +++         V    +T+ E + ++ +  A+++K LF  G+   L   +D+     L  EFG++ K+  +   D  +D+    D E+ L  RPP+VTIMGHVDHGKT+LLD +R S V   EAG ITQ IGAYQVE      IT  DTPGHEAFS+MRA GA++TDIV++VVAADDGL+PQT EAIDHA  A  PII+ INKMDK +AN ++I   L + NV  E  GG    ++ SA    G+DEL+E I++ AE++ELKANP R A G  +EA +D+G G VA +LV+ GTL V D  +VGE+ G+V+ M D   K  K A PS PV + GL+G+P++GD   V   E   +E++  R     +++ +    +L      +K     E  +++K D  GS+EAI G L+ I     ++ ++   +G I ESD+ LA  S + ++ F+ + +SK  D A   G+ +K Y++IY + DEI+  + G L P + E  +G  EIR+++S    G  AG  VL G I++   AR+ R D  II N  I SLR  KD +    AG ECG TLE   D   GDIVE +E+
  S:   393 DKRANQNRAQQVRQIRD------VVVPEAITVQELANRMAERGADLVKALFKMGVAVTLTQTIDQDTAELLVTEFGHNIKRVSE--SDVEIDSSSDVDPEETLKSRPPVVTIMGHVDHGKTSLLDALRGSDVVRGEAGGITQHIGAYQVESPSGEKITLLDTPGHEAFSEMRARGANVTDIVIIVVAADDGLRPQTVEAIDHARAADVPIIIAINKMDKPEANPQRIREALLQYNVQVEAMGGDVQDVEISAAKKTGLDELIEKILLQAEMLELKANPDRAAEGTVVEAKLDRGRGPVATILVRRGTLKVGDIFVVGEFSGRVRAMTDAQGKNQKEAGPSMPVEVLGLSGVPQAGDTLTVVESEARAREVAAYRAEIALRKRTTAQPASLESMFSALKDKQAVEYPLLIKADTQGSVEAIAGALNKISNEDIRVRILHQGVGGITESDVSLAAASGAPIIGFHVRPNSKARDIARRDGVALKFYDVIYDLIDEIKAAMAGKLGPEYFETVVGKAEIREVFSAGKHGRAAGLLVLEGYIRQKLRARVLRNDV-IIYNGSIASLRRFKDDVPEVRAGLECGITLEGSTDIKAGDIVETFEV 982
>gi|169196131|ref|ZP_02855485.1| translation initiation factor IF-2 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169090874|gb|EDS69584.1| translation initiation factor IF-2 [Rhizobium leguminosarum bv. trifolii WSM2304] (917 aa)
Score = 1083, Expect = 7.4e-116, Identities = 230/569 (40%), Positives = 350/569 (61%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN--------LNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    +TI E S+++++ + ++IKYL  +G       ++D      +  EFG+  ++  + + +  + N+  ED E  L  RPP+VTIMGHVDHGKT+LLD IR + V + EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK +A+ +K+ +QL +  V  E  GG+ + ++ SA   + +D+LLEAI++ AEI++LKANP R A G  IEA +D+G G+VA +LVQ GTL     I+ G+ +G+V+ +V      +K A P+TPV + GL+G P++GDK+ V   E   +E+SE RQ   + +  +             +   S GIKE  +++K D  GS+EAI G L  +     +  +V +  G I ESDI LA  S + ++ FN + +++   +A   GI I+ YNIIY + D+++  + G+L P   E  IG+ EI ++++ + +G +AG RV+ G+++R A  R+ R D  ++   K+ +L+  KD ++    G+ECG   EN+ D   GD++E + +
  S:   337 VLPETITIQELSQRMSERAVDVIKYLMKEGQMMKPGDVIDADLAELIASEFGHTVRRVSESDVELGIFNVSDEDGE--LVSRPPVVTIMGHVDHGKTSLLDAIRHANVVSGEAGGITQHIGAYQVEQSGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKVDKHEADPQKVRNQLLQHEVFVESMGGEVLDVEVSAKTGKNLDKLLEAILLQAEILDLKANPNRTAEGTVIEAQLDRGRGSVATVLVQKGTLRPGQIIVAGDVWGRVRALVTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAARQSGQRGSLEQMMMQRQSAGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHSGAGGITESDISLAEASNAAIIGFNVRANTQARQFAEREGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDV-VVHEGKLKTLKRFKDEVSEVPMGQECGMAFENYEDMRAGDVIECFRV 910
>gi|39931303|sp|Q9AC25|IF2_CAUCR Translation initiation factor IF-2 (1009 aa)
Score = 1083, Expect = 7.4e-116, Identities = 227/569 (39%), Positives = 353/569 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNE-------NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  + +T+ E S ++     +IIK+L  +G+   +N ++D      +  EFG+  K+  + + E+ F   I  +D ++ +D RPP+VTIMGHVDHGKT+LLD +R + VAA EAG ITQ IGAYQV  K    +TF DTPGH AFS MRA GA++TDIVVLVVA DDG+ PQT EAI HA  A+ PIIV +NKMDK  ++  ++ ++L +  ++ E  GG T +I+ SA    G+D LLEAI++ AE+++LKANP R A+G+ IEA +DKG GAV+ +LV  GTL   D ++ G  +GKV+ +++   ++++ A P+TPV I GL+G+P  GD + V  +E   +EL+E R    +++ ++  G   +          + +KEL +++K D  GS EAI G L  +     +  ++ +  G+I+ESD+ LA+ + + V+ FN + S++    A   G+ I+ Y IIY + D+I+ +L G+L P+  E  +G+ E+ Q +  S IG +AG +V  G +++ A  RI R+D  ++    + +L+  KD +     G+ECG     F D   GD +E + +
  S:   427 VIPDVITVQELSNRMAVRGVDIIKFLMRQGVMLKINDVIDNDTAELVATEFGHTVKRVSEADVEEGF---IGADDHDEHMDLRPPVVTIMGHVDHGKTSLLDALRSTDVAAGEAGGITQHIGAYQVRLKDGQRVTFLDTPGHAAFSSMRARGANITDIVVLVVAGDDGVMPQTIEAIKHAKAAEVPIIVAVNKMDKPGSDPTRVVNELLQHEIVVESLGGDTQLIEVSAKARTGLDNLLEAILLQAEVLDLKANPDRSADGVVIEAKLDKGRGAVSTVLVNRGTLKRGDIVVAGSQWGKVRALLNERNEQLQEAGPATPVEILGLDGVPSPGDAFAVVENEARARELTEYRIRLKREKSMAPVGAGASMADMMAKLQDKKLKELPLVIKADVQGSAEAIIGSLDKMATDEVRARIILSGAGAISESDVMLAKGAGAPVIGFNVRASAQARALAEREGVEIRYYAIIYDLLDDIKGVLSGMLAPIQRETFLGNAEVLQAFDISKIGKVAGCKVTEGVVRKGAKVRIIRQDIVVLELGTLQTLKRFKDEVNEVPVGQECGMMFAGFQDIKVGDTIECFTV 1001
>gi|68536219|ref|YP_250924.1| translation initiation factor IF-2 [Corynebacterium jeikeium K411] >gi|90101355|sp|Q4JV51|IF2_CORJK Translation initiation factor IF-2 >gi|68263818|emb|CAI37306.1| translation initiation factor IF-2 [Corynebacterium jeikeium K411] (922 aa)
Score = 1083, Expect = 7.6e-116, Identities = 238/561 (42%), Positives = 367/561 (65%)
  Q:    55 EFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDN---FLDNIKFEDREDL-----LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKEL---------SEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +F++KI   +A +++ LF  G        + +  +  L  E   D+K E+   ED     L++   +  ED      L +RPP+VT+MGHVDHGKT LLDTIRK+ V + EAG ITQ IGAYQV    E +  L+TF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  P++V +NK+DK+ A  +KI  QL E  ++ EE+GG+TM +  SA     ID+LLE++++TA+  ++L+ANP   A G+ IEA +D+G G VA ++VQ GTL V D I+VG+ YG+V++M+D +  +++ A PS PV++ GL  +  +GD  +V ++++  +++         +     + K+  L +  + L E +     LN+ILK DN G++EA++  L  IEV     LN++   +G++ E++++LA  S ++++ FN +   K ++ A + G+ I+ Y+IIY+  +E+E  LKG+L P++ EK+IG+ EIRQ++  SS+G+IAG  V TG+++RNA AR+ R    +     I SLR  KD +   +AG ECG  L ++ D    DI+E++E+V
  S:   341 DFAEKIKADAAALVQALFNLGEMVTATQSVSDETLMLLGEEM--DYKVEVVSPEDEDRELLESFDLQFGEDEGEDEDLAQRPPVVTVMGHVDHGKTRLLDTIRKANVGSGEAGGITQHIGAYQVSVSMEGEDRLVTFLDTPGHEAFTAMRARGAKSTDIAILVVAADDGVMPQTVEAINHAKAADIPVVVAVNKIDKEGAQPDKIRGQLTEYGLIPEEYGGETMFVDISAKQGTNIDQLLESVLLTADASLDLRANPDMDAQGVAIEAHLDRGRGPVATIIVQRGTLRVGDSIVVGDAYGRVRRMIDEHGNDVQEAGPSRPVQVLGLTSVSGAGDNLLVVDEDRTARQIADRRDARRRNALAARSRKRVSLEDLDSVLKETNT----LNLILKGDNAGTVEALEDALLKIEVDDEVDLNIIDRGVGAVTETNVNLAAASDAVIIGFNVRAEGKATEVANAEGVDIRYYSIIYKAIEEVEAALKGMLKPIYEEKQIGTAEIRQIFKASSVGLIAGCMVETGKVRRNAQARLVRDGNVVAEKTTIESLRREKDDVTEVSAGYECGMVL-SYPDIQVDDIIEVFELV 917
>gi|163867511|ref|YP_001608710.1| translation initiation factor IF-2 [Bartonella tribocorum CIP 105476] >gi|189028301|sp|A9IMT5|IF2_BART1 Translation initiation factor IF-2 >gi|161017157|emb|CAK00715.1| translation initiation factor IF-2 [Bartonella tribocorum CIP 105476] (842 aa)
Score = 1083, Expect = 8.3e-116, Identities = 239/569 (42%), Positives = 358/569 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR----------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    +TI E ++++ + S ++IK+L  +G       ++D      + +EFG+  K+ ++ + +  + NI   D    +  RPP+VTIMGHVDHGKT+LLD IRK+ V + EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA +TDI VLVVAADD + PQT E+I+HA  A  PIIV INK+DK  AN +K+ ++L +  V  E  GG+T+ ++ SA   Q +D+LLEAI++ AE+++LKA+P+R A G+ IEA +D+G G+VA +LVQ GTL  +D I+ G  +G+V+ ++D + + +K A+PSTP+ I G+ G P++GD++ V   E   +E+SE RQ   + +           L    T L   + G+KE ++I+K D  GS+EAI   L  +     +  +V +  G I ESDI LA  S S V+ FN + + +  D+A + GI I+ YNIIY + D+I+  + G+L P   E  +G+ EI ++++ + IG +AG RV  G+I+R A  R+ R D  +I   K+ +L+  KD +    +G+ECG   EN+ D   GDI+E + I
  S:   262 VLPETITIQELAQRMTERSVDVIKFLMKQGQMMKPGDVIDADVAELIAVEFGHTVKRVLESDVEEGIFNIT--DNPQNMQPRPPVVTIMGHVDHGKTSLLDAIRKANVVSGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGARVTDIAVLVVAADDSVMPQTIESINHAKAAGVPIIVAINKIDKPAANAQKVRTELLQHEVFVETMGGETLDVEVSAKTGQNLDKLLEAILLQAEMLDLKADPQRTAEGVVIEAKLDRGRGSVATVLVQKGTLHPSDIIVAGNEWGRVRALIDDHGRHVKEAVPSTPIEILGMQGTPQAGDRFAVVTHEAKAREISEYRQRLARDKAVARQTGSRGSLEQMMTKL--QTTGVKEFSLIIKGDVQGSIEAIASALEKLGNDEVRARVVHSGAGGITESDISLAEASNSAVIGFNVRANKQARDFAKTQGIEIRYYNIIYDLVDDIKAAMSGLLSPEQRETFLGNAEILEVFNITKIGKVAGCRVTEGKIERGAGVRLIR-DNIVIHEGKLKTLKRFKDEVNEVQSGQECGIAFENYEDMRAGDIIETFRI 835
>gi|116328713|ref|YP_798433.1| translation initiation factor IF-2 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|122283502|sp|Q04ZJ5|IF2_LEPBL Translation initiation factor IF-2 >gi|116121457|gb|ABJ79500.1| Translation initiation factor 2 (IF-2; GTPase) [Leptospira borgpetersenii serovar Hardjo-bovis L550] (864 aa)
Score = 1082, Expect = 9.8e-116, Identities = 248/565 (43%), Positives = 358/565 (63%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT-----------NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N+ + E +KK+N    ++I  L   G+   +N ++D      L  E+G   K  + + E+  ++  K  D E     RPP+VTIMGHVDHGKT LLDTIR+S V  TE+G ITQ IGAYQV+  + LITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI HA  A+ PIIV INK+D   AN +KI  +LA   +  EEWGG+TM +K SA  N GID+LLE I++ AE+M+LKANPKR A G  IEA +D G G+VA +L+Q+GTL V D  + G + G+V+ M +   + I+ A P+ P +++G++G+P +G  +    DEK  + +S+ R    +  K+ N G            N+NE  +   +KEL VI+K D  GS EAIK  L  +     KLN++++  G+I + D+ LA  S +L++ F+ + + K    A    + IK YNIIYQ+ DEI+  ++G+L+P  +E+ IG+ EIR+++  S IG IAG  V +G+I+++A  R+   D     + K+ SL+  KD +    +G ECG  ++ +NDF  GD +E Y +
  S:   286 NVQVGELAKKMNLKPGDVIGKLMKMGMMVTINNIIDAETAALLADEYGCKVKV-VSLYEETIIEEEK--DNEGDYINRPPVVTIMGHVDHGKTKLLDTIRRSSVIDTESGGITQHIGAYQVKTARGLITFLDTPGHEAFTSMRARGAKVTDIVILVVAADDGVMPQTLEAISHAKAAEVPIIVAINKIDLPTANPDKIMQELANHGLQSEEWGGQTMYVKISARENIGIDKLLEVILLQAEVMDLKANPKRRAKGTIIEAKLDPGRGSVATVLIQNGTLRVGDPFVAGVFSGRVRAMYNDLGQLIEEAGPAFPAQVTGIDGVPDAGAPFDAMADEKEARNISQHR---IEFEKIGNAGAAAGTTSKVTLENMNEYIKLGALKELKVIIKADVRGSAEAIKESLEKLSTPEVKLNVIQSGAGAIVDMDVMLASASNALIIGFHVRANPKTIALAEKEQVQIKYYNIIYQVVDEIKLAMEGLLEPEKIEEVIGTAEIREIFKVSKIGNIAGCMVTSGKIQKSANVRVI-SDGVTKFDGKLKSLKRVKDDVNDVVSGFECGIQVDGYNDFKVGDTIEAYNV 856
>gi|189440605|ref|YP_001955686.1| Translation initiation factor 2 [Bifidobacterium longum DJO10A] >gi|189429040|gb|ACD99188.1| Translation initiation factor 2 [Bifidobacterium longum DJO10A] (975 aa)
Score = 1082, Expect = 1.0e-115, Identities = 247/563 (43%), Positives = 362/563 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL-------DNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ + ++KIN + A ++  LF  G        LDE     L  E G++ +      ED  L        + +    ++ L  RPP+VT+MGHVDHGKT LLDTIRK+ V A EAG ITQ IGAYQV    E +   ITF DTPGHEAF+ MRA GA+LTD+ +LVVAADDG+ PQT EAI+HA  AK PI+V +NK+D   AN EK+  QL E  ++ EE+GG TM +  SA  N  +D+LLEA+++TA+  ++L+ANP   A G T+EA +DKG GAVA +LVQ GTL V D I+ G  YG+V+ M+D N + ++ A PSTPV++ GL  +P +GD ++V +D++  ++++EKRQ         K+RK   L +F     E+   I  LN+++K D++GS+EA++  L  IEV+    + ++   +G+I ++D++LA   K++++ FN + + +V+D A   G+ IK Y++IY+  ++IE  LKG+L P + E      EIR+++  S  G IAG  V  GE+KR    RI R     +++ +I+SLR  KD + S   G E G  L  FND   GDI+E +E+
  S:   387 SLADLAEKINVNQAALVTVLFHLGQMATATQSLDEETFQILGEEIGWNIQLVSAEEEDKELLQQFDINLDEEELQDDEDLKPRPPVVTVMGHVDHGKTRLLDTIRKTNVIAREAGGITQRIGAYQVTVNLEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVAADDGVMPQTVEAINHAQAAKVPIVVAVNKIDVPGANPEKVRGQLTEFGLVPEEYGGDTMFVDISAKQNLHVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQQGTLHVGDAIVAGTSYGRVRAMLDENGQPMEAAGPSTPVQVLGLTSVPTAGDLFLVASDDRAARQIAEKRQATERAAQLAKRRKVVSLEDFKKKFAESE--IDMLNIVIKGDSSGSVEALEDSLMKIEVSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSVIYRAIEDIEASLKGMLKPEYEEVVTSHSEIREIFRSSKFGNIAGVMVQDGEVKRGTKCRILRNGVATVNDLEISSLRRFKDDVQSVKEGYEAGINLGTFNDIELGDIIETFEM 969
>gi|119511044|ref|ZP_01630164.1| Initiation factor 2 [Nodularia spumigena CCY9414] >gi|119464295|gb|EAW45212.1| Initiation factor 2 [Nodularia spumigena CCY9414] (1032 aa)
Score = 1081, Expect = 1.1e-115, Identities = 244/605 (40%), Positives = 372/605 (61%)
  Q:    11 TKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFG---TNLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           T  K ++    DN    +++++ ++ E        V T  +T+ E +  +     EI+K LFLKG+  ++   LD   +  +  E   + +  E +       + +   D + LL +RPP+VTIMGHVDHGKTTLLD+IRK+KVA+ EAG ITQ IGAY V    E K   I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A  +++  +L +  +  EEWGG+T+++  SA+  + +D LLE I++ +E+ EL ANP R A G  IEA +DK +GAVA LL+Q+GTL V D ++ G  +GKV+ MVD   K +  A PS  V + GL+ +P +GD + V  +EK  + L+  R    +  +L       T L+  +Q   +KELN+ILK D  GS+EAI G L  I     ++ ++ A  G I E+DIDLA  S ++++ FNT  +S     A   G+ ++ YNIIY++ ++I+  L+G+L+P  VE+ +G  E+R ++     G +AG  V +G++ RN   R++R  K ++    ++SL+  K+      +G ECG  ++ F+D+VEGD++E +++V
  S:   417 TTRKKRSFSRRDNNRRQEVETKVERPEK------VVITGPMTVQELADVLTVADTEIVKILFLKGMAVSITQNLDIPTITLVGKELEIEVETAEREAEARKVTEMLDVADMQ-LLQRRPPVVTIMGHVDHGKTTLLDSIRKTKVASGEAGGITQHIGAYHVDVEHEGKAQQIVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVRPQTIEAISHAQAAEVPIVVAINKIDKEGAQPDRVKQELTKYGLTPEEWGGETIMVPVSAIKGENLDTLLEMILLVSEVGELSANPDRSAKGTVIEAHLDKAKGAVATLLIQNGTLHVGDMLVAGSAFGKVRAMVDDRGKRVDIAGPSFAVEVLGLSDVPGAGDDFEVFANEKEARTLAATRADKQRLSRLLQGRITLTTLSAQAQEGELKELNLILKGDVQGSVEAIVGSLRQIPQNEVQIRMLLATAGEITETDIDLAAASGAVIIGFNTTFASGARQAADESGVDVREYNIIYKLLEDIQGALEGLLEPELVEEPLGQTEVRAVFPVGR-GAVAGCYVQSGKLVRNCKVRVRRSGK-VVYEGVLDSLKRMKEDAREVNSGYECGINIDKFHDWVEGDLIEAFQMV 1022
>gi|119774098|ref|YP_926838.1| translation initiation factor IF-2 [Shewanella amazonensis SB2B] >gi|166198925|sp|A1S462|IF2_SHEAM Translation initiation factor IF-2 >gi|119766598|gb|ABL99168.1| translation initiation factor IF-2 [Shewanella amazonensis SB2B] (882 aa)
Score = 1081, Expect = 1.1e-115, Identities = 249/606 (41%), Positives = 375/606 (61%)
  Q:    10 KTKSKNKNKKIVDNR-TNIDIKSQFKKVETGIKNGVFVFTNNL------TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED----LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +TKSK   K   + R  ++  KS  + +  G    V   T ++      T+ E ++K+   + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L++    DR+D     L+ R P+VTIMGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P+IV +NKMDK +A+I+++ ++L++  V+ E+WGG+ M    SA   QG+DELLEAI++ AE++ELKA    +A G+ IE+ +DKG G VA +LVQ GTL   D +L G  YGK++ M D N + I  A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ           ++ KL N   N+ E    ++ELN++LK D  GSLEAI   L  +     K+N++ + +G++ E+D  LA  S +++V FN +  ++      S  + ++ Y++IY + DE++  + G+L P F ++ IG  E+R ++    +G IAG  V+ G +KR+A  R+ R++  +I   ++ SLR  KD +     G ECG  ++N+ND   GD +E++E +
  S:   259 QTKSKRGGKDAREGREKHMKYKSTPESMAHGFNKPVAAVTRDVRIGETVTVAELAQKMAVKATEIIKAMMKMGSMVTINQVLDQETAQLVAEEMGH----KVVLLRENELEHQVLADRDDEGTTKLEPRAPVVTIMGHVDHGKTSLLDYIRRTKVAAGEAGGITQHIGAYHVETDNGMITFLDTPGHAAFTAMRARGAKATDIVILVVAADDGVMPQTIEAIQHAKAGNVPLIVAVNKMDKPEADIDRVKNELSQHGVMSEDWGGENMFCYVSAKTGQGVDELLEAILLQAEVLELKAVRDGMAAGVVIESQLDKGRGPVATVLVQEGTLRQGDIVLCGLEYGKIRAMKDENGRPIMEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKSKLENMFANMTEGE--VQELNIVLKADVQGSLEAITDSLRKLSTDEVKVNIIASGVGALTETDATLAAASNAIMVGFNVRADAQARKTIESEAVDLRYYSVIYDLIDEVKSAMSGMLSPEFKQQIIGLAEVRDVFKSPKLGAIAGCMVIEGIVKRSAPIRVLRENV-VIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDQIEVFETI 876
>gi|116071186|ref|ZP_01468455.1| translation initiation factor IF-2 [Synechococcus sp. BL107] >gi|116066591|gb|EAU72348.1| translation initiation factor IF-2 [Synechococcus sp. BL107] (772 aa)
Score = 1081, Expect = 1.2e-115, Identities = 231/574 (40%), Positives = 367/574 (63%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + V  +NLT+ E +  ++  S+EIIK LF KG+   +   LD   +  +  EF     + +++      ++ I+  D + L+ +RPP+VT+MGHVDHGKT+LLD IR+++VAA EAG ITQ IGAYQVE +       +TF DTPGH AF+ MRA G  +TD+ VLVVAADDG++PQT EAI HA  A+ PI+V INK+DK+ A+ +++  +L+E+N+L EEWGG  +++  SA+  + ID+LLE +++  E+ +L+ANP RLA G  IEA +DK +G VA LL+Q+GTL   D +  G   GKV+ MVD NR+ +K A PS  V   G + +P +GD++ V  DEK  + +   R  + +          R++S    +   N   +KELN+ILK D  GS+EAI G L  +     ++ ++ +A G + E+D+DLA  S ++++ FNT ++S     A + G+ +++Y++IY++ ++I+  ++G+L+P  VE+ +G  E+R +++      +AG  V TG++ RN   R+ R  K+++    ++SLR  KD +   A G ECG   + F ++ EGD +E +++V +
  S:   182 IVVPEDNLTVQELADMLSVESSEIIKSLFFKGVIATVTQTLDMPTIEAVAKEFDVPVLQDDVEEAAKKTVEMIEEADLKHLI-RRPPVVTVMGHVDHGKTSLLDAIRQARVAAGEAGGITQHIGAYQVEIQHKDEARKLTFLDTPGHAAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASADRVKQELSEQNLLAEEWGGDVVMVPVSAIKGENIDKLLEMLLLVTEVEDLQANPDRLARGTVIEAHLDKAKGPVATLLIQNGTLKTGDVLAAGPVLGKVRAMVDDNRQRLKEAGPSFAVEALGFSEVPTAGDEFEVYPDEKAARAVVGDRASDARATRLAQQMASRRVSLTAMSGQANEGELKELNLILKADVQGSVEAILGSLEQLPKDEVQVRVLLSAPGEVTETDVDLAAASGAVIIGFNTSMASGAKKAADATGVDVRDYDVIYKLLEDIQLAMEGLLEPELVEEALGEAEVRAVFTIGK-SAVAGCYVNTGKLHRNCRVRVHR-GKQVVYTGDLDSLRRNKDDVKEVATGFECGVGTDRFANWEEGDRIEAFKMVTQ 766
>gi|116330629|ref|YP_800347.1| translation initiation factor IF-2 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281616|sp|Q04U31|IF2_LEPBJ Translation initiation factor IF-2 >gi|116124318|gb|ABJ75589.1| Translation initiation factor 2 (IF-2; GTPase) [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (852 aa)
Score = 1081, Expect = 1.3e-115, Identities = 248/565 (43%), Positives = 358/565 (63%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT-----------NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N+ + E +KK+N    ++I  L   G+   +N ++D      L  E+G   K  + + E+  ++  K  D E     RPP+VTIMGHVDHGKT LLDTIR+S V  TE+G ITQ IGAYQV+  + LITF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI HA  A+ PIIV INK+D   AN +KI  +LA   +  EEWGG+TM +K SA  N GID+LLE I++ AE+M+LKANPKR A G  IEA +D G G+VA +L+Q+GTL V D  + G + G+V+ M +   + I+ A P+ P +++G++G+P +G  +    DEK  + +S+ R    +  K+ N G            N+NE  +   +KEL VI+K D  GS EAIK  L  +     KLN++++  G+I + D+ LA  S +L++ F+ + + K    A    + IK YNIIYQ+ DEI+  ++G+L+P  +E+ IG+ EIR+++  S IG IAG  V +G+I+++A  R+   D     + K+ SL+  KD +    +G ECG  ++ +NDF  GD +E Y +
  S:   274 NVQVGELAKKMNLKPGDVIGKLMKMGMMVTINNIIDAETAALLADEYGCKVKV-VSLYEETIIEEEK--DNEGDYINRPPVVTIMGHVDHGKTKLLDTIRRSSVIDTESGGITQHIGAYQVKTARGLITFLDTPGHEAFTSMRARGAKVTDIVILVVAADDGVMPQTLEAISHAKAAEVPIIVAINKIDLPTANPDKIMQELANHGLQSEEWGGQTMYVKISARENIGIDKLLEVILLQAEVMDLKANPKRKAKGTIIEAKLDPGRGSVATVLIQNGTLRVGDPFVAGVFSGRVRAMYNDLGQLIEEAGPAFPAQVTGIDGVPDAGAPFDAMADEKEARNISQHR---IEFEKIGNAGAAAGTTSKVTLENMNEYIKLGALKELKVIIKADVRGSAEAIKESLEKLSTPEVKLNVIQSGAGAIVDMDVMLASASNALIIGFHVRANPKTIALAEKEQVQIKYYNIIYQVVDEIKLAMEGLLEPEKIEEVIGTAEIREIFKVSKIGNIAGCMVTSGKIQKSANVRVI-SDGVTKFDGKLKSLKRVKDDVNDVVSGFECGIQVDGYNDFKVGDTIEAYNV 844
>gi|150398627|ref|YP_001329094.1| translation initiation factor IF-2 [Sinorhizobium medicae WSM419] >gi|166198932|sp|A6UF29|IF2_SINMW Translation initiation factor IF-2 >gi|150030142|gb|ABR62259.1| translation initiation factor IF-2 [Sinorhizobium medicae WSM419] (885 aa)
Score = 1081, Expect = 1.4e-115, Identities = 233/585 (39%), Positives = 357/585 (61%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR----------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +SQ ++    I   V +    +TI E S+++++ + ++IK+L  +G       L+D      +  EFG+  K+  + + +  + NI   D +D +  RPPIVTIMGHVDHGKT+LLD IR + V A EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK  A+ +K+ ++L +  V  E  GG+ + ++ SA N   +D+LLEAI++ +EI++LKANP R A G  +EA +D+G GAVA +LVQ GTL     I+ G+ +G+V+ +V+   + +K+A PSTPV + GL+G P +GD++ V   E   +E+SE RQ   +++           L    T L   + G+KE  +++K D  GS+EAI G L  +     +  +V +  G I ESD+ LA  S + ++ FN + + +  D +   GI I+ YNIIY + D+++  + G+L P   E  +G+ EI ++++ + +G +AG RV  G+++R    R+ R D  +I   K+ +L+  KD ++   +G+ECG   EN+ D   GD +E + +
  S:   290 RSQMQETREKISREV-ILPETITIQELSQRMSERAVDVIKFLMKEGQMMKPGDLIDADLAELIAGEFGHTVKRVSESDVEEGIFNI--SDADDEMHARPPIVTIMGHVDHGKTSLLDAIRHANVVAGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKIDKPSADPQKVRTELLQHEVFVESMGGEVLDVEVSAKNQTNLDKLLEAILLQSEILDLKANPNRTAEGTVVEAELDRGRGAVATVLVQKGTLTPGQIIVAGDQWGRVRALVNDKGEHVKSAGPSTPVEVLGLSGTPAAGDRFAVVESESRAREISEYRQRLAREKAVARQSGSRGSLEQMMTQL--QTSGVKEFPLVIKGDVQGSIEAISGALEKLGTDEVRARIVHSGAGGITESDVSLAEASNAAIIGFNVRANKQARDASERAGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFLGNAEILEVFNITKVGKVAGCRVTEGKVERGVGVRLVR-DNVVIHEGKLKTLKRFKDEVSEVQSGQECGMAFENYEDIRAGDTIECFRV 878
>gi|148377959|ref|YP_001256835.1| translation initiation factor IF-2 [Mycoplasma agalactiae PG2] >gi|148292005|emb|CAL59397.1| Translation initiation factor IF-2 [Mycoplasma agalactiae PG2] (601 aa)
Score = 1080, Expect = 1.7e-115, Identities = 256/587 (43%), Positives = 376/587 (64%)
  Q:    29 IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +K Q   ++T I NG F+FTN  ++ EF++KI  ++ ++IK   L+G    +N +L+E ++ E+C+E G DFKKE  I+  NFL+ +KF D + LL KRPPI+T+MGHVDHGKT+L+D IRK+ V +TE+  ITQ  GAYQ+  K   ITF DTPGHEAFSKMR+ GA +TDI++LVVAADDG+ PQT+EAI HA  A  P+IVF+NKMDK   N+EKI  +L E +VL EE+GG T ++ GSAL  QGI+EL  AII+ A++++LKANP R   G  IE+ +DKG G V  ++V++GTL   D+I+ G  YGKV+ M       I   LP TPV+I+GLN  P +GD++I  +DEK  K+L+  +    K   L    T LN    G K  NVI+++D  G+ EAIK  LS +E   A + ++ A +G ++ SD+ LA+ S ++++ FN KVS  +   A    I I +Y++IY+I ++++ +L G    V+ E++IGS    +L+ +S +G IAG     G +K     +I R +K++I    + +L+   + +     GK+ G  ++ FND  E D++  +E V
  S:    13 VKEQLSDIKTEIVNGTFIFTNRTSLGEFAEKIKMNANDLIKRFLLRGKFYQINHILEEEEIAEICMEKGLDFKKEENIDAGNFLNEVKFNDDKSLLVKRPPIITVMGHVDHGKTSLIDYIRKTNVVSTESSGITQHTGAYQISHKGEKITFIDTPGHEAFSKMRSRGAKITDIIILVVAADDGVMPQTKEAIMHAKSANVPLIVFVNKMDKPQKNLEKIKRELMENDVLIEEFGGDTQIVYGSALKGQGIEELFSAIILLADLLDLKANPSRYPVGTVIESKVDKGVGVVTTIIVENGTLYKGDFIVAGSCYGKVRSMKSPGGAFIDEVLPGTPVKIAGLNNSPLAGDRFIGFDDEKYAKKLALDKAQIDKSHNLYE-KTQLNNVELGKKVFNVIIRSDVQGTAEAIKNKLSVMENEEATIRVIGAQVGQVSSSDLLLAQASNAIIIAFNVKVSPNIKQTAKQSNIKIMSYDVIYKIIEDMQNILDGEKPIVYEERKIGSAHCIKLFYYSKVGTIAGCMQDEGVVKVGCKVQIFR-NKKMIHEGIVETLKREANDLKVVEKGKDFGTHIKKFNDIKEDDVLVFFEEV 597
>gi|120403305|ref|YP_953134.1| translation initiation factor IF-2 [Mycobacterium vanbaalenii PYR-1] >gi|166232563|sp|A1T7H8|IF2_MYCVP Translation initiation factor IF-2 >gi|119956123|gb|ABM13128.1| bacterial translation initiation factor 2 (bIF-2) [Mycobacterium vanbaalenii PYR-1] (930 aa)
Score = 1079, Expect = 2.2e-115, Identities = 248/564 (43%), Positives = 372/564 (65%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQ-MGELCLEF-GYDFKKEIQI--NEDNFLDNIKFEDREDLLDK-----------------RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           ++ +F++KIN + A +++ LF      NL  ++   Q +G+  LE  G +    +Q+   ED        EDRE LL+                  RPP+VT+MGHVDHGKT LLDTIR + V   EAG ITQ IGAYQV    +  +  ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK+ A+  KI  QL E  ++ EE+GG  M +  SA     I+ LLEA+I+TA+  ++L+ANP   A G+ IEA +D+G G VA +L+Q GTL V D ++ G+ YG+V++MVD + ++++ ALPS PV++ G   +P +GD ++V +++++ ++++++R       L  + RK   L +  + L E SQ    LN+ILK DN+G++EA++  L  I+V    +L ++   +G + E++++LA  S ++++ FN +   K ++ A   G+ I+ Y+IIYQ  DEIE  LKG+L PV+ EKE+G  EIR ++  S +G IAG  V +G ++RNA AR+ R +  +  N  I+SL+  KD +     G ECG TL  ++D  EGD++E YE+V
  S:   346 SLSDFAEKINANPASLVQALF------NLGEMVTATQSVGDETLELLGGEMNYVVQVVSPED--------EDRE-LLESFDLTYGEDEGGEEDLEIRPPVVTVMGHVDHGKTRLLDTIRNATVREGEAGGITQHIGAYQVTVDLDGTERPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVPEEYGGDAMFVDISAKQGTNIEALLEAVILTADASLDLRANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRSARKRNALAARTRKRISLEDLDSALKETSQ----LNLILKGDNSGTVEALEEALLGIQVDDEVELRVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSIIYQAIDEIESALKGMLKPVYEEKELGRAEIRAIFRSSKVGNIAGCLVQSGIMRRNAKARLLRDNVVVAENLTISSLKREKDDVTEVRDGYECGLTL-TYSDIKEGDVIETYELV 925
>gi|124515700|gb|EAY57209.1| putative translation initiation factor 2 [Leptospirillum sp. Group II UBA] (871 aa)
Score = 1079, Expect = 2.2e-115, Identities = 227/562 (40%), Positives = 358/562 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNT------KQRKLS--NFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +++ E++ ++   + E+I  L   G+   +N  +D      L    G   + + + +ED  L   + ED   L+  RPP+VTIMGH DHGKTTLLD IRKSK+A  EAG ITQ IGAY +  K   ITF DTPGHEAF+ MRA GA +TD+V+LVVAADDG+ PQT EAI+H+  A  PIIV +NK+DK +AN +++  +L+   ++ EEWGG+T+    SA    G+D LLE +++ A++++LKANP R + G+ IE+ +DKG G VA +LVQ+GTL V D+++VG  +G+V+ +++   + ++  LPS P  + GL+G+P+ G+ ++V  DEK  +++++ R L        +Q+K+S  +F T + E     KELN+ILK D  GSLE I+  LS I  +  ++  +   +G I E+D+ LA+ S ++++ FN +  SK +  A    + IK Y++IY   +++ + ++G+L P   EK +G VE+R+++  S +G +AG  VL G ++++       +D  ++   KIN L+  KD +   AAG ECG ++EN+ D  +GDI+E +
  S:   295 ISVKEYADRLGLKAQEVIMKLMGMGVMVTINQPIDPDAAVLLAESLGIGVEVQSEESEDVLL-GTEGEDSGQLV-SRPPVVTIMGHTDHGKTTLLDAIRKSKIAEAEAGGITQHIGAYTIMEKDRNITFLDTPGHEAFTAMRARGAKVTDVVILVVAADDGVMPQTVEAINHSKAANVPIIVALNKVDKPEANPDRVMQELSGLGLIPEEWGGQTIYCPVSAKKRTGLDHLLEMVLLQADVLDLKANPDRRSQGVVIESKLDKGRGPVATVLVQNGTLRVGDFLVVGGNFGRVRSLINDRGQRVQEVLPSFPAEVIGLDGVPQPGESFVVVEDEKSGRQVAQSRSLKQRSAQMIRQKKVSLEDFYTQMQEGET--KELNLILKVDVQGSLEPIRHALSKIGTSQVRVRFIHEGVGGIRETDVLLAQASNAIILGFNVRPDSKAAVLAEKEKVDIKFYSVIYDAIEDVRKAMEGLLAPTIREKVLGRVEVREVYFISKVGTVAGCYVLDGIVQKSGANVRLLRDDVVVYTGKINQLKRFKDDVKEVAAGYECGVSIENYQDIKQGDIIECF 860
>gi|23466165|ref|NP_696768.1| translation initiation factor IF-2 [Bifidobacterium longum NCC2705] >gi|39931292|sp|Q8G3Y5|IF2_BIFLO Translation initiation factor IF-2 >gi|23326903|gb|AAN25404.1| translation initiation factor If-2 [Bifidobacterium longum NCC2705] (954 aa)
Score = 1079, Expect = 2.3e-115, Identities = 247/563 (43%), Positives = 362/563 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL-------DNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLN------TKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ + ++KIN + A ++  LF  G        LDE     L  E G++ +      ED  L        + +    ++ L  RPP+VT+MGHVDHGKT LLDTIRK+ V A EAG ITQ IGAYQV    E +   ITF DTPGHEAF+ MRA GA+LTD+ +LVVAADDG+ PQT EAI+HA  AK PI+V +NK+D   AN EK+  QL E  ++ EE+GG TM +  SA  N  +D+LLEA+++TA+  ++L+ANP   A G T+EA +DKG GAVA +LVQ GTL V D I+ G  YG+V+ M+D N + ++ A PSTPV++ GL  +P +GD ++V +D++  ++++EKRQ         K+RK   L +F     E+   I  LN+++K D++GS+EA++  L  IEV+    + ++   +G+I ++D++LA   K++++ FN + + +V+D A   G+ IK Y++IY+  ++IE  LKG+L P + E      EIR+++  S  G IAG  V  GE+KR    RI R     +++ +I+SLR  KD + S   G E G  L  FND   GDI+E +E+
  S:   366 SLADLAEKINVNQAALVTVLFHLGQMATATQSLDEETFQILGEEIGWNIQLVSAEEEDKELLQQFDINLDEEELQDDEDLKPRPPVVTVMGHVDHGKTRLLDTIRKTNVIAREAGGITQRIGAYQVTVNLEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVAADDGVMPQTVEAINHAQAAKVPIVVAVNKIDVPGANPEKVRGQLTEFGLVPEEYGGDTMFVDISAKQNLHVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQQGTLHVGDAIVAGTSYGRVRAMLDENGQPMEAAGPSTPVQVLGLTSVPTAGDLFLVASDDRAARQIAEKRQATERAAQLAKRRKVVSLEDFKKKFAESE--IDMLNIVIKGDSSGSVEALEDSLMKIEVSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSVIYRAIEDIEASLKGMLKPEYEEVVTSHSEIREIFRSSKFGNIAGVMVQDGEVKRGTKCRILRNGVATVNDLEISSLRRFKDDVQSVKEGYEAGINLGTFNDIELGDIIETFEM 948
>gi|160892794|ref|ZP_02073584.1| hypothetical protein CLOL250_00325 [Clostridium sp. L2-50] >gi|156865835|gb|EDO59266.1| hypothetical protein CLOL250_00325 [Clostridium sp. L2-50] (975 aa)
Score = 1078, Expect = 2.4e-115, Identities = 248/565 (43%), Positives = 357/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +TI E +  I +    +IK LFL G   N+N+ LD     E+ LE+    ++E +++    L     ED +D++  RPP+V +MGHVDHGKT+LLD IRK+ V + EAG ITQ+IGA  VE     ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI+HA  A   IIV INK+DK  ANIE++  +L E  ++ E+WGG T+    SA   +G+D LLE I++TAE++ELKANP R A GI IEA +DKG G VA +LVQ GTL V DY+ VG  +GKV+ M +     +  A PSTPV+I GL+ +P +G+ ++  ++EK  +++SE     ++ + L+   + ++ +       +  +KELN+I+K D  GS+EA+K  L  +      +  + + +G+INESDI LA  S ++V+ FN +  ++  + A + G+ ++ Y +IY   ++IE  +KG+LDP+F E+ IG  EIRQ +  S +G+IAG  VL G I RN   RI R +  +I   K+ SL+  KD +    +G ECG  LENFND    D +E Y++V
  S:   401 ITIKELADIIKEPVNALIKKLFLAGKMYNVNSELDFETAAEIALEYNCIAEEEEKVDVIEELLKEDEEDEKDMV-PRPPVVCVMGHVDHGKTSLLDAIRKTNVTSAEAGGITQAIGASVVEINGQTITFLDTPGHEAFTAMRMRGAQSTDIAILVVAADDGVMPQTIEAINHAKAAGIEIIVAINKIDKPSANIERVKQELTEYELIPEDWGGSTIFCPVSAHTGEGLDNLLEMILLTAEVLELKANPNRNARGIVIEAELDKGRGPVATMLVQKGTLHVGDYLAVGSSHGKVRAMHNSKGVRVTEATPSTPVQILGLDTVPSAGEIFMAVDNEKEARQISETYISQSRVKMLAETKSRMSLDDLYSQIQAGNVKELNIIIKADVQGSVEAVKQSLLKLSNDEVAVKCIHSGVGAINESDIILASASNAIVIGFNIRPDARAKETAETEGVDVRLYRVIYNAIEDIESAMKGMLDPIFEEQVIGHAEIRQTYKASGVGMIAGSYVLDGIINRNCSVRITR-EGNLIYEGKMASLKRFKDDVKEVKSGFECGIVLENFNDIQVEDQIEAYQMV 970
>gi|53987787|gb|AAV27988.1| protein synthesis initiation factor 2 [Mycoplasma hyopneumoniae 232] (564 aa)
Score = 1078, Expect = 2.7e-115, Identities = 235/557 (42%), Positives = 359/557 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGD 607
           +TI E ++KIN    +II Y F +    NLN  L E ++ E+CLEFG DFKKE+QI+  NF++ +   D++  L  RPPI+T+MGHVDHGKTTLLD IRK+ +A  E G ITQ  GAYQV ++ H+I F DTPGHEAF++MRA GA +TDI+VLVVAADDG+ PQT+EAI+HA  A  PIIVF+NKMDK + ++++I ++L+  N++ EEWGG  + + GSAL  QGID L  +I++ AEI+ELKAN  R   G  IEA +   +G +A L+VQ+GTL V D+I+ G  YG+++ + + N + IK A P TPV ++GLN +P++GDK+   ++EK  K+L+ +R+   +  K+S       + ++  K LN+I+K D  G  +A+   +  +      ++++ + +G +N++DI LA+TS S++  FN ++ + +   A    + I+ + IIY+I DEI++ ++G+ +  +  ++IG+ +I   +  S +G IAG  VL+G+   N    + R  K +I + KI SL+  K+ +     G E G  +  FND   GD
  S:     1 MTIAELAQKINVSVNQIITYFFHQAKMYNLNHSLSEDEIAEICLEFGLDFKKEVQIDASNFMEEVSILDQDKDLSPRPPIITVMGHVDHGKTTLLDYIRKTNIAKNEKGGITQHTGAYQVVFQGHIINFIDTPGHEAFTQMRARGAKVTDIIVLVVAADDGVMPQTKEAINHAAAANVPIIVFVNKMDKPNKDVDRIKNELSALNIVTEEWGGSNIFVYGSALTGQGIDTLFSSILLLAEILELKANKNRYPIGTVIEAKLHHNKGTIATLMVQNGTLMVRDFIVAGYQYGRIRSLENTNGQPIKFAPPGTPVIVTGLNYVPEAGDKFFGFHEEKFAKQLALERK---QSEKISKTKVQTKQQTKE-KTLNIIIKADVAGIAQALHSTIEKLASKQVHIHILHSGVGIVNKADILLAQTSNSIIYAFNLQIPAAIKAQAKQAQVEIREHTIIYKIVDEIKKQVRGMREIRYELQQIGTAKIIAKFWFSKVGSIAGCSVLSGKFVENCKIELWRNSK-LIHSGKIESLQRDKNPVKEVQVGNEFGTHIYKFNDIEIGD 552
>gi|167625059|ref|YP_001675353.1| translation initiation factor IF-2 [Shewanella halifaxensis HAW-EB4] >gi|189028436|sp|B0TQA2|IF2_SHEHH Translation initiation factor IF-2 >gi|167355081|gb|ABZ77694.1| translation initiation factor IF-2 [Shewanella halifaxensis HAW-EB4] (893 aa)
Score = 1078, Expect = 3.1e-115, Identities = 241/565 (42%), Positives = 353/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED--LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +++ E + K++  + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L++    DR    L + R P+VTIMGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE +  +ITF DTPGH AF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P+IV +NKMDK +A+ +++ S+L++  V+ E+WGG  M +  SA    GIDELLE I++ AE++ELKA  + +A G+ +E+ +DKG G VA +LVQ GTL   D +L G  YGKV+ M D N K I  A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ           ++ KL N   N+ E    ++ELN++LK D  GSLEAI   L+++     K+N++   +G + E+D  LA  S +++V FN +  ++      S  + ++ Y+IIYQ+ DE+   + G+L P F ++ IG  E+R ++    IG IAG  V  G IKR+A  R+ R D  +I   ++ SLR  KD ++    G ECG  ++N+ND   GD +E++E V
  S:   320 VSVSELASKMSIKATEIIKQMMKMGSMVTINQVLDQETAQLVAEEMGH----KVVLTRENELEHQVLADRNGDVLAESRAPVVTIMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTAMRARGAKATDIVILVVAADDGVMPQTIEAIQHAKAGGVPLIVAVNKMDKPEADPDRVKSELSQHGVMSEDWGGNNMFVNVSAKTGAGIDELLEGILLEAEVLELKAIKEGMAAGVVVESKLDKGRGPVATVLVQEGTLKQGDIVLCGLEYGKVRAMRDENGKAITEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKSKLENMFANMTEGE--VEELNIVLKADVQGSLEAICDSLNALSTAEVKVNIIARGVGGLTETDATLAAASNAIMVGFNVRADAQARKVVESESVDLRYYSIIYQLIDEVRDAMSGLLAPEFKQEIIGLAEVRDVFKSPKIGAIAGCMVTEGTIKRSAPIRVLR-DNIVIYEGELESLRRFKDDVSDVRNGMECGIGVKNYNDVRVGDQIEVFETV 887
>gi|116249891|ref|YP_765729.1| translation initiation factor IF-2 [Rhizobium leguminosarum bv. viciae 3841] >gi|123385009|sp|Q1MN39|IF2_RHIL3 Translation initiation factor IF-2 >gi|115254539|emb|CAK05613.1| putative translation initiation factor IF-2 [Rhizobium leguminosarum bv. viciae 3841] (917 aa)
Score = 1078, Expect = 3.2e-115, Identities = 232/585 (39%), Positives = 355/585 (60%)
  Q:    30 KSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN--------LNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           + Q ++    I   V V    +TI E S+++++ + ++IKYL  +G       ++D      +  EFG+  ++  + + +  + N+  ED E  L  RPP+VTIMGHVDHGKT+LLD IR + V + EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK +A+ +K+ +QL +  V  E  GG+ + ++ SA   + +D+LLEAI++ AEI++LKAN  R A G  IEA +D+G G+VA +LVQ GTL     I+ G+ +G+V+ +V      +K A P+TPV + GL+G P++GDK+ V   E   +E+SE RQ   + +  +             +   S GIKE  +++K D  GS+EAI G L  +     +  +V +  G I ESDI LA  S + ++ FN + +++   +A   GI I+ YNIIY + D+++  + G+L P   E  IG+ EI ++++ + +G +AG RV+ G+++R A  R+ R D  ++   K+ +L+  KD ++    G+ECG   EN+ D   GD++E + +
  S:   322 RGQMQETREKISREV-VLPETITIQELSQRMSERAVDVIKYLMKEGQMMKPGDVIDADLAEIIAGEFGHTVRRVSESDVELGIFNVSDEDGE--LVSRPPVVTIMGHVDHGKTSLLDAIRHANVVSGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKVDKHEADPQKVRNQLLQHEVFVESMGGEVLDVEVSAKTGKNLDKLLEAILLQAEILDLKANANRTAEGTVIEAQLDRGRGSVATVLVQKGTLRPGQIIVAGDVWGRVRALVTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAARQSGQRGSLEQMMMQRQSVGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHSGAGGITESDISLAEASNAAIIGFNVRANTQARQFAEREGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDV-VVHEGKLKTLKRFKDEVSEVPMGQECGMAFENYEDMRAGDVIECFRV 910
>gi|50842971|ref|YP_056198.1| translation initiation factor IF-2 [Propionibacterium acnes KPA171202] >gi|81826420|sp|Q6A7M5|IF2_PROAC Translation initiation factor IF-2 >gi|50840573|gb|AAT83240.1| translation initiation factor IF-2 [Propionibacterium acnes KPA171202] (964 aa)
Score = 1077, Expect = 3.2e-115, Identities = 238/586 (40%), Positives = 374/586 (63%)
  Q:    30 KSQFKKVETGIKNGVFVFTNN---------LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINED-NFLDNIKFEDREDLLDK-----RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWK----KHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--LNTKQRKLSNFGTNLNENSQGI-----KELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + +F +++  +  GV V   N          ++ + ++KIN   A++++ LF  G        + +  +  L  E  Y  +     +ED   L++   E  ED  D      RPP+VT+MGHVDHGKT LLD +R + V   EAG ITQ+IGAYQV+ +    +  ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EA++HA  A  PI+V +NK+DK +A+ +K+  QL E  ++ EE+GG TM +  SA  ++G+D+LLEAI++TA+  ++L+ANP   A G+ IEA +DKG G VA  L+Q GTL + D I+ G  YG+V+ M++   + +  A P+TPV++ GL  +P +GD ++V +D++  ++++EKR+  +   Q+  S+    L++  + +     +EL +ILK D  GS+EA++  L+ I+V     L ++   +G+I E+++ LA  S +++V FN + ++     A    + I+ Y++IY   DEIE  L+G+L P++ EK +G+ EIRQ++  S +G IAG  +  G I+R+A AR+ R D  ++   +IN+L+  KD++     G ECG TL N++D   GD V+ YE+V
  S:   347 RQEFDEMQAPLVGGVRVRKGNGETVRLRRGASLTDLAEKINAEPAQLVQVLFNLGEMVTATQSVSDDTLEILGGELNYQIQVVSPEDEDRELLESFDLEFGEDEGDDSDLVARPPVVTVMGHVDHGKTKLLDALRHTDVVKGEAGGITQAIGAYQVQTEVDDAERAITFIDTPGHEAFTAMRARGAQSTDIAVLVVAADDGVMPQTVEALNHAKAADVPIVVAVNKIDKPEADPDKVRGQLTEYGLVPEEYGGDTMFVNVSARTHEGLDDLLEAIVLTADAALDLRANPDMAAQGVAIEAHLDKGRGPVATALIQRGTLHIGDSIVAGSSYGRVRAMINDQGESVDEAAPATPVQVLGLTSVPGAGDNFLVVDDDRKARQIAEKREARMRAAQQARSSRRKTLDQLFEQLEKGETEELLLILKGDGAGSVEALEDALAKIDVGDEVDLRVIDRGVGAITETNVSLAAASNAVIVGFNVRPTAHAQRMADEENVDIRYYSVIYDAIDEIEAALRGMLKPIYEEKAMGTAEIRQIFRSSKVGTIAGCMITDGTIRRHAKARLVR-DGVVVQETEINTLQREKDAVTEVREGYECGLTLTNYSDIHVGDEVQCYEMV 959
>gi|116748668|ref|YP_845355.1| translation initiation factor IF-2 [Syntrophobacter fumaroxidans MPOB] >gi|166198940|sp|A0LHL8|IF2_SYNFM Translation initiation factor IF-2 >gi|116697732|gb|ABK16920.1| bacterial translation initiation factor 2 (bIF-2) [Syntrophobacter fumaroxidans MPOB] (962 aa)
Score = 1077, Expect = 3.5e-115, Identities = 247/564 (43%), Positives = 354/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +T+   +K++   + E+IK L L G+  N+N  +D      L  EF ++ +K     E+  L     EDR + L +RPP++T+MGHVDHGKT+LLD IR + V   EAG ITQ IGAY V      + F DTPGHEAF+ MRA GA +TDIV+LVVAADDG+  QT EAI+HA  A+ PIIV INK+DK +ANI+++  +LAE  ++ EEWGG   ++  SA    GI+ELLE +++ AE++ELKANP + A G  IEA +DKG G VA +L+Q GTL   D  L G   G+V+ M     + +  A PS PV + GL+G+P +GD +I   DE+  K ++E R +  ++++LS        +L E  Q   IKELN+ILK D +GSLEAI   L  +     K++L+    G++ E+D+ LA  S ++V+ FN +  +KV + A    + ++ Y++IYQ+  +++  + G+L+PVF E  IG  E+RQ +    IG+IAG  VL G ++RNA  R+ R D  +  + KI+SLR  KD      AG ECG  +ENFND   GDI+E+YE+
  S:   383 ITVANLAKQMGIKATELIKKLLLLGLPANINQAVDFDTAALLASEFEFEVEK-TGFEEEELLQ--VREDRVEDLIRRPPVITVMGHVDHGKTSLLDAIRDTNVIGGEAGGITQHIGAYYVMLPNGNVVFLDTPGHEAFTSMRARGAKVTDIVILVVAADDGVMQQTIEAINHAKAAEVPIIVAINKVDKPNANIDRVKRELAEHGLIPEEWGGNVTMVGISAKKRTGIEELLEMVLLQAELLELKANPAKPARGRVIEAKLDKGRGPVATILIQEGTLRTGDVYLCGVNSGRVRNMFSDRGQRLDEAGPSMPVEVLGLSGVPNAGDDFITLPDERQAKMIAEHRLVKLREKELSRTSKVTLESLFEQIQEGEIKELNLILKADVHGSLEAITDSLLKLSTPEVKVSLIHFGTGAVIETDVMLASASNAIVIGFNVRSETKVQELADQENVDVRYYDVIYQLLSDVKDAMVGMLEPVFKENVIGRAEVRQTFQVPKIGMIAGSFVLEGRVERNAKCRVLR-DHVVTYDGKISSLRRFKDDAKEVKAGFECGIGVENFNDIKVGDILEVYEL 948
>gi|167037621|ref|YP_001665199.1| translation initiation factor IF-2 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856455|gb|ABY94863.1| translation initiation factor IF-2 [Thermoanaerobacter pseudethanolicus ATCC 33223] (691 aa)
Score = 1077, Expect = 3.7e-115, Identities = 249/564 (44%), Positives = 359/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           LT+ E ++K+  +  EIIK L  KGI   +N  +D     ++  E+G+   KE ++ ++  L   +  D E  L  RPPIVT+MGHVDHGKT+LLD IR + V   E G ITQ IGA  VE     I F DTPGHEAF+ MRA GA +TDIVVLVVAADDG+ PQT EAI+H   A AP+IV INK+D   AN +K+ ++L+E  ++ EEWGG T+ +  SA  N GID LLE I++ AE+ +LKANP + A G  IEA ++KG+G VA ++VQ+GTL + D IL G  YG+V+ M D   K IK A PSTPV + G + +P++GDK IV  +EK  +EL+E+R       +L  KQ+  L +  + + E S  +KELN+I+K D  GS+EA+K  +  +     ++ ++  A+G+I E+D+ LA  S ++++ FN +  +   + A    + IK Y IIY + ++I+  +KG+L+P + E E+G  E+R ++    +G +AG  VL+G+I RNA  RI R +  ++   KI SL+  KD +     G ECG  +E FND  EGDI+E Y++
  S:   119 LTVKELAEKMKVNPTEIIKKLIAKGIMVTVNQQIDFENASKIAEEYGFLVDKE-EVKDELELLLEEAPDDEKDLQPRPPIVTVMGHVDHGKTSLLDAIRNTNVTMKEMGGITQHIGASVVEVNNKKIVFLDTPGHEAFTAMRARGASITDIVVLVVAADDGVMPQTVEAINHVKAANAPMIVAINKIDLPTANPDKVKTELSELGLVPEEWGGNTICVPVSAKKNIGIDNLLEMILLVAEMEDLKANPNKPARGTIIEAKLEKGKGPVATVIVQNGTLQIGDAILAGTTYGRVRAMFDDKGKRIKKAGPSTPVEVLGFSEVPEAGDKLIVVEEEKKARELAERRKELQKEMELKRKQKVSLEDLFSQIQEGS--VKELNIIIKADVQGSVEALKKSIEDLSNEEVRIKVIHGAVGAITETDVMLASASNAIIIGFNVRPETNAKNLAEKEKVDIKLYRIIYDVIEDIKAAMKGLLEPKYKEVELGRAEVRAVFRVPGVGNVAGCYVLSGKILRNADVRIIR-NGIVVYEGKIASLKRFKDDVREVQQGFECGIGIEKFNDIKEGDIIEAYQM 686
>gi|148259245|ref|YP_001233372.1| translation initiation factor IF-2 [Acidiphilium cryptum JF-5] >gi|166226242|sp|A5FV21|IF2_ACICJ Translation initiation factor IF-2 >gi|146400926|gb|ABQ29453.1| bacterial translation initiation factor 2 (bIF-2) [Acidiphilium cryptum JF-5] (887 aa)
Score = 1077, Expect = 3.9e-115, Identities = 238/568 (41%), Positives = 353/568 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL-ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGI-------------KELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           V    +T+ E + ++     E++K L   G+       +D      +  EFG+  K+  + + +  L+    ED E  L  RPP+VTIMGHVDHGKT+LLD +R + VAA EAG ITQ IGAYQV  +    +TF DTPGHEAF+ MRA GA +TDIV+LVVAADDG+ PQT EAI HA  A  PIIV INK+D+ DAN  ++ S+L + ++  E  GG+T  ++ SAL  QG+D L EAI++ AE+++LKANP R A G  IE+S+D+G G VA +LVQ GTL   D ++ G   G+V+ M+D + + +K A PSTPV I GL+G+P +G+ ++V  +E   +E++E R     QRKL          ++G              KE+ +++K D  GS EAI+  +  +     ++ ++ A +G I ESD+ LA+ S +++V FN + +++    A   G+ I+ Y+IIYQ+ D+IE ++KG L P+  EK +G  EIRQ+++ + +G +AG  V  G +KR A  R+ R +  +I   +++ L+  KD +   A G ECG +   F+D  EGD+VE YE
  S:   308 VLPETITVQELANRMAARVPEVVKSLMKLGVMATATQTIDADTAELVVEEFGHRSKRVSESDVELGLEGQ--EDSETDLKVRPPVVTIMGHVDHGKTSLLDALRSTDVAAREAGGITQHIGAYQVTLESGAKMTFIDTPGHEAFTAMRARGASVTDIVILVVAADDGVMPQTVEAIRHAKAANVPIIVAINKIDRPDANPNRVRSELLQYDIAVEAMGGETQDVEVSALKRQGLDALQEAILLQAELLDLKANPNRSAEGAVIESSLDRGRGPVATVLVQKGTLRQGDIVVAGTEQGRVRAMLDDHGQPLKDAGPSTPVEILGLSGVPGAGEVFVVVENEGRAREIAEFR-----QRKLREHAAAAGAAARGTLDQMLARIQAGEQKEVALVIKADVQGSAEAIQATVQKLGNDEVRVRVLLAGVGQITESDVQLAKASDAIIVAFNVRANAQARTLASRDGVDIRYYSIIYQVSDDIETMVKGKLAPIEREKFLGYAEIRQVFNITKVGKVAGCYVTEGLVKRGAGVRLLR-EGVVIHQGELSQLKRFKDDVREVARGYECGLSFAGFSDLREGDVVECYE 881
>gi|167455383|ref|ZP_02321605.1| translation initiation factor IF-2 [Anaeromyxobacter dehalogenans 2CP-1] >gi|167418068|gb|EDR84767.1| translation initiation factor IF-2 [Anaeromyxobacter dehalogenans 2CP-1] (951 aa)
Score = 1076, Expect = 5.0e-115, Identities = 229/565 (40%), Positives = 352/565 (62%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDF-KKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++++ E S+ +   ++++I+ L   G    +N  +D      L LE GY   KK  ++ E  F+  ++ ++ + ++  RPP+VT+MGHVDHGKT+LLD IR++ VAA EAG ITQ IGAY V   +  ITF DTPGHEAF+ MR  GA +TD+VVLVVAADDG+ PQT E+I  A  A   I+V INK+DK  A  E++  QL E  ++ E+WGG T+++  SA   QGI ELLE I + +E++ELKANP +LA G  IEA ++KG G VA +LV+ GTL V D ++ G ++G+V+ M++   +++    P  PV + GL+G+P +GD++ V  DEK  KE+++ R    +Q++L        E+      + G K LN+++K D  GS EA+   L         + ++ +A+G+I +SD+  A    +++V FNTK  S++ + A   G+ I  + IIY+  D I   + G+L+P+  EK +G  E+RQ+++   +G IAG  V  G +KR    R+ R D+++I   KI SL+  KD +   A G ECG  ++ F+D  +GDI+E+YE+
  S:   377 SISVSELSQVMGVKASDLIRKLMQMGKMVTINAQIDADTAAILALEHGYTVEKKGFEVEE--FIPEVEVDESKLVI--RPPVVTVMGHVDHGKTSLLDAIRQADVAAGEAGGITQHIGAYSVNTPQGPITFLDTPGHEAFTAMRQRGAQVTDLVVLVVAADDGVMPQTVESIKAAKAAGVTILVAINKVDKPQAAPERVMQQLTEYELVAEQWGGTTIMLPVSARTKQGIPELLEYIALQSEVLELKANPDKLAAGRVIEAKLEKGRGPVATVLVEEGTLRVGDALVTGVHFGRVRAMMNERGEQVDNVGPGYPVEVLGLSGVPVAGDEFDVVEDEKAAKEVAQHRATKQRQKELGGVKKATLEDLFAKAKTSGQKVLNLVVKADVQGSSEAVSQALEKAATKKVGVKILESAVGAITKSDVLTAAAGNAVIVGFNTKPESEIENIASQQGVKILMFGIIYEAVDRIREEMAGLLEPIIKEKPLGKAEVRQVFNIPRVGQIAGSAVTEGVVKRAGHVRVVR-DRKVIFTGKIGSLKRVKDDVREVAQGFECGIGVDGFSDVKQGDILEVYEL 943
>gi|91788291|ref|YP_549243.1| translation initiation factor 2 [Polaromonas sp. JS666] >gi|122967793|sp|Q12AU7|IF2_POLSJ Translation initiation factor IF-2 >gi|91697516|gb|ABE44345.1| bacterial translation initiation factor 2 (bIF-2) [Polaromonas sp. JS666] (968 aa)
Score = 1076, Expect = 5.1e-115, Identities = 248/584 (42%), Positives = 365/584 (62%)
  Q:    31 SQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDN-IKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-----SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++FK +E  +          +T+ E + K++  S+E+IK+L   G    +N  LD+     +  E G+        + + F D+ ++ +  E L   R P+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + +I+F DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  PI+V INK+DK DAN++++  +L  + V+ EE+GG++  +  SA   +G+D LLE +++ AE++EL+A  + LA G+ IEA +DKG G VA +L+QSGTL   D +L G  YG+V+ M+D N K IKTA PS PV I GL  +P++GD+++V  DE+  +E++  R    +  KL+    +  EN     S G +K L +I+K D  GS EA+   L  +     K+ LV + +G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E+ IG+ EIRQ++  S IG IAG  V  G I R        +D  +I   +++SL+  KD +       ECG  ++N+ND  EGDI+E +EI
  S:   381 TEFKVIEVHVPE-------TITVAELAHKMSVKSSEVIKHLMKLGQMVTINQPLDQDTAMIVVEEMGHKAITAALDDPEAFTDDDVQGQQAEAL--PRAPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGMISFLDTPGHEAFTAMRARGAQATDIVILVVAADDGVMPQTKEAIKHAKAAGVPIVVAINKIDKADANMDRVKGELVTEEVIPEEFGGESPFVGVSARTGEGVDTLLEQVLLQAEVLELRAPVEALAKGLVIEAQLDKGRGPVATVLIQSGTLKTGDVVLAGSTYGRVRAMLDENGKPIKTAGPSIPVEIQGLTEVPQAGDEFMVMTDERRAREIATYRAGKFRNTKLAKQQASKLENMFSDISAGEVKMLPIIIKADVQGSQEALAQSLLKLSTDEVKVQLVYSGVGGISESDVNLAIASKAVLIGFNTRADAQARKQAENNGIDIRYYNIIYDAVDELKAAMSGMLTPDKKEEVIGTAEIRQVFKVSKIGSIAGCMVTAG-IVRRTARLRLLRDNVVIFTGELDSLKRFKDDVKEVKESFECGLNIKNYNDIQEGDILEFFEI 961
>gi|153814918|ref|ZP_01967586.1| hypothetical protein RUMTOR_01133 [Ruminococcus torques ATCC 27756] >gi|145847949|gb|EDK24867.1| hypothetical protein RUMTOR_01133 [Ruminococcus torques ATCC 27756] (930 aa)
Score = 1076, Expect = 5.3e-115, Identities = 249/565 (44%), Positives = 353/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRE-----DLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSE--------KRQLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           LTI E + K+    + I+K LFL+G    +N  +D     E+ +EF      E+   ++  +D I+   +E     +++ KRPP+V +MGHVDHGKT+LLD IR S V   EAG ITQ IGAY VE     ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI+HA  A   IIV INK+DK  ANIE++  +L E  ++ E+WGG T+ +  SA   +GI ELLE +++TAE+MELKANP R A G+ IEA +DKG+G+VA +LVQ GTL V D I  G  +G+V+ M+D   + +K A PS PV I GLN +P +G+ ++  + EK  +  +E        K    TK R  L +  + + E +  +KELN+I+K D  GS+EAIK  L  +      + ++   +G+INESD+ LA  S ++++ FN +  +   + A   G+ ++ Y +IY   +++E  +KG+LDPVF EK +G  E+RQ +  S +G IAG  V  G  +RN   R+ R D  ++ +  + SL+  KD +    AG ECGF  EN+ND  EGD VE Y++V
  S:   356 LTIKELADKMKIVPSVIVKKLFLQGKVVTVNQEIDYDTAEEIAMEF------EVLCEKEEVVDVIEELLKEEEEDENMMVKRPPVVCVMGHVDHGKTSLLDAIRHSNVIDREAGGITQHIGAYVVEANGEKITFLDTPGHEAFTAMRMRGASSTDIAILVVAADDGVMPQTVEAINHAKAAGIEIIVAINKIDKPSANIERVKQELTEYELIPEDWGGSTIFVPVSAHTKEGIPELLEMVLLTAEVMELKANPNRAARGLVIEAELDKGKGSVATVLVQKGTLHVGDAIAAGSAHGRVRAMMDDKGRRVKEAGPSQPVEILGLNDVPNAGEVFVGCDSEKDARSFAETFIAQNKVKLLDETKSRMSLDDLFSQIQEGN--LKELNIIVKADVQGSVEAIKQSLLKLSNDEVVIKIIHGGVGAINESDVSLASASNAIIIGFNVRPDATAKEIADREGVDLRLYRVIYNAIEDVEAAMKGMLDPVFEEKILGHAEVRQTFKASGVGTIAGSYVQDGIFERNCSVRLIR-DGIVVFDGPLASLKRFKDDVKEVRAGYECGFVFENYNDIKEGDQVEAYKMV 925
>gi|95929626|ref|ZP_01312368.1| translation initiation factor IF-2 [Desulfuromonas acetoxidans DSM 684] >gi|95134323|gb|EAT15980.1| translation initiation factor IF-2 [Desulfuromonas acetoxidans DSM 684] (923 aa)
Score = 1074, Expect = 7.1e-115, Identities = 241/614 (39%), Positives = 376/614 (61%)
  Q:     1 MEVFMA-KNVKTKSKNKNKKIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKF----EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-NFGTNLNE-----NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           MEVF   +  K + + KN+K+   +T I +    K+            ++ +T+ E +K++   + ++I+ L  +G    +N  LD      L  +F Y+ +  +  +E + L +       E + + L +RP +VTIMGHVDHGKT+LLD IR++ +A  EAG ITQ IGAY V+     I+F DTPGHEAF+ MR+ GA +TDIV+LVVAADDG+ PQT+EAI H+  A  P+IV +NK+DK  AN E++  +L E  ++ EEWGG T+ ++ SA   Q +D+LLE +++ AE++ELKA+P +   G  +EA +DKG GAVA +LVQ GTL V D I+ G ++G+V+ M++     +K A PS PV ++GL G+P +GD      +EK  KE+++ RQ   ++ +L+ N   +L++         ++EL VI+K D  GS+EA+K  LS +     +L +V   +G I ESD+ LA  S ++++ F+ +   K +  A    + I+ Y+IIY   ++I   ++G+L P   EK +G +E+R+ ++ S +G IAG  V+ G++ RNA  R+ R D  ++    +NSL+  KD +   A G ECG  LE +ND   GDI+E YE+
  S:   303 MEVFEPDRGGKMRRQKKNQKM-PKQTEITVPKAIKRK--------IRISDVITVGELAKRMGVKANDLIRELMRQGSMVTINHPLDFETAAILAADFNYEVEN-VAFDELSVLSSDDLQETGESKSENLQERPAVVTIMGHVDHGKTSLLDAIRQANIADGEAGGITQHIGAYDVQVHDKTISFLDTPGHEAFTAMRSRGAQVTDIVILVVAADDGVMPQTKEAISHSKDAGVPMIVAVNKIDKPGANSERVKQELTEFEMVPEEWGGDTIFVEVSAKKRQNLDQLLEMVLLQAEVLELKADPTKRCKGTIVEARLDKGRGAVATVLVQDGTLHVGDPIVAGLHFGRVRTMINDRGVAVKEAGPSIPVEVTGLQGVPDAGDTLHALENEKTAKEVAQHRQQKIRETELAKNSRLSLDQLYARIQEGNVEELKVIVKADVQGSVEAVKDSLSKLTTDTCRLTVVHTGVGGITESDVSLASASDAIIIGFSVRPEPKAAQLAEKEHVDIRLYSIIYDAVNDIRDAMEGLLAPTLREKHLGRLEVRETFNVSKVGTIAGCMVIDGKVHRNAQVRLVR-DSIVVWEGSLNSLKRFKDDVKEVATGYECGIGLEKYNDIKVGDIIEAYEM 916
>gi|187928210|ref|YP_001898697.1| translation initiation factor IF-2 [Ralstonia pickettii 12J] >gi|187725100|gb|ACD26265.1| translation initiation factor IF-2 [Ralstonia pickettii 12J] (964 aa)
Score = 1074, Expect = 7.2e-115, Identities = 245/592 (41%), Positives = 363/592 (61%)
  Q:    23 NRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           NR   D ++ F+     +   V V    +++ + + K++  +AE+IK +   G    +N +LD+     +  E G+        + +  L     E      + RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  PI+V I K+DK +AN +++  +L  ++V+ EE+GG    +  SA   +GID LLE +++ AE++ELKA     A G+ +EA +DKG+G +A +LVQSGTL   D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ +V  DE+  +E++  RQ   +  KL     +     L + S+G +K L +I+K D  GS EA+   L  +     ++ +V AA+G I ESD++LA  SK++++ FNT+  +     A + GI I+ YNIIY   DE++  + G+L P   E+  G VE+RQ++    +G +AG  VL G +KRN+  R+ R +  I S  +++SL+  KD +     G ECG +++NFND  EGD +E+YEI
  S:   362 NRHGDDNRNAFQAPTEPVVREVHV-PETISVADLAHKMSVKAAEVIKQMMKLGQMVTINQVLDQETAMIVVEEMGHQAVAAKLDDPEAMLVGDVQEQTNAEAETRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETDRGVITFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHAKAAGVPIVVAITKVDKPEANPDRVKQELVAESVIPEEYGGDVPFVPVSAKTGEGIDSLLENVLLQAEVLELKAPVNAPAKGLVVEAQLDKGKGPIATVLVQSGTLKRGDVVLAGTAYGRVRAMLDENGKPAKDAGPSIPVEIQGLSEVPGAGEEVLVLPDERKAREIALFRQGKFRDVKLARQQAAKLENMLEQMSEGDVKSLPLIIKADVQGSQEALVHSLKKLSTDEVRVQIVHAAVGGITESDVNLATASKAVIIGFNTRADAGARKLAENHGIDIRYYNIIYDAVDEVKAAMSGMLSPEKREETTGLVEVRQVFHVPKVGAVAGCMVLDGFVKRNSLVRVLRANVVIFS-GELDSLKRFKDDVKEVKQGFECGLSIKNFNDVQEGDQLEVYEI 957
>gi|153886777|ref|ZP_02007931.1| translation initiation factor IF-2 [Ralstonia pickettii 12D] >gi|151576951|gb|EDN41353.1| translation initiation factor IF-2 [Ralstonia pickettii 12D] (964 aa)
Score = 1074, Expect = 7.3e-115, Identities = 245/592 (41%), Positives = 363/592 (61%)
  Q:    23 NRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           NR   D ++ F+     +   V V    +++ + + K++  +AE+IK +   G    +N +LD+     +  E G+        + +  L     E      + RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA  A  PI+V I K+DK +AN +++  +L  ++V+ EE+GG    +  SA   +GID LLE +++ AE++ELKA     A G+ +EA +DKG+G +A +LVQSGTL   D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ +V  DE+  +E++  RQ   +  KL     +     L + S+G +K L +I+K D  GS EA+   L  +     ++ +V AA+G I ESD++LA  SK++++ FNT+  +     A + GI I+ YNIIY   DE++  + G+L P   E+  G VE+RQ++    +G +AG  VL G +KRN+  R+ R +  I S  +++SL+  KD +     G ECG +++NFND  EGD +E+YEI
  S:   362 NRHGDDNRNAFQAPTEPVVREVHV-PETISVADLAHKMSVKAAEVIKQMMKLGQMVTINQVLDQETAMIVVEEMGHQAVAAKLDDPEAMLVGDVQEQTNAEAETRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETDRGVITFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHAKAAGVPIVVAITKVDKPEANPDRVKQELVAESVIPEEYGGDVPFVPVSAKTGEGIDSLLENVLLQAEVLELKAPVNAPAKGLVVEAQLDKGKGPIATVLVQSGTLKRGDVVLAGTAYGRVRAMLDENGKPAKEAGPSIPVEIQGLSEVPGAGEEVLVLPDERKAREIALFRQGKFRDVKLARQQAAKLENMLEQMSEGDVKSLPLIIKADVQGSQEALVHSLKKLSTDEVRVQIVHAAVGGITESDVNLATASKAVIIGFNTRADAGARKLAENHGIDIRYYNIIYDAVDEVKAAMSGMLSPEKREETTGLVEVRQVFHVPKVGAVAGCMVLDGFVKRNSLVRVLRANVVIFS-GELDSLKRFKDDVKEVKQGFECGLSIKNFNDVQEGDQLEVYEI 957
>gi|15895078|ref|NP_348427.1| translation initiation factor IF-2 [Clostridium acetobutylicum ATCC 824] >gi|39931301|sp|Q97I51|IF2_CLOAB Translation initiation factor IF-2 >gi|15024775|gb|AAK79767.1|AE007689_5 Translation IF2, GTPase [Clostridium acetobutylicum ATCC 824] (693 aa)
Score = 1074, Expect = 7.3e-115, Identities = 242/577 (41%), Positives = 365/577 (63%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD-----KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           V    N +T+ + + K+ K   E+IK L   G+   +N  +D     ++  +F  D  ++ +  +   L +    + E+  D     KRPP+VT+MGHVDHGKT+LLD IRKS V  TEAG ITQ IGAY V+  +  +TF DTPGHEAF+ MRA GA++TD+V+LVVAADDG+ PQT+EAI+H   A  PI+V INK+DK  ANI+++  +L E  ++ E+WGG T+ +  SA   QG+D L+E  I+TA++M+LKA+PKR A G  IE  +DKG G VA L+VQ+GTL V + I+VG  YG+++ M D   K+IK+A PS PV I GL+ +P++GDK+ V  DEK  + +++ R        L +K +  L +  + + E    +KEL +I+K D  GS+EA+K     +     K+ ++  A+G+I E+D+ LA  S ++++ FN +  +  S  A    + IK Y +IY   D+I+  + G+LDP + E+ IG+ E+R ++  SSIG +AG  V +G+I R++  R+ R D  +I   ++ SL+  KD     A G ECG T++ FND  EGD++E +++V    E
  S:   106 VIEIENTITVKDLADKLKKPITEVIKELMFMGVMAAINQEIDFETSSKVAAKFKVDVIQKAEEADKKELKSEFENEFEEDEDEGTWIKRPPVVTVMGHVDHGKTSLLDAIRKSSVTETEAGGITQHIGAYTVKMNEGKVTFLDTPGHEAFTAMRARGAEITDVVILVVAADDGIMPQTKEAINHCKAANVPIVVAINKIDKPGANIDRVKQELTEHGLIPEDWGGDTICVPVSAKTKQGLDSLIEMTILTADVMDLKADPKRHARGTVIEGKLDKGRGPVASLIVQNGTLKVGNSIIVGSTYGRIRAMFDDKGKKIKSAGPSVPVEILGLSDVPEAGDKFNVVKDEKTARNMAKIRVEKLRSANLASKHKVSLEDLYSQIQEGK--VKELGIIVKADVQGSVEAVKQSFEKLSTDAVKVRVIHGAVGAITETDVILASASNAIIIGFNVRPDNNASALAEKEKVDIKTYRVIYTAIDDIKSAMIGMLDPEYKEEVIGNAEVRHIYKISSIGTVAGCYVTSGKITRSSSIRVIR-DGIVILEGELASLKRFKDDAKEVARGFECGLTIDKFNDIKEGDVIEAFQMVKVKQE 692
>gi|158320560|ref|YP_001513067.1| translation initiation factor IF-2 [Alkaliphilus oremlandii OhILAs] >gi|166918481|sp|A8MFA8|IF2_ALKOO Translation initiation factor IF-2 >gi|158140759|gb|ABW19071.1| translation initiation factor IF-2 [Alkaliphilus oremlandii OhILAs] (719 aa)
Score = 1074, Expect = 7.7e-115, Identities = 245/571 (42%), Positives = 356/571 (62%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    N LT+ E S+ +NK ++EII  L   GI   +N  LD      +  EFG + +    I+ E++  D I   D+ + L  R P+VT+MGHVDHGKT+LLD IRK+KV  +EAG ITQ IGA +++     I F DTPGHEAF+ MRA GA +TD+ +LVVAADDG+ PQT EAI HA  A+ PIIV INKMDK  AN +++  +LA++ +L EEWGG  + +  SA + + ID LLE +++ +E+ ELKANP R A G  IEA +D G+G VA +LVQ+GTL + D +++G  YG+++ M++ + K +K A PST V I+GL+ +P++GD+    +D+K  K + EKR    K+ +L      +     ++  QG +K+LN+I+K D  GS+EA+K  L  +      +N +   +G I ESD+ LA  S ++++ FN + +S  +  A    + I+ Y IIY+  ++IE  +KG+LDP FVE+E+G  E+R  +     G I G  V+ G+I RNA  R+ R D  +I    I+SL+  KD     A G ECG  +  FND  EGDI+E Y +
  S:   138 VIQLKNKLTVKELSETLNKSASEIITKLIGLGIMATINQELDYDTASIIAAEFGIEVEPMTDIDAEEDVFDIIIEPDKPEDLKHRSPVVTVMGHVDHGKTSLLDAIRKTKVTNSEAGGITQHIGASEIKVNDKKIVFLDTPGHEAFTSMRARGAKVTDVAILVVAADDGVMPQTIEAISHAKAAEVPIIVAINKMDKPSANPDRVKQELADQGLLIEEWGGDVISVPVSARSGENIDALLEMVLLVSEMSELKANPNRKAIGTVIEAQLDVGKGPVATVLVQNGTLFIGDSVVIGNTYGRIRAMMNDSGKRVKVAGPSTAVEITGLSEVPEAGDQLFAVDDDKAAKAIVEKRINKIKEEQLKAGQKISLDALFSQMEQGQLKDLNLIIKADTQGSVEAVKQSLVKLSNDEVVINPIHGGVGGITESDVMLATASNAIIIGFNVRPTSNAASAAKKENVDIRTYRIIYKAIEDIEAAMKGMLDPEFVEEELGKAEVRATFKVPGAGTIGGCYVIEGKILRNAKIRLVR-DNIVIHEGSIDSLKRFKDDAKEVATGYECGIGISQFNDLKEGDIIEAYHM 714
>gi|186902107|ref|ZP_02975054.1| translation initiation factor IF-2 [Cyanothece sp. PCC 7424] >gi|186690881|gb|EDU15510.1| translation initiation factor IF-2 [Cyanothece sp. PCC 7424] (1101 aa)
Score = 1074, Expect = 7.9e-115, Identities = 262/610 (42%), Positives = 385/610 (63%)
  Q:     6 AKNVKTKSK---NKNKKIVDNRTN-IDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKK-EIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS--------NFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +KNVK  +K    + K     R+   D K Q ++ ET       V    +T+ E ++++     EII+ LF KGI  N+   LD   +  +  E     +  E++       + +   D E+L  +RPP+VTIMGHVDHGKTTLLD+IRK+KVA  EAG ITQ IGAY V    E K+  I F DTPGHEAF+ MRA GA +TDI +LVVAADDG++PQT EAI HA  A+ PI+V INK+DK ++N ++I  +L+E +++ EEWGG+T+++  SAL  + +D LLE +++ AE+ EL ANP RLA G  IEA++D+  G VA LLVQ+GTL V D I+ G   GK++ M+D    +++ A PS  V I GLN +P +GD++ V  +EK  + L+++R  + +Q +L         +  T   +  +G +KELN+ILK D  GS+EAI G L  +     ++ ++ AA G I E+D+DLA  S +++V FNT ++S     A   GI I+ YNIIY++ D+I+  ++G+LDP  VE  +G  E+R ++     G +AG  V +G+I RN   R++RK  E+I    ++SL+  K+      AG ECG  +  FND+ EGD +E++E+V
  S:   474 SKNVKAPTKAEPGRGKSAERERSERKDRKEQPQRAET------LVLDKTMTVRELAERLGIAETEIIRILFFKGIAVNITQTLDFDTIQAIAEELEVQIESPEVKAAATKTTEMLDANDLENL-HRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVDIEHEGKQEQIVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVQPQTREAISHARAAEVPIVVAINKIDKPESNPDRIKQELSELSLVPEEWGGETIMVPVSALKGENLDTLLEMLLLVAEVGELSANPDRLARGTVIEANLDRTRGPVATLLVQNGTLRVGDTIVAGPVLGKIRAMIDDRGNKVEEASPSFAVEILGLNEVPAAGDEFEVFENEKEARALADQRSQDLRQTRLQQAMSSRRISLSTLSAQAQEGKLKELNLILKADVQGSVEAILGSLKQLPQNEVQIRVLLAAPGEITETDVDLAAASGAVIVGFNTTLASGARQSADQEGIDIREYNIIYKLLDDIQGAMEGLLDPEEVESPLGVAEVRAVFPVGR-GAVAGCYVQSGKIIRNRQLRVRRKG-EVIYEGVLDSLKRMKEDAREVNAGYECGIGVSKFNDWQEGDSIEVFEMV 1092
>gi|153869168|ref|ZP_01998842.1| Translation initiation factor IF-2 [Beggiatoa sp. PS] >gi|152074290|gb|EDN71160.1| Translation initiation factor IF-2 [Beggiatoa sp. PS] (747 aa)
Score = 1073, Expect = 9.8e-115, Identities = 242/563 (42%), Positives = 361/563 (64%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK--KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           LT+ E ++K++  +AE+IK +   G    +N +LD+     +  E G+  K  KE QI ED+    IK  ++      R P+VTIMGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY V+  K  I F DTPGH AF+ MRA GA +TDIVVLVVAADDG+ PQT EAI HA  AK PIIV +NK+DK +A+ +++  +L    V+ EEWGG TM I  SA   +GID LLE+I++ AE++EL    + +A G+TIE+ +DKG GAVA +L+QSGTL   + +L G+ +G+V+ M+D N K+++ A PS PV + GL+G+P +GD+ IV  DE+  +E++  RQ   ++ KL+       EN      +  +  LN++LK D +GS+EA++  L+ +     K+N++ + +G INE+D++LA  S ++++ FN +  +          + +  Y++IY+  DE++  L G+L P   E+ IG  E+R+++    +G IAG  V+ G +KRN+  R+ R D  +I   ++ SLR  KD  +   AG ECG  ++N+ND   GD +E+YE
  S:   174 LTVAELAQKMSVKAAEVIKTMMKMGTMVTINQVLDQETAAIVVDEMGHTSKLLKENQI-EDSL---IKAGEQIGKKVHRAPVVTIMGHVDHGKTSLLDLIRRTKVAAGEAGGITQHIGAYHVDTPKGTICFLDTPGHAAFTAMRARGAKVTDIVVLVVAADDGVMPQTLEAIQHAKAAKVPIIVALNKIDKPEADPDRVKQELVTHEVVPEEWGGDTMFIPVSAKQGEGIDALLESILLQAEVLELMTVAEGIATGVTIESRLDKGRGAVASILIQSGTLNKGNVLLAGKQFGRVRAMLDENGKQVEQAGPSIPVEVLGLSGVPSAGDEAIVVPDERKAREIALFRQGKYREIKLAKSQAAKLENVFSHLQTGKVSILNIVLKADVHGSVEALQDALTKLSNEEVKVNIIASGVGGINETDVNLAVASSAILIGFNVRADNSAKRLINEENVDLHYYSVIYEAIDEVKHALSGMLAPEIREEIIGLAEVREIFRSPKLGAIAGCLVVDGLVKRNSPIRVLR-DNVVIFEGELESLRRFKDEASEVKAGTECGIGVKNYNDVQSGDQIEVYE 739
>gi|167630359|ref|YP_001680858.1| translation initiation factor IF-2 [Heliobacterium modesticaldum Ice1] >gi|167593099|gb|ABZ84847.1| translation initiation factor if-2 [Heliobacterium modesticaldum Ice1] (735 aa)
Score = 1073, Expect = 1.0e-114, Identities = 244/596 (40%), Positives = 357/596 (59%)
  Q:    19 KIVDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKEL--------SEKRQLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           K++  R+    K   +++E      + +   ++T+ E S+ + K   +IIK L   G+   +N  +D      L  ++G   +    +  +  L     E  E+L+  RPP+VT+MGHVDHGKT+LLD IR++ V A+EAG ITQ IGAYQVE     ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PI+V INK+DK DAN +++  +L E  ++ EEWGG T+ +  SA   Q ID+LLE I++ AE+ +LKANP+R A G  IEA +DKG G VA +LVQ GTL + D I+ G   GKV+ M+D   + +K A PS PV + GL+ +P++GD + V  +EKL K++         E+ Q  T +  L +    + E    +K+LNVI+K D  GS+EA+KG L  +     ++N V   +G+I E+D+ LA  S ++++ FN +  +     A +  + I+ Y +IY   ++I+  + G+L+P   E   G  E+R  +     G IAG  VL G++ RNA  R+ R D  +I   K++SL+  KD +   A G ECG  +ENFND  E D +E + I
  S:   129 KLIHPRSQSKGKKNVRQIEAEAPKHILI-DESVTVLELSQAMGKTVTDIIKKLMQLGVLATINQEIDADTASILAADWGITVEVRKSVTAEEILAEEPEETDENLI-HRPPVVTVMGHVDHGKTSLLDAIRETNVIASEAGGITQHIGAYQVEIDGKKITFLDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQTVEAINHAKAAGVPIVVAINKIDKPDANPDRVKQELTEYGLVVEEWGGDTIAVPVSAKARQNIDQLLEMILLVAEVQDLKANPERAARGTVIEAQLDKGRGPVATVLVQKGTLNIGDVIVAGTAVGKVRAMIDDKGRRVKKAEPSMPVEVLGLSDVPQAGDTFSVVTEEKLAKQVISERVNKRKEEEQKRTSKVSLDDLFKQIKEGQ--VKDLNVIVKADVQGSVEALKGALERLSTDEVRVNCVHGGVGAITETDVMLAAASNAIIIGFNVRPDANSRKAAEAQQVDIRLYRVIYDATEDIKAAMSGMLEPEEKEVVQGHAEVRATFKVPKAGTIAGCYVLDGKVTRNAEVRVIR-DGIVIHEGKLDSLKRFKDDVKEVAEGYECGIGIENFNDIREHDTLEFFII 727
>gi|167845947|ref|ZP_02471455.1| translation initiation factor IF-2 [Burkholderia pseudomallei B7210] (633 aa)
Score = 1073, Expect = 1.1e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:    59 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 626
>gi|124267110|ref|YP_001021114.1| translation initiation factor 2 [Methylibium petroleiphilum PM1] >gi|166232556|sp|A2SH40|IF2_METPP Translation initiation factor IF-2 >gi|124259885|gb|ABM94879.1| bacterial translation initiation factor 2 (bIF-2) [Methylibium petroleiphilum PM1] (948 aa)
Score = 1073, Expect = 1.1e-114, Identities = 242/564 (42%), Positives = 357/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL-DNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-----SQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK L   G    +N  LD+     L  E G+        + D FL D+++  D    L+ R P+VT+MGHVDHGKT+LLD IR ++VAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TD+V+LVVAADDG+ PQT+EAI HA  A+ P+IV INK+DK   N+E++ S+L  + V+ E++GG +  ++ SA   QGIDELLE +++ AE++EL+A     A G+ IEA +DKG G VA +LVQSGTL   D +L G  YG+V+ M+D N K    A PS PV I GL  +P++GD+++V +DE+  +E++  R    +  KLS       EN      QG ++ L +I+K D  GS EA+   L  +     K+ +V AA+G I+ESD++LA  SK++++ FN +  +     A    + ++ YNIIY   DEI+  + G+L P   E+ IG+ EIR ++  S IG +AG  V +G ++RNA  R+ R++  ++ + +I S+R  KD +     G ECG  L+N+ND  EGD +E++EI
  S:   374 ISVADLAHKMSVKASEVIKQLMKLGQMVTINQQLDQETAMILVEEMGHKAFTAKLDDPDAFLEDDVEVTDVP--LEPRAPVVTVMGHVDHGKTSLLDYIRTTRVAAGEAGGITQHIGAYHVETPRGMITFLDTPGHEAFTAMRARGAKATDLVILVVAADDGVMPQTKEAIHHAKAAEVPLIVAINKIDKPGTNLERVRSELIAEQVVPEDFGGDSPFVQVSAKTGQGIDELLEQVLLQAEVLELQAQVAAPAKGLVIEAQLDKGRGPVATVLVQSGTLKRGDVVLAGSTYGRVRAMLDENGKPATEAGPSIPVEIQGLTEVPQAGDEFMVLSDERRAREIATFRSGKYRDVKLSKQQAAKLENMFETMGQGEVQTLPLIIKADVQGSQEALGASLLKLSTAEVKVQIVHAAVGGISESDVNLAIASKAVIIGFNVRADAGARKLAEGNNVDLRYYNIIYDAVDEIKSAMTGMLAPEQKEELIGTAEIRTVFVASKIGTVAGSMVTSGIVRRNARFRLLRENV-VVYSGEIESVRRMKDDVREVKEGFECGIKLKNYNDIKEGDQLEVFEI 941
>gi|167894524|ref|ZP_02481926.1| translation initiation factor IF-2 [Burkholderia pseudomallei 7894] (652 aa)
Score = 1073, Expect = 1.1e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:    78 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 645
>gi|162454074|ref|YP_001616441.1| translation initiation factor IF-2 [Sorangium cellulosum 'So ce 56'] >gi|161164656|emb|CAN95961.1| translation initiation factor IF-2 [Sorangium cellulosum 'So ce 56'] (624 aa)
Score = 1073, Expect = 1.2e-114, Identities = 241/583 (41%), Positives = 351/583 (60%)
  Q:    32 QFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGIN-CNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKF-EDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR--------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           Q    E      V      +T+ + + K++  + +++  L   G+   N+N+ LD      L  EFG+  +      +D     ++   D ++ ++ RPPIVT+MGHVDHGKT+LLD IRK+ VA  EAG ITQ IGAY+VE  +  I F DTPGHEAF+ MRA GA LTDIV+LVVAADDG+ PQT+EAI HA  AK PIIV +NK+DK  A+ +KI   LA   +  EEWGG+TM    SA   QGID+LLE++++ AE+ +L+ANPK+ A+G  IEA +D+G G VA ++VQ GTL   D +L G  +GKV+ M D   + +  A P+TPV + GLN +P +GD      D K  +E++E R+    +          L +   NL E  Q   EL +I+K D  GS+EAI   L+ +     K+ +V  A+G I E D++LA  SK+++V FN + + K    A + G+ I+ YNIIY   D+I   ++G+L    VEK +G  E+RQ++  +  G +AG   ++G +KR   AR+ R D  ++   +++ LR  KD +     G ECG +L+ ++D  E DI+E +EI
  S:    28 QVSTQEMASHKKVIKIEEQVTLQQLAAKMSLKATDVLMRLLSMGMTGVNINSTLDAETAKILASEFGWSVEDVAVSEQDTLTAAMQAGADTDEDVEIRPPIVTVMGHVDHGKTSLLDRIRKATVAEGEAGGITQHIGAYRVETPRGTIAFLDTPGHEAFTAMRARGASLTDIVILVVAADDGVMPQTKEAISHAQAAKVPIIVAVNKIDKPGADADKIKRDLAALGLQPEEWGGETMFCAVSAKMGQGIDQLLESVLLLAEVQDLRANPKKRASGTVIEALLDRGRGPVARVMVQDGTLRTGDILLAGAAWGKVRAMTDELGRSVAEAGPATPVEVLGLNEVPSAGDPVHAVKDGKTAEEIAETRRKKASKTLIPQDSRVSLESITKNLQEADQ--LELKLIIKGDVQGSVEAITHALAKLSTEKVKVTIVNGAVGGITEGDVNLAVASKAIIVGFNVRPAGKAGALAENEGVEIRLYNIIYNAVDDIRSAMEGLLPATKVEKVLGRAEVRQVFKITKAGTVAGCMAISGSVKRTGEARLIR-DNAVVWTGRLSGLRRFKDDVKEVVEGFECGISLDGYSDIKERDIIESFEI 617
>gi|167719817|ref|ZP_02403053.1| translation initiation factor IF-2 [Burkholderia pseudomallei DM98] (778 aa)
Score = 1072, Expect = 1.3e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:   204 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 771
>gi|167824415|ref|ZP_02455886.1| translation initiation factor IF-2 [Burkholderia pseudomallei 9] (655 aa)
Score = 1072, Expect = 1.4e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:    81 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 648
>gi|171058384|ref|YP_001790733.1| translation initiation factor IF-2 [Leptothrix cholodnii SP-6] >gi|170775829|gb|ACB33968.1| translation initiation factor IF-2 [Leptothrix cholodnii SP-6] (991 aa)
Score = 1072, Expect = 1.4e-114, Identities = 239/564 (42%), Positives = 350/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ-------LNTKQ-RKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++   +E+IK L   G    +N  LD+     +  E G+        + D FL+     +  + L  RPP+VT+MGHVDHGKT+LLD IR S+VAA EAG ITQ IGAY VE  + +ITF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI H+  A  PI+V INK+DK D+N++++ S+L  + V+ EE+GG       SA   QGID LLE +++ AE++EL A  + LA G+ IEA +DKG G VA +LVQSGTL   D +L G+ YG+V+ M+D   K  + A PS PV I GL  +P +GD+++V  DE+  +E++  RQ       LN +Q  KL N   N+ + +   + L +I+K D  GS EA+   L  +     K+ +V AA+G I+ESD++LA  SK++++ FN +  +     A    + ++ YN+IY   DEI+  + G+L P   E+ IG+ EIR ++  + IG IAG  V +G ++RN   R+ R +  +I   +++S+R  KD +     G ECG  L+N+ D  EGD +E +EI
  S:   417 ISVADLAHKMSVKGSEVIKQLMRLGQMVTINQQLDQETAMIVVEEMGHKAFAAKLDDPDAFLEEENLAEAGESL-PRPPVVTVMGHVDHGKTSLLDYIRTSRVAAGEAGGITQHIGAYHVETPRGVITFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHSKAAGVPIVVAINKIDKPDSNLDRVRSELVAEGVVPEEFGGDAPFCLVSAKTGQGIDTLLEQVLLQAEVLELNAPQEALAKGLVIEARLDKGRGPVATVLVQSGTLKRGDVVLAGQSYGRVRAMLDETGKAAQEAGPSIPVEIQGLTEVPSAGDEFMVLADERRAREIATFRQGKYREVNLNRRQAAKLENMFENMGQGAA--QTLALIIKADVQGSQEALAASLLKLSTDEVKVQIVHAAVGGISESDVNLALASKAVIIGFNVRADAGARKLADGNDVDLRYYNVIYDAVDEIKSAMSGMLAPEQREEAIGTAEIRTVFVATKIGTIAGSMVTSGLVRRNCRFRLLRNNI-VIYTGEVDSVRRLKDDVKEVKEGFECGIKLKNYTDIAEGDQLEFFEI 984
>gi|154509094|ref|ZP_02044736.1| hypothetical protein ACTODO_01611 [Actinomyces odontolyticus ATCC 17982] >gi|153798728|gb|EDN81148.1| hypothetical protein ACTODO_01611 [Actinomyces odontolyticus ATCC 17982] (606 aa)
Score = 1072, Expect = 1.4e-114, Identities = 247/563 (43%), Positives = 362/563 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFK--------KEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKH-----LITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ------LNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTG-AKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ + ++KI+ + A ++  LF  G        LD+     L  E GYD K        +E+  + D  L+  + +D E+++  RPP+VT+MGHVDHGKT LLD IR + V  TE G ITQ IGAYQV  K        ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A  PI+V +NK+DK  AN EKI SQL E  ++ EE+GG  M +  SA   +GI ELLEA+++TA+  + L+ANP   A G+ IEA++DKG GAVA +LVQ GTL V D ++VG  YG+V+ M D    ++  A PSTPV + GL  +P++GD ++V  D++  +++++KR+      L  K+RK   L +F   L E    +  LN+++K D +G++EA++  L  I+V     L ++   +G+I ++D++LA    ++++ FN + + +V++ A + G+ IK YN+IY   D+IE  LKG+L P++ E ++G+ EIRQ++     G IAG  V +G IKR   AR+ R    +  N +I SLR  KD +     G ECG TL +  D  EGDI+E +E+
  S:    18 SLADLAEKIDVNPAALVTVLFALGEMATATQSLDQDTFEALGAELGYDVKVVSPEDEDRELLESFDIDLEAEELDDAENMV-PRPPVVTVMGHVDHGKTKLLDAIRHTDVVDTEHGGITQHIGAYQVTVKAEDGTVRPITFIDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQTVEAINHAQAAGVPIVVAVNKVDKDTANPEKIRSQLTEYGLVAEEYGGDVMFVNISAKQRKGIRELLEAVLLTADAALTLEANPNTDARGVAIEANLDKGRGAVATMLVQRGTLHVGDSLVVGSSYGRVRAMFDDGGNDVSEAGPSTPVAVLGLTSVPRAGDSFLVAPDDRTARQIADKREAAERQALLAKRRKRVSLEDFDKVLAEGE--VDTLNLVIKGDVSGAVEALEDSLLRIDVGDEVALRIIHRGVGAITQNDVNLATVDNAVIIGFNVRPAERVAEMADAEGVEIKYYNVIYSAIDDIEAALKGMLKPIYEEVQLGTAEIRQVFRSGKFGNIAGSIVRSGTIKRGTKARLVRDGVVVADNLEIVSLRREKDDVTEVREGYECGITLGH-KDIAEGDIIETWEM 600
>gi|167738818|ref|ZP_02411592.1| translation initiation factor IF-2 [Burkholderia pseudomallei 14] (645 aa)
Score = 1072, Expect = 1.4e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:    71 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 638
>gi|119717414|ref|YP_924379.1| translation initiation factor IF-2 [Nocardioides sp. JS614] >gi|166232566|sp|A1SLK7|IF2_NOCSJ Translation initiation factor IF-2 >gi|119538075|gb|ABL82692.1| bacterial translation initiation factor 2 (bIF-2) [Nocardioides sp. JS614] (938 aa)
Score = 1071, Expect = 1.6e-114, Identities = 237/563 (42%), Positives = 359/563 (63%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL---DNIKFEDRED---LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTK---------QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F+++IN   A++++ LF  G        +++  +  L  E  Y  +     +ED  L    +I+F D ED     + RPP+VT+MGHVDHGKT LLD +R + VA+ EAG ITQ IGAYQV    + +   ITF DTPGHEAF+ MRA G+  +DI VLVVAADDG+ PQT EA++HA  A  PI+V +NK+DK +A+  K+  QL E  ++ EE+GG TM +  SA +   +D+LLEA+++TA+  ++L+ANP R A G+ IEA +D+G G VA +LVQ GTL V D I+ G  +G+V+ M+D    E+  A PS P  + GL+ +P +G  +IV  D+++ ++++EKR+   +         +R L +F  ++ +     +ELN+ILK D +GS+EA++  L+ I+V     L ++   +G+I E+++DLA  S ++++ FN +   K ++ A   G+ I+ Y +IYQ  +EIE  LKG+L P F E  +G  EIR ++  S +G IAG  V++G I+RNA  R+ R    +  N  + SL+  KD  +    G ECG  L NF D  EGDIVE +E+
  S:   351 SLTDFAERINVEPAQLVQMLFSLGEMVTATESVNDETLELLGEELNYVVEVVSPEDEDRELLESFDIEFADDEDDEGHFEARPPVVTVMGHVDHGKTKLLDALRHANVASGEAGGITQHIGAYQVHTDVDGEDRKITFIDTPGHEAFTAMRARGSQSSDIAVLVVAADDGVMPQTVEALNHAKAAGVPIVVAVNKIDKPEADPTKVRGQLTEYGLVPEEYGGDTMFVDVSAKSELNLDKLLEAVVLTADASLDLRANPNRDAQGLVIEAHLDRGRGPVATILVQRGTLHVGDSIVAGPAHGRVRAMLDEYGNELTEATPSRPAMVLGLSTVPGAGQNFIVVEDDRMARQIAEKREARERAAMQAKRRVRRTLEDFMASMEKGES--QELNLILKGDVSGSVEALEDALAKIDVGDDVSLRVIDRGVGAITETNVDLAAASDAIIIGFNVRPQGKATELADREGVEIRYYTVIYQAIEEIEAALKGMLKPEFEESTLGQAEIRAIFRSSKVGNIAGCMVISGVIRRNAKVRVIRDGAVVADNLDLASLKREKDDASEVREGFECGLVLRNFQDIKEGDIVEAFEM 932
>gi|126175439|ref|YP_001051588.1| translation initiation factor IF-2 [Shewanella baltica OS155] >gi|149117929|ref|ZP_01844572.1| translation initiation factor IF-2 [Shewanella baltica OS223] >gi|153001789|ref|YP_001367470.1| translation initiation factor IF-2 [Shewanella baltica OS185] >gi|160876523|ref|YP_001555839.1| translation initiation factor IF-2 [Shewanella baltica OS195] >gi|166198926|sp|A3D7K6|IF2_SHEB5 Translation initiation factor IF-2 >gi|166198927|sp|A6WRG8|IF2_SHEB8 Translation initiation factor IF-2 >gi|189028435|sp|A9KZX1|IF2_SHEB9 Translation initiation factor IF-2 >gi|125998644|gb|ABN62719.1| translation initiation factor IF-2 [Shewanella baltica OS155] >gi|146861901|gb|EDK47719.1| translation initiation factor IF-2 [Shewanella baltica OS223] >gi|151366407|gb|ABS09407.1| translation initiation factor IF-2 [Shewanella baltica OS185] >gi|160862045|gb|ABX50579.1| translation initiation factor IF-2 [Shewanella baltica OS195] (880 aa)
Score = 1071, Expect = 1.7e-114, Identities = 241/565 (42%), Positives = 352/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED----LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +T+ E +  +   + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L++   +DR+D      + R P+VTIMGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE +  +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA     P+IV +NKMDK +A+I+++ S+L++  V+ E+WGG  M    SA   +G+DELLE I++ AE++ELKA    +A G+ IE+ +DKG G VA +LVQ GTL   D +L G  YGK++ M D N + I  A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ           ++ KL N   N+ E    +KELN++LK D  GSLEAI   L+ +     K+N++   +G++ E+D  LA  S +++V FN +  ++      S  + ++ Y++IY + DE+   + G+L P F ++ IG  E+R ++    +G IAG  V  G IKR+A  R+ R D  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E V
  S:   305 VTVSELAHLMAVKATEIIKQMMKMGSMVTINQVLDQETAQMVAEEMGH----KVVLIRENELEHQVLKDRDDEDGIKQESRAPVVTIMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTAMRARGAKATDIVVLVVAADDGVMPQTIEAIQHAKAGNVPLIVAVNKMDKPEADIDRVKSELSQHGVMSEDWGGDNMFAFVSAKTGEGVDELLEGILLQAEVLELKAVRDGMAAGVVIESQLDKGRGPVATILVQEGTLRQGDIVLCGLEYGKIRAMKDENGRSITEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKSKLENMFANMTEGE--VKELNIVLKADVQGSLEAITDSLTGLSTDEVKVNIIARGVGALTETDATLAAASNAILVGFNVRADAQARKTIDSESVDLRYYSVIYNLIDEVRAAMTGMLSPEFKQQIIGLAEVRDVFKSPKLGAIAGCMVTEGTIKRSAPIRVLR-DNVVIYEGELESLRRFKDDVAEVRNGMECGIGVKNYNDVRVGDQIEVFETV 874
>gi|171853979|emb|CAM11942.1| Translation initiation factor 2 [Candidatus Phytoplasma australiense] (623 aa)
Score = 1071, Expect = 1.7e-114, Identities = 267/600 (44%), Positives = 386/600 (64%)
  Q:    11 TKSKNKNKKIVD-NRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDF-----KKEIQINEDNFLDN--IKFEDR----EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEK-----LLKELSEKRQLNTK---QRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVE 610
           T  KNKNK  VD N+  +D +   KK    + +  + F     + + ++     SA +I+ L   GI  ++N  L++  +  L      +F     +  +  N+++   N  +K E R    +  L+K PPIV IMGHVDHGKTTLLD IRK++V   E G ITQ IGAYQV+++ + ITF DTPGHEAF KMRA GA +T+I +LVVA DD +KPQT EA+ HA  A+ PIIV +NK DK + N ++I ++L+  ++L EEWGG+T  I  SAL  +G+D+LLE I++ +EI +LKA+ ++   G  +EAS+DK  G VA  +V  G L ++D ++VG  YGK++ M D N+K +K  LPS PVR++GL  +PK+GD + V  +EK     +L+  SE+++  +K      L N   NL E     KELN+ILKTD  GSLEAI G++  I V+  K+NL+R ++G++ E D+ LA +S+SL++ FN K SS +   A    I I  +NIIY+I ++IE+ LK ++ PVF E   G  E+R+++  S IG IAG  V  G +  N FA++ R D E+I   KINSL+  K++I S+  G ECG  L+NFNDF+  DI+E
  S:     2 TPDKNKNKLEVDKNKEQLDPQKNSKK----MVHKTYFFNPQDKVFQIAQSFEVSSASLIQKLLQLGIKTDVNQTLNKETIKILANTCNVEFLEKPEENNVSKNQEHKEKNPVVKKESRTKETKTNLEKIPPIVVIMGHVDHGKTTLLDAIRKTRVVDQEFGGITQHIGAYQVDYQNNKITFIDTPGHEAFGKMRARGAQITNICILVVAVDDCVKPQTIEALKHAKKAQIPIIVALNKSDKPNNNSKQIMTELSSFDLLPEEWGGQTPYIPISALKKEGLDKLLETILLLSEIQDLKADLQKKGQGAVLEASLDKSLGPVATFMVNYGNLKISDVVVVGHTYGKIRFMEDENKKPLKKVLPSQPVRVAGLKDVPKAGDLFYVVANEKEARKIILEAKSEQQENLSKALPSLDLENILQNLEEEKP--KELNIILKTDTQGSLEAICGMIEKINVSDLKVNLLRTSVGTVTEKDVILAESSQSLLIGFNVKPSSSILKLAQKQKIQIVVHNIIYRIIEDIEKRLKQMVKPVFEEVFTGQAEVRKIFHISKIGNIAGCYVTQGIVNNNDFAKVIR-DGEVIFKGKINSLKRLKENIKSSKQGYECGILLDNFNDFIINDIIE 614
>gi|33592375|ref|NP_880019.1| translation initiation factor IF-2 [Bordetella pertussis Tohama I] >gi|39931244|sp|Q7VYR2|IF2_BORPE Translation initiation factor IF-2 >gi|33572020|emb|CAE41543.1| translation initiation factor IF-2 [Bordetella pertussis Tohama I] (997 aa)
Score = 1071, Expect = 1.8e-114, Identities = 236/564 (41%), Positives = 353/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  +AE+IK L   G    +N +LD+     +  EFG+        + + FLD       E   + R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P++V +NK+DK +AN E++  +L  + V+ EE+GG    +  SA    GID+LLE +++ AEI+ELKA  +  A G+ IEA +DKG G VA +LVQSGTL   D +L G  +G+V+ M+D N K+I+TA PS PV I GL  +P +GD+ +V +DE+  +E++  RQ   +  KL     +N  +  +   +G + L +I+KTD  GS EA+   L+ +     ++ +V AA+G I+ESD++LA  S ++V+ FN +        A + GI ++ YNIIY   DE++  + G+L P   E+ IG VE+R++++ S IG +AG  VL G ++R++  R+ R +  +     ++SLR  KD +    +G +CG TL   ND   GD +E++EI
  S:   424 ISVADLAHKMSVKAAEVIKQLMKLGQMVTINQVLDQETAMIVVQEFGHTAIAAKLDDPEAFLDETA-AVTEAEAEPRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETGRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTREAIHHAKAGGVPLVVAVNKIDKPEANPERVKQELVAEEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQAEILELKAPIEAPAKGLVIEARLDKGRGPVATILVQSGTLKRGDVVLAGASFGRVRAMLDENGKQIQTAGPSIPVEIQGLTEVPAAGDELMVLSDERKAREIALFRQGKFRDVKLARQQAANLESMFDNLGEGTQTLALIVKTDVQGSQEALVSSLTKLSTDEVRVQVVHAAVGGISESDVNLAIASNAVVIGFNVRAEQSAKKLAETNGIDLRYYNIIYDAVDEVKAAMSGMLAPEKREEVIGLVEVREVYTISRIGTVAGCMVLDGVVRRDSQVRLLRNNV-VQWTGHLDSLRRFKDDVKEVKSGFDCGLTLRGNNDLQLGDQLEVFEI 990
>gi|167746755|ref|ZP_02418882.1| hypothetical protein ANACAC_01467 [Anaerostipes caccae DSM 14662] >gi|167653715|gb|EDR97844.1| hypothetical protein ANACAC_01467 [Anaerostipes caccae DSM 14662] (788 aa)
Score = 1071, Expect = 1.9e-114, Identities = 247/562 (43%), Positives = 353/562 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGIN-CNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           LT+ EF++ I+  + +IIK L + G    NLNT LD  +  E+ LE+    + E  ++    L   + E+    L  RPP+V +MGHVDHGKT+LLD IR ++V A EAG ITQ IGAY V+ +   ITF DTPGHEAF+ MR  GA  TDI +LVVAADDG+ PQT EAI+HA  A   IIV INK+DK+ ANIE++  +L E  ++ E+WGG T+    SA + +GID+LL+ I +TAE++ELKANPKR A GI IEA +DKG G VA +LVQ GTL V D I VG  +GKV+ M+D   K +KTA PSTPV I GL+ +P +G+  +  ++EK  +  +EK     +++ LS   + L+ +       +  +K+LN+I+K D  GS+EA+K  LS +      + ++   +G+I ESD+ LA  S ++++ FN +      D A    + ++ Y +IY   ++IE  +KG+L+P +VEK IG  E+RQ +  S +G IAG  +L G I+R + AR+ R D  ++      S++   D +     G ECG  LEN+ND  EGD +E Y
  S:   213 LTLKEFAEAIHIPANDIIKKLLISGGGLVNLNTELDFERAEEIALEYDRIVELEETVDVIEELLKDEDEEDTKDLVTRPPVVCVMGHVDHGKTSLLDAIRSARVTAGEAGGITQHIGAYTVQTESGTITFLDTPGHEAFTSMRMRGAQSTDIAILVVAADDGVMPQTIEAINHAKAAGVEIIVAINKIDKESANIERVKQELTEYELIPEDWGGTTIFCPVSAHSKEGIDDLLDMISLTAEVLELKANPKRKARGIVIEAELDKGRGPVATVLVQKGTLHVGDAIAVGSAHGKVRAMIDDKGKRVKTAGPSTPVEILGLSEVPFAGEVCMAMDNEKEARSTAEKFIAYGREKMLSETKSQLSLDDLFDQIQAGSVKDLNIIVKADVQGSVEAVKQSLSKLSNDEVAVKVIHGGVGAITESDVMLASASNAIIIGFNVRPDPTAKDAAERDKVDLRLYRVIYNAIEDIEAAMKGMLEPEYVEKVIGHAEVRQTFKASGVGTIAGSYILDGIIQRGSTARLIR-DGIVVHEGGFASIKRFNDDVKEVKTGFECGLVLENYNDIKEGDQIEAY 781
>gi|167040282|ref|YP_001663267.1| translation initiation factor IF-2 [Thermoanaerobacter sp. X514] >gi|166854522|gb|ABY92931.1| translation initiation factor IF-2 [Thermoanaerobacter sp. X514] (692 aa)
Score = 1071, Expect = 2.0e-114, Identities = 246/564 (43%), Positives = 357/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           LT+ E ++K+  +  EIIK L  KGI   +N  +D     ++  E+G+   KE   +E   L     +D +DL   RPPIVT+MGHVDHGKT+LLD IR + V   E G ITQ IGA  VE     I F DTPGHEAF+ MRA GA +TDIVVLVVAADDG+ PQT EAI+H   A  P+IV INK+D   AN +++ ++L+E  ++ EEWGG T+ +  SA  N GID LLE I++ AE+ +LKANP + A G  IEA ++KG+G VA ++VQ+GTL + D IL G  YGKV+ M+D   + IK A PS PV + G + +P++GDK IV  DEK  +EL+E+R       +L  KQ+  L +  + + E S  +KELN+I+K D  GS+EA+K  +  +     ++ ++  A+G+I E+D+ LA  S ++++ FN +  +   + A    + IK Y IIY+  ++I+  +KG+L+P + E E+G  E+R ++    +G +AG  VL+G+I RN+  R+ R D  ++   KI SL+  KD +     G ECG  ++ FND  EGDI+E Y++
  S:   120 LTVKELAEKMKVNPTEIIKKLIAKGIMVTVNQQIDFENAAKIAEEYGFLVDKEEVKDELEMLLEETPDDEKDL-QPRPPIVTVMGHVDHGKTSLLDAIRNTNVTMKEMGGITQHIGASVVEINDKKIVFLDTPGHEAFTAMRARGASITDIVVLVVAADDGVMPQTVEAINHVKAANVPMIVAINKIDLPTANPDRVKTELSELGLVPEEWGGNTICVPVSAKKNIGIDNLLEMILLVAEMEDLKANPNKPARGTIIEAKLEKGKGPVATVIVQNGTLQIGDAILAGTVYGKVRAMLDDKGRRIKKAGPSMPVEVLGFSEVPEAGDKLIVVEDEKKARELAERRKELQKEMELKRKQKVSLEDLFSQIQEGS--VKELNIIIKADVQGSVEALKKSIEDLSNEEVRIKVIHGAVGAITETDVMLASASNAIIIGFNVRPETNAKNLAEKEKVDIKLYRIIYEAIEDIKAAMKGLLEPKYKEVELGRAEVRAVFRVPGVGNVAGCYVLSGKILRNSDIRVVR-DGIVVYEGKIASLKRFKDDVREVQQGFECGIGIDRFNDIKEGDIIEAYQM 687
>gi|37522221|ref|NP_925598.1| translation initiation factor IF-2 [Gloeobacter violaceus PCC 7421] >gi|39931206|sp|Q7NH85|IF2_GLOVI Translation initiation factor IF-2 >gi|35213221|dbj|BAC90593.1| translation initiation factor IF-2 [Gloeobacter violaceus PCC 7421] (925 aa)
Score = 1071, Expect = 2.0e-114, Identities = 232/574 (40%), Positives = 365/574 (63%)
  Q:    44 VFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHL----ITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEI-MELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-----------QLNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + + + N+++ + +++++  + EIIK LF+K +  N+N  LD+     +  E GY+ + E  + +    + +   D E L + RPP+VTIMGHVDHGKT+LLD IR ++VA  EAG ITQ IGAYQ+E         + F DTPGHEAF+ MRA GA +TDI VLVVAADDG+KPQT EAI HA  A  PI+V INK+DK DAN E++  +L E +++ EEWGGKT+++  SA     +D LLE +++ A+  +EL ANP R A G  IEA++DK  G VA  LVQ+GTL V D I+VG  +GKV+ + D     +  A PS PV + GL  +P++GD++ V +DE+  + ++++R           Q+ +++  L  F     E    +KEL +I++ D  GS+EAI+  L  +     +L +++AA G ++E+DIDLA  S ++++ F+T ++S     A   G+ ++ Y++IY++ ++I+  ++G+LDP  VE+ +G  E+RQ++     G +AG  V  G++ RNA  R+ R+ KE++    ++SL+  K+     A G ECG   + F  +  GD++E + +V +
  S:   336 ILLLSGNISVQDLAQRMHVPTTEIIKTLFMKSVMVNINQTLDQATAELVARELGYEVQAETAVAQATKTEMLDVGDIESL-EVRPPVVTIMGHVDHGKTSLLDAIRSARVAEGEAGGITQHIGAYQIEVPTEAGPRKLVFLDTPGHEAFTAMRARGAKVTDITVLVVAADDGVKPQTIEAISHAKAAGVPILVAINKVDKPDANPERVKQELTEYDLVPEEWGGKTVMVPVSAKQKLNLDLLLENLLLVADYELELMANPNRQAKGTIIEANLDKARGPVATALVQNGTLHVGDIIVVGSIFGKVRALYDDRGNRVDAAPPSMPVEVLGLTDVPQAGDEFEVYSDEREARRIADERTSKARENRLQQQMASRRVSLGAFSAQAQEGE--LKELALIIRADVQGSVEAIRASLEKLPQDKVQLRVLQAAAGEVSETDIDLAAASNAVILSFSTTLASGARQAAEQAGVDVREYDVIYKLLEDIQLAMEGLLDPELVEEALGGAEVRQVFPVGK-GQVAGCYVKEGKLLRNAQMRV-RRGKEVVFEGHVDSLKRFKEDAKEVATGFECGVGSDKFASWQPGDLIECFRMVTQ 920
>gi|85712990|ref|ZP_01044028.1| translation initiation factor IF-2 [Idiomarina baltica OS145] >gi|85693159|gb|EAQ31119.1| translation initiation factor IF-2 [Idiomarina baltica OS145] (896 aa)
Score = 1071, Expect = 2.0e-114, Identities = 236/565 (41%), Positives = 359/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRP--PIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ-------LNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +T+ E + ++   ++++IK +   G    +N +LD+     +  E G+    +  + +DN L+     DR +  ++ P  P+VT+MGHVDHGKT+LLD IRK+KVA+ EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TD+V+LVVAADDG+ PQT+EA+ HA  A  PI+V INKMDK++A+ +++ ++LA+ +V+ E+WGG  M I  SA +  GIDELLE I++ +E+++LKA    +A+GI +E+ +D+G G VA +LVQ G L   D +L G  YG+++ M D   K+IK A PS PV I GL+G+P++GD+  V  DE+  +E++  RQ       L  +Q+ KL N   N+ E    + ELN++LK+D  GSLEAI   L  +     K+N++ + +G I E+DI LA  S ++VV FN +  +          + ++ Y++IY + DE+++ + G+L P F ++ IG  E+R ++    +G IAG  V  G +KR+A  R+ R D  +I   ++ SLR  KD +     G ECG  ++N+ND  EGD +E++E V
  S:   323 ITVGELASRMAVKASDLIKTMMKMGEMVTINQILDQETAALVVEELGH----KAVVVKDNALEEEVLSDRSEGGEEEPRAPVVTVMGHVDHGKTSLLDHIRKAKVASGEAGGITQHIGAYHVETDHGMITFLDTPGHAAFTSMRARGAGATDVVILVVAADDGVMPQTKEAVQHAKAAGVPIVVAINKMDKEEADPDRVKNELAQLDVIPEDWGGDVMFIPVSAHSGMGIDELLEGILLQSEVLDLKAEKTGMASGIVVESRLDRGRGPVATVLVQRGLLRQGDIVLCGLEYGRIRAMRDETGKDIKEAGPSIPVEILGLSGVPQAGDEATVVKDERKAREVANYRQGKYREVKLAKQQKAKLENMFANMAEGD--VSELNIVLKSDVQGSLEAISDALVKLSTDEVKVNIIGSGVGGITETDISLASASNAIVVGFNVRAEAAAKKLVEQENVDLRYYSVIYDLIDEVKQAMTGMLRPEFKQQIIGLAEVRDVFKSPKLGAIAGCMVTEGIVKRSAPIRVLR-DNVVIYEGELESLRRFKDDVQEVRNGMECGIGVKNYNDVKEGDQIEVFETV 890
>gi|163752373|ref|ZP_02159568.1| translation initiation factor IF-2 [Shewanella benthica KT99] >gi|161327745|gb|EDP98932.1| translation initiation factor IF-2 [Shewanella benthica KT99] (892 aa)
Score = 1070, Expect = 2.2e-114, Identities = 243/565 (43%), Positives = 356/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLD--KRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ-------LNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +++ E ++K+   + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L++    DR+  ++   R P+VTIMGHVDHGKT+LLD IR +KVAA EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA   K P+IV +NKMDK DA+ E++ S+L++  ++ E+WGG  M +  SA   QGIDELLEAI++ AE++ELKA    +A G+ IE+ +DKG G VA +LVQ GTL   D +L G  YGKV+ M D N + IK A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ       L  +Q+ KL N   N+ E    ++ELN++LK D  GSLEAI   L+ +     K+N++   +G + E+D  LA  S ++++ FN +  ++      S  + ++ Y++IY + DE+   + G+L P F +  IG  E+R ++    IG IAG  V+ G IK++A  R+ R++  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E +
  S:   317 VSVSELAQKMAVKATEIIKTMMKMGSMVTINQVLDQETAQLVAEEMGH----KVTLTRENELEHQVLADRDGNVEAVSRAPVVTIMGHVDHGKTSLLDYIRNAKVAAGEAGGITQHIGAYHVETANGMITFLDTPGHAAFTAMRARGAKATDIVILVVAADDGVMPQTIEAIQHAKAGKVPLIVAVNKMDKPDADAERVKSELSQHGIMSEDWGGNNMFVSVSAKTGQGIDELLEAILLEAEVLELKAIKDCMAAGVVIESKLDKGRGPVATVLVQEGTLKQGDIVLCGLEYGKVRAMRDENGQTIKEAGPSFPVEILGLSGVPAAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKAKLENMFANMTEGV--VEELNIVLKADVQGSLEAIADSLNKLSTDEVKVNIIARGVGGLTETDATLASASNAIMIGFNIRADAQARRVIDSENVDLRYYSVIYNLIDEVRDAMSGLLAPEFKQVIIGLAEVRDVFKSPKIGSIAGCMVIEGTIKKSAPIRVLRENI-VIYEGELESLRRFKDDVADVRNGMECGIGVKNYNDVRVGDQIEVFETI 884
>gi|187932649|ref|YP_001885471.1| translation initiation factor IF-2 [Clostridium botulinum B str. Eklund 17B] >gi|187720802|gb|ACD22023.1| translation initiation factor IF-2 [Clostridium botulinum B str. Eklund 17B] (687 aa)
Score = 1070, Expect = 2.2e-114, Identities = 241/562 (42%), Positives = 368/562 (65%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDR-EDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +T+ E ++K+NK S ++I+ L   G+   +N  +D     ++C  +G   +K +++ E+  L+ ++ ED  E+ L KRPPIVT+MGHVDHGKT+LLD IRK+KV  TEAG ITQ IGAY +      ITF DTPGHEAF+ MRA GA +TD+V+LVVAADDG+ PQT+EAI+H   A  P++V INK+DK  AN +++  +L E  ++ EEWGG T+  + SA +N  I++LLE +++TAE++ELKAN +R A G  IEA +DKG G+VA LLVQ+GTL V D I+VG  YG+++ M D   K+IK+A PS PV + GL+ +P++GD++    DEK  + +++KR+        ++  +  L +  + + E    +KEL +I+K D  GS++AI   L  +     K+ ++ + +G+I E+DI LA  S ++V+ FN +  +     A    + IK Y IIY   ++++  + G+L+P + E  +GS E+R+ +  S++G IAG  VL G+++RNA  R+ R D  +I  + ++SL+  KD +     G ECG T+E FND  EGDI+E +
  S:   113 ITVKELAEKLNKPSNDVIRTLIFSGVMAAINQEIDFATAEKVCESYGVILEK-LEVTEE--LEAVEAEDDDEENLTKRPPIVTVMGHVDHGKTSLLDAIRKAKVTDTEAGGITQHIGAYTININGEEITFLDTPGHEAFTAMRARGAQVTDVVILVVAADDGIMPQTKEAINHCKAAGVPMVVAINKIDKPGANPDRVKQELTEHGLVVEEWGGDTICEEVSAKSNLNIEKLLEMVLLTAEMLELKANKERKAKGTVIEAKLDKGRGSVATLLVQNGTLHVGDAIIVGSTYGRIRAMFDDTGKKIKSAGPSIPVEVLGLSEVPEAGDRFNQVKDEKTARIMADKRKDKEKSDSLMSGNRVSLEDLYSQIKEGK--VKELGIIVKADVQGSVQAINQSLEKLSTDDVKVRVIHSGVGAITETDITLATASNAIVIGFNVRPDNNAVAQADKENVEIKTYRIIYDAIEDVKSAMIGMLEPEYKEVILGSAEVRETYKISNVGTIAGCYVLNGKLQRNAETRVIR-DGIVIFESNLSSLKRFKDDVKEVNTGYECGLTVEKFNDVKEGDILECF 677
>gi|167902929|ref|ZP_02490134.1| translation initiation factor IF-2 [Burkholderia pseudomallei NCTC 13177] (761 aa)
Score = 1070, Expect = 2.3e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:   187 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 754
>gi|120597900|ref|YP_962474.1| translation initiation factor IF-2 [Shewanella sp. W3-18-1] >gi|124549938|ref|ZP_01707897.1| translation initiation factor IF-2 [Shewanella putrefaciens 200] >gi|146293928|ref|YP_001184352.1| translation initiation factor IF-2 [Shewanella putrefaciens CN-32] >gi|166198929|sp|A4Y9C0|IF2_SHEPC Translation initiation factor IF-2 >gi|166198931|sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 >gi|120557993|gb|ABM23920.1| translation initiation factor IF-2 [Shewanella sp. W3-18-1] >gi|124507644|gb|EAY51769.1| translation initiation factor IF-2 [Shewanella putrefaciens 200] >gi|145565618|gb|ABP76553.1| translation initiation factor IF-2 [Shewanella putrefaciens CN-32] (880 aa)
Score = 1070, Expect = 2.4e-114, Identities = 240/565 (42%), Positives = 354/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED----LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +T+ E +  +   + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L++   +DR+D     L+ R P+VTIMGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE +  +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA     P+IV +NKMDK +A+I+++ S+L++  V+ E+WGG  M    SA   +G+D+LLE I++ AE++ELKA    +A G+ IE+ +DKG G VA +LVQ GTL   D +L G  YGK++ M D N + I  A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ           ++ KL N   N+ +    +KELN++LK D  GSLEAI   L+ +     K+N++   +G++ E+D  LA  S +++V FN +  ++      S  + ++ Y++IY + DE++  + G+L P F ++ IG  E+R ++    +G IAG  V  G IKR+A  R+ R D  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E V
  S:   305 VTVSELAHLMAVKATEIIKQMMKMGSMVTINQVLDQETAQLVAEEMGH----KVVLIRENELEHQVLQDRDDEDGIKLESRAPVVTIMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTAMRARGAKATDIVVLVVAADDGVMPQTIEAIQHAKAGNVPLIVAVNKMDKPEADIDRVKSELSQHGVMSEDWGGDNMFAFVSAKTGEGVDDLLEGILLQAEVLELKAVRDGMAAGVVIESQLDKGRGPVATILVQEGTLRQGDIVLCGLEYGKIRAMKDENGRSITEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKSKLENMFANMTDGE--VKELNIVLKADVQGSLEAITDSLTGLSTDEVKVNIIARGVGALTETDATLAAASNAIMVGFNVRADAQARKVIESESVDLRYYSVIYNLIDEVKAAMTGMLSPEFKQQIIGLAEVRDVFKSPKLGAIAGCMVTEGTIKRSAPIRVLR-DNVVIFEGELESLRRFKDDVAEVRNGMECGIGVKNYNDVRVGDQIEVFETV 874
>gi|73748750|ref|YP_307989.1| translation initiation factor IF-2 [Dehalococcoides sp. CBDB1] >gi|147669516|ref|YP_001214334.1| translation initiation factor IF-2 [Dehalococcoides sp. BAV1] >gi|189028314|sp|A5FQR6|IF2_DEHSB Translation initiation factor IF-2 >gi|90101358|sp|Q3ZXU3|IF2_DEHSC Translation initiation factor IF-2 >gi|73660466|emb|CAI83073.1| translation initiation factor IF-2 [Dehalococcoides sp. CBDB1] >gi|146270464|gb|ABQ17456.1| bacterial translation initiation factor 2 (bIF-2) [Dehalococcoides sp. BAV1] (593 aa)
Score = 1070, Expect = 2.5e-114, Identities = 241/562 (42%), Positives = 354/562 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +++ E +  +  +  E+IK L  KGI  N+N ++D      +    G++ K +I + +         +++      RPP+VTIMGHVDHGKT LLD IR + V   E G ITQ IGAYQVE K H ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EA+DHA  A  PII+ INKMDK +AN +++  QLAE  ++ EEWGG T+ I  SA  N+GI+ELLEA+++ AE+ +L+A+P + A+G+ IEA MDK +G +A +LVQSGTL + D ++ G  +G+VK M +   K IK A PSTPV + G+  +P+ GDK I    EK  +++  +   +T++    +     ++ SQG IKELN+ILKTD  GSLE IK  L  +     K+N+ R+  G++ ESD+ LA  S  L++ F+T + +     A +  I I++Y+IIY++ +++++ L+G+L+P   E   G  E+R ++  +    IAG  VL G++ +N+  R+ R   E+I +A  NSLR  K+ +    AG ECG  L++FN+F + DI+E Y
  S:    27 VSVKELADSLETNPVEVIKALMRKGIMANINQVIDFDIAKGVIEAAGFEAKLKI-LKKSAAKKASPAKEKLSNFPLRPPVVTIMGHVDHGKTRLLDAIRSTNVMEKEVGGITQHIGAYQVEIKGHKITFLDTPGHEAFTAMRARGAQATDITILVVAADDGVMPQTLEALDHAKAAGVPIILAINKMDKPEANPDRVKQQLAEVGLVVEEWGGDTLAIPTSARENKGINELLEAVLLIAELEDLRADPNQPASGVVIEAEMDKTKGPMATVLVQSGTLKLGDTVVAGNTWGRVKAMFNDVGKRIKKAEPSTPVALLGMESVPQVGDKIIAVATEKQARDMVNENSQSTRKTNAVSLTNVYDQVSQGNIKELNIILKTDVQGSLEPIKDSLEKLSTDKIKININRSGAGNVTESDVMLAMASGGLIIGFSTGIETNAQRLADAEDIDIRHYDIIYKLIEDVDKALQGLLEPTIKEVIDGRAEVRAVFESTKKLSIAGCMVLEGKLVKNSQVRLLR-GGEVIVDAPSNSLRRFKEDVKEVVAGYECGVGLKDFNEFQKSDILEFY 587
>gi|196480320|gb|ACG79848.1| translation initiation factor IF-2 [Phenylobacterium zucineum HLK1] (994 aa)
Score = 1070, Expect = 2.5e-114, Identities = 227/569 (39%), Positives = 352/569 (61%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQIN-EDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK-HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQR--------KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V  + +T+ E + ++     E+IK+L  +G+   +N ++D      +  EFG+  K+  + + E+ F   I  ED +D L  RPP+V +MGHVDHGKT+LLD +R + V + E G ITQ IGAYQV       +TF DTPGH AFS MR  GA++TDIV+LVVAADDG+ PQT EAI HA  A APIIV INK+DK DA+  ++ ++L +  ++ E  GG+T  ++ SA    G+D+L+E I++ AE+++LKANP R A+G  IEA +DKG GAVA +LV+ GTL   D ++ G  +G+V+ +++   ++++ A PSTPV I GL+G P  G+ + V  +E   +EL+E RQ   +++         L++    L +  + + EL VI+K D  GS EAI G L  +     +  ++ +  G+INESD+ LA+ + + ++ FN + S +  D A   G+ I+ Y IIY + D+I+ +L G+L P+  E  +G+ E+ Q +  + +G +AG RV  G +++ A  RI R+D  I+    + +L+  KD +    AG+ECG   E F D   GD++E + +
  S:   414 VIPDVITVGELANRMATRGVEVIKFLMRQGVMLKINDVIDNDTAELVATEFGHTVKRVSEADVEEGF---IGAEDVDDHLLPRPPVVAVMGHVDHGKTSLLDALRSTDVVSGEHGGITQHIGAYQVRLADGQRVTFLDTPGHAAFSAMRMRGANVTDIVILVVAADDGVMPQTVEAIQHAKAAGAPIIVAINKIDKPDADPTRVINELLQHEIVVESLGGETQAVEVSATQKMGLDDLIENILLQAEVLDLKANPDRTADGSVIEAKLDKGRGAVATVLVKRGTLKRGDIVVAGSSWGRVRALLNERGEQLQEATPSTPVEILGLDGTPDPGEPFAVVENEARARELTEYRQRVKREKAGAPVASASLADMMAKLAD--KKVSELPVIIKADVQGSAEAIVGSLDKLATDEVRARIILSGAGAINESDVLLAKGAGAPILGFNVRASKQARDLAEREGVEIRYYAIIYDLIDDIKGVLSGMLAPIQRETFLGNAEVLQAFDITKVGRVAGCRVTEGVVRKGARVRIVREDVVILELGVLKTLKRFKDEVNEVQAGQECGMAFEGFQDIKAGDVIECFNL 987
>gi|114329056|ref|YP_746213.1| translation initiation factor IF-2 [Granulibacter bethesdensis CGDNIH1] >gi|122325998|sp|Q0BPG2|IF2_GRABC Translation initiation factor IF-2 >gi|114317230|gb|ABI63290.1| bacterial Protein Translation Initiation Factor 2 (IF-2) [Granulibacter bethesdensis CGDNIH1] (915 aa)
Score = 1070, Expect = 2.6e-114, Identities = 227/568 (39%), Positives = 348/568 (61%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEW-KKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQGI--------KELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYE 613
           V    + + E + ++   +A++IK L   G+   +   +D      +  EFG+  ++  + + +  L+ I   D +  L  RPP+VT+MGHVDHGKT+LLD +R + VAA EAG ITQ IGAYQV    +  +TF DTPGHEAF+ MR+ GA +TDIVVLVVAADDG+ PQT EAI HA  A APIIV INK DK  AN  ++  +L    ++ E+ GG T  ++ SAL  Q +D+L EAI++ AE+++LKANP R A G  +E+ +D+G G VA +LVQ GTL   D ++ G  +G+V+ M+D   +++K ALPSTPV I GL G+P +G+ ++   +E   +E+SE RQ   +++  +          Q +        KE+ V++K D  GS EAI   +   E    K+  + +++G I+ESD+ LA+ S ++++ FN + +++  + A   G+ I+ Y+IIY++ D+IE L++G + P   EK +G  EIR+++  + +G +AG  V  G +KR    R+ R D  +I   +++ L+  KD +   A   ECG +   +ND  EGD+VE YE
  S:   336 VLPETIAVGELANRMAVRAADVIKQLMRMGMMATVTQTIDADTAELVVQEFGHRVRRVSESDVEVGLEGI--SDIDSDLQPRPPVVTVMGHVDHGKTSLLDALRATDVAAGEAGGITQHIGAYQVTLPSRQKLTFLDTPGHEAFTAMRSRGASVTDIVVLVVAADDGVMPQTIEAIKHAKAANAPIIVAINKCDKPGANPGRVRQELLHHEIVVEDMGGDTQDVEVSALKRQNLDKLEEAILLQAEVLDLKANPDRAAEGTVVESRLDRGRGPVATVLVQKGTLRQGDIVVAGAEWGRVRAMLDDKGQQMKEALPSTPVEILGLAGVPSAGEPFVAVENESRAREISEFRQRKIREKMAAGIAAGRGTLEQMLSRIQAGAQKEVAVVIKADVQGSAEAIATTVQKQEHEEVKVRTLLSSVGQISESDVQLAKASNAVLIAFNVRATNQARELAQREGVDIRYYSIIYEVADDIEALVRGKIAPKQREKFLGYAEIRKVFEITKVGKVAGCMVTEGVVKRGCGVRLLR-DNVVIHTGELSQLKRFKDDVKEVARNYECGLSFAGYNDIKEGDVVECYE 909
>gi|152993550|ref|YP_001359271.1| translation initiation factor IF-2 [Sulfurovum sp. NBC37-1] >gi|166198939|sp|A6QBQ5|IF2_SULNB Translation initiation factor IF-2 >gi|151425411|dbj|BAF72914.1| translation initiation factor IF-2 [Sulfurovum sp. NBC37-1] (906 aa)
Score = 1069, Expect = 2.8e-114, Identities = 243/568 (42%), Positives = 367/568 (64%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL-LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-NFGTNLNENSQGI-----KELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI-FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           N+ + EF++K+N+   E++K LF  G+    N  L + ++  L  EFG +      ++E +++    +++ ED  L++RPP++TIMGHVDHGKT+LLD IR +KVA  EAG ITQ +GAYQVE     ITF DTPGHEAF++MRA GA  TDIV++VVAADDG+ PQT+EAI H   A  P+I+ +NKMDK+ AN + I SQLAE +V+  +WGG+   +  SA    GID+LLE I++ AE+MELKA+P R A  + +E+S++KG G VA++++++GTL V D ++VG  YG++K +   +   +K   PSTP  I GLN +P +G+  +  + +K ++EL+EKR    + ++LS +   +L++ S  I     K L VI+K D  GSLEAIKG L  +     K+N++   +G + ESD+ LA  S+  V++ FN + +  V   A  +G+ ++ Y IIY + D+++ LL G++ PV  E+  G  E+R+ +    +G IAG +V  G I RN+ AR+ R D  ++  +KI+SL+   +       G ECG  LENFND  EGD++E ++ V E
  S:   330 NVRVYEFAEKVNRSVGEVVKVLFALGMMVTKNDFLSKDEIEILAEEFGVEVSTMNPLDELDYVQ--AYDEVEDTHLEERPPVITIMGHVDHGKTSLLDKIRSAKVADKEAGGITQHVGAYQVEKNGKKITFVDTPGHEAFTEMRARGAQATDIVIIVVAADDGVMPQTKEAIAHTKAAGVPMIIAMNKMDKESANPDNIKSQLAEIDVMAADWGGEYEFVPVSAHTGLGIDDLLETILLQAEMMELKADPTRKAKAVVVESSVEKGFGPVANVIIKNGTLHVGDNVIVGTTYGRIKAIKLDDGSAVKEIGPSTPAAIVGLNEVPGAGEALVAMDTDKEVRELAEKRAEYDRAKQLSKSTKASLDDLSALIAEGQLKSLPVIIKADVQGSLEAIKGSLEKLRNEEVKVNIIHEGVGGVTESDVTLADASEHAVILGFNVRPTGSVKKKAKELGVEVRTYTIIYDLLDDVKALLGGMMSPVIKEEVTGQAEVRETFVVGKVGTIAGCKVSDGVITRNSKARLIR-DGVVVYESKISSLKRFNEDAREVKNGYECGIMLENFNDIKEGDVIETFKDVEE 902
>gi|158334116|ref|YP_001515288.1| translation initiation factor IF-2 [Acaryochloris marina MBIC11017] >gi|158304357|gb|ABW25974.1| translation initiation factor IF-2 [Acaryochloris marina MBIC11017] (973 aa)
Score = 1069, Expect = 3.0e-114, Identities = 238/550 (43%), Positives = 365/550 (66%)
  Q:    66 EIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDL--LDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKK----HLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR---QLNTK-QRKLSNFGTNLNENSQG-----IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           E+IK LF+KGI  N+N +LD      +  E   D + E Q  E       +  D EDL  L  RPP+VTIMGHVDHGKTTLLD IR++KVA  EAG ITQ IGAY V+         + F DTPGHEAF+ MRA G  +TDI +LVVAADDG++PQT EAI HA  A+ PIIV INK+DK+ A ++++  +L+E N++ E+WGG+T+++  SAL  + +D LLE +++ AE+ +L+ANP R A G  IEA +DK +G VA LLVQ+GTL V D ++ G  +GKV+ MVD     ++TA PS  V + G++ +P +G+++ V  DEK  +  + +R   Q +T+ Q+ +++   +LN  S+      +KELN+I+K D  GSLEA+ G L+ +     ++ ++ +A G I+E+D+DLA  S ++++ FNT ++S     A   G+ I+ Y+IIY++ ++IE  ++G+L+P FVE+++G  E+R ++     G IAG  + +G++ RN   RI+R + +++    ++SL+  KD +    +G ECG  ++NF+ + EGD +E Y++V
  S:   403 EVIKILFMKGIAANINQVLDIETATMVAEEL--DCEVETQEEESEARKVSEMLDVEDLEKLQARPPVVTIMGHVDHGKTTLLDAIRETKVAQGEAGGITQHIGAYHVDLPHEDGIQQVVFLDTPGHEAFTAMRARGTRVTDIAILVVAADDGVRPQTLEAISHARAAEVPIIVAINKIDKEGAQLDRVRQELSEHNLVPEDWGGETVMVPVSALKGENLDTLLEMVLLVAEVEDLQANPDRPAKGTVIEAHLDKAKGPVASLLVQNGTLRVGDVLVAGSVFGKVRAMVDDRGARVETASPSFAVEVLGMSEVPAAGEEFEVFVDEKEARSQAGQRTDQQRHTRLQQAMASRRVSLNALSEQAREGELKELNLIIKADVQGSLEALLGSLAQLPQNEVQVRVLLSAPGEISETDVDLASASGAVIIGFNTSLASGARQAADQAGVDIREYDIIYKLLEDIEGAMEGLLEPEFVEEDLGEAEVRAVFPVGR-GAIAGCYIQSGKLVRNCRIRIQRGN-DVVFEGILDSLKRMKDDVREVNSGYECGVGVDNFSGWTEGDRIEAYQMV 963
>gi|153855235|ref|ZP_01996401.1| hypothetical protein DORLON_02415 [Dorea longicatena DSM 13814] >gi|149752234|gb|EDM62165.1| hypothetical protein DORLON_02415 [Dorea longicatena DSM 13814] (847 aa)
Score = 1069, Expect = 3.2e-114, Identities = 247/565 (43%), Positives = 351/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEK-------RQLNTKQRKLS--NFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           LTI E + K+    + IIK LF++G    +N  +D     E+ LEF    +KE ++ +       + E+ E  + KRPP+V +MGHVDHGKT+LLD IR + V   EAG ITQ IGAY VE     ITF DTPGHEAF+ MR  GA  TDI VLVVAADDG+ PQT EAI+HA  A   IIV +NKMDK  ANI+++  +L E  ++ E+WGG T+ +  SA   +G+++L+E I +TAE+MELKANP R A G+ +EA +DKG G+VA++LVQ GTL V D I  G  +GKV+ M+D   + +K A PSTPV I GLN +P +G+  +   +EK  +  +E        + L   + KLS  +  T + E +  +KEL +++K D  GS+EAIK  L  +      + ++   +G+INESD+ LA  S ++++ FN +  +   + A   G+ I+ Y +IY   +++E  +KG+LDPVF EK +G  E+RQ +  S +G IAG  VL G  +R+   R+ R D  +I    + SL+  KD +    AG ECGF   NFND  EGD+VE +++V
  S:   274 LTIKELADKMKIVPSVIIKKLFMQGKVATVNQEIDYETAEEIALEFDVLCEKE-EVVDVIEELLKEEEEDEKKMKKRPPVVCVMGHVDHGKTSLLDAIRHTNVIDREAGGITQHIGAYVVEINGEKITFLDTPGHEAFTAMRMRGASSTDIAVLVVAADDGVMPQTVEAINHAKAAGVEIIVAVNKMDKPSANIDRVKQELTEYELIPEDWGGSTIFVPVSAKTGEGLEDLMEMIALTAEVMELKANPNRRARGLVLEAKLDKGRGSVANILVQKGTLRVGDPIAAGSAFGKVRAMMDDKGRRVKEAGPSTPVEILGLNDVPNAGEVIVGCGNEKEARNFAETFISQSKVKLLEETKSKLSLDDLFTQIQEGN--LKELGIVVKADVQGSVEAIKQSLLKLSNDEVVVKIIHGGVGAINESDVSLASASNAIIIGFNVRPDATAKETADREGVDIRLYRVIYNAIEDVEAAMKGMLDPVFEEKVLGHAEVRQTFKASGVGTIAGSYVLDGVFERDCSVRLTR-DGIVIFEGPLASLKRFKDDVKEVKAGYECGFVFANFNDIKEGDLVEAFKMV 843
>gi|163812294|ref|ZP_02203969.1| translation initiation factor IF-2 [Dehalococcoides sp. VS] >gi|157404035|gb|EDO70080.1| translation initiation factor IF-2 [Dehalococcoides sp. VS] (593 aa)
Score = 1069, Expect = 3.5e-114, Identities = 242/562 (43%), Positives = 353/562 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +++ E +  ++ +  E+IK L  KGI  N+N ++D      +    G++ K +I + +         +++      RPP+VTIMGHVDHGKT LLD IR + V   EAG ITQ IGAYQVE K   ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EA+DHA  A  PII+ INKMDK +AN +++  QLAE  ++ EEWGG T+ I  SA   +GI+ELLEA+++ AE+ +L+A+P + ANG+ IEA MDK +G +A +LVQSGTL + D ++ G  +G+VK M +   K IK A PSTPV + G+  +P+ GDK I    EK  +++  +     ++    +     ++ S+G IKELN+ILKTD  GSLE IK  L  +     K+N+ R+ +G+I ESD+ LA  S  L++ F+T + +     A +  I I++Y+IIY++ +++E+ L+G+L+P   E   G  E+R ++  +    IAG  VL G++ +N+  R+ R   E+I +A  NSLR  KD +    AG ECG  L++FN+F + DI+E Y
  S:    27 VSVKELADSLDTNPVEVIKALMRKGIMANINQVIDFEVAKGIVEAAGFEAKLKI-LKKSAAKKVSPAKEKLSNFPLRPPVVTIMGHVDHGKTRLLDAIRSTNVMEKEAGGITQHIGAYQVEIKGQKITFLDTPGHEAFTAMRARGAQATDITILVVAADDGVMPQTLEALDHAKAAGVPIILAINKMDKPEANPDRVKQQLAEAGLVVEEWGGDTLAIPTSAREKKGINELLEAVLLIAELEDLRADPNQPANGVVIEAEMDKTKGPMATVLVQSGTLKLGDTVVAGNTWGRVKAMFNDVGKRIKKAEPSTPVALLGMENVPQVGDKIIAVATEKQARDMVNENSQVIRKINAVSLTNVYDQVSKGNIKELNIILKTDVQGSLEPIKDSLEKLGTDKIKININRSGVGNITESDVMLAMASGGLIIGFSTGIETNAQRLADAEDIDIRHYDIIYKLVEDVEKALQGLLEPTLKEVIDGRAEVRAVFESTKKLSIAGCMVLEGKLTKNSQVRLLR-GGEVIVDAPSNSLRRFKDDVKEVVAGYECGVGLKDFNEFQKSDILEFY 587
>gi|163857445|ref|YP_001631743.1| translation initiation factor IF-2 [Bordetella petrii DSM 12804] >gi|163261173|emb|CAP43475.1| translation initiation factor IF-2 [Bordetella petrii] (991 aa)
Score = 1068, Expect = 3.6e-114, Identities = 236/564 (41%), Positives = 347/564 (61%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  +AE+IK L   G    +N +LD+     +  E G+        + + FLD        + L  R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P++V +NK+DK +AN E++  +L  + V+ EE+GG    +  SA    GID+LLE +++ AEI+EL A  +  A G+ IEA +DKG G VA +LVQSGTL   D +L G  +G+V+ MVD N K+I+ A PS PV I GL  +P +GD+ I   DE+  +E++  RQ   +  KL     +   +  +   +G + L +I+KTD  GS EA+   L+ +     ++ +V AA+G I+ESDI+LA  S ++V+ FN +        A S GI ++ YNIIY   DE++  + G+L P   E+ IG VE+R+++S S IG +AG  VL G ++R++  R+ R +  +     ++SLR  KD +    +G +CG TL   ND   GD +E++EI
  S:   418 ISVADLAHKMSVKAAEVIKQLMKLGQMVTINQVLDQETAMIVVEELGHVAIAAKLDDPEAFLDETPVASEAEAL-PRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETARGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTREAIHHAKAGGVPLVVAVNKIDKPEANPERVKQELVAEEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQAEILELTAPVEAPAKGLVIEARLDKGRGPVATILVQSGTLKRGDVVLAGASFGRVRAMVDENGKQIQEAGPSIPVEIQGLTEVPAAGDELIALADERKAREIALFRQGKFRDVKLARQQAAKLESMFDNLGEGTQTLPLIVKTDVQGSQEALVASLTKLSTDEVRVQVVHAAVGGISESDINLAIASNAVVIGFNVRAEQSAKKLAESNGIDVRYYNIIYDAVDEVKAAMSGMLAPEKKEEVIGLVEVREVYSISRIGNVAGCMVLDGLVRRDSQIRLLRNNV-VHWTGHLDSLRRFKDDVKEVKSGFDCGLTLRGSNDIQVGDQLEVFEI 984
>gi|53724825|ref|YP_102760.1| translation initiation factor IF-2 [Burkholderia mallei ATCC 23344] >gi|121599362|ref|YP_992837.1| translation initiation factor IF-2 [Burkholderia mallei SAVP1] >gi|124385783|ref|YP_001026180.1| translation initiation factor IF-2 [Burkholderia mallei NCTC 10229] >gi|126450786|ref|YP_001080550.1| translation initiation factor IF-2 [Burkholderia mallei NCTC 10247] >gi|194525295|ref|YP_002060825.1| translation initiation factor IF-2 [Burkholderia mallei FMH] >gi|194575279|ref|YP_002110163.1| translation initiation factor IF-2 [Burkholderia mallei 2002721280] >gi|166226254|sp|A3MJW4|IF2_BURM7 Translation initiation factor IF-2 >gi|166226255|sp|A2S2L1|IF2_BURM9 Translation initiation factor IF-2 >gi|166226256|sp|A1V3N4|IF2_BURMS Translation initiation factor IF-2 >gi|81824031|sp|Q62KK9|IF2_BURMA Translation initiation factor IF-2 >gi|52428248|gb|AAU48841.1| translation initiation factor IF-2 [Burkholderia mallei ATCC 23344] >gi|121228172|gb|ABM50690.1| translation initiation factor IF-2 [Burkholderia mallei SAVP1] >gi|124293803|gb|ABN03072.1| translation initiation factor IF-2 [Burkholderia mallei NCTC 10229] >gi|126243656|gb|ABO06749.1| translation initiation factor IF-2 [Burkholderia mallei NCTC 10247] >gi|147749305|gb|EDK56379.1| translation initiation factor IF-2 [Burkholderia mallei FMH] >gi|148027531|gb|EDK85552.1| translation initiation factor IF-2 [Burkholderia mallei 2002721280] (975 aa)
Score = 1068, Expect = 3.6e-114, Identities = 238/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +GD+ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:   401 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGDEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 968
>gi|108759767|ref|YP_630297.1| translation initiation factor IF-2 [Myxococcus xanthus DK 1622] >gi|123374694|sp|Q1DAM6|IF2_MYXXD Translation initiation factor IF-2 >gi|108463647|gb|ABF88832.1| translation initiation factor IF-2 [Myxococcus xanthus DK 1622] (1072 aa)
Score = 1068, Expect = 3.7e-114, Identities = 237/608 (38%), Positives = 364/608 (59%)
  Q:     8 NVKTKSKNKNKKIVDNRTNIDIKSQFKK----------VETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN-------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + ++ SK +   +V  R  I I+ + +K           +   +  V      +++ +  +++   SAE+IK L   G     N L+D      +  ++G+   + +    +++L  +  E R +    RPP+V IMGHVDHGKT+LLD IRK+ VA  EAG ITQ IGAY +   +  +TF DTPGHEAF+ MRA GAD+TDIVVLVVA+DDG+ PQT EAI HA  A+ PI+V INKMD   AN++++   LA   ++ EEWGG T+++  SA   + ++ LLE + + AE++EL +NP R + G  IEA +D+G G VA +LVQ GTL + D ++ G +YG+V+ M +   +++K   P     + GL+G+P +GD   V  DEK  K+++E R +  +Q +LS       E          G KEL V++K D  GS EA+K  +  +     K+ +V + +G+I E D+  A  SK +V+ FN    S     A +  + +K+Y+IIY++ D +   ++G+L+P+  E+++G  E+R  ++   +G IAG  VL G +KR A  R+ R++K++ S  K+ SLR  KD +   A G ECG  +E+FND   GDI+E YEIV
  S:   445 DTQSVSKQELTDMVWGRVTIPIRGKKRKPTKKGAKTQITQMAEEKKVIKLQEGISVSDLGQRMGVRSAELIKKLMGLGKMATANQLVDADTAEMIAGDYGWKIDR-VGFEVEDYLPEV--ETRPEDERPRPPVVAIMGHVDHGKTSLLDAIRKASVAQGEAGGITQHIGAYSITTARGDVTFLDTPGHEAFTSMRARGADVTDIVVLVVASDDGVMPQTVEAIKHAKAAEVPIVVAINKMDLPTANLDRVKKDLATHELVPEEWGGDTIMVPVSAKTKENLELLLENLALQAEVLELASNPLRPSVGAIIEAKLDRGRGPVATVLVQEGTLKLGDAVVTGSHYGRVRAMTNSRGEQVKEVKPGYCAEVVGLSGVPGAGDAINVVADEKAAKQIAEHRNMKERQTELSKVSRESLEQLFAKTKAGGGPKELRVVIKADVQGSAEAVKQAVQKLSTHKVKVEVVHSGVGAITEGDVMRAAASKGVVLGFNVNPESGAEAAAKAQEVVLKSYSIIYELIDGVRTEMEGLLEPIRTERKLGRAEVRNTFNVPRLGTIAGAAVLDGVMKRGAIVRLMRENKQLFS-GKMASLRRFKDDVKEVAQGFECGIGIESFNDLKPGDIIEAYEIV 1065
>gi|163766326|ref|ZP_02173352.1| translation initiation factor IF-2 [Anaeromyxobacter sp. K] >gi|196171422|gb|ACG72395.1| translation initiation factor IF-2 [Anaeromyxobacter sp. K] (946 aa)
Score = 1068, Expect = 4.0e-114, Identities = 231/565 (40%), Positives = 350/565 (61%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDF-KKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++++ E S+ +   ++++I+ L   G    +N  +D      L LE GY   KK  ++ E  F+  ++ +  E  L  RPP+VT+MGHVDHGKT+LLD IR++ VAA EAG ITQ IGAY V   +  ITF DTPGHEAF+ MR  GA +TD+VVLVVAADDG+ PQT E+I  A  A   I+V INK+DK  A  E++  QL E  ++ E+WGG T+++  SA   QGI ELLE I + +E++ELKANP +LA G  IEA ++KG G VA +LV+ GTL V D ++ G ++G+V+ M++   +++    P  PV + GL+G+P +GD++ V  DEK  KE+++ R    +Q++L        E+      + G K LN+++K D  GS EA+   L         + ++ +A+G+I +SD+  A    +++V FNTK  S++ + A   G+ I  + IIY+  D I   + G+L+P+  EK +G  E+RQ+++   +G IAG  V  G +KR    R+ R D+++I   KI SL+  KD +   A G ECG  ++ F+D  +GDI+E+YE+
  S:   372 SISVSELSQVMGVKASDLIRKLMQMGKMVTINAQIDADTAAILALEHGYTVEKKGFEVEE--FIPEVEVD--ESKLVIRPPVVTVMGHVDHGKTSLLDAIRQADVAAGEAGGITQHIGAYSVNTPQGPITFLDTPGHEAFTAMRQRGAQVTDLVVLVVAADDGVMPQTVESIKAAKAAGVTILVAINKVDKPQAAPERVMQQLTEYELVAEQWGGTTIMLPVSARTKQGIPELLEYIALQSEVLELKANPDKLAAGRVIEAKLEKGRGPVATVLVEEGTLRVGDALVTGVHFGRVRAMMNERGEQVDNVGPGYPVEVLGLSGVPVAGDEFDVVEDEKAAKEVAQHRATKQRQKELGGVKKATLEDLFAKAKTSGQKVLNLVVKADVQGSSEAVSQALEKAATKKVGVKILESAVGAITKSDVLTAAAGNAVIVGFNTKPESEIENIASQQGVKILMFGIIYEAVDRIREEMAGLLEPIIKEKPLGKAEVRQVFNIPRVGQIAGSAVTEGVVKRAGHVRVVR-DRKVIFTGKIGSLKRVKDDVREVAQGFECGIGVDGFSDVKQGDILEVYEL 938
>gi|167359419|ref|ZP_02294058.1| translation initiation factor IF-2 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167073706|gb|EDR77543.1| translation initiation factor IF-2 [Rhizobium leguminosarum bv. trifolii WSM1325] (917 aa)
Score = 1068, Expect = 4.1e-114, Identities = 228/569 (40%), Positives = 349/569 (61%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTN--------LNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           V    +TI E S+++++ + ++IKYL  +G       ++D      +  EFG+  ++  + + +  + N+  +D E  L  RPP+VTIMGHVDHGKT+LLD IR + V + EAG ITQ IGAYQVE     ITF DTPGH AF+ MRA GA  TDI +LVVAADD + PQT E+I+HA  A  PIIV INK+DK +A+ +K+ +QL +  V  E  GG+ + ++ SA   + +D+LLEAI++ AEI++LKAN  R A G  IEA +D+G G+VA +LVQ GTL     I+ G+ +G+V+ +V      +K A P+TPV + GL+G P++GDK+ V   E   +E+SE RQ   + +  +             +   S GIKE  +++K D  GS+EAI G L  +     +  +V +  G I ESDI LA  S + ++ FN + +++   +A   GI I+ YNIIY + D+++  + G+L P   E  IG+ EI ++++ + +G +AG RV+ G+++R A  R+ R D  ++   K+ +L+  KD ++    G+ECG   EN+ D   GD++E + +
  S:   337 VLPETITIQELSQRMSERAVDVIKYLMKEGQMMKPGDVIDADLAEIIAGEFGHTVRRVSESDVELGIFNVSDDDGE--LVSRPPVVTIMGHVDHGKTSLLDAIRHANVVSGEAGGITQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGVPIIVAINKVDKHEADPQKVRNQLLQHEVFVESMGGEVLDVEVSAKTGKNLDKLLEAILLQAEILDLKANANRTAEGTVIEAQLDRGRGSVATVLVQKGTLRPGQIIVAGDVWGRVRALVTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAARQSGQRGSLEQMMMQRQSVGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHSGAGGITESDISLAEASNAAIIGFNVRANTQARQFAEREGIEIRYYNIIYDLVDDVKAAMSGLLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDV-VVHEGKLKTLKRFKDEVSEVPMGQECGMAFENYEDMRAGDVIECFRV 910
>gi|167816040|ref|ZP_02447720.1| translation initiation factor IF-2 [Burkholderia pseudomallei 91] (662 aa)
Score = 1068, Expect = 4.1e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:    88 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 655
>gi|167911165|ref|ZP_02498256.1| translation initiation factor IF-2 [Burkholderia pseudomallei 112] >gi|167919189|ref|ZP_02506280.1| translation initiation factor IF-2 [Burkholderia pseudomallei BCC215] (661 aa)
Score = 1068, Expect = 4.2e-114, Identities = 237/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:    87 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 654
>gi|183220912|ref|YP_001838908.1| translation initiation factor IF-2 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911008|ref|YP_001962563.1| Translation initiation factor 2 (IF-2; GTPase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|189028329|sp|B0SH18|IF2_LEPBA Translation initiation factor IF-2 >gi|167775684|gb|ABZ93985.1| Translation initiation factor 2 (IF-2; GTPase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779334|gb|ABZ97632.1| Translation initiation factor IF-2 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (917 aa)
Score = 1068, Expect = 4.5e-114, Identities = 249/565 (44%), Positives = 353/565 (62%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT-----NLNE--NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFAR-IKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           N+ + E +KK+N    E+I  L   G+   +N ++D      L  ++G   K  + + ++  ++  K +  ED +  RPP+VTIMGHVDHGKT LLDTIR S+VA  E+G ITQ IGAYQVE ++  I F DTPGHEAF+ MRA GA +TDIVVLVVAADDG+ PQT EAI+HA  A+ PIIV +NK+D   AN EK+  +L+   +  EEWGG T+    SA +N GID+LLE +I+ AE+++ KANPKR A G  +EA +D G GAVA +L+Q+GTL V D  + G + G+V+ M D   + IK A PS P  ++GL+G+P +G  + V  D+K  + +S  RQ   +  +  N  T     N++E      +KEL VI+K D  GS EA+K  L  +     +LN++ A  G+I +SDI LA  S ++V+ F+T+ + K    A    + IK Y+IIY + +E++  ++G+L+P  VE  IG VEIR ++  S +G IAG  V +G++ + A  R I  +  EI    KI +L+  KD +A    G ECG  L+ FNDF  GD +E YEI
  S:   341 NIQVGEIAKKLNLKPGEVISKLMKMGMMVTINNVIDAETASILADDYGCKVKI-VSLYDETVIEEEK-DAPEDYI-TRPPVVTIMGHVDHGKTKLLDTIRSSRVAEGESGGITQHIGAYQVETERGKIAFLDTPGHEAFTSMRARGASVTDIVVLVVAADDGVMPQTIEAINHAKEAEVPIIVAVNKIDLPAANPEKVRQELSNYGLQPEEWGGTTIFCDISAKSNIGIDKLLEMLIIQAELLDHKANPKRKAKGTIVEAKLDPGRGAVATVLIQNGTLRVGDAFVAGVHAGRVRAMYDDLGRSIKEAGPSFPALVTGLDGVPDAGAPFDVVIDDKEARTISHSRQEYERLGQSKNAATRVTLDNMSEIIKQGALKELKVIIKADVRGSTEAVKEALEKLSTADVRLNVIHAGTGAIVDSDIILASASNAIVIGFHTRANPKTVSLAEKEKVEIKYYSIIYDVVNEVKASMEGMLEPEKVENIIGKVEIRDVFKISKVGNIAGCMVKSGKVTKQAHVRVISSETGEITWEGKIKNLKRMKDDVADVLTGFECGILLDGFNDFSVGDEIEAYEI 910
>gi|67641341|ref|ZP_00440121.1| COG0532: Translation initiation factor 2 (IF-2; GTPase) [Burkholderia mallei GB8 horse 4] >gi|167004352|ref|ZP_02270110.1| translation initiation factor IF-2 [Burkholderia mallei PRL-20] (957 aa)
Score = 1067, Expect = 5.0e-114, Identities = 238/564 (42%), Positives = 358/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK +AN +++  +L  + V+ EE+GG +  +  SA    GID+LLE +++ AE++ELKA  +  A GI IEA +DKG+G VA +LVQSGTL+  D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +GD+ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +     ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +L+NFND VEGD  E++E+
  S:   383 ISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEIGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVLLQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGDEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEV 950
>gi|94986977|ref|YP_594910.1| translation initiation factor 2 (IF-2; GTPase) [Lawsonia intracellularis PHE/MN1-00] >gi|123385063|sp|Q1MQY8|IF2_LAWIP Translation initiation factor IF-2 >gi|94731226|emb|CAJ54589.1| translation initiation factor 2 (IF-2; GTPase) [Lawsonia intracellularis PHE/MN1-00] (961 aa)
Score = 1067, Expect = 5.3e-114, Identities = 237/567 (41%), Positives = 358/567 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLS-----NFGTNLNE--NSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGE 617
           + + + + ++   + EIIK LF  G+   +N  LD      +  EFGY+ +K I   E+++L     E  E L  +RPP+VTIMGHVDHGKT+LLD IRK+ V   EAG ITQ IGAY V  K   I F DTPGHEAF+ MRA GA +TDIVVLVVAADDG+  QT EA++HA  A  PI+V +NKMDK +AN +++  +L++  ++ E+WGG T+V K SA +  GIDELLE + +  +I+ELKANP + A G  +EA +DKG G +A +L+Q GTL   D  + G + G+V+ M +   K++K A PS P+ + G  G+P++G+ +I   DEKL + ++E R +  ++++L+        T L++  N +  + LN+++K+D  GSLEAI   L  +     ++N++    G+I ESDI LA  S ++V+ FN + ++KV + A    + I+ Y+IIY++ +EI+  + G+L P+  E  +G  ++R++++   IG IAG  V  G++ RNA  R+ R +  ++    I SLR  K+ +     G ECG +LENFND   GD++E +E V E
  S:   387 IRVADMAHQMGLKANEIIKVLFNLGVMATINMSLDIDTATLVAAEFGYEVEK-IGFTEEDYLVATAPEQSESL-KRRPPVVTIMGHVDHGKTSLLDAIRKTNVTGGEAGGITQHIGAYHVTTKSGEIVFLDTPGHEAFTTMRARGAQVTDIVVLVVAADDGVMEQTREAVNHARAANVPIMVAVNKMDKPEANPDRVLRELSDIGLVPEDWGGDTIVTKVSAKSLDGIDELLELLALQTDILELKANPDKPARGHIVEAKLDKGRGPIATVLIQEGTLHQGDTFVCGVFSGRVRAMFNDQGKKVKDAGPSMPIEVQGFEGVPEAGEAFICLPDEKLARRIAESRAIKQREKELAKESRVTLETFLSKTSNEKEAQVLNLVVKSDVQGSLEAILEALRKLSTAKVRINIIHGGSGAITESDILLASASDAIVIGFNVRPTAKVKEVAEQENVDIRFYDIIYKLVEEIKSAMAGLLAPISREVYLGQADVREIFNVPKIGTIAGSHVSDGKVLRNAGVRLLR-EGVVVYTGGIASLRRFKEDVREVQKGYECGISLENFNDIKLGDVIESFETVEE 957
>gi|169797407|ref|YP_001715200.1| protein chain initiation factor IF-2 [Acinetobacter baumannii AYE] >gi|184156670|ref|YP_001845009.1| translation initiation factor 2 GTPase [Acinetobacter baumannii ACICU] >gi|169150334|emb|CAM88231.1| protein chain initiation factor IF-2 [Acinetobacter baumannii] >gi|183208264|gb|ACC55662.1| Translation initiation factor 2 (IF-2; GTPase) [Acinetobacter baumannii ACICU] (899 aa)
Score = 1067, Expect = 5.4e-114, Identities = 249/586 (42%), Positives = 360/586 (61%)
  Q:    29 IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD--FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN---SQGIKE---LNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +K Q   VE G         +++ + + ++K+     E+IK L   G   N N  +D+     +  E G++     + Q  EDN L+    E+       RPP+VTIMGHVDHGKT+LLD IR+SKVAA EAG ITQ IGAY VE  K +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAIDHA  A  PIIV INKMDK+ A+ +++ ++L  K ++ EEWGG   V K SA   QGIDELL+ I++ +E+MELKA+ +  A G+ IEA +DKG GAV  +LVQ+GTL + D +L G  YG+V+ M D N K IK+A PS PV I GL   P +GD+ +V NDEK  +E+++ R    +++++        EN   S G K+   +NV+L+TD  G+LEA+   L  +     K+ ++ + +G+I ESD+ LA +S+++++ FN +  +     +   GI I+ Y+IIY++ D+++  + G L P   E  +G  ++R+++  S  G  AG  V+ G I RN   R+ R D  +I   ++ SLR  KD +    AG ECG  ++ +ND    D +E+Y++
  S:   312 VKKQVYDVEIG---------SSIVVADLAQKMAIKVREVIKTLMKMGELVNQNQTIDQDTAALVVEEMGHNPVLVSDTQA-EDNLLEAA--EEARGEQTTRPPVVTIMGHVDHGKTSLLDRIRRSKVAAGEAGGITQHIGAYHVETDKGIITFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTAEAIDHARAAGTPIIVAINKMDKESADPDRVLNELTTKEIVPEEWGGDVPVAKVSAHTGQGIDELLDLILIQSELMELKASAEGAAQGVVIEARVDKGRGAVTSILVQNGTLNIGDLVLAGSSYGRVRAMSDENGKPIKSAGPSIPVEILGLPEAPMAGDEVLVVNDEKKAREVADARADREREKRIERQSAMRLENIMASMGKKDVPTVNVVLRTDVRGTLEALNAALHELSTDEVKVRVISSGVGAITESDVILAESSEAVLLGFNVRADTAARQKSDQDGIDIRYYSIIYELIDDVKDAMSGKLAPEHRETILGVAQVREVFRSSKFGAAAGCMVMEGVIHRNKPIRVLRDDV-VIFQGELESLRRYKDVVDEVRAGMECGLAVKGYNDIKPLDKIEVYDV 892
>gi|169634553|ref|YP_001708289.1| protein chain initiation factor IF-2 [Acinetobacter baumannii SDF] >gi|169153345|emb|CAP02458.1| protein chain initiation factor IF-2 [Acinetobacter baumannii] (899 aa)
Score = 1067, Expect = 5.7e-114, Identities = 249/586 (42%), Positives = 360/586 (61%)
  Q:    29 IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD--FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN---SQGIKE---LNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +K Q   VE G         +++ + + ++K+     E+IK L   G   N N  +D+     +  E G++     + Q  EDN L+    E+       RPP+VTIMGHVDHGKT+LLD IR+SKVAA EAG ITQ IGAY VE  K +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAIDHA  A  PIIV INKMDK+ A+ +++ ++L  K ++ EEWGG   V K SA   QGIDELL+ I++ +E+MELKA+ +  A G+ IEA +DKG GAV  +LVQ+GTL + D +L G  YG+V+ M D N K IK+A PS PV I GL   P +GD+ +V NDEK  +E+++ R    +++++        EN   S G K+   +NV+L+TD  G+LEA+   L  +     K+ ++ + +G+I ESD+ LA +S+++++ FN +  +     +   GI I+ Y+IIY++ D+++  + G L P   E  +G  ++R+++  S  G  AG  V+ G I RN   R+ R D  +I   ++ SLR  KD +    AG ECG  ++ +ND    D +E+Y++
  S:   312 VKKQVYDVEIG---------SSIVVADLAQKMAIKVREVIKTLMKMGELVNQNQTIDQDTAALVVEEMGHNPVLVSDTQA-EDNLLEAA--EEARGEQTTRPPVVTIMGHVDHGKTSLLDRIRRSKVAAGEAGGITQHIGAYHVETDKGIITFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTAEAIDHARAAGTPIIVAINKMDKESADPDRVLNELTTKEIVPEEWGGDVPVAKVSAHTGQGIDELLDLILIQSELMELKASAEGAAQGVVIEARVDKGRGAVTSILVQNGTLNIGDLVLAGSSYGRVRAMSDENGKPIKSAGPSIPVEILGLPEAPMAGDEVLVVNDEKKAREVADARADREREKRIERQSAMRLENIMASMGKKDVPTVNVVLRTDVRGTLEALNAALHELSTDEVKVRVISSGVGAITESDVILAESSEAVLLGFNVRADTAARQKSDQDGIDIRYYSIIYELIDDVKDAMSGKLAPEHRETILGVAQVREVFRSSKFGAAAGCMVMEGVIHRNKPIRVLRDDV-VIFQGELESLRRYKDVVDEVRAGMECGLAVKGYNDIKPLDKIEVYDV 892
>gi|157962878|ref|YP_001502912.1| translation initiation factor IF-2 [Shewanella pealeana ATCC 700345] >gi|189028437|sp|A8H740|IF2_SHEPA Translation initiation factor IF-2 >gi|157847878|gb|ABV88377.1| translation initiation factor IF-2 [Shewanella pealeana ATCC 700345] (896 aa)
Score = 1066, Expect = 6.4e-114, Identities = 239/565 (42%), Positives = 354/565 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED--LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +++ E + K++  + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L++    DR     ++ R P+VTIMGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE +  +ITF DTPGH AF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P+IV +NK+DK +A+ +++ S+L++  V+ E+WGG  M +  SA +  GIDELLE I++ AE++EL+A  + +A G+ +E+ +DKG G VA +LVQ GTL   D +L G  YGKV+ M D N K I  A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ           ++ KL N   N+ E    ++ELN++LK D  GSLEAI   L+S+     K+N++   +G + E+D  LA  S +++V FN +  ++      S  + ++ Y+IIYQ+ DE+   + G+L P F ++ IG  E+R ++    IG IAG  V  G IKR+A  R+ R D  +I   ++ SLR  KD ++    G ECG  ++N+ND   GD +E++E V
  S:   323 VSVAELASKMSIKATEIIKQMMKMGSMVTINQVLDQETAQLVAEEMGH----KVILTRENELEHQVLADRNGDVKVEPRAPVVTIMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTAMRARGAKATDIVILVVAADDGVMPQTIEAIQHAKAGGVPLIVAVNKIDKPEADPDRVKSELSQHGVMSEDWGGNNMFVHVSAKDGTGIDELLEGILLEAEVLELQAVREGMAAGVVVESKLDKGRGPVATVLVQEGTLKQGDIVLCGLEYGKVRAMRDENGKAITEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKSKLENMFANMVEGE--VQELNLVLKADVQGSLEAIADSLNSLSTDEVKVNIIARGVGGLTETDATLAAASNAIMVGFNVRADAQARKVVDSESVDLRYYSIIYQLIDEVRDAMSGMLAPEFKQEIIGLAEVRDVFKSPKIGAIAGCMVTEGTIKRSAPIRVLR-DNIVIYEGELESLRRFKDDVSDVRNGMECGIGVKNYNDVRVGDQIEVFETV 890
>gi|90416135|ref|ZP_01224067.1| translation initiation factor IF-2 [marine gamma proteobacterium HTCC2207] >gi|90331860|gb|EAS47074.1| translation initiation factor IF-2 [marine gamma proteobacterium HTCC2207] (897 aa)
Score = 1066, Expect = 6.6e-114, Identities = 234/594 (39%), Positives = 355/594 (59%)
  Q:    21 VDNRTNIDIKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNEN------SQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           VDN+      ++ K +E  I +        +++ E ++++   S  +++ L   G+  ++N ++D+     +  E G+    ++++  ED           E   + R PIVT+MGHVDHGKT+LLD IRKS+VA+ EAG ITQ IGAY V+  K ++TF DTPGH AF+ MRA GA  TD+V+LVVAADDG+ PQTEEAI HA  A  PI++ INKMDK  A+ E++ ++LA K+V+ EEWGG T  IK SA    GID+LLEA+++ +E++EL A     A G+ +EA +DKG G +A  LVQ GTL   D++L GE  GK++ M D  +K    A PS PV I GL+  PK+GD++ V  DE+  KE++E RQ   +Q ++S       EN      +  + +LN+I+KTD  GSLEAI   L     +   +++V + +G I ESD++LA T+ ++++ FN +             I ++ Y++IY + DE++  L G+L P   E  +G  E+R ++     G IAG  V+ G + R+   R+ R D  +I   ++ SLR  KD       G ECG  ++N+ND   GD++E++++
  S:   298 VDNKHTFQKPTEKKVLEVQIPD-------EISVGELAQRMLSKSGPVVRQLMKMGVMASINEVIDQETAFLVVEELGHQPVVEQVESVEDELAKQFAEIKSEGTEEPRAPIVTVMGHVDHGKTSLLDQIRKSRVASGEAGGITQHIGAYHVDTPKGMVTFLDTPGHAAFTAMRARGAQATDVVILVVAADDGVMPQTEEAIQHAKAAGVPIVIAINKMDKDGADPERVTNELAAKDVIPEEWGGDTQFIKVSAHTGDGIDQLLEAVLLQSELLELTAPVNVPARGVIVEARVDKGRGVIATALVQQGTLRKGDFMLAGESVGKIRAMTDEAKKPALEAGPSIPVEILGLDEAPKAGDEFFVVADERKAKEIAETRQTKARQERMSRQQAAKLENMFSDMGADQVSKLNLIVKTDVRGSLEAINSALHDFATSEVAVDIVASGVGGITESDMNLALTTGAIILGFNVRAGGAARALGEKENIEVRYYSVIYNLLDEVKSALSGMLAPETREDIVGIAEVRDVFRSPKFGAIAGCMVIEGTVFRSKPIRVLRDDI-VIYEGELESLRRFKDDAQEVRNGMECGIGVKNYNDVKPGDLIEVFDV 890
>gi|91792367|ref|YP_562018.1| translation initiation factor IF-2 [Shewanella denitrificans OS217] >gi|123061156|sp|Q12QI1|IF2_SHEDO Translation initiation factor IF-2 >gi|91714369|gb|ABE54295.1| translation initiation factor IF-2 [Shewanella denitrificans OS217] (884 aa)
Score = 1066, Expect = 6.7e-114, Identities = 237/565 (41%), Positives = 349/565 (61%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDRED--LLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           +++ E +  +   + EIIK +   G    +N +LD+     +  E G+    ++ +  +N L+     DR+D   L+ R P+VTIMGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P+IV +NKMDK DA+ E++ S+L++  V+ ++WGG  M +  SA   +G+DELLE I++ +E++ELKA  + +A G+ IE+ +DKG G VA +LVQSGTL   D +L G  YGK++ M D N   I  A PS PV I GL+G+P +GD+  V  DE+  +E++  RQ           ++ KL N   N+ E    ++ELN++LK D  GSLEAI   L+ +     K+N++   +G++ E+D  LA  S +++V FN +  ++      +  + ++ Y+IIY + DE+   + G+L P F ++ IG  E+R ++    IG IAG  V  G +KR+A  R+ R D  +I   ++ SLR  KD       G ECG  ++N+ND   GD +E++E +
  S:   311 VSVAELAHLMAVKATEIIKQMMKMGSMVTINQILDQETAQMVAEEMGH----KVVLLRENELEEQVLGDRDDNVKLETRAPVVTIMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETDNGMITFLDTPGHAAFTSMRARGAKATDIVILVVAADDGVMPQTIEAIQHAKAGNVPLIVAVNKMDKPDADPERVKSELSQHGVMSDDWGGDNMFVHLSAKTGEGVDELLEGILLQSEVLELKAVREGMAAGVVIESQLDKGRGPVATVLVQSGTLRQGDIVLCGLMYGKIRAMKDENGNAITEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDVKLARQQKSKLENMFANMEEGE--VQELNIVLKADVQGSLEAICDSLTGLSTAEVKVNIIARGVGALTETDATLAAASNAIMVGFNVRADAQARKTIEAESVDLRYYSIIYNLIDEVRAAMTGMLAPEFKQQIIGLAEVRDVFKSPKIGAIAGCMVTEGIVKRSAPIRVLR-DNVVIYEGELESLRRFKDDATEVRNGMECGIGVKNYNDVRVGDQIEVFETI 878
>gi|94268657|ref|ZP_01291246.1| Initiation factor 2:Small GTP-binding protein domain [delta proteobacterium MLMS-1] >gi|93451512|gb|EAT02335.1| Initiation factor 2:Small GTP-binding protein domain [delta proteobacterium MLMS-1] (627 aa)
Score = 1066, Expect = 7.4e-114, Identities = 227/584 (38%), Positives = 369/584 (63%)
  Q:    29 IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +K Q       IK  + V    +++ + + ++   + E+I  L   G+   +N  +D      +  EFGY+   E    E+  + +++ ++       RPP+VT+MGHVDHGKT++LD IRKS VA  EAG ITQ IGA+ V   +  + F DTPGHEAF++MR+ GA +TDIVVLVVAADDG+  QT EAI+HA  A+ PIIV +NK+DK +A+  ++  +L++  ++ E+WGG+ +  + SA    GI  LL+ I++ AE++ELKA+P+R   G  +EA + KG G VA +LVQ GTL + D  + G+Y GKV+ +++   +++K A PSTPV I GL+G+P++GD+++V  DEK+ K +S +RQL  ++++L++       NL E  Q   +KEL V+L+ D  G+L A    L  +     K+ ++ +  G++ ESD+ LA  S +L++ FN + ++++ + A    + ++ Y++IY   ++I++ ++G+L+P FVE+ IGS E+RQ +  S +G IAG  + +G+ +RNA  R+ R +  ++   +++SL+  KD     A G ECG +L N+ND  EGDI+E +
  S:    33 VKPQHAAETKAIKKRITVH-ETISVGDLAHRMGAKANEVIAKLMGLGVMATVNQAMDIDTASLVAAEFGYEV--EQGKTEEQSILSLEEQESGGESRPRPPVVTVMGHVDHGKTSILDAIRKSDVAGGEAGGITQHIGAHYVRAPQGDVVFLDTPGHEAFTEMRSRGAQVTDIVVLVVAADDGVMDQTREAINHARAAEVPIIVCVNKIDKNNADAMRVKRELSDLGLMPEDWGGEAIYCETSAKQGIGIGALLDNILLQAEVLELKADPQRHGKGHVVEAQLHKGRGPVATVLVQEGTLRLGDAFVAGQYSGKVRSLINDKGEQVKEAGPSTPVEIQGLSGVPQAGDEFVVVRDEKMAKSVSAERQLKVREQELASDSKISLDNLFERMQEGEVKELMVVLRADVQGTLGAFTSSLEQLSTDAVKVRVLNSGTGTVTESDVLLAAASDALIIGFNVRPTARIQELAKRERVDMRFYDVIYHALEDIKKAMEGLLEPEFVEEVIGSAEVRQTFHVSKVGTIAGCYITSGKAERNAKVRLLR-EGVVVFTGQLSSLKRFKDDAKEVATGYECGMSLRNYNDIKEGDILEFF 618
>gi|134102373|ref|YP_001108034.1| translation initiation factor IF-2 [Saccharopolyspora erythraea NRRL 2338] >gi|189028429|sp|A4FM34|IF2_SACEN Translation initiation factor IF-2 >gi|133914996|emb|CAM05109.1| translation initiation factor IF-2 [Saccharopolyspora erythraea NRRL 2338] (1027 aa)
Score = 1066, Expect = 7.6e-114, Identities = 239/563 (42%), Positives = 364/563 (64%)
  Q:    52 TIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFL---DNIKFED---REDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQV----EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAE-IMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR------QLNTKQRK---LSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEV-TGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++ +F++KIN + A +++ +F  G        + +  +  L  E  Y  +     +ED  L    +I F D    ++ L  RPP+VT+MGHVDHGKT LLDTIRK+ V A EAG ITQ IGAYQV    E  +  ITF DTPGHEAF+ MRA GA  TDI VLVVAADDG+ PQT EA++HA  A  PI+V +NK+D + AN  K+  QL E N++ EE+GG+TM +  SA     I+ LLEAI++TA+  ++L+ANP   A G+ IEA +D+G G VA +LVQ GTL V D ++ G  +G+V++M++ + +++  ALPS PV++ G   +P +GD ++V +++++ ++++++R        N  +RK   L +    L E +Q    LN+I+K DN+G++EA++  L+ IEV    +L ++   +G INESDI+LA    ++V+ FN +   K ++ A   G+ I+ Y++IY+  ++IE+ LKG+L P + E E+G  E+R+++  S +G IAG  V  G ++RNA AR+ R +  I  N  + SL+  KD       G ECG TL +++D    DI+E YE+
  S:   443 SLTDFAEKINANPASLVQAMFHLGEMVTATQSVSDEILELLGSEMNYKVEMVSPEDEDRELLESFDISFGDPGSSDEELMSRPPVVTVMGHVDHGKTRLLDTIRKANVQAGEAGGITQHIGAYQVITELEGNERPITFIDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTVEALNHAQAAGVPIVVAVNKIDVEGANPAKVRQQLTEYNLVAEEYGGETMFVDISARQGTNIESLLEAILLTADATLDLRANPSMEAQGVAIEAHLDRGRGPVATVLVQRGTLRVGDSVVAGNAFGRVRRMINEHDEDVTEALPSRPVQVIGFTSVPGAGDTFLVVDEDRVARQIADRRGARIREAQNAAKRKRVSLEDLDKVLKETNQ----LNLIIKGDNSGTVEALEESLTKIEVGEEVELRVIHRGVGGINESDINLATAENTIVLGFNVRAEGKAAEVANREGVEIRYYSVIYRAIEDIEQALKGMLKPEYEEVELGRAEVREVFKSSKVGTIAGCMVTDGIMRRNAKARLLRDNVVISENLTVTSLKRFKDDATEVRDGFECGLTL-SYSDIKVDDIIETYEM 1021
>gi|33596483|ref|NP_884126.1| translation initiation factor IF-2 [Bordetella parapertussis 12822] >gi|39931248|sp|Q7W9A5|IF2_BORPA Translation initiation factor IF-2 >gi|33566252|emb|CAE37163.1| translation initiation factor IF-2 [Bordetella parapertussis] (969 aa)
Score = 1066, Expect = 7.8e-114, Identities = 235/564 (41%), Positives = 352/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  +AE+IK L   G    +N +LD+     +  EFG+        + + FLD       E   + R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P++V +NK+DK +AN E++  +L  + V+ EE+GG    +  SA    GID+LLE +++ AEI+ELKA  +  A G+ IEA +DKG G VA +LVQSGTL   D +L G  +G+V+ M+D N K+I+TA PS PV I GL  +P +GD+ +V +DE+  +E++  RQ   +  KL     +   +  +   +G + L +I+KTD  GS EA+   L+ +     ++ +V AA+G I+ESD++LA  S ++V+ FN +        A + GI ++ YNIIY   DE++  + G+L P   E+ IG VE+R++++ S IG +AG  VL G ++R++  R+ R +  +     ++SLR  KD +    +G +CG TL   ND   GD +E++EI
  S:   396 ISVADLAHKMSVKAAEVIKQLMKLGQMVTINQVLDQETAMIVVQEFGHTAIAAKLDDPEAFLDETA-AVTEAEAEPRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETGRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTREAIHHAKAGGVPLVVAVNKIDKPEANPERVKQELVAEEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQAEILELKAPIEVPAKGLVIEARLDKGRGPVATILVQSGTLKRGDVVLAGASFGRVRAMLDENGKQIQTAGPSIPVEIQGLTEVPAAGDELMVLSDERKAREIALFRQGKFRDVKLARQQAAKLESMFDNLGEGTQTLALIVKTDVQGSQEALVSSLTKLSTDEVRVQVVHAAVGGISESDVNLAIASNAVVIGFNVRAEQSAKKLAETNGIDLRYYNIIYDAVDEVKAAMSGMLAPEKREEVIGLVEVREVYTISRIGTVAGCMVLDGVVRRDSQVRLLRNNV-VQWTGHLDSLRRFKDDVKEVKSGFDCGLTLRGNNDLQLGDQLEVFEI 962
>gi|57234293|ref|YP_181706.1| translation initiation factor IF-2 [Dehalococcoides ethenogenes 195] >gi|90101357|sp|Q3Z7U3|IF2_DEHE1 Translation initiation factor IF-2 >gi|57224741|gb|AAW39798.1| translation initiation factor IF-2 [Dehalococcoides ethenogenes 195] (593 aa)
Score = 1065, Expect = 8.3e-114, Identities = 241/562 (42%), Positives = 357/562 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIK-FEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +++ E +  ++ +  E+IK L  KGI  N+N ++ E ++ +  +E    F+  +++ + +    +   +++      RPP+VTIMGHVDHGKT LLD IR + V   EAG ITQ IGAYQVE K   ITF DTPGHEAF+ MRA GA  TDI +LVVAADDG+ PQT EA+DHA  A  PII+ INKMDK +AN +++  QLAE  ++ EEWGG T+ I  SA   +GI+ELLEA+++ AE+ +L+A+P + A+G+ IEA MDK  G +A +LVQSGTL + D ++ G  +G+VK M +   K IK A PSTPV + G+  +P+ GDK I    EK  +++  +    T++    +     ++ S+G IKELN+ILKTD  GSLE IK  L  +     K+N+ R+ +G+I ESD+ LA  S  L++ F+T + +     A +  I I++Y+IIY++ +++E+ ++G+L+P   E   G  E+R ++  +    IAG  VL G++ +N+  R+ R   E+I +A  NSLR  KD +    AG ECG  L++FNDF + DI+E Y
  S:    27 VSVKELADSLDTNPVEVIKALMRKGIMANINQVI-EFEVAKGIVE-AAGFEARLKVLKKSAAKKVSPAKEKLSNFPLRPPVVTIMGHVDHGKTRLLDAIRSTNVMEKEAGGITQHIGAYQVEIKGQKITFLDTPGHEAFTAMRARGAQATDITILVVAADDGVMPQTLEALDHAKAAGVPIILAINKMDKPEANPDRVKQQLAEAGLVVEEWGGDTLAIPTSAREKKGINELLEAVLLIAELEDLRADPNQPASGVVIEAEMDKNRGPMATVLVQSGTLKLGDTVVAGTTWGRVKAMFNDVGKRIKKAEPSTPVALLGMESVPQVGDKIIAVATEKQARDMVNENSQVTRKTNAVSLTNVYDQVSKGNIKELNIILKTDVQGSLEPIKDSLEKLSTDKIKININRSGVGNITESDVMLAMASGGLIIGFSTGIETNAQRLADAEDIDIRHYDIIYKLVEDVEKAVQGLLEPTIKEVIDGRAEVRAVFESTKKLSIAGCMVLEGKVLKNSQVRLLR-GGEVIVDAPSNSLRRFKDDVKEVVAGYECGVGLKDFNDFQKSDILEFY 587
>gi|160932909|ref|ZP_02080298.1| hypothetical protein CLOLEP_01750 [Clostridium leptum DSM 753] >gi|156867983|gb|EDO61355.1| hypothetical protein CLOLEP_01750 [Clostridium leptum DSM 753] (853 aa)
Score = 1065, Expect = 8.3e-114, Identities = 239/564 (42%), Positives = 351/564 (62%)
  Q:    49 NNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           + +T+ E + ++   +AE+IK L + G    +N ++D      + +EF    +KE+ +  ++ + +   +D E+L+  R P+V +MGHVDHGKT+LLD IR + V A EAG ITQ IGAY+V      ITF DTPGHEAF+ MRA GA +TDI +LVVAADDG+ PQT EAI+HA  A   +IV INKMDK  AN E++  QL E  ++ EEWGG T  I  SA   +GI +LLE + + A++ ELKANP R   G  IEA +DKG G +A +LVQ+GTL V D I+ G   G+V+ M++   + ++ A PS PV I+GL+ +P  GD +   +DE+L +EL ++R+   K+ + +        NL +  Q   IKEL +I+K D  GS+EA++  L  +     +++++   +G++NESD+ LA  S +++V FN +     ++ A    + ++ Y +IY   +EIE  +KG+L P F E  +G  E RQ++  S++G IAG  VL+G+I RNA  RI R D  +I   K+ SLR  KD +   A+G ECG  LE FND  EGD+ E +
  S:   278 DEITVGELALRLKATAAEVIKKLMMMGTMATVNDVIDFDTAALVAMEFHAKVEKEVVVTIEDRIIDDSEDDDENLV-PRAPVVVVMGHVDHGKTSLLDAIRHANVTAGEAGGITQHIGAYRVNIGDREITFLDTPGHEAFTTMRARGAQVTDIAILVVAADDGIMPQTIEAINHAKAAGVSVIVAINKMDKMGANPERVKEQLTEYELVPEEWGGDTPCIPVSAHTKEGIGDLLEMVTLIADMKELKANPDRAGKGTVIEARLDKGRGPIATVLVQNGTLHVGDIIVAGTSVGRVRAMMNDRGERVQEAGPSVPVEITGLDDVPTGGDTFNCVSDERLARELVDQRKAAQKEEQFNAQTKVTLDNLFDQMQLGDIKELKIIVKADVQGSVEAVRQSLEKLSNDEVRVHVIHGGVGAVNESDVMLANASNAIIVGFNVRPDPVAAENAERDKVDMRLYRVIYDCIEEIESAMKGMLAPKFRENLLGRAECRQVYKISNVGTIAGSYVLSGKITRNAEIRIVR-DGIVIGEDKLASLRRFKDDVKEVASGYECGIGLERFNDIKEGDVFEAF 845
>gi|153826523|ref|ZP_01979190.1| initiation factor IF-2 [Vibrio cholerae MZO-2] >gi|149739703|gb|EDM53910.1| initiation factor IF-2 [Vibrio cholerae MZO-2] (898 aa)
Score = 1065, Expect = 8.6e-114, Identities = 240/565 (42%), Positives = 356/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK--RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + E ++K++  + E+IK +   G    +N ++D+     +  E G+    ++ + ++N L+     DR+D  ++  R P+VTIMGHVDHGKT+ LD IR++ VA+ EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA  A  P+IV +NK+DK  AN + + ++L++ NV+ EEWGG  M +  SA     ID LLEAI++ AE++ELKA  + +A+G+ IE+ +DKG G VA +LVQSGTL   D +L G+ YG+V+ M D    E++ A PS PV I GL+G+P +GD+  V  DE+  +E++  R       +L  +Q+ KL N  +N+      + ELN++LK D  GS+EAI   L+ +     K+N+V + +G I E+D  LA  S ++VV FN +  +       +  I ++ Y+IIYQ+ DE+++ + G+L P F ++ IG  E+R ++    +G IAG  V  G IKRNA  R+ R D  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E +
  S:   324 IVVSELAQKMSVKATEVIKVMMKMGAMATINQVIDQETAQLVAEEMGH----KVVLRKENELEEAILSDRDDKFEEVSRAPVVTIMGHVDHGKTSTLDYIRRTHVASGEAGGITQHIGAYHVETPNGMITFLDTPGHAAFTAMRARGAQATDIVVLVVAADDGVMPQTVEAIQHAKAAGVPLIVAVNKIDKDTANPDNVKTELSQYNVMPEEWGGDNMFVHISAKQGTNIDGLLEAILLQAEVLELKAVKQGMASGVVIESRLDKGRGPVATVLVQSGTLRKGDIVLCGQEYGRVRAMRDEVGNEVEEAGPSIPVEILGLSGVPAAGDEATVVRDERKAREVANYRAGKFREVKLARQQKSKLENMFSNMTAGD--VAELNIVLKADVQGSVEAIADSLTRLSTNEVKVNIVGSGVGGITETDAVLAAASNAIVVGFNVRADASARRMIEAENIDLRYYSIIYQLIDEVKQAMSGMLSPEFKQEIIGLAEVRDVFKSPKLGAIAGCMVTEGVIKRNAPIRVLR-DNVVIYEGELESLRRFKDDVAEVKNGYECGIGVKNYNDVRVGDQIEVFETI 891
>gi|167836821|ref|ZP_02463704.1| translation initiation factor IF-2 [Burkholderia thailandensis MSMB43] (954 aa)
Score = 1065, Expect = 8.7e-114, Identities = 238/564 (42%), Positives = 356/564 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYD-FKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQG-IKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K+   ++E+IK +   G    +N +LD+     +  E G+     ++   E   ++     D E L   RPP+VT+MGHVDHGKT+LLD IR++KVAA EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT+EAI HA     PI+V INK+DK DAN +++  +L  + V+ EE+GG +  +  SA    GIDELLE +++ AE++ELKA     A GI IEA +DKG+G VA +LVQSGTL   D +L G  YG+V+ M+D N K  K A PS PV I GL+ +P +G++ IV  DE+  +E++  RQ   +  KL     +   + L +  +G ++ L +I+K D  GS EA+   L  +  +  ++ +V +A+G I+ESD++LA  SK++++ FNT+  ++    A + GI I+ YNIIY   DE++  + G+L P   E   G VE+RQ++    +G +AG  V  G +KR++  R+ R +  +I   +++SL+  KD +     G ECG +++NFND VEGD  E++E+
  S:   380 ISVADLAHKMAIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDPEALLVEGEVGSDAEQL--PRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGGVPIVVAINKIDKPDANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDELLENVLLQAEVLELKAPVDSPAKGIVIEAKLDKGKGPVATVLVQSGTLNRGDVVLAGTAYGRVRAMLDENGKPTKEAGPSIPVEIQGLSEVPGAGEEVIVLPDERKAREIALFRQGKFRDVKLAKQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTSEVRVQIVHSAVGGISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGMLAPEKREVVTGMVEVRQVFKVPKVGAVAGCMVTDGIVKRSSSVRVLRNNV-VIFTGELDSLKRFKDDVKEVKQGFECGMSIKNFNDIVEGDQFEVFEV 947
>gi|94263056|ref|ZP_01286875.1| Initiation factor 2:Small GTP-binding protein domain [delta proteobacterium MLMS-1] >gi|93456599|gb|EAT06707.1| Initiation factor 2:Small GTP-binding protein domain [delta proteobacterium MLMS-1] (900 aa)
Score = 1065, Expect = 8.7e-114, Identities = 227/584 (38%), Positives = 369/584 (63%)
  Q:    29 IKSQFKKVETGIKNGVFVFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGT----NLNENSQ--GIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIY 612
           +K Q       IK  + V    +++ + + ++   + E+I  L   G+   +N  +D      +  EFGY+   E    E+  + +++ ++       RPP+VT+MGHVDHGKT++LD IRKS VA  EAG ITQ IGA+ V   +  + F DTPGHEAF++MR+ GA +TDIVVLVVAADDG+  QT EAI+HA  A+ PIIV +NK+DK +A+  ++  +L++  ++ E+WGG+ +  + SA    GI  LL+ I++ AE++ELKA+P+R   G  +EA + KG G VA +LVQ GTL + D  + G+Y GKV+ +++   +++K A PSTPV I GL+G+P++GD+++V  DEK+ K +S +RQL  ++++L++       NL E  Q   +KEL V+L+ D  G+L A    L  +     K+ ++ +  G++ ESD+ LA  S +L++ FN + ++++ + A    + ++ Y++IY   ++I++ ++G+L+P FVE+ IGS E+RQ +  S +G IAG  + +G+ +RNA  R+ R +  ++   +++SL+  KD     A G ECG +L N+ND  EGDI+E +
  S:   306 VKPQHAAETKAIKKRITVH-ETISVGDLAHRMGAKANEVIAKLMGLGVMATVNQAMDIDTASLVAAEFGYEV--EQGKTEEQSILSLEEQESGGESRPRPPVVTVMGHVDHGKTSILDAIRKSDVAGGEAGGITQHIGAHYVRAPQGDVVFLDTPGHEAFTEMRSRGAQVTDIVVLVVAADDGVMDQTREAINHARAAEVPIIVCVNKIDKNNADAMRVKRELSDLGLMPEDWGGEAIYCETSAKQGIGIGALLDNILLQAEVLELKADPQRHGKGHVVEAQLHKGRGPVATVLVQEGTLRLGDAFVAGQYSGKVRSLINDKGEQVKEAGPSTPVEIQGLSGVPQAGDEFVVVRDEKMAKSVSAERQLKVREQELASDSKISLDNLFERMQEGEVKELMVVLRADVQGTLGAFTSSLEQLSTDAVKVRVLNSGTGTVTESDVLLAAASDALIIGFNVRPTARIQELAKRERVDMRFYDVIYHALEDIKKAMEGLLEPEFVEEVIGSAEVRQTFHVSKVGTIAGCYITSGKAERNAKVRLLR-EGVVVFTGQLSSLKRFKDDAKEVATGYECGMSLRNYNDIKEGDILEFF 891
>gi|46446395|ref|YP_007760.1| translation initiation factor IF-2 [Candidatus Protochlamydia amoebophila UWE25] >gi|81829027|sp|Q6MD64|IF2_PARUW Translation initiation factor IF-2 >gi|46400036|emb|CAF23485.1| putative translation initiation factor IF-2 [Candidatus Protochlamydia amoebophila UWE25] (920 aa)
Score = 1065, Expect = 9.4e-114, Identities = 243/570 (42%), Positives = 363/570 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELC-LEFGYDF------KKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQ--------RKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIVGETHE 620
           ++I + + ++   +++++  LFL+GI   LN LL++    +L   EFG +       +K IQI + +  + ++ +   D L  RPP+V  MGHVDHGKT+L+D IRKS  AA EAG ITQ IGA++       I   DTPGHEAFS MRA GAD+TDIVVLVVA D+GL+ Q+ EAI HA  A   I+V INK DK + N + +Y QLAE+N+L E WGG+T+ +  SA+  +GI ELLE + + AE++EL+ANP   A G  +E+ M KG G+VA +LVQ+GTL   D ++ G  +G+VK M D   KE++ A PSTPV I+GL+G+P++G ++IV  +EK  +E++  R    +Q        +K+S        ++ G K LN++L+ D  GSLEA+K  L  IE   A LN++   +G ++ESD+ LA  SK++V+ F+T++ S        +G+ ++ +NIIY   D+I+ L+ G+L+ +  E E G   ++  +  S  G+IAG +V+ G I RN + R+KR  +E+I    I+SL+  K+ +     G ECG  L NF D +EGDI+E Y+I   + E
  S:   337 ISIKDLASEMKLKASQLVGKLFLQGIVVTLNDLLEDETTAQLLGQEFGCEITIDTAEEKRIQITDKSIREELQ-QSPTDQLQLRPPVVAFMGHVDHGKTSLIDAIRKSNRAAGEAGAITQHIGAFRCHTTVGDIAILDTPGHEAFSAMRARGADVTDIVVLVVAGDEGLRQQSIEAIQHARAANVIIVVAINKCDKPNFNPDNVYRQLAEQNLLPEPWGGQTITVNCSAVTGEGIPELLEMLALQAEVLELRANPSMRARGTVLESEMHKGLGSVATILVQNGTLKRGDALVFGLLWGRVKTMHDEYGKELQEAGPSTPVEITGLSGLPEAGQEFIVVKNEKEAREIANVRSEGARQNTFMLQQKKKVSMENMLQQASATGKKMLNIVLRADVQGSLEALKVALLKIESDKADLNIIFNGVGEVSESDVQLAAASKAIVLGFHTQIESHAEALVKQLGVQVRLHNIIYHAIDDIKVLMAGLLEKIAQETEKGKAIVKATFKSSQAGIIAGCQVIEGSIHRNNYVRLKR-GQEVIWKGTISSLKRVKEDVREVQKGIECGILLNNFTDILEGDIIEAYDITYISQE 919
>gi|15640663|ref|NP_230292.1| translation initiation factor IF-2 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587865|ref|ZP_01677622.1| initiation factor IF-2 [Vibrio cholerae 2740-80] >gi|121728406|ref|ZP_01681434.1| initiation factor IF-2 [Vibrio cholerae V52] >gi|147675225|ref|YP_001216137.1| translation initiation factor IF-2 [Vibrio cholerae O395] >gi|153818677|ref|ZP_01971344.1| initiation factor IF-2 [Vibrio cholerae NCTC 8457] >gi|153822528|ref|ZP_01975195.1| initiation factor IF-2 [Vibrio cholerae B33] >gi|153829173|ref|ZP_01981840.1| initiation factor IF-2 [Vibrio cholerae 623-39] >gi|194531817|ref|YP_002067258.1| initiation factor IF-2 [Vibrio cholerae MO10] >gi|172047700|sp|A5F926|IF2_VIBC3 Translation initiation factor IF-2 >gi|20138523|sp|Q9KU80|IF2_VIBCH Translation initiation factor IF-2 >gi|9655079|gb|AAF93809.1| initiation factor IF-2 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547901|gb|EAX57985.1| initiation factor IF-2 [Vibrio cholerae 2740-80] >gi|121629340|gb|EAX61772.1| initiation factor IF-2 [Vibrio cholerae V52] >gi|125617771|gb|EAZ46325.1| initiation factor IF-2 [Vibrio cholerae MO10] >gi|126510757|gb|EAZ73351.1| initiation factor IF-2 [Vibrio cholerae NCTC 8457] >gi|126519946|gb|EAZ77169.1| initiation factor IF-2 [Vibrio cholerae B33] >gi|146317108|gb|ABQ21647.1| initiation factor IF-2 [Vibrio cholerae O395] >gi|148875362|gb|EDL73497.1| initiation factor IF-2 [Vibrio cholerae 623-39] (898 aa)
Score = 1065, Expect = 1.0e-113, Identities = 240/565 (42%), Positives = 356/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK--RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + E ++K++  + E+IK +   G    +N ++D+     +  E G+    ++ + ++N L+     DR+D  ++  R P+VTIMGHVDHGKT+ LD IR++ VA+ EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA  A  P+IV +NK+DK  AN + + ++L++ NV+ EEWGG  M +  SA     ID LLEAI++ AE++ELKA  + +A+G+ IE+ +DKG G VA +LVQSGTL   D +L G+ YG+V+ M D    E++ A PS PV I GL+G+P +GD+  V  DE+  +E++  R       +L  +Q+ KL N  +N+      + ELN++LK D  GS+EAI   L+ +     K+N+V + +G I E+D  LA  S ++VV FN +  +       +  I ++ Y+IIYQ+ DE+++ + G+L P F ++ IG  E+R ++    +G IAG  V  G IKRNA  R+ R D  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E +
  S:   324 IVVSELAQKMSVKATEVIKVMMKMGAMATINQVIDQETAQLVAEEMGH----KVVLRKENELEEAILSDRDDKFEEVSRAPVVTIMGHVDHGKTSTLDYIRRTHVASGEAGGITQHIGAYHVETPNGMITFLDTPGHAAFTAMRARGAQATDIVVLVVAADDGVMPQTVEAIQHAKAAGVPLIVAVNKIDKDTANPDNVKTELSQYNVMPEEWGGDNMFVHISAKQGTNIDGLLEAILLQAEVLELKAVKQGMASGVVIESRLDKGRGPVATVLVQSGTLRKGDIVLCGQEYGRVRAMRDEVGNEVEEAGPSIPVEILGLSGVPAAGDEATVVRDERKAREVANYRAGKFREVKLARQQKSKLENMFSNMTAGD--VAELNIVLKADVQGSVEAIADSLTKLSTDEVKVNIVGSGVGGITETDAVLAAASNAIVVGFNVRADASARRMIEAENIDLRYYSIIYQLIDEVKQAMSGMLSPEFKQEIIGLAEVRDVFKSPKLGAIAGCMVTEGVIKRNAPIRVLR-DNVVIYEGELESLRRFKDDVAEVKNGYECGIGVKNYNDVRVGDQIEVFETI 891
>gi|153802004|ref|ZP_01956590.1| initiation factor IF-2 [Vibrio cholerae MZO-3] >gi|124122463|gb|EAY41206.1| initiation factor IF-2 [Vibrio cholerae MZO-3] (898 aa)
Score = 1064, Expect = 1.1e-113, Identities = 240/565 (42%), Positives = 356/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK--RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + E ++K++  + E+IK +   G    +N ++D+     +  E G+    ++ + ++N L+     DR+D  ++  R P+VTIMGHVDHGKT+ LD IR++ VA+ EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA  A  P+IV +NK+DK  AN + + ++L++ NV+ EEWGG  M +  SA     ID LLEAI++ AE++ELKA  + +A+G+ IE+ +DKG G VA +LVQSGTL   D +L G+ YG+V+ M D    E++ A PS PV I GL+G+P +GD+  V  DE+  +E++  R       +L  +Q+ KL N  +N+      + ELN++LK D  GS+EAI   L+ +     K+N+V + +G I E+D  LA  S ++VV FN +  +       +  I ++ Y+IIYQ+ DE+++ + G+L P F ++ IG  E+R ++    +G IAG  V  G IKRNA  R+ R D  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E +
  S:   324 IVVSELAQKMSVKATEVIKVMMKMGAMATINQVIDQETAQLVAEEMGH----KVVLRKENELEEAILSDRDDKFEEVSRAPVVTIMGHVDHGKTSTLDYIRRTHVASGEAGGITQHIGAYHVETPNGMITFLDTPGHAAFTAMRARGAQATDIVVLVVAADDGVMPQTVEAIQHAKAAGVPLIVAVNKIDKDTANPDNVKTELSQYNVMPEEWGGDNMFVHISAKQGTNIDGLLEAILLQAEVLELKAVKQGMASGVVIESRLDKGRGPVATVLVQSGTLRKGDIVLCGQEYGRVRAMRDEVGNEVEEAGPSIPVEILGLSGVPAAGDEATVVRDERKAREVANYRAGKFREVKLARQQKSKLENMFSNMTAGD--VAELNIVLKADVQGSVEAIADSLTRLSTDEVKVNIVGSGVGGITETDAVLAAASNAIVVGFNVRADASARRMIEAENIDLRYYSIIYQLIDEVKQAMSGMLSPEFKQEIIGLAEVRDVFKSPKLGAIAGCMVTEGVIKRNAPIRVLR-DNVVIYEGELESLRRFKDDVAEVKNGYECGIGVKNYNDVRVGDQIEVFETI 891
>gi|153215851|ref|ZP_01950183.1| initiation factor IF-2 [Vibrio cholerae 1587] >gi|124114568|gb|EAY33388.1| initiation factor IF-2 [Vibrio cholerae 1587] >gi|125620954|gb|EAZ49305.1| initiation factor IF-2 [Vibrio cholerae V51] >gi|150422168|gb|EDN14133.1| initiation factor IF-2 [Vibrio cholerae AM-19226] (898 aa)
Score = 1064, Expect = 1.1e-113, Identities = 240/565 (42%), Positives = 356/565 (63%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDK--RPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKR-------QLNTKQR-KLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEIV 615
           + + E ++K++  + E+IK +   G    +N ++D+     +  E G+    ++ + ++N L+     DR+D  ++  R P+VTIMGHVDHGKT+ LD IR++ VA+ EAG ITQ IGAY VE    +ITF DTPGH AF+ MRA GA  TDIVVLVVAADDG+ PQT EAI HA  A  P+IV +NK+DK  AN + + ++L++ NV+ EEWGG  M +  SA     ID LLEAI++ AE++ELKA  + +A+G+ IE+ +DKG G VA +LVQSGTL   D +L G+ YG+V+ M D    E++ A PS PV I GL+G+P +GD+  V  DE+  +E++  R       +L  +Q+ KL N  +N+      + ELN++LK D  GS+EAI   L+ +     K+N+V + +G I E+D  LA  S ++VV FN +  +       +  I ++ Y+IIYQ+ DE+++ + G+L P F ++ IG  E+R ++    +G IAG  V  G IKRNA  R+ R D  +I   ++ SLR  KD +A    G ECG  ++N+ND   GD +E++E +
  S:   324 IVVSELAQKMSVKATEVIKVMMKMGAMATINQVIDQETAQLVAEEMGH----KVVLRKENELEEAILSDRDDKFEEVSRAPVVTIMGHVDHGKTSTLDYIRRTHVASGEAGGITQHIGAYHVETPNGMITFLDTPGHAAFTAMRARGAQATDIVVLVVAADDGVMPQTVEAIQHAKAAGVPLIVAVNKIDKDTANPDNVKTELSQYNVMPEEWGGDNMFVHISAKQGTNIDGLLEAILLQAEVLELKAVKQGMASGVVIESRLDKGRGPVATVLVQSGTLRKGDIVLCGQEYGRVRAMRDEVGNEVEEAGPSIPVEILGLSGVPAAGDEATVVRDERKAREVANYRAGKFREVKLARQQKSKLENMFSNMTAGD--VAELNIVLKADVQGSVEAIADSLTRLSTDEVKVNIVGSGVGGITETDAVLAAASNAIVVGFNVRADASARRMIEAENIDLRYYSIIYQLIDEVKQAMSGMLSPEFKQEIIGLAEVRDVFKSPKLGAIAGCMVTEGVIKRNAPIRVLR-DNVVIYEGELESLRRFKDDVAEVKNGYECGIGVKNYNDVRVGDQIEVFETI 891
>gi|15639876|ref|NP_219326.1| translation initiation factor IF-2 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026114|ref|YP_001933886.1| translation initiation factor 2 [Treponema pallidum subsp. pallidum SS14] >gi|6016321|sp|O83861|IF2_TREPA Translation initiation factor IF-2 >gi|3323208|gb|AAC26581.1| translation initiation factor 2 (infB) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018689|gb|ACD71307.1| translation initiation factor 2 [Treponema pallidum subsp. pallidum SS14] (842 aa)
Score = 1064, Expect = 1.2e-113, Identities = 232/565 (41%), Positives = 356/565 (63%)
  Q:    50 NLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQ--------LNTKQRKLSNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVI-FNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           ++++ + +KK+N  ++E+I  LF  G+   +N  +D      L  E+G + +  + + ++  ++++   D   +L  RPP+VT+MGHVDHGKT  LD IR ++VA  E G ITQ IGAY V   K  ITF DTPGHEAF+ MRA GA++TDIVVL+VAADDG+ PQT EAI+HA  +K PIIV INK+D+ DAN  K+ ++LAE  +  EEWGG TM +  SAL   G+D LL+AI++ AE+MEL+AN    A G  IE+ +D G G VA ++V+ G L V D  + G Y G+V+ + +   ++I+ A PS PV I GL G+P +GD + VT+ E++ +++S KRQ         N K+  L     ++ + S  + E  VI+K D  GS+EA+K  L  +     +L ++ +++G+IN+SD+ LA    ++ ++ FN + + + +  A    + IK Y +IYQ  +E+ER ++G+L P   E  +GS E+R+++    +G +AG  VL G +KRNA   + R D  ++ + K++SLR  KD +    +G ECG  +EN+ DF E D +E  E+
  S:   255 SVSVADLAKKMNLKASELIGKLFGMGMMVTMNQSIDADTATILASEYGCEVRI-VSLYDETIIESVG--DEHAVLRARPPVVTVMGHVDHGKTKTLDAIRSTRVAEGEFGGITQHIGAYAVSTPKGSITFLDTPGHEAFTMMRARGAEITDIVVLIVAADDGVMPQTIEAINHAKASKVPIIVAINKIDRADANPNKVMTRLAELGLAPEEWGGDTMYVSISALQGIGLDLLLDAIMLQAEVMELRANYGCCAEGRIIESRIDHGRGIVASVIVRRGVLRVGDTYVAGVYSGRVRAIFNDQGEKIQEATPSMPVEILGLEGMPNAGDPFQVTDSERIARQISLKRQELRRYENARNVKRITLDKLYESIEKGS--VSEFKVIIKGDVQGSVEALKQSLEKLSTDEVQLRVIHSSVGAINDSDVMLAAADSNVTIVGFNVRPTPQAAVLAERERVEIKKYTVIYQAVEEMERAMEGMLKPSLKEVVLGSAEVRKVFKIPKVGSVAGVYVLEGVMKRNAIVHVVR-DGIVLHSGKVSSLRREKDDVKEVHSGFECGVGVENYFDFRERDRLECAEM 822
>gi|33602222|ref|NP_889782.1| translation initiation factor IF-2 [Bordetella bronchiseptica RB50] >gi|39931249|sp|Q7WHG2|IF2_BORBR Translation initiation factor IF-2 >gi|33576660|emb|CAE33738.1| translation initiation factor IF-2 [Bordetella bronchiseptica RB50] (997 aa)
Score = 1064, Expect = 1.3e-113, Identities = 235/564 (41%), Positives = 352/564 (62%)
  Q:    51 LTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKL-----SNFGTNLNENSQGIKELNVILKTDNNGSLEAIKGLLSSIEVTGAKLNLVRAAIGSINESDIDLARTSKSLVVIFNTKVSSKVSDYAISMGITIKNYNIIYQIKDEIERLLKGILDPVFVEKEIGSVEIRQLWSHSSIGVIAGGRVLTGEIKRNAFARIKRKDKEIISNAKINSLRHGKDSIASAAAGKECGFTLENFNDFVEGDIVEIYEI 614
           +++ + + K++  +AE+IK L   G    +N +LD+     +  EFG+        + + FLD       E   + R P+VT+MGHVDHGKT+LLD IR++KVA+ EAG ITQ IGAY VE  + ++TF DTPGHEAF+ MRA GA  TDIV+LVVAADDG+ PQT EAI HA     P++V +NK+DK +AN E++  +L  + V+ EE+GG    +  SA    GID+LLE +++ AEI+ELKA  +  A G+ IEA +DKG G VA +LVQSGTL   D +L G  +G+V+ M+D N K+I+TA PS PV I GL  +P +GD+ +V +DE+  +E++  RQ   +  KL     +   +  +   +G + L +I+KTD  GS EA+   L+ +     ++ +V AA+G I+ESD++LA  S ++V+ FN +        A + GI ++ YNIIY   DE++  + G+L P   E+ IG VE+R++++ S IG +AG  VL G ++R++  R+ R +  +     ++SLR  KD +    +G +CG TL   ND   GD +E++EI
  S:   424 ISVADLAHKMSVKAAEVIKQLMKLGQMVTINQVLDQETAMIVVQEFGHMAIAAKLDDPEAFLDETA-AVTEAEAEPRAPVVTVMGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETGRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTREAIHHAKAGGVPLVVAVNKIDKPEANPERVKQELVAEEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQAEILELKAPIEAPAKGLVIEARLDKGRGPVATILVQSGTLKRGDVVLAGASFGRVRAMLDENGKQIQTAGPSIPVEIQGLTEVPAAGDELMVLSDERKAREIALFRQGKFRDVKLARQQAAKLESMFDNLGEGTQTLALIVKTDVQGSQEALVSSLTKLSTDEVRVQVVHAAVGGISESDVNLAIASNAVVIGFNVRAEQSAKKLAETNGIDLRYYNIIYDAVDEVKAAMSGMLAPEKREEVIGLVEVREVYTISRIGTVAGCMVLDGVVRRDSQVRLLRNNV-VQWTGHLDSLRRFKDDVKEVKSGFDCGLTLRGNNDLQLGDQLEVFEI 990
>gi|49475027|ref|YP_033068.1| translation initiation factor IF-2 [Bartonella henselae str. Houston-1] >gi|81827749|sp|Q6G4W7|IF2_BARHE Translation initiation factor IF-2 >gi|49237832|emb|CAF27027.1| Translation initiation factor [Bartonella henselae str. Houston-1] (845 aa)
Score = 1063, Expect = 1.4e-113, Identities = 235/569 (41%), Positives = 354/569 (62%)
  Q:    46 VFTNNLTIDEFSKKINKHSAEIIKYLFLKGINCNLNTLLDERQMGELCLEFGYDFKKEIQINEDNFLDNIKFEDREDLLDKRPPIVTIMGHVDHGKTTLLDTIRKSKVAATEAGNITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGLKPQTEEAIDHALFAKAPIIVFINKMDKKDANIEKIYSQLAEKNVLCEEWGGKTMVIKGSALNNQGIDELLEAIIVTAEIMELKANPKRLANGITIEASMDKGEGAVADLLVQSGTLAVNDYILVGEYYGKVKKMVDFNRKEIKTALPSTPVRISGLNGIPKSGDKWIVTNDEKLLKELSEKRQLNTKQRKLSNFGTNLNENSQ--------GIKELNVILKTDNNGSLEAIKGLLSSIEV