>gi|26553566|ref|NP_757500.1| ribosome-binding factor A [Mycoplasma penetrans HF-2] >gi|29427771|sp|Q8EWT9|RBFA_MYCPE Ribosome-binding factor A >gi|26453572|dbj|BAC43904.1| ribosome binding factor A [Mycoplasma penetrans HF-2] (116 aa)
Score = 476, Expect = 1.5e-46, Identities = 115/116 (99%), Positives = 116/116 (100%)
  Q:     1 VKHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +KHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK
  S:     1 MKHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
>gi|31544320|ref|NP_852898.1| ribosome-binding factor A [Mycoplasma gallisepticum R] >gi|39931736|sp|Q7NBZ3|RBFA_MYCGA Ribosome-binding factor A >gi|31541164|gb|AAP56466.1| RbfA [Mycoplasma gallisepticum R] (121 aa)
Score = 185, Expect = 9.5e-13, Identities = 46/111 (41%), Positives = 70/111 (63%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           MS +K  R E+ I  L+S AI+T + + LIK + +  + LS DKS+AK+YI C     I K L+    A+G FR +L+K+L +R+ P +VF  D+SI K  +I+ +L +IK
  S:     3 MSKIKTLRLEATIHKLLSQAISTEINNSLIKTSVITAIKLSDDKSVAKIYIDCLIPNNIAKTLQAYKDATGVFRHVLSKHLTIRRIPQLVFYYDDSISKGAKIDQILAEIK 113
>gi|171920984|ref|ZP_02932110.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179150|ref|ZP_02964865.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024214|ref|ZP_02996921.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039432|ref|ZP_02998196.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 8] >gi|188518619|ref|ZP_03004067.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524497|ref|ZP_03004497.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530885|ref|ZP_03005168.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568594|ref|ZP_03005387.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 2] >gi|188592404|ref|ZP_03005773.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 10] >gi|171903014|gb|EDT49303.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208930|gb|EDU05973.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018868|gb|EDU56908.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997854|gb|EDU66951.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659670|gb|EDX53050.1| ribosome-binding factor A [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (116 aa)
Score = 165, Expect = 1.6e-10, Identities = 39/110 (35%), Positives = 67/110 (60%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + V++ R ES+IKD+I++A+   + D + K A V  V LS D S+AK+++  + +  + K+L+ +N  SG  R+ LA      K P + F+ DE+ID  + I+ L ++IK
  S:     3 NEVRVARLESLIKDVINNALANEINDKIAKLARVTAVRLSNDLSVAKIFLDAHKRESMPKVLENVNKVSGLLRSKLAAEWTSYKVPELRFVIDETIDYANHIDELFKKIK 112
>gi|13357881|ref|NP_078155.1| ribosome-binding factor A [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762143|ref|YP_001752403.1| ribosome-binding factor A [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920191|ref|ZP_02931575.1| ribosome-binding factor A [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508773|ref|ZP_02958240.1| ribosome-binding factor A [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701715|ref|ZP_02971407.1| ribosome-binding factor A [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189039566|sp|B1AIV9|RBFA_UREP2 Ribosome-binding factor A >gi|20978664|sp|Q9PQH0|RBFA_UREPA Ribosome-binding factor A >gi|11357047|pir||C82906 ribosome binding factor A UU321 [imported] - Ureaplasma urealyticum >gi|6899298|gb|AAF30730.1|AE002129_6 ribosome binding factor A [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827720|gb|ACA32982.1| ribosome-binding factor A [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902569|gb|EDT48858.1| ribosome-binding factor A [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675715|gb|EDT87620.1| ribosome-binding factor A [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700982|gb|EDU19264.1| ribosome-binding factor A [Ureaplasma parvum serovar 6 str. ATCC 27818] (116 aa)
Score = 162, Expect = 4.0e-10, Identities = 39/110 (35%), Positives = 67/110 (60%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + V++ R ES+IKD+I++A+   + D + K A V  V LS D S+AK+++  + +  + K+L+ +N  SG  R+ LA      K P + F+ DE+ID  + I+ L ++IK
  S:     3 NEVRVARLESLIKDVINNALANEINDKIAKLARVTAVRLSNDLSVAKIFLDAHKRESMLKVLENVNKVSGLLRSKLAAEWTSYKVPELRFVIDETIDYANHIDELFKKIK 112
>gi|13507895|ref|NP_109844.1| ribosome binding factor A [Mycoplasma pneumoniae M129] >gi|2496316|sp|P75589|RBFA_MYCPN Ribosome-binding factor A >gi|46015193|pdb|1PA4|A Chain A, Solution Structure Of A Putative Ribosome-Binding Factor From Mycoplasma Pneumoniae (Mpn156) >gi|1674381|gb|AAB96323.1| ribosome binding factor A [Mycoplasma pneumoniae M129] (116 aa)
Score = 157, Expect = 1.7e-09, Identities = 40/111 (36%), Positives = 63/111 (56%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M++ K ER E+ I  LI+  +   +Y++ +K   V +V LS D     VY+ CY++  ID+++   N A G F  +LA NL L KA  I F+ D++ID    I S++  +K
  S:     1 MASYKKERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAMRIESIINSLK 111
>gi|12044995|ref|NP_072805.1| ribosome-binding factor A [Mycoplasma genitalium G37] >gi|66879983|ref|ZP_00404970.1| COG0858: Ribosome-binding factor A [Mycoplasma genitalium G-37] >gi|1723113|sp|P47389|RBFA_MYCGE Ribosome-binding factor A >gi|3844736|gb|AAC71361.1| ribosome-binding factor A [Mycoplasma genitalium G37] >gi|166078882|gb|ABY79500.1| ribosome-binding factor A [synthetic Mycoplasma genitalium JCVI-1.0] (112 aa)
Score = 146, Expect = 2.9e-08, Identities = 37/111 (33%), Positives = 63/111 (56%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M++ + +R E+ I  LI+  I   +YD ++K   V +V LS D   A VY+ CYD++ I  ++     A G F  +LA+NL L K+  + F+ D++ID   +I  ++  +K
  S:     1 MASYRKQRIENDIIRLINRTIINEIYDPVVKLGHVSHVKLSADFFHAVVYLDCYDRSQIQTVVNAFKKAQGVFSQMLAQNLYLAKSVKLHFVKDDAIDNALKIEQIINSLK 111
>gi|167627173|ref|YP_001677673.1| ribosome-binding factor A [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189039542|sp|B0TWR4|RBFA_FRAP2 Ribosome-binding factor A >gi|167597174|gb|ABZ87172.1| ribosome-binding factor A [Francisella philomiragia subsp. philomiragia ATCC 25017] (143 aa)
Score = 146, Expect = 3.0e-08, Identities = 39/105 (37%), Positives = 61/105 (58%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +++R  S ++ +IS  + T + D  +  AT+  V LSKD S AKVY +C D      I K    + GFFR+ +AK+LNLR  P + F+ D+S+D   E+   ++Q
  S:     6 RVQRVASELQKVISLLLRTKIKDSKLATATITEVELSKDLSYAKVYYTCLDIQEAQYISKAFEKSKGFFRSSIAKSLNLRIVPNLKFVYDKSLDYGMEMEGKIQQ 110
>gi|160903126|ref|YP_001568707.1| ribosome-binding factor A [Petrotoga mobilis SJ95] >gi|182676541|sp|A9BI93|RBFA_PETMO Ribosome-binding factor A >gi|160360770|gb|ABX32384.1| ribosome-binding factor A [Petrotoga mobilis SJ95] (117 aa)
Score = 143, Expect = 6.8e-08, Identities = 44/111 (39%), Positives = 64/111 (57%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLI-KQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  + E  ES +K LI+   + L    L  K   ++ V LSKDKS   VY+S  D+ I D I+  +N A G FRT++AKN+ + K P + F  DE I+    IN L+E+I+
  S:     1 MAQYRREMLESEMKKLITQGFSQLKDPRLKDKFIDINMVRLSKDKSYLDVYVSSLDEDI-DTIINILNNAKGMFRTLIAKNIKMFKVPEVRFHKDEGIEASIRINKLIEKIE 111
>gi|188586071|ref|YP_001917616.1| ribosome-binding factor A [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350758|gb|ACB85028.1| ribosome-binding factor A [Natranaerobius thermophilus JW/NM-WN-LF] (131 aa)
Score = 142, Expect = 8.5e-08, Identities = 42/110 (38%), Positives = 61/110 (55%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           MS ++ E+ +  +K +IS  +   V D  +   TV  V LS D   AKV++S   +K      L+ +  A+GF R+ L K + LR  P IVF  DESI+  D IN LL+Q+
  S:     1 MSGMRKEKLQEELKKIISDILQREVKDPSVGFVTVTSVDLSGDLRHAKVFVSILGEKENQQDSLRGLEKATGFIRSELGKRVRLRHVPEIVFKFDESIEHGDHINKLLKQM 111
>gi|119509684|ref|ZP_01628830.1| ribosome-binding factor A [Nodularia spumigena CCY9414] >gi|119465703|gb|EAW46594.1| ribosome-binding factor A [Nodularia spumigena CCY9414] (142 aa)
Score = 135, Expect = 5.9e-07, Identities = 34/110 (30%), Positives = 65/110 (59%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +N +I R   +IK  +S  +   + DD +     +V YV +S D   AKVY+S Y  ++   + +  +  A+GF R+ L   + LR+ P ++F+ D+SI++ +++ SLL +++
  S:     3 TNRRISRVAELIKREVSQMLLHGIKDDRVGTGMVSVTYVDVSGDLQHAKVYVSIYGTESAKSETMAGLKSATGFVRSELGSRVRLRRTPEVIFIEDDSIEQGNKVLSLLNKLE 115
>gi|32307616|gb|AAP79213.1| ribosome-binding factor A [Bigelowiella natans] (198 aa)
Score = 135, Expect = 6.1e-07, Identities = 29/85 (34%), Positives = 55/85 (64%)
  Q:    30 DDLIKQATVHYVT---LSKDKSIAKVYI--SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           DD I+  T+  VT   +S+D S+AK+Y+  S   K     IL ++N   G+ R ++++ LNLR++P +VF  D ++++ DE+  ++  ++
  S:    98 DDDIRNMTIASVTEVQMSRDLSVAKLYLMFSGGTKKSYQPILDRLNAKKGYIRRVVSQRLNLRRSPELVFYEDNTLNEADEMKRIMAVLR 187
>gi|86607701|ref|YP_476463.1| ribosome-binding factor A [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123504067|sp|Q2JPS6|RBFA_SYNJB Ribosome-binding factor A >gi|86556243|gb|ABD01200.1| ribosome-binding factor A [Synechococcus sp. JA-2-3B'a(2-13)] (144 aa)
Score = 133, Expect = 8.6e-07, Identities = 30/107 (28%), Positives = 61/107 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYV--TLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ R   +IK  +S  + + + DD +    V  V   +S D   A++++S Y D+T   + ++ +  A+ F R  + + L+LR+ P +VFL D S+++   + +LL Q++
  S:     6 RVARVAELIKREVSQILLSEIKDDRVGAGMVSIVDVEVSNDLQNARIFVSIYGDETAQHQAMEGLAAATPFVRREIGQRLSLRRVPTVVFLQDRSLERGSRVLALLNQLR 115
>gi|124024303|ref|YP_001018610.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9303] >gi|166219388|sp|A2CCY5|RBFA_PROM3 Ribosome-binding factor A >gi|123964589|gb|ABM79345.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9303] (142 aa)
Score = 131, Expect = 1.4e-06, Identities = 33/107 (30%), Positives = 60/107 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTII-DKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + Q  V    V +S D    K+++S Y + I   ++L+ +  ASGF R  L + L +R+AP + F  D  I+K   + +LLEQ++
  S:     6 RVERVAALIRRETSELLIHGIRDERVHQGMVSITNVEVSGDLQHCKIFVSIYGEEIQRSEVLEGLEAASGFLRGELGRRLQMRRAPEVHFHLDRGIEKGTSVLNLLEQLE 115
>gi|33864228|ref|NP_895788.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9313] >gi|39931781|sp|Q7V4I8|RBFA_PROMM Ribosome-binding factor A >gi|33635812|emb|CAE22137.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9313] (142 aa)
Score = 131, Expect = 1.4e-06, Identities = 33/107 (30%), Positives = 60/107 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTII-DKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + Q  V    V +S D    K+++S Y + I   ++L+ +  ASGF R  L + L +R+AP + F  D  I+K   + +LLEQ++
  S:     6 RVERVAALIRRETSELLIHGIRDERVHQGMVSITNVEVSGDLQHCKIFVSIYGEEIQRSEVLEGLEAASGFLRGELGRRLQMRRAPEVHFHLDRGIEKGTSVLNLLEQLE 115
>gi|159030294|emb|CAO91189.1| rbfA [Microcystis aeruginosa PCC 7806] (130 aa)
Score = 131, Expect = 1.5e-06, Identities = 34/107 (31%), Positives = 59/107 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ R  S+IK  +S  +   + DD +    V    V LS D   A++++S Y +K    + +  +  A+GF R  L + + LR+ P +VFL D S+++ D +  LL+ IK
  S:     6 RVSRVSSLIKREVSQMLLMEIKDDRVGAGMVSVTDVDLSHDLQHARIFVSIYGNKDAKAETMAGLKAAAGFVRRELGQRIRLRRTPEVVFLEDSSLERGDRMLHLLDHIK 115
>gi|192359933|ref|YP_001980960.1| ribosome-binding factor A [Cellvibrio japonicus Ueda107] >gi|190686098|gb|ACE83776.1| ribosome-binding factor A [Cellvibrio japonicus Ueda107] (136 aa)
Score = 130, Expect = 2.3e-06, Identities = 32/103 (31%), Positives = 60/103 (58%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI---NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +R    I+ L++  I   V D  +    ++ V +S+D + AKVY++    T   K L+ I   N ASGF R+ +A+ L++R  P + F+ D++  +  E++SL+++
  S:     9 DRVSDAIQRLLAQVIPQEVRDPRLGMVNINAVAVSRDMAFAKVYVTFVGVTDEPKSLEGIGILNKASGFLRSFVARELSMRTVPKLQFIYDKTSIRGQELSSLIDR 114
>gi|118498221|ref|YP_899271.1| ribosome-binding factor A [Francisella tularensis subsp. novicida U112] >gi|194324405|ref|ZP_03058178.1| ribosome-binding factor A [Francisella tularensis subsp. novicida FTE] >gi|166218439|sp|A0Q8F2|RBFA_FRATN Ribosome-binding factor A >gi|118424127|gb|ABK90517.1| ribosome-binding factor A [Francisella tularensis subsp. novicida U112] >gi|151571289|gb|EDN36943.1| ribosome-binding factor A [Francisella tularensis subsp. novicida GA99-3549] >gi|151572747|gb|EDN38401.1| ribosome-binding factor A [Francisella tularensis subsp. novicida GA99-3548] >gi|194321470|gb|EDX18955.1| ribosome-binding factor A [Francisella tularensis subsp. novicida FTE] (143 aa)
Score = 129, Expect = 2.6e-06, Identities = 35/105 (33%), Positives = 60/105 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +++R  S ++ +IS  + T + D  +  AT+  V LSKD S AK+Y +C      + I K    + GFFR+ +AK+L+LR  P + F+ D S+D   ++   ++Q
  S:     6 RVQRVASELQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQ 110
>gi|167464644|ref|ZP_02329733.1| ribosome-binding factor A [Paenibacillus larvae subsp. larvae BRL-230010] (118 aa)
Score = 129, Expect = 2.7e-06, Identities = 39/110 (35%), Positives = 58/110 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+ V++ R    IK  +S  + + + D  I   T+  V ++ D S+AKVY+S        +  LK +  ASG+ R+ L K + LRK P + F  D SID    I SLL+ I
  S:     1 MARVRVGRVGEQIKKELSQIVQSELKDPRIGFLTITGVDVTNDLSLAKVYLSVLGSDEEKEATLKALGVASGYIRSELGKRIRLRKVPELQFKFDTSIDYGSRIESLLQDI 111
>gi|160913526|ref|ZP_02076217.1| hypothetical protein EUBDOL_00002 [Eubacterium dolichum DSM 3991] >gi|158434078|gb|EDP12367.1| hypothetical protein EUBDOL_00002 [Eubacterium dolichum DSM 3991] (120 aa)
Score = 128, Expect = 3.3e-06, Identities = 36/107 (33%), Positives = 65/107 (60%)
  Q:     7 VKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI-LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +K E+   II+  +S  I   + D  I   T+  V +S D SIAKVY+S   +   +   +K +  + GF R+ LAK + +RK P++VFL D+S++K ++I ++++++
  S:    11 LKTEKIAGIIQKEVSEIIQFQLKDPKIGFITITDVVVSGDLSIAKVYVSFLGQKAREAAGMKALERSKGFIRSELAKRMTIRKVPSLVFLIDDSLEKGNKIENIIKEL 118
>gi|86605483|ref|YP_474246.1| ribosome-binding factor A [Synechococcus sp. JA-3-3Ab] >gi|123507268|sp|Q2JW85|RBFA_SYNJA Ribosome-binding factor A >gi|86554025|gb|ABC98983.1| ribosome-binding factor A [Synechococcus sp. JA-3-3Ab] (149 aa)
Score = 128, Expect = 3.4e-06, Identities = 29/107 (27%), Positives = 59/107 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYV--TLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ R   +IK  +S  + + + DD +    V  V   +S D   A++++S Y D+    + ++ +  A+ F R  + + L LR+ P +VFL D S+++   + +LL Q++
  S:     6 RVARVAELIKREVSQILLSEIKDDRVGAGMVSIVDVEVSNDLQNARIFVSIYGDEAAQQQTMEGLASATPFVRREIGQRLGLRRVPTVVFLQDRSLERGSRVLALLNQLR 115
>gi|56707230|ref|YP_169126.1| ribosome-binding factor A [Francisella tularensis subsp. tularensis SCHU S4] >gi|89257071|ref|YP_514433.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica] >gi|110669700|ref|YP_666257.1| ribosome-binding factor A [Francisella tularensis subsp. tularensis FSC198] >gi|115315427|ref|YP_764150.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica OSU18] >gi|134301265|ref|YP_001121233.1| ribosome-binding factor A [Francisella tularensis subsp. tularensis WY96-3418] >gi|156503281|ref|YP_001429346.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009458|ref|ZP_02274389.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica FSC200] >gi|187931007|ref|YP_001890991.1| ribosome-binding factor A [Francisella tularensis subsp. mediasiatica FSC147] >gi|122324587|sp|Q0BK71|RBFA_FRATO Ribosome-binding factor A >gi|122500221|sp|Q2A1G9|RBFA_FRATH Ribosome-binding factor A >gi|123063628|sp|Q14K19|RBFA_FRAT1 Ribosome-binding factor A >gi|166218438|sp|A7NEI7|RBFA_FRATF Ribosome-binding factor A >gi|166218440|sp|A4IW11|RBFA_FRATW Ribosome-binding factor A >gi|61214713|sp|Q5NIL6|RBFA_FRATT Ribosome-binding factor A >gi|54114151|gb|AAV29709.1| NT02FT1759 [synthetic construct] >gi|56603722|emb|CAG44684.1| Ribosome-binding factor A [Francisella tularensis subsp. tularensis SCHU S4] >gi|89144902|emb|CAJ80247.1| Ribosome-binding factor A [Francisella tularensis subsp. holarctica LVS] >gi|110320033|emb|CAL08067.1| Ribosome-binding factor A [Francisella tularensis subsp. tularensis FSC 198] >gi|115130326|gb|ABI83513.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica OSU18] >gi|134049042|gb|ABO46113.1| ribosome-binding factor A [Francisella tularensis subsp. tularensis WY96-3418] >gi|134254118|gb|EBA53212.1| ribosome binding factor A [Francisella tularensis subsp. holarctica 257] >gi|151568161|gb|EDN33815.1| ribosome-binding factor A [Francisella tularensis subsp. tularensis FSC033] >gi|156253884|gb|ABU62390.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122878|gb|EDO66995.1| ribosome-binding factor A [Francisella tularensis subsp. holarctica FSC022] >gi|187711916|gb|ACD30213.1| ribosome-binding factor A [Francisella tularensis subsp. mediasiatica FSC147] (143 aa)
Score = 128, Expect = 3.4e-06, Identities = 35/105 (33%), Positives = 59/105 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +++R  S  + +IS  + T + D  +  AT+  V LSKD S AK+Y +C      + I K    + GFFR+ +AK+L+LR  P + F+ D S+D   ++   ++Q
  S:     6 RVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQ 110
>gi|166363717|ref|YP_001655990.1| ribosome binding factor A [Microcystis aeruginosa NIES-843] >gi|189039547|sp|B0JRP8|RBFA_MICAN Ribosome-binding factor A >gi|166086090|dbj|BAG00798.1| ribosome binding factor A [Microcystis aeruginosa NIES-843] (128 aa)
Score = 128, Expect = 3.4e-06, Identities = 33/107 (30%), Positives = 59/107 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ R  S+IK  +S  +   + DD +    V    V LS D   AK+++S Y ++    + +  +  ++GF R  L + + LR+ P +VFL D S+++ D +  LL+ IK
  S:     6 RVSRVSSLIKREVSQMLLMEIKDDRVGAGMVSVTDVDLSHDLQHAKIFVSIYGNEDAKAETMAGLKASAGFVRRELGQRIRLRRTPEVVFLEDSSLERGDRMLHLLDHIK 115
>gi|167756912|ref|ZP_02429039.1| hypothetical protein CLORAM_02461 [Clostridium ramosum DSM 1402] >gi|167703087|gb|EDS17666.1| hypothetical protein CLORAM_02461 [Clostridium ramosum DSM 1402] (115 aa)
Score = 128, Expect = 3.4e-06, Identities = 35/107 (32%), Positives = 62/107 (57%)
  Q:     7 VKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTI-IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +K ++   II+  +S  I   V D  I   T+  V  + D SIAKVY++   K     K ++ +N + GF R++LAK L +RK P ++F+ND S++  ++I  +++ +
  S:     3 LKKDKMNGIIQRELSQIIQVEVRDPKIGFCTITAVDTTTDLSIAKVYVTFLGKDFDTRKGMEALNRSKGFIRSLLAKRLTIRKVPELIFVNDTSLEYGNKIEKIIDDL 110
>gi|169191229|ref|ZP_02851095.1| ribosome-binding factor A [Paenibacillus sp. JDR-2] >gi|169002143|gb|EDS49040.1| ribosome-binding factor A [Paenibacillus sp. JDR-2] (118 aa)
Score = 127, Expect = 4.4e-06, Identities = 37/110 (33%), Positives = 58/110 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+ +++ R    IK  +S  I T + D  I   TV  V  + D S A+VY+S    +   ++ LK +  A+G+ R+ L K + LR  P ++F  D SI+    I  LLE+I
  S:     1 MAKIRVGRVGEQIKKELSQIIQTELKDPRIGFITVTGVEATSDLSQARVYLSVLGSEEQKEETLKALGKANGYLRSELGKRMRLRHTPELLFKFDSSIEYGSRIEGLLEEI 111
>gi|170287879|ref|YP_001738117.1| ribosome-binding factor A [Thermotoga sp. RQ2] >gi|170175382|gb|ACB08434.1| ribosome-binding factor A [Thermotoga sp. RQ2] (131 aa)
Score = 124, Expect = 9.2e-06, Identities = 41/101 (40%), Positives = 55/101 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQ-ATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ES I+ L+  A+  L    L K   T   V LSKDK  A VY+S        K  ++ +N A GFFRT +AKNL L  AP I F  D+ I+   +++ LL Q+
  S:    11 ESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVKVHQLLVQL 113
>gi|15643618|ref|NP_228664.1| ribosome binding factor A [Thermotoga maritima MSB8] >gi|20978666|sp|Q9WZV9|RBFA_THEMA Ribosome-binding factor A >gi|4981389|gb|AAD35937.1|AE001752_4 ribosome binding factor A [Thermotoga maritima MSB8] (131 aa)
Score = 124, Expect = 9.2e-06, Identities = 41/101 (40%), Positives = 55/101 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQ-ATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ES I+ L+  A+  L    L K   T   V LSKDK  A VY+S        K  ++ +N A GFFRT +AKNL L  AP I F  D+ I+   +++ LL Q+
  S:    11 ESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVKVHQLLVQL 113
>gi|116073898|ref|ZP_01471160.1| ribosome-binding factor A [Synechococcus sp. RS9916] >gi|116069203|gb|EAU74955.1| ribosome-binding factor A [Synechococcus sp. RS9916] (133 aa)
Score = 124, Expect = 1.1e-05, Identities = 30/107 (28%), Positives = 60/107 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + Q  V    V +S D    K+++S Y ++    ++L+ +  ASG+ R  L + L +R+AP +VF  D  I+K   + +LL +++
  S:     6 RVERVAALIRRETSELLINGIRDERVHQGMVSITEVEVSGDLQHCKIFVSIYSEEEQRQQVLEGLQAASGYLRGELGRRLQMRRAPEVVFQLDRGIEKGTSVLNLLNRLE 115
>gi|186681202|ref|YP_001864398.1| ribosome-binding factor A [Nostoc punctiforme PCC 73102] >gi|28380131|sp|Q93LL7|RBFA_NOSPU Ribosome-binding factor A >gi|14594717|gb|AAK68649.1| ribosome binding factor A [Nostoc punctiforme] >gi|186463654|gb|ACC79455.1| ribosome-binding factor A [Nostoc punctiforme PCC 73102] (139 aa)
Score = 123, Expect = 1.2e-05, Identities = 32/109 (29%), Positives = 62/109 (56%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +N ++ R   +IK  +S  +   + DD +    V    V +S D   AK+Y+S Y  D+  ++  +  +  A+G+ R+ L   + LR+ P ++FL D SI++ +++ +LL Q+
  S:     3 TNRRVSRVAELIKREVSQMLLNGIKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTDEAKVET-MAGLKSATGYVRSELGARVRLRRTPEVIFLEDRSIERGNKVLALLSQL 114
>gi|139436988|ref|ZP_01771148.1| Hypothetical protein COLAER_00122 [Collinsella aerofaciens ATCC 25986] >gi|133776635|gb|EBA40455.1| Hypothetical protein COLAER_00122 [Collinsella aerofaciens ATCC 25986] (136 aa)
Score = 123, Expect = 1.3e-05, Identities = 28/86 (32%), Positives = 50/86 (58%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V D  +   T+  V ++ D+S A+VY+SC D +  D++++ +  A G  R++LA++L+ R  P + F  D S D+ + I   LE +
  S:    26 VSDPRLDLVTLTAVEVAVDRSFARVYVSC-DASRYDEVMEALASAKGRIRSLLARSLDWRVTPELDFRIDRSTDEAERITRALENV 110
>gi|169350442|ref|ZP_02867380.1| hypothetical protein CLOSPI_01210 [Clostridium spiroforme DSM 1552] >gi|169292762|gb|EDS74895.1| hypothetical protein CLOSPI_01210 [Clostridium spiroforme DSM 1552] (114 aa)
Score = 123, Expect = 1.5e-05, Identities = 34/107 (31%), Positives = 60/107 (56%)
  Q:     7 VKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTI-IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +K E+   II+  +S  +   V D  I   T+  V L+ D SIAK+Y++   K     K ++ +  + GF R++LAK L +RK P + F+ND S+   ++I  +++ +
  S:     3 LKKEKVSGIIQRELSQILQMEVRDPKIGFCTITAVDLTNDLSIAKIYVTFLGKDFDTRKGMQALERSKGFIRSLLAKRLTIRKVPELHFVNDTSLQYGNKIEKIIDDL 110
>gi|56751167|ref|YP_171868.1| ribosome-binding factor A [Synechococcus elongatus PCC 6301] >gi|81299166|ref|YP_399374.1| ribosome-binding factor A [Synechococcus elongatus PCC 7942] >gi|123557478|sp|Q31RD2|RBFA_SYNP7 Ribosome-binding factor A >gi|61214698|sp|Q5N2X2|RBFA_SYNP6 Ribosome-binding factor A >gi|56686126|dbj|BAD79348.1| ribosome binding factor A [Synechococcus elongatus PCC 6301] >gi|81168047|gb|ABB56387.1| ribosome-binding factor A [Synechococcus elongatus PCC 7942] (137 aa)
Score = 122, Expect = 2.0e-05, Identities = 29/109 (26%), Positives = 62/109 (56%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTIID-KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +N ++ER  S+IK  +S  + + + DD +    V    V +S D    K+++S Y       + ++ +  A+ + R+ L + + LR+ P ++F+ D+ +++  ++ SLLEQ+
  S:     3 TNRRVERVASLIKREVSQMLMSGIKDDRVGAGMVSVTDVVVSGDLQHTKIFVSIYGTPEAKAETMEGLKSAASYVRSELGQRVRLRRTPEVIFVEDKGLERGTQVISLLEQL 114
>gi|196241612|ref|ZP_03140374.1| ribosome-binding factor A [Cyanothece sp. PCC 7425] >gi|196214367|gb|EDY09024.1| ribosome-binding factor A [Cyanothece sp. PCC 7425] (134 aa)
Score = 121, Expect = 2.0e-05, Identities = 31/109 (28%), Positives = 60/109 (55%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ ++ R   +IK  IS  + + + DD +    V    V LS D   AK+++S Y  +    + +  +  A+G+ R+ L   + LR+ P +VFL D S+++  ++ SLL ++
  S:     3 TDRRVARVAELIKREISQMLMSGIKDDRVGSGMVSVTDVDLSGDLQHAKIFVSIYGTEAARAETMAGLKAATGYVRSELGHRVRLRRTPEVVFLEDRSLERGTQVLSLLNRL 114
>gi|89095213|ref|ZP_01168136.1| Ribosome-binding factor A [Oceanospirillum sp. MED92] >gi|89080510|gb|EAR59759.1| Ribosome-binding factor A [Oceanospirillum sp. MED92] (135 aa)
Score = 121, Expect = 2.1e-05, Identities = 36/104 (34%), Positives = 58/104 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYD-------KTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           + ER    ++  ++  I   + D  +   TV YV +SKD   A VYI+          + I+D  LK +N A+GF R  LA+N+ LR  P + F  DE+I++   ++ L+E
  S:     7 RTERIADQLQRELAQLIQFEIKDPRLGMVTVSYVKVSKDLGFADVYITVLPLNGKDEAEAIVDS-LKVLNSAAGFLRGELARNIKLRIMPQLRFHFDETIERGRHLHHLIE 116
>gi|148269217|ref|YP_001243677.1| ribosome-binding factor A [Thermotoga petrophila RKU-1] >gi|166199572|sp|A5IIS8|RBFA_THEP1 Ribosome-binding factor A >gi|147734761|gb|ABQ46101.1| ribosome-binding factor A [Thermotoga petrophila RKU-1] (131 aa)
Score = 121, Expect = 2.3e-05, Identities = 40/101 (39%), Positives = 55/101 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQ-ATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ES I+ L+  A+  L    L K   T   V LSKDK  A VY+S        K  ++ +N A GFFRT ++KNL L  AP I F  D+ I+   +++ LL Q+
  S:    11 ESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFISKNLRLYVAPEIRFYEDKGIEASVKVHQLLVQL 113
>gi|78213858|ref|YP_382637.1| ribosome-binding factor A [Synechococcus sp. CC9605] >gi|123577495|sp|Q3AH50|RBFA_SYNSC Ribosome-binding factor A >gi|78198317|gb|ABB36082.1| ribosome-binding factor A [Synechococcus sp. CC9605] (140 aa)
Score = 121, Expect = 2.3e-05, Identities = 28/107 (26%), Positives = 59/107 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+  +S  +   + D+ +    V    V +S D    K+++S + +    D++L+ +  ASGF R  L + L +R+AP +VF  D  +++   +  LL +++
  S:     6 RVERVAALIRKEVSELMINGIRDERVHHGMVSITEVEVSGDLQHCKIFVSVFGEAQERDQVLEGLQAASGFLRGELGRRLQMRRAPEVVFQLDRGLERGTSVLGLLNRLE 115
>gi|118602113|ref|YP_903328.1| ribosome-binding factor A [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|171704478|sp|A1AVA0|RBFA_RUTMC Ribosome-binding factor A >gi|118567052|gb|ABL01857.1| ribosome-binding factor A [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (112 aa)
Score = 121, Expect = 2.4e-05, Identities = 35/109 (32%), Positives = 63/109 (57%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVY--ISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ ++ER   +I+  ++  + T   D  +    +  V  S+D S AKV+  ++  D+T+++ IL K   ASGFFR+ L+K L+LR  PA+ F+ D + +    I  LL ++
  S:     5 TSYRVERISELIRRELTLLLKTTTKDPRLSGVMITDVLASRDLSSAKVFYTVTKEDRTVVEPILSK---ASGFFRSRLSKTLDLRHTPALGFIFDSASNTGARIEQLLSKL 112
>gi|42526615|ref|NP_971713.1| ribosome-binding factor A [Treponema denticola ATCC 35405] >gi|61215109|sp|Q73NP7|RBFA_TREDE Ribosome-binding factor A >gi|41816808|gb|AAS11594.1| ribosome-binding factor A [Treponema denticola ATCC 35405] (132 aa)
Score = 120, Expect = 2.7e-05, Identities = 37/106 (34%), Positives = 63/106 (59%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD--LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK-IDEINSL 109
           MS  ++ R    I++ IS  I +    D  +    +++ V +S D + AKVY+S + D+    + ++ +  ASGF RT LAK L++R+ P + F+ D+SI + ID +N L
  S:     1 MSEFRLARLGEQIREEISALICSGKIKDPRVSSLLSINRVIVSGDLAYAKVYVSSFLDEHKTKQGVRGLENASGFIRTSLAKKLHVRQCPELTFIFDKSIKEGIDMVNKL 110
>gi|167630360|ref|YP_001680859.1| ribosome-binding factor a [Heliobacterium modesticaldum Ice1] >gi|167593100|gb|ABZ84848.1| ribosome-binding factor a [Heliobacterium modesticaldum Ice1] (121 aa)
Score = 120, Expect = 2.8e-05, Identities = 34/111 (30%), Positives = 60/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  ++ R    IK  ++  +   + D  +   ++  V +S D   AKVY+S   D++  D     +  A+GF RT L+K+L +R  P +VFL+D SI++   I  LL +++
  S:     1 MAGHRMARMAEEIKRELARLLRDEMKDPRLGFVSITAVEVSGDGRHAKVYVSVMGDESARDNSQAALKQATGFLRTELSKSLRVRYVPELVFLSDLSIERGTRIARLLTEME 112
>gi|196181283|gb|EDX76271.1| ribosome-binding factor A [Microcoleus chthonoplastes PCC 7420] (132 aa)
Score = 120, Expect = 2.8e-05, Identities = 30/109 (27%), Positives = 58/109 (53%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +N ++ R  S+I+  +S  +   + DD +    V    V +S D   AK+Y+S Y  +    + +  +  A+GF R  L + + LR+ P +VF+ D  +++   + +LL Q+
  S:     3 TNRRVSRVSSLIQQEVSQMLLHDIKDDRVGAGMVSVTDVDVSGDLQHAKIYVSIYGTEEAKSETMAGLQSATGFVRRELGRRVRLRRTPEVVFIEDRGLERGARMLTLLNQL 114
>gi|124024898|ref|YP_001014014.1| ribosome-binding factor A [Prochlorococcus marinus str. NATL1A] >gi|166219387|sp|A2BZT9|RBFA_PROM1 Ribosome-binding factor A >gi|123959966|gb|ABM74749.1| Ribosome-binding factor A [Prochlorococcus marinus str. NATL1A] (123 aa)
Score = 120, Expect = 3.3e-05, Identities = 33/107 (30%), Positives = 63/107 (58%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++E+  +++K  IS  +   + D+ I QA  T+  V +S D   A+++IS + ++   D++L  +  A GF R  LA+ L +R++P +VF  D+ + K  E+  LL  ++
  S:     6 RVEKLAALLKREISELLVNGIRDERIHQAMITITSVEVSGDLQHARIFISLFGEEKKKDQVLVGLEEAKGFIRAELARRLQMRRSPELVFKIDKGMTKGPEVLDLLNALE 115
>gi|113476475|ref|YP_722536.1| ribosome-binding factor A [Trichodesmium erythraeum IMS101] >gi|123056530|sp|Q110L1|RBFA_TRIEI Ribosome-binding factor A >gi|110167523|gb|ABG52063.1| ribosome-binding factor A [Trichodesmium erythraeum IMS101] (137 aa)
Score = 119, Expect = 3.6e-05, Identities = 33/106 (31%), Positives = 60/106 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDL--IKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +I R  S+IK  IS  +   + D+   I   +V  V +S D   AKV++S Y    +  + +  +  A+G+ R+ L K + +R+ P ++F+ D S+++  EI SLL ++
  S:     6 RISRIASLIKQEISQMLLHGIKDNRVGIGMVSVTDVDVSGDLQHAKVFVSIYGSDEVRSQTMAGLRSATGYVRSELGKRIRMRRTPEVIFVEDRSLERGTEILSLLNKL 114
>gi|22299172|ref|NP_682419.1| ribosome-binding factor A [Thermosynechococcus elongatus BP-1] >gi|29427713|sp|Q8DIF9|RBFA_SYNEL Ribosome-binding factor A >gi|22295354|dbj|BAC09181.1| ribosome binding factor A [Thermosynechococcus elongatus BP-1] (126 aa)
Score = 119, Expect = 3.7e-05, Identities = 30/106 (28%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ R   +IK  +S  +   + D+ +    V    V +S D   AK+++S Y    + +  +  +  ASGF R  L + + LR+ P +VF+ D S+++   + +LL QI
  S:     6 RVARVAELIKREVSQLLMYEIRDERVGAGMVSVTDVEVSGDLQHAKIFVSIYSTEEVRRSTMAGLKAASGFVRRELGQRIRLRRTPEVVFIEDRSLERGSRVLALLNQI 114
>gi|119486756|ref|ZP_01620731.1| ribosome-binding factor A [Lyngbya sp. PCC 8106] >gi|119456049|gb|EAW37182.1| ribosome-binding factor A [Lyngbya sp. PCC 8106] (142 aa)
Score = 119, Expect = 4.1e-05, Identities = 30/109 (27%), Positives = 60/109 (55%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ ++ R  ++IK  +S  +   V DD +    V    V ++ D    K+++S Y      K  ++ +  A+G+ R+ L + + LR+ P ++FL D S+++ D++ SLL  I
  S:     3 TDRRVSRVAALIKREVSQILLQEVKDDRVGSGMVSITDVNVAGDLQHVKIFVSIYGTEEARKETMEGLRAATGYIRSSLGQRVRLRRTPEVLFLEDRSLERGDKMLSLLNHI 114
>gi|192812889|ref|ZP_03041555.1| ribosome-binding factor A [Geobacillus sp. Y412MC10] >gi|192798217|gb|EDV74731.1| ribosome-binding factor A [Geobacillus sp. Y412MC10] (117 aa)
Score = 119, Expect = 4.1e-05, Identities = 40/110 (36%), Positives = 55/110 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+ ++  R    IK  +S  I T + D  I   TV  V ++ D S AKVY+S   D       LK +  ASGF R+ L K + LR  P ++F  D+SI     I  LL +I
  S:     1 MAKIRTGRVGEQIKKELSQLIQTELKDPRIGFITVTGVDVTNDLSQAKVYLSVLGDDEQKAASLKGLEKASGFLRSELGKRIRLRHVPELIFKFDDSIAYGSHIEKLLTEI 111
>gi|196256559|ref|ZP_03155096.1| ribosome-binding factor A [Cyanothece sp. PCC 7822] >gi|196201954|gb|EDX96772.1| ribosome-binding factor A [Cyanothece sp. PCC 7822] (133 aa)
Score = 119, Expect = 4.3e-05, Identities = 31/110 (28%), Positives = 59/110 (53%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ ++ R  S+IK  +S  +   + DD +    V    V +S D   AK+++S Y  +    + ++ +  ++GF R  L + + LR+ P IVF  D S+++ D    LL Q++
  S:     3 TDRRVSRVSSLIKREVSQMLLYEIKDDRVGAGMVSVTDVDVSGDLQHAKIFVSIYGTEQAKAETMEGLRSSAGFVRRELGQRIRLRRTPEIVFFEDRSLERGDRTLHLLNQLR 115
>gi|163722483|ref|ZP_02130021.1| ribosome-binding factor A [Desulfatibacillum alkenivorans AK-01] >gi|161404237|gb|EDQ28467.1| ribosome-binding factor A [Desulfatibacillum alkenivorans AK-01] (123 aa)
Score = 119, Expect = 4.3e-05, Identities = 36/104 (34%), Positives = 55/104 (52%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +R    I+  +S  I   + D  ++ AT+  V ++KD  IA+VY   +   +K I  K+ +    A GF +  LAK L LR  P + F  DES D   +I S+L +I
  S:     8 DRVAGRIQQELSALIQKRINDPRLEWATITGVKMTKDLKIARVYYCVFGEEEKKI--KVGEAFQQAHGFIKRELAKKLGLRYMPELEFFFDESFDYGRKIESILREI 112
>gi|138894785|ref|YP_001125238.1| ribosome-binding factor A [Geobacillus thermodenitrificans NG80-2] >gi|196247591|ref|ZP_03146293.1| ribosome-binding factor A [Geobacillus sp. G11MC16] >gi|166218441|sp|A4IMD9|RBFA_GEOTN Ribosome-binding factor A >gi|134266298|gb|ABO66493.1| Ribosome-binding factor A [Geobacillus thermodenitrificans NG80-2] >gi|196212375|gb|EDY07132.1| ribosome-binding factor A [Geobacillus sp. G11MC16] (128 aa)
Score = 118, Expect = 4.6e-05, Identities = 37/108 (34%), Positives = 55/108 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           N++  R    +K  +S  I   + D  I   TV  V ++ D   AKVYIS + D    +  LK +  A GF R+ + + + LRK P I+F  DE+I+    I  L+ QI
  S:     2 NIRATRVGEQMKKELSDIIGRKLKDPRIGFVTVTDVRVTGDLQQAKVYISVFGDDEQRENTLKALEKAKGFIRSEIGQRIRLRKTPEILFEIDETIEYGSRIERLIRQI 110
>gi|87125212|ref|ZP_01081058.1| Ribosome-binding factor A [Synechococcus sp. RS9917] >gi|86166981|gb|EAQ68242.1| Ribosome-binding factor A [Synechococcus sp. RS9917] (136 aa)
Score = 118, Expect = 4.8e-05, Identities = 32/107 (29%), Positives = 59/107 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTIIDK--ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + Q  V    V +S D    K+++S Y +   DK  +L+ +  ASG+ R  L + L +R+AP +VF  D  I+K   +  LL +++
  S:     6 RVERVAALIRRETSELLIHGIRDERVHQGMVSITEVEVSGDLQHCKIFVSIYGEDA-DKQNVLEGLKAASGYLRGELGRRLQMRRAPEVVFQLDRGIEKGTTVLHLLNRLE 115
>gi|30021900|ref|NP_833531.1| ribosome-binding factor A [Bacillus cereus ATCC 14579] >gi|163941548|ref|YP_001646432.1| ribosome-binding factor A [Bacillus weihenstephanensis KBAB4] >gi|168138559|ref|ZP_02581788.1| ribosome-binding factor A [Bacillus cereus B4264] >gi|168142531|ref|ZP_02585760.1| ribosome-binding factor A [Bacillus cereus G9842] >gi|33301481|sp|Q819Y8|RBFA_BACCR Ribosome-binding factor A >gi|29897456|gb|AAP10732.1| Ribosome-binding factor A [Bacillus cereus ATCC 14579] >gi|163863745|gb|ABY44804.1| ribosome-binding factor A [Bacillus weihenstephanensis KBAB4] (118 aa)
Score = 118, Expect = 4.9e-05, Identities = 40/104 (38%), Positives = 55/104 (52%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  I   TV  V +S D  IAKVYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:    10 EQMKKELGDIISRKIK----DPRIGFVTVTDVQVSGDLQIAKVYISVLGDEEQKENTLKGLAKAKGFIRSEIGQRIRLRKTPEITFEFDESIGYGHRIDTLLHEI 110
>gi|84702289|ref|ZP_01016864.1| ribosome-binding factor A [Parvularcula bermudensis HTCC2503] >gi|84691535|gb|EAQ17375.1| ribosome-binding factor A [Parvularcula bermudensis HTCC2503] (106 aa)
Score = 118, Expect = 5.4e-05, Identities = 27/96 (28%), Positives = 54/96 (56%)
  Q:    19 LISHAITTLVYDDLIKQ-------ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +I HA+  +   + I +        T+  V +S D   A V+ S   K + D+ + ++N  SG  R +L + + ++  P++ FL DE+ ++   IN+LL++ +
  S:     1 MIRHALAEMFQREEIHEEAFPTTPVTITEVRVSPDLKSATVFCSALGKDVFDEEVAQLNAISGAIRQVLGRKITMKYTPSLKFLPDETFEEAARINALLKETR 103
>gi|114321096|ref|YP_742779.1| ribosome-binding factor A [Alkalilimnicola ehrlichei MLHE-1] >gi|122311320|sp|Q0A798|RBFA_ALHEH Ribosome-binding factor A >gi|114227490|gb|ABI57289.1| ribosome-binding factor A [Alkalilimnicola ehrlichei MLHE-1] (130 aa)
Score = 117, Expect = 5.9e-05, Identities = 28/97 (28%), Positives = 59/97 (60%)
  Q:    16 IKDLISHAITTLVYDDL----IKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + + I   +  L+ D+L    +   TV  VT+S+D + AKV+++    +  D  K ++ +  A+G+ R +L + L +R+ PA+ F +D + D+ D ++ L+++
  S:    11 VGEQIQRELAELIRDELRDPRLGMVTVSEVTVSRDLAHAKVFVTALGGSDEDNAKTVEVLTRAAGYLRKLLGQRLRIRQVPALHFQHDTAFDRGDRLSRLIDE 113
>gi|90022352|ref|YP_528179.1| ribosome-binding factor A [Saccharophagus degradans 2-40] >gi|123090262|sp|Q21H62|RBFA_SACD2 Ribosome-binding factor A >gi|89951952|gb|ABD81967.1| ribosome-binding factor A [Saccharophagus degradans 2-40] (128 aa)
Score = 117, Expect = 7.2e-05, Identities = 29/103 (28%), Positives = 60/103 (58%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +R    I+  ++  I T V D  +    ++ V +++D SIAKVY++     +++  +  +K +N A+GF R ++AK L +R AP + F  D +  +   +++L+++
  S:     9 DRIADAIQRSLARVIQTEVRDPRLGLVNINSVDVTRDLSIAKVYVTVVGAKEESESEVAVKVLNKAAGFLRNVIAKELTMRSAPRLSFFYDRTAVQGQNLSNLIDR 114
>gi|15614974|ref|NP_243277.1| ribosome-binding factor A [Bacillus halodurans C-125] >gi|20139771|sp|Q9KA79|RBFA_BACHD Ribosome-binding factor A >gi|10175031|dbj|BAB06130.1| ribosome-binding factor A [Bacillus halodurans C-125] (116 aa)
Score = 117, Expect = 7.6e-05, Identities = 37/110 (33%), Positives = 55/110 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           MSNV+  R    +K  +S      + D  I+  TV  V ++ D   A VYI+   D    +  L  ++ A GF R+ + K + LRK P + F  DESI+  + I  LL+ I
  S:     1 MSNVRANRVGEQMKKELSDIFMRELKDPRIEFVTVTGVDVTGDLQQANVYITVLGDDEQKEATLAGLSKAKGFIRSEIGKRIRLRKTPELFFHFDESIEYGNRIEKLLQDI 111
>gi|194476765|ref|YP_002048944.1| ribosome-binding factor A [Paulinella chromatophora] >gi|171191772|gb|ACB42734.1| ribosome-binding factor A [Paulinella chromatophora] (124 aa)
Score = 116, Expect = 8.3e-05, Identities = 33/113 (29%), Positives = 60/113 (53%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + N ++ER  ++I+   S  I++ + D  + Q   +V  V L+ D    K+++S +  +    ++L  +  AS F R  L + L LR+ P IVF  D  I+K   +  LL +++ K
  S:     2 VQNRRVERVAALIRREASELISSSIRDRRVHQGMMSVTEVKLAGDLQHCKIFVSIFGSEEERHQVLTGLQSASAFVRGELGRRLKLRRTPEIVFELDRGIEKGTSVIGLLNELEKK 117
>gi|24378915|ref|NP_720870.1| ribosome-binding factor A [Streptococcus mutans UA159] >gi|29427727|sp|Q8DVP8|RBFA_STRMU Ribosome-binding factor A >gi|24376799|gb|AAN58176.1|AE014889_1 ribosome binding factor A [Streptococcus mutans UA159] (116 aa)
Score = 116, Expect = 8.4e-05, Identities = 36/113 (31%), Positives = 60/113 (53%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           MSN +IER    IK  ++  +   V D  ++  T+  V +S D S+AKVY +       D  K+   +  A G  +  L KNL + K P + F+ DESI+  ++I+ +L  ++ +
  S:     1 MSNHRIERVGMEIKREVNEILQKKVRDPRVQGVTITDVQMSGDLSLAKVYYTIMSDLASDNQKVQIGLEKAKGTIKRELGKNLTMYKIPDLTFIKDESIEYGNKIDQMLRDLEKR 115
>gi|114566434|ref|YP_753588.1| hypothetical protein Swol_0901 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122318494|sp|Q0AYI7|RBFA_SYNWW Ribosome-binding factor A >gi|114337369|gb|ABI68217.1| ribosome-binding factor A [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (122 aa)
Score = 116, Expect = 1.0e-04, Identities = 40/111 (36%), Positives = 61/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLI--KQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           MS  + ER    I  ++S  I   + D  I  K  ++  + LS D S A+V IS   D+   ++ +K +  A G+ R+ LA+ L +R AP + F  D SI+    I+SLLE+IK
  S:     1 MSKRRQERMSVEIMRVLSQIIQEEIKDPRIEFKNLSITRIDLSNDYSHARVNISILGDEIQREEAMKALQKAKGYIRSALAQQLKVRHAPELEFRLDRSIEHGIRISSLLEEIK 114
>gi|161551797|ref|YP_147118.2| ribosome-binding factor A [Geobacillus kaustophilus HTA426] >gi|61214671|sp|Q5L0I6|RBFA_GEOKA Ribosome-binding factor A (127 aa)
Score = 115, Expect = 1.1e-04, Identities = 36/108 (33%), Positives = 54/108 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           N++  R    +K  +S  I+  + D  I   TV  V ++ D   AKVYIS   D    +  LK +  A GF R+ + + + LRK P I F  DE+++    I  L+ QI
  S:     2 NIRATRVGEQMKKELSDIISRRLKDPRIGFVTVTDVRVTGDLQQAKVYISVLGDDKQRENTLKALEKAKGFIRSEIGQRIRLRKTPEIFFEIDETMEYGSRIEQLIRQI 110
>gi|171324501|ref|ZP_02913015.1| ribosome-binding factor A [Geobacillus sp. WCH70] >gi|171089543|gb|EDT35871.1| ribosome-binding factor A [Geobacillus sp. WCH70] (126 aa)
Score = 115, Expect = 1.2e-04, Identities = 38/108 (35%), Positives = 54/108 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           N++  R    +K  +S  I   + D  I   TV  V ++ D   AKVYIS   D+      LK +  A GF R+ + + + LRK P I F  DESI+  + I  L+ QI
  S:     2 NLRATRVGEQMKKELSDIIGRKLKDPRIGFVTVTDVRVTGDLQQAKVYISVLGDEEQRQNTLKGLEKAKGFIRSEIGQRIRLRKTPEIFFEIDESIEYGNRIEQLIRQI 110
>gi|168164216|ref|ZP_02599449.1| ribosome-binding factor A [Bacillus cereus H3081.97] (118 aa)
Score = 115, Expect = 1.2e-04, Identities = 39/104 (37%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S D  IA VYIS   D+   D  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVQVSGDLQIATVYISVLGDEEQKDSTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHEI 110
>gi|21672639|ref|NP_660706.1| ribosome-binding factor A [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25009041|sp|Q8K9H2|RBFA_BUCAP Ribosome-binding factor A >gi|21623274|gb|AAM67917.1| ribosome-binding factor A [Buchnera aphidicola str. Sg (Schizaphis graminum)] (124 aa)
Score = 115, Expect = 1.2e-04, Identities = 34/80 (42%), Positives = 50/80 (62%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKT---IIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V LSKD S A+V++S  +      + K+L  +N ASG+ R +L K +NLR  P IVF +D+S  K ++I+ LL  +  K
  S:    37 TVSEVRLSKDLSYAQVFVSFLETNSNLTVKKVLILLNRASGYIRKLLCKKMNLRIIPIIVFFHDDSFFKGNKISKLLNILTEK 119
>gi|52080272|ref|YP_079063.1| ribosome-binding factor A [Bacillus licheniformis ATCC 14580] >gi|52785649|ref|YP_091478.1| ribosome-binding factor A [Bacillus licheniformis ATCC 14580] >gi|61214855|sp|Q65JH9|RBFA_BACLD Ribosome-binding factor A >gi|52003483|gb|AAU23425.1| ribosome-binding factor A [Bacillus licheniformis ATCC 14580] >gi|52348151|gb|AAU40785.1| RbfA [Bacillus licheniformis DSM 13] (117 aa)
Score = 115, Expect = 1.2e-04, Identities = 33/77 (42%), Positives = 45/77 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           TV  V +S D  IAKVYIS   D+   ++ LK +  A GF R+ L   + LRK P I F  DESID  + I +L+ ++
  S:    33 TVTDVRVSGDLQIAKVYISVLGDEKKREETLKGLAKAKGFIRSELGNRIRLRKTPEIHFEFDESIDYGNRIETLIHEL 110
>gi|72383316|ref|YP_292671.1| ribosome-binding factor A [Prochlorococcus marinus str. NATL2A] >gi|123620526|sp|Q46HR0|RBFA_PROMT Ribosome-binding factor A >gi|72003166|gb|AAZ58968.1| ribosome-binding factor A [Prochlorococcus marinus str. NATL2A] (123 aa)
Score = 115, Expect = 1.3e-04, Identities = 35/109 (32%), Positives = 66/109 (60%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK----IDEINSLLEQIKGK 116
           ++E+  +++K  +S  +   + D+ I QA  T+  V +S D   AK++IS + ++   D++L  +  A GF R  LA+ L +R++P +VF  D+ + K    +D +N+L  + K K
  S:     6 RVEKLAALLKREVSELLVNGIRDERIHQAMITITSVEVSGDLQHAKIFISLFGEEKKKDEVLVGLEEAKGFIRAELAQRLQMRRSPELVFKIDKGMTKGPAVLDLLNALELERKSK 121
>gi|16078728|ref|NP_389547.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str. 168] >gi|418464|sp|P32731|RBFA_BACSU Ribosome-binding factor A >gi|580902|emb|CAA79236.1| ORF6 [Bacillus subtilis] >gi|2634037|emb|CAB13538.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str. 168] (117 aa)
Score = 115, Expect = 1.3e-04, Identities = 37/108 (34%), Positives = 57/108 (52%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +++  R    +K  +   I+  + D  I   TV  V +S D  IAKVYIS   D+   ++ LK +  A GF R+ +   + LRK P I F  DESID  + I +L+ ++
  S:     2 SMRANRVGEQMKKELGDIISRKLKDPRIGFLTVTDVRVSGDLQIAKVYISVLGDEKKREEALKGLAKAKGFIRSEIGSRIRLRKTPEIEFEFDESIDYGNRIETLIHEL 110
>gi|89895262|ref|YP_518749.1| hypothetical protein DSY2516 [Desulfitobacterium hafniense Y51] >gi|109645607|ref|ZP_01369527.1| ribosome-binding factor A [Desulfitobacterium hafniense DCB-2] >gi|122482377|sp|Q24UI7|RBFA_DESHY Ribosome-binding factor A >gi|89334710|dbj|BAE84305.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109643556|gb|EAT53109.1| ribosome-binding factor A [Desulfitobacterium hafniense DCB-2] (125 aa)
Score = 114, Expect = 1.3e-04, Identities = 41/113 (36%), Positives = 53/113 (46%)
  Q:     2 KHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           KH SN    R    +K  IS  I   + D  I   TV  V ++ D   AKVY+S   D       L  +  A+GF R+ + K + LR AP IVF  D SI+    I  LL  +K
  S:     3 KHRSN----RLAETLKQEISQLIREELKDPRIGFVTVTSVEVADDLGNAKVYVSVLGDSQQAKDSLDALKRAAGFVRSEIGKRVRLRHAPEIVFKYDTSIEHGAHIAQLLRGVK 112
>gi|186900422|ref|ZP_02973380.1| ribosome-binding factor A [Cyanothece sp. PCC 7424] >gi|186692541|gb|EDU17159.1| ribosome-binding factor A [Cyanothece sp. PCC 7424] (131 aa)
Score = 114, Expect = 1.4e-04, Identities = 31/110 (28%), Positives = 59/110 (53%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ ++ R  S+IK  +S  +   + DD +    V    V +S D   AK+++S Y  +    + ++ +  + GF R  L + + LR+ P +VFL D S+++ D    LL Q++
  S:     3 TDRRVSRVSSLIKREVSQMLLHGIKDDRVGAGMVSITDVDVSGDLQHAKIFVSIYGTEQAKAETMEGLKSSVGFVRRELGQRIRLRRTPEVVFLEDTSLERGDRTLHLLNQLQ 115
>gi|49478390|ref|YP_037872.1| ribosome-binding factor A [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141678|ref|YP_085152.1| ribosome-binding factor A [Bacillus cereus E33L] >gi|118479031|ref|YP_896182.1| ribosome-binding factor A [Bacillus thuringiensis str. Al Hakam] >gi|196042166|ref|ZP_03109449.1| ribosome-binding factor A [Bacillus cereus NVH0597-99] >gi|196044539|ref|ZP_03111774.1| ribosome-binding factor A [Bacillus cereus 03BB108] >gi|166218421|sp|A0RHI2|RBFA_BACAH Ribosome-binding factor A >gi|61214843|sp|Q636L5|RBFA_BACCZ Ribosome-binding factor A >gi|61215017|sp|Q6HF04|RBFA_BACHK Ribosome-binding factor A >gi|49329946|gb|AAT60592.1| ribosome-binding factor A [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975147|gb|AAU16697.1| ribosome-binding factor A [Bacillus cereus E33L] >gi|118418256|gb|ABK86675.1| ribosome-binding factor A [Bacillus thuringiensis str. Al Hakam] >gi|196024574|gb|EDX63246.1| ribosome-binding factor A [Bacillus cereus 03BB108] >gi|196027018|gb|EDX65642.1| ribosome-binding factor A [Bacillus cereus NVH0597-99] (118 aa)
Score = 114, Expect = 1.4e-04, Identities = 39/104 (37%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S D  IA VYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL QI
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVQVSGDLQIATVYISVLGDEEQKENTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHQI 110
>gi|47569088|ref|ZP_00239777.1| ribosome-binding factor A [Bacillus cereus G9241] >gi|47554250|gb|EAL12612.1| ribosome-binding factor A [Bacillus cereus G9241] (118 aa)
Score = 114, Expect = 1.4e-04, Identities = 39/104 (37%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S D  IA VYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL QI
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVQVSGDLQIATVYISVLGDEEQKESTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHQI 110
>gi|119713527|gb|ABL97580.1| ribosome-binding factor A [uncultured marine bacterium EB0_35D03] (112 aa)
Score = 114, Expect = 1.5e-04, Identities = 30/111 (27%), Positives = 61/111 (54%)
  Q:     3 HMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
             ++ + ER   +I+  +   ++    D  +++  +  V +S+D + AKV+ S  D +    +   +N ASGFFR+ L+K L+LR  PA++F+ D + +    ++ LL ++
  S:     3 QQTSYRAERVNELIRRELVLLLSKETKDPRLQEVVITDVKVSRDLTSAKVFFSV-DASAQKTVTTLLNKASGFFRSSLSKVLDLRHTPALIFIYDTAPNTGARMDDLLSKL 112
>gi|113953283|ref|YP_731751.1| ribosome-binding factor A [Synechococcus sp. CC9311] >gi|123132376|sp|Q0I721|RBFA_SYNS3 Ribosome-binding factor A >gi|113880634|gb|ABI45592.1| ribosome-binding factor A [Synechococcus sp. CC9311] (134 aa)
Score = 114, Expect = 1.5e-04, Identities = 29/107 (27%), Positives = 58/107 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + Q  V    V +S D    ++++S + ++   D+++  +  A GF R  L + L +R+AP IVF  D  I+K   +  LL +++
  S:     6 RVERVAALIRKETSELLIHGIRDERVHQGMVSITEVEVSGDLQHCRIFVSVFGEQAQKDEVMDGLEAARGFLRGELGRRLQMRRAPEIVFKLDLGIEKGTTVLHLLGELE 115
>gi|18310667|ref|NP_562601.1| ribosome-binding factor A [Clostridium perfringens str. 13] >gi|110800717|ref|YP_696372.1| ribosome-binding factor A [Clostridium perfringens ATCC 13124] >gi|110802728|ref|YP_698972.1| ribosome-binding factor A [Clostridium perfringens SM101] >gi|168211427|ref|ZP_02637052.1| ribosome-binding factor A [Clostridium perfringens B str. ATCC 3626] >gi|168214482|ref|ZP_02640107.1| ribosome-binding factor A [Clostridium perfringens CPE str. F4969] >gi|168216972|ref|ZP_02642597.1| ribosome-binding factor A [Clostridium perfringens NCTC 8239] >gi|169342675|ref|ZP_02863716.1| ribosome-binding factor A [Clostridium perfringens C str. JGS1495] >gi|182626365|ref|ZP_02954119.1| ribosome-binding factor A [Clostridium perfringens D str. JGS1721] >gi|123049758|sp|Q0TPR8|RBFA_CLOP1 Ribosome-binding factor A >gi|123146056|sp|Q0SSD5|RBFA_CLOPS Ribosome-binding factor A >gi|20978576|sp|Q8XJR9|RBFA_CLOPE Ribosome-binding factor A >gi|18145348|dbj|BAB81391.1| ribosome-binding factor A [Clostridium perfringens str. 13] >gi|110675364|gb|ABG84351.1| ribosome-binding factor A [Clostridium perfringens ATCC 13124] >gi|110683229|gb|ABG86599.1| ribosome-binding factor A [Clostridium perfringens SM101] >gi|169299181|gb|EDS81251.1| ribosome-binding factor A [Clostridium perfringens C str. JGS1495] >gi|170710576|gb|EDT22758.1| ribosome-binding factor A [Clostridium perfringens B str. ATCC 3626] >gi|170714032|gb|EDT26214.1| ribosome-binding factor A [Clostridium perfringens CPE str. F4969] >gi|177908316|gb|EDT70864.1| ribosome-binding factor A [Clostridium perfringens D str. JGS1721] >gi|182380987|gb|EDT78466.1| ribosome-binding factor A [Clostridium perfringens NCTC 8239] (116 aa)
Score = 114, Expect = 1.5e-04, Identities = 38/113 (33%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK--ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N + +R    ++  +S  I   + D  L    +V  V ++KD   AKV++S + K   +K   LK +  ++GF R  +   + LR  P I+F  D SID    I SLL +IK K
  S:     1 MANFRGKRINEEVRKEVSDIIRNQIKDPRLTAMVSVTQVEVTKDLRYAKVFVSLFAKNDEEKEESLKALKSSAGFIRREVGNRVKLRSTPEILFEEDNSIDNAMYIESLLNKIKEK 116
>gi|30263814|ref|NP_846191.1| ribosome-binding factor A [Bacillus anthracis str. Ames] >gi|47529238|ref|YP_020587.1| ribosome-binding factor A [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186661|ref|YP_029913.1| ribosome-binding factor A [Bacillus anthracis str. Sterne] >gi|65321138|ref|ZP_00394097.1| COG0858: Ribosome-binding factor A [Bacillus anthracis str. A2012] >gi|165872633|ref|ZP_02217264.1| ribosome-binding factor A [Bacillus anthracis str. A0488] >gi|167639837|ref|ZP_02398106.1| ribosome-binding factor A [Bacillus anthracis str. A0193] >gi|170706868|ref|ZP_02897326.1| ribosome-binding factor A [Bacillus anthracis str. A0389] >gi|177652087|ref|ZP_02934633.1| ribosome-binding factor A [Bacillus anthracis str. A0174] >gi|190568437|ref|ZP_03021344.1| ribosome-binding factor A [Bacillus anthracis Tsiankovskii-I] >gi|33301489|sp|Q81WM5|RBFA_BACAN Ribosome-binding factor A >gi|30258458|gb|AAP27677.1| ribosome-binding factor A [Bacillus anthracis str. Ames] >gi|47504386|gb|AAT33062.1| ribosome-binding factor A [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180588|gb|AAT55964.1| ribosome-binding factor A [Bacillus anthracis str. Sterne] >gi|164711665|gb|EDR17211.1| ribosome-binding factor A [Bacillus anthracis str. A0488] >gi|167512238|gb|EDR87615.1| ribosome-binding factor A [Bacillus anthracis str. A0193] >gi|170128286|gb|EDS97155.1| ribosome-binding factor A [Bacillus anthracis str. A0389] >gi|172082456|gb|EDT67521.1| ribosome-binding factor A [Bacillus anthracis str. A0174] >gi|190560441|gb|EDV14419.1| ribosome-binding factor A [Bacillus anthracis Tsiankovskii-I] (118 aa)
Score = 114, Expect = 1.6e-04, Identities = 38/104 (36%), Positives = 55/104 (52%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S+D  IA VYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVQVSRDLQIATVYISVLGDEEQKENTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHEI 110
>gi|148244227|ref|YP_001218921.1| ribosome-binding factor A [Candidatus Vesicomyosocius okutanii HA] >gi|172047244|sp|A5CXX7|RBFA_VESOH Ribosome-binding factor A >gi|146326054|dbj|BAF61197.1| ribosome-binding factor A [Candidatus Vesicomyosocius okutanii HA] (114 aa)
Score = 114, Expect = 1.6e-04, Identities = 33/112 (29%), Positives = 63/112 (56%)
  Q:     2 KHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +  ++ ++ER   +I+  ++  + T + D  ++   +  V +S+D S AKV+ +    DK +I+ +L K   ASGFFR  L+K ++LR  P + F+ D + +    I  LL ++
  S:     4 QEQASYRVERINELIRRELTLLLRTSIKDPRLRDMIITDVLISRDLSSAKVFYTVIKEDKKMIEPLLDK---ASGFFRIHLSKTIDLRHTPVLRFIFDSAPNTGARIEQLLSKL 114
>gi|27467865|ref|NP_764502.1| ribosome-binding factor A [Staphylococcus epidermidis ATCC 12228] >gi|57866760|ref|YP_188419.1| ribosome-binding factor A [Staphylococcus epidermidis RP62A] >gi|29427695|sp|Q8CPG2|RBFA_STAES Ribosome-binding factor A >gi|61214666|sp|Q5HPS1|RBFA_STAEQ Ribosome-binding factor A >gi|27315410|gb|AAO04544.1|AE016747_41 ribosome-binding factor A [Staphylococcus epidermidis ATCC 12228] >gi|57637418|gb|AAW54206.1| ribosome-binding factor A [Staphylococcus epidermidis RP62A] (116 aa)
Score = 114, Expect = 1.6e-04, Identities = 32/110 (29%), Positives = 59/110 (53%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N++ ER    +K  I   +   V D  +   T+  V L+ D S AKVY++   +   +D   K ++ A+GF ++ L   + LR  P + F  DESI+  ++I  +++++
  S:     1 MNNIRAERVGEQMKQEIMDIVNNKVKDPRVGFLTITDVELTNDLSQAKVYLTVLGNDKEVDNTFKALHKATGFIKSELGSRMRLRIIPELTFEYDESIEYGNKIERMIQEL 111
>gi|33866739|ref|NP_898298.1| ribosome-binding factor A [Synechococcus sp. WH 8102] >gi|39931754|sp|Q7TTS8|RBFA_SYNPX Ribosome-binding factor A >gi|33639340|emb|CAE08722.1| possible Ribosome-binding factor A [Synechococcus sp. WH 8102] (134 aa)
Score = 114, Expect = 1.6e-04, Identities = 27/107 (25%), Positives = 59/107 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + Q  V    V +S D    K+++S + D+    ++++ +  ASG+ +  L + L +R+AP +VF  D  I++   +  LL +++
  S:     6 RVERVAALIRKETSELLINGIRDERVHQGMVSITNVEVSGDLQHCKIFVSIFGDEASQLQVMEGLQAASGYLKGELGRRLQMRRAPDVVFQLDRGIERGTSVLGLLNKLE 115
>gi|17227559|ref|NP_484107.1| ribosome-binding factor A [Nostoc sp. PCC 7120] >gi|20978596|sp|Q8Z0M8|RBFA_ANASP Ribosome-binding factor A >gi|17135041|dbj|BAB77587.1| ribosome binding facror A [Nostoc sp. PCC 7120] (133 aa)
Score = 114, Expect = 1.7e-04, Identities = 30/110 (27%), Positives = 59/110 (53%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +N ++ R   +IK  +S  +   + DD +    V    V +S D   AK+Y+S Y  +    + +  +  A+GF R+ L   + LR+ P + F+ D SI++  ++ +LL +++
  S:     3 TNRRVSRVAELIKREVSQMLINGIKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTEEAKAETMAGLKSATGFVRSELGARVRLRRTPEVTFIEDRSIERGTKVLTLLNKLE 115
>gi|149194183|ref|ZP_01871281.1| ribosome-binding factor A [Caminibacter mediatlanticus TB-2] >gi|149136136|gb|EDM24614.1| ribosome-binding factor A [Caminibacter mediatlanticus TB-2] (115 aa)
Score = 114, Expect = 1.7e-04, Identities = 35/111 (31%), Positives = 65/111 (58%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI--SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++K++R ES++K++I   ++ +  D  I+  +V  V  S+D S AKVY+  S  ++    + LKK+  A G+ +T   K+    K P + F  D+ ++K +++  L E+IK K
  S:     4 SIKVQRKESLLKEIIPEVLSQM-GDGRIRGLSVVDVVCSRDGSDAKVYLEKSYLNENEQKQALKKLKQARGYIQTQTLKSTGWYKVPNLSFTFDDLLEKENKMEELFEKIKKK 115
>gi|168207529|ref|ZP_02633534.1| ribosome-binding factor A [Clostridium perfringens E str. JGS1987] >gi|170661132|gb|EDT13815.1| ribosome-binding factor A [Clostridium perfringens E str. JGS1987] (116 aa)
Score = 114, Expect = 1.7e-04, Identities = 38/113 (33%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK--ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N + +R    ++  +S  I   + D  L    +V  V ++KD   AKV++S + K   +K   LK +  ++GF R  +   + LR  P I+F  D SID    I SLL +IK K
  S:     1 MANFRGKRINEEVRKEVSDIIRNQIKDPRLTAMVSVTQVEVTKDLRYAKVFVSLFAKNDEEKEESLKALKSSAGFIRREVGNRVKLRSTPEILFEEDTSIDNAMYIESLLNKIKEK 116
>gi|148377991|ref|YP_001256867.1| ribosome-binding factor A [Mycoplasma agalactiae PG2] >gi|148292037|emb|CAL59429.1| Ribosome-binding factor A [Mycoplasma agalactiae PG2] (113 aa)
Score = 114, Expect = 1.7e-04, Identities = 39/111 (35%), Positives = 57/111 (51%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ + R ES IK+ IS  IT  + +  I   TV  V LS D    KV+++   K   +  L  +  ASG+ R  L+K LN RK P + F  DE   K  EI+ +L  +K +
  S:     4 SISVLRKESQIKNFISTIITNELTNANIYNPTVTDVVLSTDLGHVKVFLAFSSKE--NDGLDAVKNASGYIRKRLSKTLNWRKVPELHFYIDEVEKKAFEIDQILNSLKNE 112
>gi|78043533|ref|YP_360585.1| ribosome-binding factor A [Carboxydothermus hydrogenoformans Z-2901] >gi|123575934|sp|Q3AB99|RBFA_CARHZ Ribosome-binding factor A >gi|77995648|gb|ABB14547.1| ribosome-binding factor A [Carboxydothermus hydrogenoformans Z-2901] (125 aa)
Score = 113, Expect = 1.8e-04, Identities = 37/111 (33%), Positives = 57/111 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +++ K ER    IK+ ++  I+  V D  +   +V  V L++D S AK+YIS Y      K     +N A GF +  LA  + LR  P + F+ D SI+    I  +LE +K
  S:     4 LASHKHERTAQAIKEAVAAIISREVKDPRLGFVSVTKVDLARDLSQAKIYISVYGSEEDKKNSFIALNSAKGFIKGELASRVRLRIMPELYFVEDPSIEYGARIMEILEGLK 115
>gi|70734338|ref|YP_257978.1| ribosome-binding factor A [Pseudomonas fluorescens Pf-5] >gi|123658131|sp|Q4KIF5|RBFA_PSEF5 Ribosome-binding factor A >gi|68348637|gb|AAY96243.1| ribosome-binding factor A [Pseudomonas fluorescens Pf-5] (133 aa)
Score = 113, Expect = 1.8e-04, Identities = 30/105 (28%), Positives = 58/105 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   V D  +   T+  V +S+D   AK++I+   +   ++I   +K +N A+GF R  LAK + LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAQLIRREVKDPRVGLVTITAVEVSRDVGHAKIFITVMGQENAEQIAQSIKVLNSAAGFLRMQLAKEMKLRSVPQLHFHYDESVARGAHLSALIER 114
>gi|83589899|ref|YP_429908.1| ribosome-binding factor A [Moorella thermoacetica ATCC 39073] >gi|123524645|sp|Q2RJM4|RBFA_MOOTA Ribosome-binding factor A >gi|83572813|gb|ABC19365.1| ribosome-binding factor A [Moorella thermoacetica ATCC 39073] (122 aa)
Score = 113, Expect = 1.9e-04, Identities = 29/79 (36%), Positives = 46/79 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKG 115
           +V  V LS D+  AKVY+S Y D+   ++ ++ +  A+ F R  + + L+LR  P I F  D SI+  D IN LL +++ 
  S:    37 SVTGVELSNDRHYAKVYVSIYGDEEARNQAMEGLARATSFIRREIGQRLSLRYTPEITFKLDVSIEHGDHINRLLARVRA 116
>gi|89101191|ref|ZP_01174022.1| ribosome-binding factor A [Bacillus sp. NRRL B-14911] >gi|89084100|gb|EAR63270.1| ribosome-binding factor A [Bacillus sp. NRRL B-14911] (112 aa)
Score = 113, Expect = 1.9e-04, Identities = 35/99 (35%), Positives = 53/99 (53%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +K  +   I   + D  I   TV  V ++ D   A VYIS   D+   +  LK +  A GF R+ + + + LRK P I+F  DESID  + I++LL +I+
  S:     1 MKKELGEIIGRKIKDPRIGFVTVTDVAVTGDLQQATVYISVLGDEEKRENTLKGLAKAKGFIRSEIGQRIRLRKTPEIIFEFDESIDYGNRIDTLLHKIQ 100
>gi|157364232|ref|YP_001470999.1| ribosome-binding factor A [Thermotoga lettingae TMO] >gi|166918679|sp|A8F701|RBFA_THELT Ribosome-binding factor A >gi|157314836|gb|ABV33935.1| ribosome-binding factor A [Thermotoga lettingae TMO] (119 aa)
Score = 113, Expect = 1.9e-04, Identities = 40/102 (39%), Positives = 53/102 (51%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQA-TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ES I  LI+ A+       +  Q  T+  V LS DK  A VY+S   DK    K ++ ++   G+FRT LA NL+L  AP I F  D  I+    I  LL +IK
  S:    11 ESEIMKLITEALREAKDPKISGQIITISRVELSNDKRFADVYVSAMGDKDERVKTVEYLDKIKGYFRTYLANNLDLYTAPQIRFKEDPGIEASVRIQELLNKIK 114
>gi|166986831|ref|ZP_02258062.1| ribosome-binding factor A [Bacillus cereus AH187] (108 aa)
Score = 113, Expect = 1.9e-04, Identities = 36/98 (36%), Positives = 51/98 (52%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +K  +   I+  + D  +   TV  V +S D  IA VYIS   D+   D  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:     2 MKKELGDIISRKIKDPRVGFVTVTDVQVSGDLQIATVYISVLGDEEQKDSTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHEI 100
>gi|49077912|gb|AAT49730.1| PA4743 [synthetic construct] (130 aa)
Score = 113, Expect = 2.1e-04, Identities = 30/105 (28%), Positives = 60/105 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D + AKV+I+   +    KI   ++ +N A+G+ R +L K++ LR  P + F  DESI +  E+++L+E+
  S:     7 RTQRIGDQMQRELAQLIQREIKDPRLGLVTITGVEVSRDVAHAKVFITVMGQDDAGKIALNMEILNDAAGYLRMLLGKSMKLRSVPQLHFHYDESIRRGAELSALIER 114
>gi|90416136|ref|ZP_01224068.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2207] >gi|90331861|gb|EAS47075.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2207] (142 aa)
Score = 113, Expect = 2.2e-04, Identities = 27/104 (25%), Positives = 58/104 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           + ER    ++  ++  I + V D  +    V  V +S+D +  KV+++     ++  ID+ +  +NGASG+ R +L  ++ LR  P + F+ DE+  +   +++L++
  S:     7 RAERVSDSVQQELATLIRSEVRDPRVGMVNVTEVQISRDLAYGKVFVNFVGDREQEQIDEAMAALNGASGYLRKLLGASIQLRIVPKLNFIFDETGRRGQHLSALID 113
>gi|75908877|ref|YP_323173.1| ribosome-binding factor A [Anabaena variabilis ATCC 29413] >gi|123609303|sp|Q3M9Q8|RBFA_ANAVT Ribosome-binding factor A >gi|75702602|gb|ABA22278.1| ribosome-binding factor A [Anabaena variabilis ATCC 29413] (133 aa)
Score = 113, Expect = 2.2e-04, Identities = 30/110 (27%), Positives = 59/110 (53%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +N ++ R   +IK  +S  +   + DD +    V    V +S D   AK+Y+S Y  +    + +  +  A+GF R+ L   + LR+ P + F+ D SI++  ++ +LL +++
  S:     3 TNRRVSRVAELIKREVSQMLINGIKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTEEAKAETMAGLKSATGFVRSELGARVRLRRTPEVTFIEDRSIERGTKVLTLLNKLE 115
>gi|15599937|ref|NP_253431.1| ribosome-binding factor A [Pseudomonas aeruginosa PAO1] >gi|116052890|ref|YP_793207.1| ribosome-binding factor A [Pseudomonas aeruginosa UCBPP-PA14] >gi|122257099|sp|Q02FS9|RBFA_PSEAB Ribosome-binding factor A >gi|20978658|sp|Q9HV56|RBFA_PSEAE Ribosome-binding factor A >gi|9951005|gb|AAG08129.1|AE004888_4 ribosome-binding factor A [Pseudomonas aeruginosa PAO1] >gi|115588111|gb|ABJ14126.1| ribosome-binding factor A [Pseudomonas aeruginosa UCBPP-PA14] (129 aa)
Score = 112, Expect = 2.6e-04, Identities = 30/105 (28%), Positives = 60/105 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D + AKV+I+   +    KI   ++ +N A+G+ R +L K++ LR  P + F  DESI +  E+++L+E+
  S:     7 RTQRIGDQMQRELAQLIQREIKDPRLGLVTITGVEVSRDVAHAKVFITVMGQDDAGKIALNMEILNDAAGYLRMLLGKSMKLRSVPQLHFHYDESIRRGAELSALIER 114
>gi|33519580|ref|NP_878412.1| ribosome-binding factor A (P15B protein) [Candidatus Blochmannia floridanus] >gi|39931815|sp|Q7VQM2|RBFA_BLOFL Ribosome-binding factor A >gi|33517243|emb|CAD83626.1| ribosome-binding factor A (P15B protein) [Candidatus Blochmannia floridanus] (117 aa)
Score = 112, Expect = 2.6e-04, Identities = 34/107 (31%), Positives = 62/107 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +++R    I+  ++  I   V+D  +   T+  V +S+D   AK++I+  DK  I++I   +  +  ASGF R +LA ++NLR  P ++F  D S+ +  +I  L+ Q+K
  S:     8 RLQRISQEIQRKVAIIIHHKVHDPRVGLPTISGVQVSRDLKNAKIFITFLDKNNIEEINFSILILQKASGFIRFLLANSMNLRTVPVLLFKYDYSLKEGIKICKLISQLK 117
>gi|90422005|ref|YP_530375.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB18] >gi|122477505|sp|Q21C30|RBFA_RHOPB Ribosome-binding factor A >gi|90104019|gb|ABD86056.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB18] (137 aa)
Score = 112, Expect = 2.6e-04, Identities = 31/95 (32%), Positives = 52/95 (54%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + +++ HA+  L     V+D +++    TV  V +S D  +A VY+        D +LK +     F RT +A+ +NL+ AP + F  DE  D+ + I  LL
  S:    20 VGEIVRHAVAELLSQGGVHDPVLEGHLITVPEVRMSPDLKLATVYVMPLGGRDTDVVLKALAANKPFIRTAVARRVNLKFAPDLRFRIDERFDEAERIEKLL 121
>gi|147677605|ref|YP_001211820.1| ribosome-binding factor A [Pelotomaculum thermopropionicum SI] >gi|189039550|sp|A5D2S1|RBFA_PELTS Ribosome-binding factor A >gi|146273702|dbj|BAF59451.1| ribosome-binding factor A [Pelotomaculum thermopropionicum SI] (119 aa)
Score = 112, Expect = 2.8e-04, Identities = 33/107 (30%), Positives = 52/107 (48%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ER    IK  +S  +   + D  I   T+  V +SKD   A +Y S +      K  ++ +  A GF R  L K + LR  P I F  D+SI +   + +L+E+++ K
  S:     6 ERVAEAIKKEVSDMLRNELKDPRIGFVTITSVEVSKDLRYANIYASVFGSPDDQKETIEALKKAQGFIRGELGKRIRLRYTPEITFKLDQSIGRGSRVLALMEEVREK 113
>gi|107103842|ref|ZP_01367760.1| hypothetical protein PaerPA_01004913 [Pseudomonas aeruginosa PACS2] >gi|194555340|ref|YP_002090367.1| ribosome-binding factor A [Pseudomonas aeruginosa 2192] >gi|126197733|gb|EAZ61796.1| ribosome-binding factor A [Pseudomonas aeruginosa 2192] (130 aa)
Score = 112, Expect = 2.9e-04, Identities = 30/105 (28%), Positives = 60/105 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D + AKV+I+   +    KI   ++ +N A+G+ R +L K++ LR  P + F  DESI +  E+++L+E+
  S:     7 RTQRIGDQMQRELAQLIQREIKDPRLGLVTITGVEVSRDVAHAKVFITVMGQDDAGKIALNMEILNDAAGYLRMLLGKSMKLRSVPQLHFHYDESIRRGAELSALIER 114
>gi|42782899|ref|NP_980146.1| ribosome-binding factor A [Bacillus cereus ATCC 10987] >gi|61215104|sp|Q732R1|RBFA_BACC1 Ribosome-binding factor A >gi|42738826|gb|AAS42754.1| ribosome-binding factor A [Bacillus cereus ATCC 10987] (118 aa)
Score = 111, Expect = 3.2e-04, Identities = 38/104 (36%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S D  IA VYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVQVSGDLQIATVYISVLGDEEQKESTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHEI 110
>gi|166994464|ref|ZP_02260924.1| ribosome-binding factor A [Bacillus cereus AH820] >gi|167635838|ref|ZP_02394147.1| ribosome-binding factor A [Bacillus anthracis str. A0442] >gi|170687860|ref|ZP_02879074.1| ribosome-binding factor A [Bacillus anthracis str. A0465] >gi|167528795|gb|EDR91553.1| ribosome-binding factor A [Bacillus anthracis str. A0442] >gi|170668176|gb|EDT18925.1| ribosome-binding factor A [Bacillus anthracis str. A0465] (118 aa)
Score = 111, Expect = 3.2e-04, Identities = 38/104 (36%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S D  IA VYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVQVSGDLQIATVYISVLGDEEQKENTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHEI 110
>gi|177666907|ref|ZP_02942691.1| ribosome-binding factor A [Cyanothece sp. PCC 8801] >gi|196246142|ref|ZP_03144863.1| ribosome-binding factor A [Cyanothece sp. PCC 8802] >gi|172074193|gb|EDT59613.1| ribosome-binding factor A [Cyanothece sp. PCC 8801] >gi|196206216|gb|EDY01014.1| ribosome-binding factor A [Cyanothece sp. PCC 8802] (128 aa)
Score = 111, Expect = 3.4e-04, Identities = 30/107 (28%), Positives = 58/107 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIK--QATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ R  S+IK  +S  +   + DD +     +V  V +S D   A +++S Y  +    + ++ +  ++ F R  L+  + LR++P +VF  D S+++ D +  LL QIK
  S:     6 RVSRVSSLIKREVSQMLLHDIKDDRVGAGMVSVTEVDVSGDLQHATIFVSIYGSEQAQAETMEGLKSSTSFVRRELSHRMRLRRSPEVVFRQDHSLERGDRMVHLLNQIK 115
>gi|152989168|ref|YP_001350785.1| ribosome-binding factor A [Pseudomonas aeruginosa PA7] >gi|166219391|sp|A6VCK0|RBFA_PSEA7 Ribosome-binding factor A >gi|150964326|gb|ABR86351.1| ribosome-binding factor A [Pseudomonas aeruginosa PA7] (128 aa)
Score = 110, Expect = 3.8e-04, Identities = 28/105 (26%), Positives = 61/105 (58%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D + AKV+I+   +   +++   ++ +N A+G+ R +L K++ LR  P + F  DESI +  E+++L+E+
  S:     7 RTQRIGDQMQRELAQLIQREIKDPRLGLVTITGVEVSRDVAHAKVFITVMGQDDAERVALNMEILNDAAGYLRMLLGKSMKLRSVPQLHFHYDESIRRGAELSALIER 114
>gi|157692348|ref|YP_001486810.1| ribosome-binding factor A [Bacillus pumilus SAFR-032] >gi|166918673|sp|A8FDD3|RBFA_BACP2 Ribosome-binding factor A >gi|157681106|gb|ABV62250.1| ribosome-binding factor A [Bacillus pumilus SAFR-032] (116 aa)
Score = 110, Expect = 4.1e-04, Identities = 31/80 (38%), Positives = 46/80 (57%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V +S D  IAKVYIS   D+   ++ LK +  A G+ R+ +   + LRK P + F  DES+D  + I SL+ ++  K
  S:    33 TVTDVEVSGDLQIAKVYISVLGDEKKREETLKGLAKAKGYIRSEIGNRIRLRKTPELHFEFDESVDYGNRIESLIAELNTK 113
>gi|152976177|ref|YP_001375694.1| ribosome-binding factor A [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189039526|sp|A7GRE1|RBFA_BACCN Ribosome-binding factor A >gi|152024929|gb|ABS22699.1| ribosome-binding factor A [Bacillus cereus subsp. cytotoxis NVH 391-98] (118 aa)
Score = 110, Expect = 4.3e-04, Identities = 38/104 (36%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  I     D  +   TV  V +S D  IA VYIS   D+   +  LK +  A GF R+ + + + LRK P I F  DESI     I++LL +I
  S:    10 EQMKKELGDIISRKIK----DPRVGFVTVTDVKVSGDLQIATVYISVLGDEEQKENTLKGLAKAKGFIRSEIGQRIRLRKTPEISFEFDESIGYGHRIDTLLHEI 110
>gi|158336219|ref|YP_001517393.1| ribosome-binding factor A [Acaryochloris marina MBIC11017] >gi|189039525|sp|B0CDK8|RBFA_ACAM1 Ribosome-binding factor A >gi|158306460|gb|ABW28077.1| ribosome-binding factor A [Acaryochloris marina MBIC11017] (138 aa)
Score = 110, Expect = 4.6e-04, Identities = 28/106 (26%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ R   +IK  +S  +   + DD +     +V  V LS D   AK+++S Y       + +  +  A+G+ R  L   ++LR+ P ++F  D S ++ +++ SLL ++
  S:     6 RVSRVAELIKREVSQMLLHSIKDDRVGSGMISVTAVDLSGDLQHAKIFVSIYGTDEARAETMAGLESATGYVRKQLGHRIHLRRTPEVIFCEDRSFEEGNQVLSLLHKL 114
>gi|57234294|ref|YP_181705.1| ribosome-binding factor A [Dehalococcoides ethenogenes 195] >gi|123618614|sp|Q3Z7U4|RBFA_DEHE1 Ribosome-binding factor A >gi|57224742|gb|AAW39799.1| ribosome-binding factor A [Dehalococcoides ethenogenes 195] (118 aa)
Score = 110, Expect = 4.6e-04, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:    37 TVHYVTLSKDKSIAKVYIS-CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +V+ V +S+D   A VY+S        D+IL  +N A+GFFRT +AK  ++R  P   F+ D++I++   +N+L++++
  S:    34 SVNEVDVSEDMRHATVYVSHLAGDEHKDEILAALNAAAGFFRTEIAKKTDIRYMPVFNFIWDDTIERGVRLNTLIDRV 111
>gi|194684718|emb|CAR46706.1| ribosome-binding factor A [Proteus mirabilis HI4320] (133 aa)
Score = 110, Expect = 4.7e-04, Identities = 29/86 (33%), Positives = 52/86 (60%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY--------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V D  I  ATV  V +S+D + AKV+++          D+ +++  LK +N A+GF R++L K + LR  P + F  D S+ +   +++L+  +
  S:    27 VKDPRIGMATVSGVEISRDLAYAKVFVTFLNLSAGEESDEEMVENGLKALNEAAGFIRSLLGKAMRLRVVPELTFAYDNSLVEGMRMSNLVSNV 120
>gi|154249099|ref|YP_001409924.1| ribosome-binding factor A [Fervidobacterium nodosum Rt17-B1] >gi|171769324|sp|A7HK34|RBFA_FERNB Ribosome-binding factor A >gi|154153035|gb|ABS60267.1| ribosome-binding factor A [Fervidobacterium nodosum Rt17-B1] (125 aa)
Score = 110, Expect = 4.9e-04, Identities = 35/107 (32%), Positives = 57/107 (53%)
  Q:     8 KIERYESIIKDLISHAITTLV---YDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           K++  ES I+ ++S A+  +     D +    T+  V +SKDK  A VY+S   D+     ++       G+FRT +AKN+ +  AP + F  D+ I+    I  LL+ IK
  S:     6 KLKMLESEIRKVLSEALMEMKDPNIDPMKSLITISRVEVSKDKRYADVYVSVLGDEAKRKDVVNYFEQKKGYFRTYVAKNIRMYTAPELRFKEDKGIEATVRIGQLLDSIK 116
>gi|152993549|ref|YP_001359270.1| ribosome-binding factor A [Sulfurovum sp. NBC37-1] >gi|151425410|dbj|BAF72913.1| ribosome-binding factor A [Sulfurovum sp. NBC37-1] (129 aa)
Score = 110, Expect = 4.9e-04, Identities = 34/107 (31%), Positives = 60/107 (56%)
  Q:     7 VKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID-----KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +K  R ES++K++I  A++TL  D+ I    V  V  SK +S AKVY+   DK+ +      + L+++   +G+ +    ++    KAP   F  DE ++K+  +  L +QI
  S:     6 IKRHRVESVLKEIIPEALSTL-DDERINALVVTDVICSKGRSDAKVYL---DKSFLSPKEQSEALRQLRTVAGYVQNHCKQSEGWFKAPRFTFEFDEQLEKVSRMEELFKQI 113
>gi|29654722|ref|NP_820414.1| ribosome-binding factor A [Coxiella burnetii RSA 493] >gi|153207247|ref|ZP_01946011.1| ribosome-binding factor A [Coxiella burnetii 'MSU Goat Q177'] >gi|154707600|ref|YP_001423974.1| ribosome-binding factor A [Coxiella burnetii Dugway 5J108-111] >gi|161830027|ref|YP_001597275.1| ribosome-binding factor A [Coxiella burnetii RSA 331] >gi|165918811|ref|ZP_02218897.1| ribosome-binding factor A [Coxiella burnetii RSA 334] >gi|189039536|sp|A9KBM2|RBFA_COXBN Ribosome-binding factor A >gi|189039537|sp|A9N8V5|RBFA_COXBR Ribosome-binding factor A >gi|34098454|sp|Q83BS2|RBFA_COXBU Ribosome-binding factor A >gi|29541990|gb|AAO90928.1| ribosome-binding factor A [Coxiella burnetii RSA 493] >gi|120576735|gb|EAX33359.1| ribosome-binding factor A [Coxiella burnetii 'MSU Goat Q177'] >gi|154356886|gb|ABS78348.1| ribosome-binding factor A [Coxiella burnetii Dugway 5J108-111] >gi|161761894|gb|ABX77536.1| ribosome-binding factor A [Coxiella burnetii RSA 331] >gi|165917535|gb|EDR36139.1| ribosome-binding factor A [Coxiella burnetii RSA 334] (119 aa)
Score = 109, Expect = 5.1e-04, Identities = 29/103 (28%), Positives = 56/103 (54%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +R   +I   ++  +   V D  + + ++  V++S D   AKV+ S  +     ++ K +N A+G+ R +LA+   LR  P + F+ DESI++   I+ L+E+
  S:     6 QRVADLIHQQLAELLKKEVRDSRLSKISLTAVSISPDLKQAKVFYSLLENQNEKEVQKALNKATGYLRHLLAQATVLRYVPKLEFVYDESIERAHRISLLIER 108
>gi|16331339|ref|NP_442067.1| ribosome-binding factor A [Synechocystis sp. PCC 6803] >gi|3914560|sp|Q55625|RBFA_SYNY3 Ribosome-binding factor A >gi|1001511|dbj|BAA10137.1| sll0754 [Synechocystis sp. PCC 6803] (133 aa)
Score = 109, Expect = 5.2e-04, Identities = 30/106 (28%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCYDKTIID-KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ R  S+IK  +S  +   + DD +     +V  V +S D   AK+++S Y         +  ++ A+ F R  L + + LR+ P + FL D S+++ D+I +LL  +
  S:     6 RVSRVSSLIKREVSQMLLHEIKDDRVGTGMVSVTEVEVSGDLQHAKIFVSIYGSPEAKASTMAGLHSAAPFVRRELGQRMRLRRTPEVSFLEDRSLERGDKILNLLNNL 114
>gi|78183922|ref|YP_376357.1| ribosome-binding factor A [Synechococcus sp. CC9902] >gi|123582140|sp|Q3B014|RBFA_SYNS9 Ribosome-binding factor A >gi|78168216|gb|ABB25313.1| ribosome-binding factor A [Synechococcus sp. CC9902] (134 aa)
Score = 109, Expect = 5.7e-04, Identities = 26/107 (24%), Positives = 58/107 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + +  V    V ++ D    K+++S + +    +++++ +  ASGF R  L + L +R+AP + F  D  ++K   +  LL Q++
  S:     6 RVERVAALIRKETSELLINGIRDERVHKGMVSITSVEVAGDLQHCKIFVSIFGEPNDQNEVMEGLEAASGFLRGELGRRLQMRRAPEVKFQLDRGLEKGTSVLGLLNQLE 115
>gi|34558304|ref|NP_908119.1| ribosome-binding factor A [Wolinella succinogenes DSM 1740] >gi|39931714|sp|Q7MQU1|RBFA_WOLSU Ribosome-binding factor A >gi|34484023|emb|CAE11019.1| conserved hypothetical protein [Wolinella succinogenes] (119 aa)
Score = 109, Expect = 5.9e-04, Identities = 36/109 (33%), Positives = 59/109 (54%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK--ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +VK++R ES++K++I  A++TL  D  +    V  V  SK K  A+VY+     T  +K  IL+++  A G  R          K P   F  D+S DK + ++++ EQ+K
  S:     5 SVKLQRTESLLKEVIPEALSTLS-DTRLNSLGVVEVDCSKGKYHAEVYLDAPFATPEEKREILRQLRLAEGTIRDHCLSATGWFKCPRFHFNFDDSTDKANRLDAIFEQLK 114
>gi|170076709|ref|YP_001733347.1| ribosome-binding factor A [Synechococcus sp. PCC 7002] >gi|169884378|gb|ACA98091.1| ribosome-binding factor A [Synechococcus sp. PCC 7002] (131 aa)
Score = 109, Expect = 6.1e-04, Identities = 28/109 (25%), Positives = 60/109 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ +  S+IK  +S  +   + DD +    V    V +S D   AK+++S Y  +    + ++ +  + GF R  L + + LR++P ++F+ D S+++ D +  L+ Q++ K
  S:     6 RVSKVSSLIKREVSLMLMQDIKDDRVGAGMVSITEVEVSGDLQHAKIFVSIYGSEEARAETMEGLRASQGFVRRTLGQRIRLRRSPEVLFIEDRSLEEGDRMIHLINQLEIK 117
>gi|109898016|ref|YP_661271.1| ribosome-binding factor A [Pseudoalteromonas atlantica T6c] >gi|123064712|sp|Q15V71|RBFA_PSEA6 Ribosome-binding factor A >gi|109700297|gb|ABG40217.1| ribosome-binding factor A [Pseudoalteromonas atlantica T6c] (138 aa)
Score = 109, Expect = 6.2e-04, Identities = 26/87 (29%), Positives = 50/87 (57%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           D  +   TV  V +S+D +  K+Y++ +  D+ ++D  L  +    G+ RT+LA  + +R  PAI F+ D S+ +   I++L+++   K
  S:    31 DPRLGMVTVSAVEVSRDLAYTKIYVTFFENDEEVMDNYLSILEENKGYIRTLLANRMRMRAVPAIKFVRDGSLSEGIRISNLVDETLNK 119
>gi|163812293|ref|ZP_02203968.1| ribosome-binding factor A [Dehalococcoides sp. VS] >gi|157404034|gb|EDO70079.1| ribosome-binding factor A [Dehalococcoides sp. VS] (118 aa)
Score = 108, Expect = 6.8e-04, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:    37 TVHYVTLSKDKSIAKVYIS-CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +V+ V +S+D   A VY+S        D+IL  +N A+GFFRT +AK  ++R  P   F+ D++I++   +N+L++++
  S:    34 SVNEVDISEDMRHANVYVSHLSGNEHKDEILAALNTAAGFFRTEIAKKTDIRYMPVFHFVWDDTIERGVRLNTLIDRV 111
>gi|108757332|ref|YP_630299.1| ribosome-binding factor A [Myxococcus xanthus DK 1622] >gi|122389557|sp|Q1DAM4|RBFA_MYXXD Ribosome-binding factor A >gi|108461212|gb|ABF86397.1| ribosome-binding factor A [Myxococcus xanthus DK 1622] (119 aa)
Score = 108, Expect = 6.8e-04, Identities = 31/107 (28%), Positives = 56/107 (52%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +  ++ I DL++     ++ D  I   T+  V +S D  +A+V+ S   ++       K +  A GF R  +   +NLR +P I F  DES+ + D+I+ LL +++ K
  S:    12 QEIQAAIGDLLTRG---MLRDPRIGYITITGVKVSPDLRVARVFYSMMGNEQERADTQKGLEAAKGFVRREVTSAVNLRVSPEIFFSFDESVGEGDKIDRLLREVRNK 116
>gi|73748749|ref|YP_307988.1| ribosome-binding factor A [Dehalococcoides sp. CBDB1] >gi|147669515|ref|YP_001214333.1| ribosome-binding factor A [Dehalococcoides sp. BAV1] >gi|123619752|sp|Q3ZXU4|RBFA_DEHSC Ribosome-binding factor A >gi|189039538|sp|A5FQR5|RBFA_DEHSB Ribosome-binding factor A >gi|73660465|emb|CAI83072.1| ribosome-binding factor A [Dehalococcoides sp. CBDB1] >gi|146270463|gb|ABQ17455.1| ribosome-binding factor A [Dehalococcoides sp. BAV1] (118 aa)
Score = 108, Expect = 6.8e-04, Identities = 28/77 (36%), Positives = 48/77 (62%)
  Q:    37 TVHYVTLSKDKSIAKVYIS-CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +V+ V +S+D   A VY+S        D+IL  +N A+GFFRT +AK  ++R  P   F+ D +I++   +N+L++Q+
  S:    34 SVNEVDISEDMRHANVYVSHLAGDEHKDEILAALNAAAGFFRTEIAKKTDIRYMPVFHFVWDITIERGVRLNTLIDQV 111
>gi|167856180|ref|ZP_02478918.1| ribosome-binding factor A [Haemophilus parasuis 29755] >gi|167852702|gb|EDS23978.1| ribosome-binding factor A [Haemophilus parasuis 29755] (127 aa)
Score = 108, Expect = 6.9e-04, Identities = 26/73 (35%), Positives = 47/73 (64%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           V D  I   TV  V +S+D + AKV+++     D++ +++ L+ +N ASG+ RT++ K + LR  P + F+ D+S+
  S:    27 VKDPRIGMVTVSDVEISRDLAYAKVFVTFLFDSDESAVERGLEGLNKASGYIRTLVGKAMRLRIVPELRFVYDQSL 102
>gi|28210962|ref|NP_781906.1| ribosome-binding factor A [Clostridium tetani E88] >gi|32171612|sp|Q895J7|RBFA_CLOTE Ribosome-binding factor A >gi|28203401|gb|AAO35843.1| ribosome-binding factor A [Clostridium tetani E88] (121 aa)
Score = 108, Expect = 7.4e-04, Identities = 36/111 (32%), Positives = 61/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIK-QATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  +  R    +K  IS  I   + D  I    +V  V ++KD+  AKVY+S + D+   ++ L+ +  +SGF R  +   + LR  P I+  ND+SI+    I+S+L++IK
  S:     1 MAKYRAGRINEEVKKEISSIIRMDLKDPRISAMVSVTKVDVTKDQRYAKVYVSIFGDEKSKEETLEALKSSSGFIRREVGHRIKLRYTPEIIIQNDDSIEHGMHIDSILDKIK 113
>gi|188587938|ref|YP_001920619.1| ribosome-binding factor A [Clostridium botulinum E3 str. Alaska E43] >gi|188498219|gb|ACD51355.1| ribosome-binding factor A [Clostridium botulinum E3 str. Alaska E43] (116 aa)
Score = 108, Expect = 7.8e-04, Identities = 38/113 (33%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI--LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M N +  R     K  IS+ I   + D  L    +V  V ++KD   AKVY+S +     +K      +  ASGF R IL + +N+R  P I+F  D+SI+    I+ L++++K K
  S:     1 MPNYRGGRINEEFKREISNIIQNEIKDPRLTAMISVTDVKVTKDLRYAKVYVSIFSTKEEEKKDNFTALKSASGFIRKILGQRINVRHNPEILFELDDSINYAMHIDELIQKVKDK 116
>gi|194014192|ref|ZP_03052809.1| ribosome-binding factor A [Bacillus pumilus ATCC 7061] >gi|194013218|gb|EDW22783.1| ribosome-binding factor A [Bacillus pumilus ATCC 7061] (116 aa)
Score = 108, Expect = 7.9e-04, Identities = 30/80 (37%), Positives = 46/80 (57%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V ++ D  IAKVYIS   D+   ++ LK +  A G+ R+ +   + LRK P + F  DES+D  + I SL+ ++  K
  S:    33 TVTDVEVTGDLQIAKVYISVLGDEKKREETLKGLAKAKGYIRSEIGNRIRLRKTPELHFEFDESVDYGNRIESLIAELNTK 113
>gi|163762563|ref|ZP_02169628.1| protein of unknown function DUF342 [Bacillus selenitireducens MLS10] >gi|160357302|gb|EDP83950.1| protein of unknown function DUF342 [Bacillus selenitireducens MLS10] (115 aa)
Score = 108, Expect = 8.1e-04, Identities = 33/110 (30%), Positives = 56/110 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M N++  R    IK  ++  I   + D  I   TV  V ++ D   A  +++ Y D    +K L  +  A+G+ R+ + K + LRK P + F  DESI++ + I+ LL  +
  S:     1 MGNLRANRVGEQIKKELTDIIQRGIKDPRIGFVTVTAVDVTGDLQQATAFVTVYGDDDEREKSLLALEKANGYIRSEIGKRIKLRKTPELDFKFDESIERGNRIDELLRNL 111
>gi|94263055|ref|ZP_01286874.1| Ribosome-binding factor A [delta proteobacterium MLMS-1] >gi|94268658|ref|ZP_01291247.1| Ribosome-binding factor A [delta proteobacterium MLMS-1] >gi|93451513|gb|EAT02336.1| Ribosome-binding factor A [delta proteobacterium MLMS-1] >gi|93456598|gb|EAT06706.1| Ribosome-binding factor A [delta proteobacterium MLMS-1] (131 aa)
Score = 108, Expect = 8.1e-04, Identities = 31/99 (31%), Positives = 47/99 (47%)
  Q:    16 IKDLISHAITTL----VYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + D I   + TL    V D  ++Q T+   T++ D   A++Y S             +  A  F R  LAKNL LR  PA++F  D S+     +  LL +I+
  S:    29 VADEIRQEVATLLLAKVKDPRVEQVTILKATVTADLRQARIYYSVLHDEAAADAAAGLESARSFIRRSLAKNLVLRVVPALIFERDRSLADQQHLEQLLAEIQ 131
>gi|157738247|ref|YP_001490931.1| ribosome-binding factor A [Arcobacter butzleri RM4018] >gi|157700101|gb|ABV68261.1| ribosome binding factor A [Arcobacter butzleri RM4018] (119 aa)
Score = 108, Expect = 8.4e-04, Identities = 35/111 (31%), Positives = 58/111 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI--SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M ++ ++R ES++ +LI  A++ L  D+ I    +  V     K  A VY   S +DK  I  I+  +N A+G  ++ +  + +  K P   F+ND S++K   I  L  QIK
  S:     1 MKSINLQRTESLLMELIPQALSNL-DDERINSLPITGVNCKNGKYDAIVYFDGSDFDKDEIKAIISLLNRANGRIKSDVLASTSWYKCPNFTFVNDTSLEKSKHIEDLFAQIK 112
>gi|187933507|ref|YP_001885472.1| ribosome-binding factor A [Clostridium botulinum B str. Eklund 17B] >gi|187721660|gb|ACD22881.1| ribosome-binding factor A [Clostridium botulinum B str. Eklund 17B] (116 aa)
Score = 107, Expect = 8.9e-04, Identities = 38/113 (33%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI--LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M N +  R     K  IS+ I   + D  L    +V  V ++KD   AKVY+S +     +K      +  ASGF R IL + +N+R  P I+F  D+SI+    I+ L++++K K
  S:     1 MPNYRGGRINEEFKREISNIIQNEIKDPRLTAMISVTDVKVTKDLKYAKVYVSIFSTKEEEKKDNFTALKSASGFIRKILGQRINVRHNPEILFELDDSINYAMHIDELIQKVKDK 116
>gi|148241380|ref|YP_001226537.1| ribosome-binding factor A [Synechococcus sp. RCC307] >gi|166219414|sp|A5GQM5|RBFA_SYNR3 Ribosome-binding factor A >gi|147849690|emb|CAK27184.1| Ribosome-binding factor A [Synechococcus sp. RCC307] (131 aa)
Score = 107, Expect = 9.4e-04, Identities = 28/107 (26%), Positives = 60/107 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  S+I+  +S  +   V D+ + Q  V    V ++ D    KV +S +  ++  D+ +  +  A+ + R  L++ LN+R+ P +VF +D+ + +  E+  LL +++
  S:     6 RVERVASMIRREMSELLVNGVRDERVNQGMVSITNVVVAGDLQHCKVSVSIFGSESEQDQAMAGLRSAAPYLRGELSRRLNMRRTPELVFHHDKGLAQGVEVLGLLSKLE 115
>gi|154497686|ref|ZP_02036064.1| hypothetical protein BACCAP_01662 [Bacteroides capillosus ATCC 29799] >gi|150273184|gb|EDN00329.1| hypothetical protein BACCAP_01662 [Bacteroides capillosus ATCC 29799] (129 aa)
Score = 107, Expect = 9.5e-04, Identities = 29/107 (27%), Positives = 58/107 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           M++ +I R    I+  +S  I T+    +    ++  V  + D   AK+++S  DK+ +++++K +  A+G+ R  L   L+LR  P ++F  D+S+ +   I S+L
  S:     1 MASNRIGRINEEIQRELSGLIRTVKDPRVHGLVSITAVDTTTDLRYAKIHVSVLDKSDVNEVVKGLKSAAGYLRRELGAALSLRYTPELIFEKDDSMAQGAHILSML 107
>gi|116328712|ref|YP_798432.1| ribosome-binding factor A [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330630|ref|YP_800348.1| ribosome-binding factor A [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281615|sp|Q04U30|RBFA_LEPBJ Ribosome-binding factor A >gi|122283503|sp|Q04ZJ6|RBFA_LEPBL Ribosome-binding factor A >gi|116121456|gb|ABJ79499.1| Ribosome-binding factor A [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124319|gb|ABJ75590.1| Ribosome-binding factor A [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (117 aa)
Score = 107, Expect = 9.5e-04, Identities = 30/78 (38%), Positives = 45/78 (57%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYIS--CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDES-IDKIDE 105
           V D  +   +VH   +S+D    KV+++  C DK  + K+L  +N A+G F+T L+  L LR  P + FL DE  I  +DE
  S:    26 VKDPRVHMVSVHRAEISEDGKNMKVFVTAICTDKKKL-KVLSGLNSAAGLFQTTLSGKLGLRITPRMQFLWDEEYIQSLDE 105
>gi|182417577|ref|ZP_02948902.1| ribosome-binding factor A [Clostridium butyricum 5521] >gi|182378590|gb|EDT76118.1| ribosome-binding factor A [Clostridium butyricum 5521] (117 aa)
Score = 107, Expect = 9.7e-04, Identities = 38/113 (33%), Positives = 58/113 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYIS--CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +  R     K  IS+ I   + D  L    +V  V ++KD   AKVY+S  C D+      L  + GASGF R  + + +NLR  P I+   D+SI+    ++ L+ +I  K
  S:     1 MANYRGGRINEEFKREISNLIQNEIKDPRLTAMISVTDVKVTKDLRYAKVYVSIFCNDEEEKKSNLAALRGASGFIRKNVGQRINLRHTPEILIELDDSINYGMHMDELIHKISSK 116
>gi|37528347|ref|NP_931692.1| ribosome-binding factor A [Photorhabdus luminescens subsp. laumondii TTO1] >gi|39931723|sp|Q7MYY8|RBFA_PHOLL Ribosome-binding factor A >gi|36787785|emb|CAE16900.1| ribosome-binding factor A (fragment) [Photorhabdus luminescens subsp. laumondii TTO1] (136 aa)
Score = 107, Expect = 9.8e-04, Identities = 28/73 (38%), Positives = 44/73 (60%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISC-------YDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           V D  I  ATV  V +S+D + AKV+++        +D  ++   +K +N ASGF R++L K + LR  P + F  D S+
  S:    27 VKDPRIGMATVSGVEVSRDLAYAKVFVTFLNVLTEEHDSDVVKNGIKALNEASGFIRSLLGKAMRLRVVPELTFSYDNSL 106
>gi|146283629|ref|YP_001173782.1| ribosome-binding factor A [Pseudomonas stutzeri A1501] >gi|166219395|sp|A4VPN9|RBFA_PSEU5 Ribosome-binding factor A >gi|145571834|gb|ABP80940.1| ribosome-binding factor A [Pseudomonas stutzeri A1501] (129 aa)
Score = 107, Expect = 1.1e-03, Identities = 29/76 (38%), Positives = 47/76 (61%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           T+  V +S+D S AK++I+      D+  I   L+ +N A+GF R  L K++ LR  P + F  D SI +  E++SL+E+
  S:    36 TITAVDVSRDLSHAKIFITIMGQDDDQEAIKGNLRILNDAAGFLRMQLGKSMKLRTVPQLHFNYDASIRRGVELSSLIER 115
>gi|21243415|ref|NP_642997.1| ribosome-binding factor A [Xanthomonas axonopodis pv. citri str. 306] >gi|24418644|sp|Q8PJ56|RBFA_XANAC Ribosome-binding factor A >gi|21108966|gb|AAM37533.1| ribosomal-binding factor A [Xanthomonas axonopodis pv. citri str. 306] (130 aa)
Score = 107, Expect = 1.1e-03, Identities = 26/106 (24%), Positives = 57/106 (53%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R  + ++  +   +   V D+ +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:     8 RTDRVSAQVRRDLGTIVHAAVRDNGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKEIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 113
>gi|15639875|ref|NP_219325.1| ribosome-binding factor A (rbfA) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026113|ref|YP_001933885.1| ribosome-binding factor A [Treponema pallidum subsp. pallidum SS14] >gi|6093904|sp|O83860|RBFA_TREPA Ribosome-binding factor A >gi|3323207|gb|AAC26580.1| ribosome-binding factor A (rbfA) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018688|gb|ACD71306.1| ribosome-binding factor A [Treponema pallidum subsp. pallidum SS14] (126 aa)
Score = 107, Expect = 1.1e-03, Identities = 27/72 (37%), Positives = 46/72 (63%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI-------DKIDEINS 108
           +V++V +S     A+VY+S +  K    + ++ +  A+GF R++LAK L LR+ P + F+ DES+        KID + S
  S:    39 SVNWVDVSGGMVCARVYVSSFMGKYKTKQGVQGLESAAGFIRSVLAKKLRLRQCPRLSFVYDESVRDGFSLSRKIDRLES 118
>gi|56460075|ref|YP_155356.1| ribosome-binding factor A [Idiomarina loihiensis L2TR] >gi|61214736|sp|Q5QTY9|RBFA_IDILO Ribosome-binding factor A >gi|56179085|gb|AAV81807.1| Ribosome-binding factor A [Idiomarina loihiensis L2TR] (128 aa)
Score = 106, Expect = 1.1e-03, Identities = 28/95 (29%), Positives = 52/95 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK 102
           + ER    ++  I+  +   + D  +   TV  V +S+D + AKV+++ +  D     + LK +N ASGF R++L K +  R  P + F +D S+++
  S:     7 RTERVRHQLQREIAMILQREIKDPRVSMVTVSDVEVSRDLAYAKVFVTFFQDDPEQTKQALKVLNEASGFIRSLLGKRIKARIVPQLRFQHDASLNE 103
>gi|160943260|ref|ZP_02090496.1| hypothetical protein FAEPRAM212_00746 [Faecalibacterium prausnitzii M21/2] >gi|158445499|gb|EDP22502.1| hypothetical protein FAEPRAM212_00746 [Faecalibacterium prausnitzii M21/2] (164 aa)
Score = 106, Expect = 1.2e-03, Identities = 25/77 (32%), Positives = 44/77 (57%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           TV  + ++ D  +AKVY+S   +    K  ++ +N A+G  RT ++K +++RKAP  +F+ D+       IN LL  +
  S:    69 TVTRLDVTPDLDVAKVYVSVMGRADGPKPAIEALNRAAGHVRTEVSKKMHIRKAPRFIFVEDDGAAYAAHINELLRSL 146
>gi|148240554|ref|YP_001225941.1| ribosome-binding factor A [Synechococcus sp. WH 7803] >gi|166219413|sp|A5GNX9|RBFA_SYNPW Ribosome-binding factor A >gi|147849093|emb|CAK24644.1| Ribosome-binding factor A [Synechococcus sp. WH 7803] (140 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/103 (27%), Positives = 54/103 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           ++ER  ++I+   S  +   + DD + Q   ++  V +S D    K+++S   D     ++++ +  AS F R  L + L +R+AP +VF  D  ++K   +  LL
  S:     6 RVERVAALIRKETSELLMHGIRDDRVHQGLISITQVDVSGDLQHCKIFVSVLADPEGRAQVMEGLQAASSFLRGELGRRLQMRRAPEVVFHLDRGLEKGASVLGLL 111
>gi|21231943|ref|NP_637860.1| ribosome-binding factor A [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66767930|ref|YP_242692.1| ribosome-binding factor A [Xanthomonas campestris pv. campestris str. 8004] >gi|188991046|ref|YP_001903056.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris] >gi|21113672|gb|AAM41784.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66573262|gb|AAY48672.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris str. 8004] >gi|167732806|emb|CAP51000.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris] (132 aa)
Score = 106, Expect = 1.2e-03, Identities = 26/106 (24%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R  + ++  +   +   V D  +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:    10 RTDRVSAQVRRDLGTIVHAAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKEIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 115
>gi|153812991|ref|ZP_01965659.1| hypothetical protein RUMOBE_03398 [Ruminococcus obeum ATCC 29174] >gi|149830938|gb|EDM86028.1| hypothetical protein RUMOBE_03398 [Ruminococcus obeum ATCC 29174] (127 aa)
Score = 106, Expect = 1.2e-03, Identities = 36/109 (33%), Positives = 57/109 (52%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +++K  R    ++  +S  I   V D  I   T V  V ++ D    K +IS   +K   D  ++ +N A G+ R  LAKNLNLR  P I F+ DESI+    ++ L++ +
  S:     4 NSIKNTRINGEVQKELSTIIRNEVKDPRIHPMTSVMAVEVAPDLKTCKAFISVLGNKEAKDATIQGLNKAEGYIRRQLAKNLNLRNTPEIRFILDESIEYGVNMSKLIDDV 114
>gi|172046801|sp|Q4UWA1|RBFA_XANC8 Ribosome-binding factor A >gi|189039669|sp|B0RRB5|RBFA_XANCB Ribosome-binding factor A >gi|24418643|sp|Q8P7U8|RBFA_XANCP Ribosome-binding factor A (130 aa)
Score = 106, Expect = 1.2e-03, Identities = 26/106 (24%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R  + ++  +   +   V D  +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:     8 RTDRVSAQVRRDLGTIVHAAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKEIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 113
>gi|66047406|ref|YP_237247.1| ribosome-binding factor A [Pseudomonas syringae pv. syringae B728a] >gi|75500704|sp|Q4ZNR3|RBFA_PSEU2 Ribosome-binding factor A >gi|63258113|gb|AAY39209.1| Ribosome-binding factor A [Pseudomonas syringae pv. syringae B728a] (138 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/105 (25%), Positives = 58/105 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D   AK++++   +   ++I   +K +N A+GF R  LA+ + LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAQLIRREIKDPRVGLVTITAVDVSRDVGHAKIFMTVMGQDSAEEIAQTIKVLNSAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIER 114
>gi|71736021|ref|YP_276310.1| ribosome-binding factor A [Pseudomonas syringae pv. phaseolicola 1448A] >gi|123635189|sp|Q48E78|RBFA_PSE14 Ribosome-binding factor A >gi|71556574|gb|AAZ35785.1| ribosome-binding factor A [Pseudomonas syringae pv. phaseolicola 1448A] (138 aa)
Score = 106, Expect = 1.3e-03, Identities = 27/105 (25%), Positives = 58/105 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D   AK++++   +   ++I   +K +N A+GF R  LA+ + LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAQLIRREIKDPRVGLVTITAVDVSRDVGHAKIFMTVMGQDSAEEIAQTIKVLNSAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIER 114
>gi|56379642|dbj|BAD75550.1| ribosome-binding factor A [Geobacillus kaustophilus HTA426] (112 aa)
Score = 106, Expect = 1.3e-03, Identities = 33/94 (35%), Positives = 48/94 (51%)
  Q:    20 ISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +S  I+  + D  I   TV  V ++ D   AKVYIS   D    +  LK +  A GF R+ + + + LRK P I F  DE+++    I  L+ QI
  S:     1 MSDIISRRLKDPRIGFVTVTDVRVTGDLQQAKVYISVLGDDKQRENTLKALEKAKGFIRSEIGQRIRLRKTPEIFFEIDETMEYGSRIEQLIRQI 95
>gi|77457007|ref|YP_346512.1| ribosome-binding factor A [Pseudomonas fluorescens PfO-1] >gi|123606004|sp|Q3KI83|RBFA_PSEPF Ribosome-binding factor A >gi|77381010|gb|ABA72523.1| ribosome-binding factor A [Pseudomonas fluorescens PfO-1] (133 aa)
Score = 106, Expect = 1.3e-03, Identities = 29/105 (27%), Positives = 57/105 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   V D  +   T+  V +S+D   AK++I+   +   + I   +K +N A+GF R  LA+ + LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAQLIRREVKDPRVGLVTITAVEVSRDVGHAKIFITVMGQDNAEDIAQSIKVLNAAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIER 114
>gi|24213644|ref|NP_711125.1| ribosome binding factor A [Leptospira interrogans serovar Lai str. 56601] >gi|29427777|sp|Q8F7K0|RBFA_LEPIN Ribosome-binding factor A >gi|24194446|gb|AAN48143.1|AE011278_4 ribosome binding factor A [Leptospira interrogans serovar Lai str. 56601] (117 aa)
Score = 106, Expect = 1.4e-03, Identities = 31/78 (39%), Positives = 44/78 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYIS--CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDES-IDKIDE 105
           V D  +   +VH   +S+D    KV+++  C DK  I K+L  +N ASG F+  L+  L LR  P + FL DE  I  +DE
  S:    26 VKDPRVHMVSVHRAEISEDGKNMKVFVTAICTDKKKI-KVLSGLNSASGLFQATLSGKLGLRITPRMHFLWDEEYIQSLDE 105
>gi|171778099|ref|ZP_02919356.1| hypothetical protein STRINF_00191 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283081|gb|EDT48505.1| hypothetical protein STRINF_00191 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (118 aa)
Score = 106, Expect = 1.4e-03, Identities = 32/113 (28%), Positives = 60/113 (53%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +++R    IK  ++  +   V D  ++  T+  V +  D S+AKVY + + +   D    +I    A G  +  L +NL + K P + F+ DESI+  ++I+ +L  ++ K
  S:     3 MANHRVDRVGMEIKREVNEILHKKVRDPRVQDVTITDVQMLGDLSMAKVYYTIHSELASDNQKAQIGLEKAKGTIKRELGRNLTMYKIPDLTFIKDESIEYGNKIDQMLRDLEAK 117
>gi|116071460|ref|ZP_01468728.1| Ribosome-binding factor A [Synechococcus sp. BL107] >gi|116065083|gb|EAU70841.1| Ribosome-binding factor A [Synechococcus sp. BL107] (134 aa)
Score = 106, Expect = 1.4e-03, Identities = 25/107 (23%), Positives = 58/107 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHY--VTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ER  ++I+   S  +   + D+ + +  V    V ++ D    K+++S + +    +++++ +  ASG+ R  L + L +R+AP + F  D  ++K   +  LL Q++
  S:     6 RVERVAALIRKETSELLINGIRDERVHKGMVSITSVEVAGDLQHCKIFVSIFGEPNDQNEVMEGLEAASGYLRGELGRRLQMRRAPEVKFQLDRGLEKGTSVLGLLNQLE 115
>gi|51246464|ref|YP_066348.1| ribosome-binding factor A [Desulfotalea psychrophila LSv54] >gi|61214924|sp|Q6AJY5|RBFA_DESPS Ribosome-binding factor A >gi|50877501|emb|CAG37341.1| related to ribosome-binding factor A [Desulfotalea psychrophila LSv54] (140 aa)
Score = 106, Expect = 1.4e-03, Identities = 25/86 (29%), Positives = 48/86 (55%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCYD-KTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  ++   +  VT + D +I K+Y + Y     +  + K    A+GF R+ LA+ LN+R  P + F  D++ +K+ EI ++ ++I
  S:    43 IRDPKLQDVGISRVTATDDLTIVKIYYTIYGPHKHVKAVDKAFLAATGFIRSHLARTLNMRYTPNLQFCYDKTAEKVAEIENIFQEI 129
>gi|45658539|ref|YP_002625.1| ribosomal-binding factor A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|56749627|sp|Q72NX4|RBFA_LEPIC Ribosome-binding factor A >gi|45601782|gb|AAS71262.1| ribosomal-binding factor A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (117 aa)
Score = 105, Expect = 1.5e-03, Identities = 31/78 (39%), Positives = 44/78 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYIS--CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDES-IDKIDE 105
           V D  +   +VH   +S+D    KV+++  C DK  I K+L  +N ASG F+  L+  L LR  P + FL DE  I  +DE
  S:    26 VKDPRVHMVSVHRAEISEDGKNMKVFVTAICTDKKKI-KVLSGLNSASGLFQATLSGKLGLRITPKMHFLWDEEYIQSLDE 105
>gi|157368737|ref|YP_001476726.1| ribosome-binding factor A [Serratia proteamaculans 568] >gi|166918678|sp|A8G908|RBFA_SERP5 Ribosome-binding factor A >gi|157320501|gb|ABV39598.1| ribosome-binding factor A [Serratia proteamaculans 568] (136 aa)
Score = 105, Expect = 1.6e-03, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           V D  +  ATV  V +S+D + AKVY++         D  ++   +K +  ASG+ RT+L K + LR  P + F  D S+
  S:    27 VKDPRVGMATVSGVEVSRDLAYAKVYVTFLNVLTENADPNLVPNGIKALEDASGYIRTLLGKAMRLRVVPELTFAYDNSL 106
>gi|119774099|ref|YP_926839.1| ribosome-binding factor A [Shewanella amazonensis SB2B] >gi|166219403|sp|A1S463|RBFA_SHEAM Ribosome-binding factor A >gi|119766599|gb|ABL99169.1| ribosome-binding factor A [Shewanella amazonensis SB2B] (137 aa)
Score = 105, Expect = 1.6e-03, Identities = 27/84 (32%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKVY++ +  D  +I+  L  +N A+ + RT++A  + LR  P + F+ D S+ +   +++L+ ++
  S:    29 DPRIGMVTVNDVDVSRDLSHAKVYVTFFEEDPQVIEAKLAALNTAAPYARTLVAGRMKLRVMPELRFIYDASLVEGMRMSNLVSKV 114
>gi|167035702|ref|YP_001670933.1| ribosome-binding factor A [Pseudomonas putida GB-1] >gi|189039552|sp|B0KHX7|RBFA_PSEPG Ribosome-binding factor A >gi|166862190|gb|ABZ00598.1| ribosome-binding factor A [Pseudomonas putida GB-1] (132 aa)
Score = 105, Expect = 1.7e-03, Identities = 29/105 (27%), Positives = 56/105 (53%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   V D  +   T+  V +S+D   AKV+I+   +   D +   LK +N A+ F R  L +++ LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAELIRREVKDPRVGLVTITAVDVSRDLGHAKVFITVMGEETPDAVQQSLKALNSAASFLRLHLGRSMQLRSVPQLHFHFDESVSRGVHLSALIER 114
>gi|168062353|ref|XP_001783145.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162665343|gb|EDQ52031.1| predicted protein [Physcomitrella patens subsp. patens] (140 aa)
Score = 105, Expect = 1.7e-03, Identities = 26/83 (31%), Positives = 48/83 (57%)
  Q:    32 LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           L   AT+  V +S D  +AKV++S Y D+   +  L+ +   + + R  L K ++LR  P + F+ DES+++   +  LL+++K
  S:    47 LSSMATITDVEISNDLQVAKVFVSLYGDEREQEVALEGLKSKAKYVRMGLGKRMSLRMTPDVRFVKDESLERGSRVLELLDKVK 130
>gi|166712597|ref|ZP_02243804.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzicola BLS256] (130 aa)
Score = 105, Expect = 1.7e-03, Identities = 26/106 (24%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R  + ++  +   +   V D  +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:     8 RTDRVSAQVRRDLGTIVHAAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKDIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 113
>gi|58582840|ref|YP_201856.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84624707|ref|YP_452079.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|123521403|sp|Q2P0X2|RBFA_XANOM Ribosome-binding factor A >gi|62510970|sp|Q5GXV0|RBFA_XANOR Ribosome-binding factor A >gi|58427434|gb|AAW76471.1| ribosomal-binding factor A [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84368647|dbj|BAE69805.1| ribosomal-binding factor A [Xanthomonas oryzae pv. oryzae MAFF 311018] (130 aa)
Score = 105, Expect = 1.7e-03, Identities = 26/106 (24%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R  + ++  +   +   V D  +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:     8 RTDRVSAQVRRDLGTIVHAAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKDIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 113
>gi|85712991|ref|ZP_01044029.1| ribosome-binding factor A [Idiomarina baltica OS145] >gi|85693160|gb|EAQ31120.1| ribosome-binding factor A [Idiomarina baltica OS145] (125 aa)
Score = 105, Expect = 1.8e-03, Identities = 30/109 (27%), Positives = 59/109 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + ER    ++  I+  +   V D  +   TV  V +S+D + AKV+++    D   +   LK +N ASGF R++L K +  R  P + F +D S+++   ++ L+++ + +
  S:     7 RTERVRHQLQREIAMILQREVKDPRVSMVTVSDVEVSRDLAYAKVFVTFLHDDDDQVKAGLKVLNQASGFIRSLLGKRIKARVVPELKFQHDGSLNEGIRMSRLVDEARKR 117
>gi|146328987|ref|YP_001208966.1| ribosome-binding factor A [Dichelobacter nodosus VCS1703A] >gi|166218436|sp|A5EWY8|RBFA_DICNV Ribosome-binding factor A >gi|146232457|gb|ABQ13435.1| ribosome-binding factor A [Dichelobacter nodosus VCS1703A] (122 aa)
Score = 105, Expect = 1.8e-03, Identities = 30/101 (29%), Positives = 57/101 (56%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E + +DL + A+  +V+       +   V L++D S AKVY++    ++    +++ ++N  +G FR  LAKNL++RK P + F  D+S++    +  LL  +
  S:    13 EQMRRDL-AQALVDIVHHPHASLLSFTAVHLTRDLSFAKVYVTHVLDNEEERSELVAELNAKAGQFRHYLAKNLSIRKVPELQFYYDQSVEYGARMEQLLTHL 114
>gi|159902668|ref|YP_001550012.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9211] >gi|159887844|gb|ABX08058.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9211] (130 aa)
Score = 105, Expect = 1.8e-03, Identities = 30/109 (27%), Positives = 61/109 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCYDKTII-DKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK----IDEINSLLEQIKGK 116
           ++E+  ++I+  +S  +   + D+ +  +  T+  V +S D    K+++S + +    ++    +  ASGF R  L + L +R+AP IVF  D+ ++K    +D +  L E+ K K
  S:     6 RVEKVSALIRKEMSQLLLDGIRDERVASSMVTITEVEVSGDLQHCKIFVSIFGQDPKREEAFSGLQAASGFLRGELGRRLQMRRAPEIVFKLDKGMEKGSSVLDLLGKLEEERKNK 121
>gi|110004480|emb|CAK98817.1| putative ribosome-binding factor a protein [Spiroplasma citri] (112 aa)
Score = 105, Expect = 1.8e-03, Identities = 29/110 (26%), Positives = 57/110 (51%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + +K+ER +S+I   ++  +   + D+++   ++H V LS D S AKVY S        ++   +       R+ LA  L + + P + F+ D S+D  + I ++L+ +K
  S:     3 NKIKVERMQSLIARDLTIIMQREIRDEILNTLSIHAVKLSNDLSHAKVYYSSLLNKPEAELHNIVQNYKNKIRSKLAHKLEIYRCPDLEFIFDRSLDNANNIEAILQNLK 112
>gi|78778501|ref|YP_396613.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9312] >gi|123554790|sp|Q31D68|RBFA_PROM9 Ribosome-binding factor A >gi|78712000|gb|ABB49177.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9312] (130 aa)
Score = 104, Expect = 1.9e-03, Identities = 33/112 (29%), Positives = 61/112 (54%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDK-TIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +N ++ +  S++K  I+  +   + +DLI+     +  + LS D    K+YI+   K T+  +I+  +N A  F R  L K + +R+ P I+F  D  +DK   +  LL+++K K
  S:     3 NNFRLAKVSSLLKKEITLILQNDLENDLIRDYFVNISKIDLSGDLQHCKIYITSTAKETVRKEIVANLNTAKSFIRNNLGKRIEMRRVPEIIFKEDIVLDKGLSVLKLLDELKNK 117
>gi|78048392|ref|YP_364567.1| ribosome-binding factor A [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|123584681|sp|Q3BRP6|RBFA_XANC5 Ribosome-binding factor A >gi|78036822|emb|CAJ24515.1| ribosomal-binding factor A [Xanthomonas campestris pv. vesicatoria str. 85-10] (130 aa)
Score = 104, Expect = 2.0e-03, Identities = 26/106 (24%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R  + ++  +   +   V D  +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:     8 RTDRVSAQVRRDLGTIVHAAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKEIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 113
>gi|92115188|ref|YP_575116.1| ribosome-binding factor A [Chromohalobacter salexigens DSM 3043] >gi|122419135|sp|Q1QSZ1|RBFA_CHRSD Ribosome-binding factor A >gi|91798278|gb|ABE60417.1| ribosome-binding factor A [Chromohalobacter salexigens DSM 3043] (131 aa)
Score = 104, Expect = 2.1e-03, Identities = 30/105 (28%), Positives = 55/105 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   TV  V +S+D   A +YI+     D   ID+ LK +  A GF R+ +A  + LR  P + F  DES+ +   ++SL+++
  S:     6 RTDRVADQLQQELAVLIQREIKDPRLGMVTVSSVKVSRDLGYADIYITLLGENDAARIDENLKVLRHARGFLRSQIANRIKLRHVPELRFHYDESVVRGQRLSSLIDE 113
>gi|28871623|ref|NP_794242.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato str. DC3000] >gi|32171593|sp|Q87WQ6|RBFA_PSESM Ribosome-binding factor A >gi|28854875|gb|AAO57937.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato str. DC3000] (138 aa)
Score = 104, Expect = 2.1e-03, Identities = 27/105 (25%), Positives = 57/105 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   + D  +   T+  V +S+D   AK++++     +   I + +K +N A+GF R  LA+ + LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAQLIRREIKDPRVGLVTITAVDVSRDVGHAKIFMTVMGQDNAEDIAQTIKVLNAAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIER 114
>gi|70726645|ref|YP_253559.1| ribosome-binding factor A [Staphylococcus haemolyticus JCSC1435] >gi|123660054|sp|Q4L5X2|RBFA_STAHJ Ribosome-binding factor A >gi|68447369|dbj|BAE04953.1| ribosome-binding factor A [Staphylococcus haemolyticus JCSC1435] (116 aa)
Score = 104, Expect = 2.3e-03, Identities = 31/110 (28%), Positives = 57/110 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N++ ER    +K  I   +   V D  +   T+  V L+ D S AKVY++    +  ++   K ++ A GF ++ L   + LR  P + F  DESI+  ++I  +++ +
  S:     1 MNNMRAERVGEQMKKEIMDIVNNKVKDPRVGFITITDVDLTNDLSQAKVYLTVLGSEKEVNDTFKALDKAKGFIKSELGSRMRLRIVPELFFEYDESIEYGNKIEKMIQDL 111
>gi|170719908|ref|YP_001747596.1| ribosome-binding factor A [Pseudomonas putida W619] >gi|169757911|gb|ACA71227.1| ribosome-binding factor A [Pseudomonas putida W619] (132 aa)
Score = 104, Expect = 2.3e-03, Identities = 29/105 (27%), Positives = 56/105 (53%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   V D  +   T+  V +S+D   AKV+I+   +   D +   LK +N A+ F R  L +++ LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAELIRREVKDPRVGLVTITAVDVSRDLGHAKVFITVMGEETPDAVQQSLKALNSAASFLRLHLGRSMQLRSVPQLHFHFDESVSRGVHLSALIER 114
>gi|26991394|ref|NP_746819.1| ribosome-binding factor A [Pseudomonas putida KT2440] >gi|148549778|ref|YP_001269880.1| ribosome-binding factor A [Pseudomonas putida F1] >gi|166219394|sp|A5W986|RBFA_PSEP1 Ribosome-binding factor A >gi|32171601|sp|Q88DV8|RBFA_PSEPK Ribosome-binding factor A >gi|24986463|gb|AAN70283.1|AE016669_1 ribosome-binding factor A [Pseudomonas putida KT2440] >gi|148513836|gb|ABQ80696.1| ribosome-binding factor A [Pseudomonas putida F1] (132 aa)
Score = 104, Expect = 2.3e-03, Identities = 29/105 (27%), Positives = 56/105 (53%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   V D  +   T+  V +S+D   AKV+I+   +   D +   LK +N A+ F R  L +++ LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAELIRREVKDPRVGLVTITAVDVSRDLGHAKVFITVMGEETPDAVQQSLKALNSAASFLRLHLGRSMQLRSVPQLHFHFDESVSRGVHLSALIER 114
>gi|149909279|ref|ZP_01897935.1| ribosome-binding factor A [Moritella sp. PE36] >gi|149807596|gb|EDM67544.1| ribosome-binding factor A [Moritella sp. PE36] (141 aa)
Score = 104, Expect = 2.4e-03, Identities = 26/89 (29%), Positives = 52/89 (58%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           V D  I   TV  + LS+D S AKVY++ +    D+  + + +  +  ASG+ R+++   + LR  P + F+ D ++ +   ++SL+ +++ K
  S:    27 VKDPRIGMVTVSSIDLSRDLSYAKVYVTFFNIDNDEDRVKEGIAALTAASGYIRSLVGSAMKLRIVPELRFIYDNTLVEGMRLSSLVTEVRAK 119
>gi|54295601|ref|YP_128016.1| ribosome-binding factor A [Legionella pneumophila str. Lens] >gi|61214769|sp|Q5WT37|RBFA_LEGPL Ribosome-binding factor A >gi|53755433|emb|CAH16929.1| Ribosome-binding factor A [Legionella pneumophila str. Lens] (123 aa)
Score = 104, Expect = 2.4e-03, Identities = 30/106 (28%), Positives = 61/106 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQ-ATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R   +I+  ++  I   + D  +K   T+  V ++ D   AK+Y +    DK+++  IL   NGA+ + R+ LA+++ LR  P + F+ DESI+    ++ L++++
  S:     7 RTDRIAEMIQRKLALIIPQEIKDPRLKGFVTISAVKVAADLGHAKIYFTVLNEDKSVVTNIL---NGAASYLRSALARSITLRTVPQLHFIYDESIEYGQRLSRLIDEV 112
>gi|52842970|ref|YP_096769.1| ribosome binding factor A [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54298755|ref|YP_125124.1| ribosome-binding factor A [Legionella pneumophila str. Paris] >gi|148361085|ref|YP_001252292.1| ribosome binding factor A [Legionella pneumophila str. Corby] >gi|166218446|sp|A5IHU6|RBFA_LEGPC Ribosome-binding factor A >gi|61214776|sp|Q5X1C4|RBFA_LEGPA Ribosome-binding factor A >gi|61214803|sp|Q5ZRV5|RBFA_LEGPH Ribosome-binding factor A >gi|52630081|gb|AAU28822.1| ribosome binding factor A [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53752540|emb|CAH13972.1| Ribosome-binding factor A [Legionella pneumophila str. Paris] >gi|148282858|gb|ABQ56946.1| ribosome binding factor A [Legionella pneumophila str. Corby] (123 aa)
Score = 104, Expect = 2.4e-03, Identities = 30/106 (28%), Positives = 61/106 (57%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQ-ATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R   +I+  ++  I   + D  +K   T+  V ++ D   AK+Y +    DK+++  IL   NGA+ + R+ LA+++ LR  P + F+ DESI+    ++ L++++
  S:     7 RTDRIAEMIQRKLALIIPQEIKDPRLKGFVTISAVKVAADLGHAKIYFTVLNEDKSVVTNIL---NGAASYLRSALARSITLRTVPQLHFIYDESIEYGQRLSRLIDEV 112
>gi|77919157|ref|YP_356972.1| ribosome-binding factor A [Pelobacter carbinolicus DSM 2380] >gi|123574181|sp|Q3A4A5|RBFA_PELCD Ribosome-binding factor A >gi|77545240|gb|ABA88802.1| ribosome-binding factor A [Pelobacter carbinolicus DSM 2380] (119 aa)
Score = 104, Expect = 2.4e-03, Identities = 30/110 (27%), Positives = 57/110 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKK-INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M + +  R    ++  IS  +   + D  +   T+  V+++ D  +A+VY + Y +    K  +K +  A+ FFR  L + L +R  P +VF  D++++  + I SLL Q+
  S:     1 MDHPRPHRVGEQLQKEISALLLKGLKDPRVGFVTITAVSVTPDMHLARVYYTVYGEEEQRKETQKGLESATPFFRRELGRRLRMRYVPDLVFEFDKALEYGNRIESLLRQL 111
>gi|182676604|sp|A7Z4T6|RBFA_BACA2 Ribosome-binding factor A (117 aa)
Score = 103, Expect = 2.6e-03, Identities = 34/108 (31%), Positives = 56/108 (51%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYD-KTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +++  R    +K  +   I+  + D  I   TV  V +S D  IAKVYIS    +   ++ LK +  A GF R+ +   + LRK P + F  DESI+  + I +L+ ++
  S:     2 SMRANRVGEQMKKELGDIISRKLKDPRIGFLTVTDVRVSGDLQIAKVYISVLGGEKKKEEALKGLEKAKGFIRSEIGSRIRLRKTPELEFEFDESIEYGNRIETLIHEL 110
>gi|167729263|emb|CAO80174.1| putative ribosome-binding factor A (rbfA-like) [Candidatus Cloacamonas acidaminovorans] (161 aa)
Score = 103, Expect = 2.6e-03, Identities = 30/111 (27%), Positives = 60/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTII-DKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M N +I R ++ +K L + A++  + D  +    +  V +SKD   AK+Y S Y+     D+I + +  +SGF +  +A    +R  P + F  D++ D+  ++++LL  ++
  S:     1 MKNYRIPRLQAELKKLFNIALSQKLNDPKLAWVQITDVVISKDLHYAKLYFSHYNNPASHDQIRELLIKSSGFLKKQIAGAQIMRTIPELSFYYDDTEDRAAKVDTLLASLR 112
>gi|188577679|ref|YP_001914608.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188522131|gb|ACD60076.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzae PXO99A] (115 aa)
Score = 103, Expect = 2.9e-03, Identities = 25/86 (29%), Positives = 48/86 (55%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V D  +   +V  V +S+D + AKV+++   +    + +K +   +G  RT LA+ + LR  P + F  D+S+D+ + I++LL  +
  S:    13 VRDHGLPSVSVSDVEISRDLAHAKVFVTALQQERSAEAVKGLKDIAGQLRTQLARAMKLRHVPELHFHYDDSVDRGERIDNLLRDL 98
>gi|154686082|ref|YP_001421243.1| ribosome-binding factor A [Bacillus amyloliquefaciens FZB42] >gi|154351933|gb|ABS74012.1| RbfA [Bacillus amyloliquefaciens FZB42] (115 aa)
Score = 103, Expect = 2.9e-03, Identities = 35/104 (33%), Positives = 55/104 (52%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYD-KTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+ +  + D+IS  +     D  I   TV  V +S D  IAKVYIS    +   ++ LK +  A GF R+ +   + LRK P + F  DESI+  + I +L+ ++
  S:     8 EQMKKELGDIISRKLK----DPRIGFLTVTDVRVSGDLQIAKVYISVLGGEKKKEEALKGLEKAKGFIRSEIGSRIRLRKTPELEFEFDESIEYGNRIETLIHEL 108
>gi|89209757|ref|ZP_01188152.1| Ribosome-binding factor A [Halothermothrix orenii H 168] >gi|89160826|gb|EAR80479.1| Ribosome-binding factor A [Halothermothrix orenii H 168] (122 aa)
Score = 103, Expect = 2.9e-03, Identities = 32/111 (28%), Positives = 58/111 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M   +  R   ++K  IS  I   V D  I   +V  V +S D   AKV++S Y D+    + ++ +  A+G+ R ++ + + +   P I+F  D+S++    IN LL+++K
  S:     1 MKRQRARRLGELLKKEISDIILREVKDPRIGFISVTDVEVSNDLRHAKVFVSVYGDEKERKETMEGLEKATGYIRKLIGERVKVYYTPEILFRYDDSLEHGARINELLKKVK 112
>gi|51892661|ref|YP_075352.1| ribosome-binding factor A [Symbiobacterium thermophilum IAM 14863] >gi|61214894|sp|Q67P85|RBFA_SYMTH Ribosome-binding factor A >gi|51856350|dbj|BAD40508.1| ribosome-binding factor A [Symbiobacterium thermophilum IAM 14863] (125 aa)
Score = 103, Expect = 2.9e-03, Identities = 33/108 (30%), Positives = 53/108 (49%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           N +  R    +++ ++  +   V D  I   ++  V +S+D   AK+Y+S        K  +  +  A+GF R+ LAK L LR  P + F  DESI+    I  LL Q+
  S:     4 NARAIRVGEQMREELAQLLRDEVKDPRIGFVSIVKVEVSRDIRHAKIYVSVLGNDQQKKETMAGLASATGFLRSELAKRLQLRYMPELHFALDESIEHGQRIAQLLVQV 112
>gi|116490514|ref|YP_810058.1| ribosome-binding factor A [Oenococcus oeni PSU-1] >gi|122277299|sp|Q04GM9|RBFA_OENOB Ribosome-binding factor A >gi|116091239|gb|ABJ56393.1| ribosome-binding factor A [Oenococcus oeni PSU-1] (121 aa)
Score = 103, Expect = 2.9e-03, Identities = 31/112 (27%), Positives = 55/112 (49%)
  Q:     2 KHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDK--TIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           KH  + ++ R E  I+  IS  +   V D  +K  T+  + ++ D SIA VY + Y    +  +K    +  A G  +  LA+ +   K P ++F  D +I+  D I  L+ ++
  S:     3 KHAKSARLLRVEGTIQREISEILVKEVSDPRLKDVTITGIDMTPDFSIAYVYWTIYSDLASSGEKADAGLQAAKGLIKRQLARKMTTFKIPDLIFKRDTAIEYGDHIEQLIAKL 116
>gi|67158745|ref|ZP_00419606.1| Ribosome-binding factor A [Azotobacter vinelandii AvOP] >gi|67084618|gb|EAM04100.1| Ribosome-binding factor A [Azotobacter vinelandii AvOP] (129 aa)
Score = 103, Expect = 3.0e-03, Identities = 31/105 (29%), Positives = 59/105 (56%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTI----IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  +S  I   + D  +   TV  V +++D S AKV+I+   K      I++ L+ ++ A+GF R  L K++ LR  P + F  D S+ +  E+++L+E+
  S:     7 RTQRIGDQMQRELSFLIQREIKDPRLGMITVTAVEVARDLSHAKVFITVMGKEDSADEIERNLEILHEAAGFLRMQLGKSMKLRSVPQLHFSYDASVRRGVELSALIER 115
>gi|149369322|ref|ZP_01889174.1| ribosome-binding factor A [unidentified eubacterium SCB49] >gi|149356749|gb|EDM45304.1| ribosome-binding factor A [unidentified eubacterium SCB49] (131 aa)
Score = 103, Expect = 3.1e-03, Identities = 30/80 (37%), Positives = 48/80 (60%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAK--NLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +V  V ++ D SIAKVY+S +  T    I+K+IN      +  +A+     LR+ P + F ND+S+D I++I+   E +KGK
  S:    37 SVSKVNVTVDLSIAKVYVSVFPTTNAAAIVKEINDGKSKIKHQVAQLTRHQLRRMPELHFFNDDSLDYIEQID---EAVKGK 115
>gi|118587520|ref|ZP_01544944.1| ribosome binding factor A [Oenococcus oeni ATCC BAA-1163] >gi|118431971|gb|EAV38713.1| ribosome binding factor A [Oenococcus oeni ATCC BAA-1163] (139 aa)
Score = 103, Expect = 3.1e-03, Identities = 31/112 (27%), Positives = 55/112 (49%)
  Q:     2 KHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDK--TIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           KH  + ++ R E  I+  IS  +   V D  +K  T+  + ++ D SIA VY + Y    +  +K    +  A G  +  LA+ +   K P ++F  D +I+  D I  L+ ++
  S:    21 KHAKSARLLRVEGTIQREISEILVKEVSDPRLKDVTITGIDMTPDFSIAYVYWTIYSDLASSGEKADAGLQAAKGLIKRQLARKMTTFKIPDLIFKRDTAIEYGDHIEQLIAKL 134
>gi|15616981|ref|NP_240194.1| ribosome-binding factor A [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387026|sp|P57457|RBFA_BUCAI Ribosome-binding factor A >gi|25302100|pir||H84973 ribosome-binding factor A [imported] - Buchnera sp. (strain APS) >gi|10039046|dbj|BAB13080.1| ribosome-binding factor A [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (120 aa)
Score = 103, Expect = 3.2e-03, Identities = 31/80 (38%), Positives = 50/80 (62%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI---NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V +SKD S A++++S  +    +K+ KKI   N AS + R +L K + LR  P I+F +D+S  K ++I+ +LE +  K
  S:    37 TVSEVQVSKDLSYAQIFVSFLESDNNEKVKKKITILNRASSYIRKLLCKRMKLRIVPNIIFHHDDSFLKGNKISCILENLTKK 119
>gi|117926999|ref|YP_867616.1| ribosome-binding factor A [Magnetococcus sp. MC-1] >gi|171460788|sp|A0LE17|RBFA_MAGSM Ribosome-binding factor A >gi|117610755|gb|ABK46210.1| ribosome-binding factor A [Magnetococcus sp. MC-1] (123 aa)
Score = 102, Expect = 3.3e-03, Identities = 32/108 (29%), Positives = 52/108 (48%)
  Q:     7 VKIERYESIIKDLISHAITTLVYDD--LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ ER  + I+  ++  +T     D  L     +  V +S D S AKVY + + ++    +      ASGF R ++AK L LR AP + F  D   D    I+ LL  ++
  S:     3 IRTERVGNAIRKEVASMLTRGEIKDPRLGGFVNIQEVRVSPDLSYAKVYYTVFGESDQAGVADAWQRASGFLRNVIAKRLKLRHAPELRFELDHVADYSKRIDELLNGLE 112
>gi|170727893|ref|YP_001761919.1| ribosome-binding factor A [Shewanella woodyi ATCC 51908] >gi|169813240|gb|ACA87824.1| ribosome-binding factor A [Shewanella woodyi ATCC 51908] (140 aa)
Score = 102, Expect = 3.3e-03, Identities = 26/86 (30%), Positives = 54/86 (62%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  I   TV+ V +S+D S AKV+++ +  D  ++++ L+ +  ASG+ R+++A  + LR  P + F+ D S+ +   +++L+ +I
  S:    27 IKDPRIGMVTVNDVEVSRDLSYAKVFVTFFEEDSKLVEEKLEALTTASGYVRSLVAGRMKLRVMPELRFVYDASLVEGMRMSNLVTRI 114
>gi|71854003|gb|AAZ52026.1| ribosome-binding factor A [Streptococcus pyogenes MGAS5005] (163 aa)
Score = 102, Expect = 3.3e-03, Identities = 34/113 (30%), Positives = 55/113 (48%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL  +  K
  S:    48 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRDLDNK 162
>gi|32473743|ref|NP_866737.1| ribosome-binding factor A [Rhodopirellula baltica SH 1] >gi|39931771|sp|Q7URR1|RBFA_RHOBA Ribosome-binding factor A >gi|32444279|emb|CAD74277.1| probable ribosome-binding factor A [Rhodopirellula baltica SH 1] (137 aa)
Score = 102, Expect = 3.4e-03, Identities = 29/111 (26%), Positives = 61/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           MS+ ++ +    I++++++AI T V D  ++  TV  V +S D   AKV +S   D+T  +  L+ +  ++GF ++ +A  ++ R  P + F  D   +    ++ +L +I+
  S:     1 MSSRRLLKAAEAIREVVANAIVTEVRDPRVRDVTVIGVEVSPDMREAKVKVSVMGDETQKNLSLRGLQNSAGFLQSKIANRMDTRYTPKLRFEVDRGQENAMTVSEILARIQ 112
>gi|46133543|ref|ZP_00203198.1| COG0858: Ribosome-binding factor A [Haemophilus influenzae R2866] >gi|53732695|ref|ZP_00349548.1| COG0858: Ribosome-binding factor A [Haemophilus influenzae R2846] >gi|68250153|ref|YP_249265.1| ribosome-binding factor A [Haemophilus influenzae 86-028NP] >gi|145629355|ref|ZP_01785154.1| ribosome-binding factor A [Haemophilus influenzae 22.1-21] >gi|145630826|ref|ZP_01786604.1| ribosome-binding factor A [Haemophilus influenzae 22.4-21] >gi|145633238|ref|ZP_01788969.1| ribosome-binding factor A [Haemophilus influenzae 3655] >gi|145634362|ref|ZP_01790072.1| ribosome-binding factor A [Haemophilus influenzae PittAA] >gi|145637806|ref|ZP_01793455.1| ribosome-binding factor A [Haemophilus influenzae PittHH] >gi|145641331|ref|ZP_01796910.1| ribosome-binding factor A [Haemophilus influenzae R3021] >gi|148825872|ref|YP_001290625.1| ribosome-binding factor A [Haemophilus influenzae PittEE] >gi|166218442|sp|A5UBU1|RBFA_HAEIE Ribosome-binding factor A >gi|81335423|sp|Q4QK42|RBFA_HAEI8 Ribosome-binding factor A >gi|68058352|gb|AAX88605.1| ribosome-binding factor A [Haemophilus influenzae 86-028NP] >gi|144978858|gb|EDJ88581.1| ribosome-binding factor A [Haemophilus influenzae 22.1-21] >gi|144983708|gb|EDJ91168.1| ribosome-binding factor A [Haemophilus influenzae R3021] >gi|144986084|gb|EDJ92674.1| ribosome-binding factor A [Haemophilus influenzae 3655] >gi|145268342|gb|EDK08336.1| ribosome-binding factor A [Haemophilus influenzae PittAA] >gi|145268999|gb|EDK08953.1| ribosome-binding factor A [Haemophilus influenzae PittHH] >gi|145273874|gb|EDK13741.1| ribosome-binding factor A [Haemophilus influenzae 22.4-21] >gi|148716032|gb|ABQ98242.1| ribosome-binding factor A [Haemophilus influenzae PittEE] (128 aa)
Score = 102, Expect = 3.4e-03, Identities = 30/91 (32%), Positives = 52/91 (57%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISC---YDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           +R    I+  I+  +   V D  I   TV  V +S D S AK++++    +D+T I++ +K +  AS + R++L K + LR  P I F+ D+S+
  S:     9 DRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDETAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSL 102
>gi|110833191|ref|YP_692050.1| ribosome-binding factor A [Alcanivorax borkumensis SK2] >gi|122959683|sp|Q0VSS0|RBFA_ALCBS Ribosome-binding factor A >gi|110646302|emb|CAL15778.1| ribosome-binding factor A [Alcanivorax borkumensis SK2] (137 aa)
Score = 102, Expect = 3.6e-03, Identities = 28/109 (25%), Positives = 56/109 (51%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKK--INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + +R    I+  +S  +   + D  +  AT+  VT+S+D S A+VY +   +        +  +  ASGF R+ LA+ LN R  P + F  D + ++   ++ L+++ + +
  S:    12 RTDRVADQIQRELSRLLQFEMKDPRVNLATIQDVTVSRDLSYAEVYFTLLGQGEEAGAEAEEVLTKASGFLRSSLAQGLNTRTTPKLRFHYDMTPERAAHLSQLIDEARAE 122
>gi|182678032|ref|YP_001832178.1| ribosome-binding factor A [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633915|gb|ACB94689.1| ribosome-binding factor A [Beijerinckia indica subsp. indica ATCC 9039] (141 aa)
Score = 102, Expect = 3.9e-03, Identities = 28/95 (29%), Positives = 53/95 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQA-------TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + +LI H ++ L+   ++          TV  V +S D  +A  ++       I+ +++ ++    F R+ +A+ ++LR AP I F  DES D  D+I++LL
  S:    19 VAELIRHTLSDLLSRSIVNDPVLEGHVITVPDVRMSPDLKLATAFVMPLGGKDINSVIEALDRHKKFLRSEIAQRIHLRFAPDIRFKADESFDYGDKIDALL 120
>gi|188026375|ref|ZP_02961860.2| hypothetical protein PROSTU_03932 [Providencia stuartii ATCC 25827] >gi|188020158|gb|EDU58198.1| hypothetical protein PROSTU_03932 [Providencia stuartii ATCC 25827] (142 aa)
Score = 102, Expect = 4.1e-03, Identities = 27/73 (36%), Positives = 43/73 (58%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISC-------YDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           V D  I  ATV  V LS+D +  KV+++        ++  ++   +K +N ASGF R++L K + LR  P + F  D S+
  S:    33 VKDPRIGMATVSGVELSRDLAYGKVFVTFLNISHEEHESQMVQDGIKALNEASGFIRSLLGKAMRLRVIPELTFSYDSSL 112
>gi|91792368|ref|YP_562019.1| ribosome-binding factor A [Shewanella denitrificans OS217] >gi|123061155|sp|Q12QI0|RBFA_SHEDO Ribosome-binding factor A >gi|91714370|gb|ABE54296.1| ribosome-binding factor A [Shewanella denitrificans OS217] (142 aa)
Score = 102, Expect = 4.1e-03, Identities = 26/84 (30%), Positives = 52/84 (61%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ Y  D T++++ +  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFYEEDLTLVEQKIAALTAAAPYVRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQV 114
>gi|157148736|ref|YP_001456055.1| ribosome-binding factor A [Citrobacter koseri ATCC BAA-895] >gi|166218429|sp|A8AQ56|RBFA_CITK8 Ribosome-binding factor A >gi|157085941|gb|ABV15619.1| hypothetical protein CKO_04566 [Citrobacter koseri ATCC BAA-895] (133 aa)
Score = 102, Expect = 4.2e-03, Identities = 25/64 (39%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF RT+L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRTLLGKAMRLRIVPELTFFYDNSL 103
>gi|78222797|ref|YP_384544.1| ribosome-binding factor A [Geobacter metallireducens GS-15] >gi|123571972|sp|Q39VA5|RBFA_GEOMG Ribosome-binding factor A >gi|78194052|gb|ABB31819.1| ribosome-binding factor A [Geobacter metallireducens GS-15] (118 aa)
Score = 101, Expect = 4.4e-03, Identities = 28/90 (31%), Positives = 46/90 (51%)
  Q:    24 ITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           IT +   D I+ AT++Y  +  D++                 L  +N + GF R  ++K L LR AP ++F  DESI+  + I+ LL++I
  S:    34 ITGVKVSDDIRHATIYYTVMGSDEAKKST-------------LHGLNSSVGFIRKEVSKELRLRFAPELIFKYDESIEYGNRIDQLLKEI 110
>gi|150016087|ref|YP_001308341.1| ribosome-binding factor A [Clostridium beijerinckii NCIMB 8052] >gi|189039533|sp|A6LSQ5|RBFA_CLOB8 Ribosome-binding factor A >gi|149902552|gb|ABR33385.1| ribosome-binding factor A [Clostridium beijerinckii NCIMB 8052] (118 aa)
Score = 101, Expect = 4.4e-03, Identities = 37/110 (33%), Positives = 59/110 (53%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI--LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N +  R     K  IS+ I   V D  L    +V  V ++KD   AKVY+S + K   +K   L+ +  ASGF R  + + +NLR  P I+   D+SI+    ++ L+++I
  S:     1 MANYRGGRINEEFKREISNLIQNEVKDPRLTAMISVTDVKVTKDLRYAKVYVSIFSKDDEEKKNNLEALKNASGFIRKSVGQKINLRHTPEIIIELDDSINYGMHMDELIQRI 113
>gi|76788091|ref|YP_329102.1| ribosome-binding factor A [Streptococcus agalactiae A909] >gi|76798050|ref|ZP_00780307.1| ribosome-binding factor A [Streptococcus agalactiae 18RS21] >gi|77406442|ref|ZP_00783499.1| ribosome-binding factor A [Streptococcus agalactiae H36B] >gi|77408764|ref|ZP_00785494.1| ribosome-binding factor A [Streptococcus agalactiae COH1] >gi|77411635|ref|ZP_00787975.1| ribosome-binding factor A [Streptococcus agalactiae CJB111] >gi|123602371|sp|Q3K301|RBFA_STRA1 Ribosome-binding factor A >gi|44888538|sp|Q9K333|RBFA_STRAG Ribosome-binding factor A >gi|54039028|sp|P65970|RBFA_STRA5 Ribosome-binding factor A >gi|54041788|sp|P65969|RBFA_STRA3 Ribosome-binding factor A >gi|76563148|gb|ABA45732.1| ribosome-binding factor A [Streptococcus agalactiae A909] >gi|76586609|gb|EAO63110.1| ribosome-binding factor A [Streptococcus agalactiae 18RS21] >gi|77162279|gb|EAO73250.1| ribosome-binding factor A [Streptococcus agalactiae CJB111] >gi|77172609|gb|EAO75748.1| ribosome-binding factor A [Streptococcus agalactiae COH1] >gi|77174944|gb|EAO77756.1| ribosome-binding factor A [Streptococcus agalactiae H36B] (116 aa)
Score = 101, Expect = 4.4e-03, Identities = 33/113 (29%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKV+ + +     D    +I    A+G  +  L KNL + K P + F+ DESI+  ++I+ +L  +  K
  S:     1 MANHRIDRVGMEIKREVNEILRLRVNDPRVQDVTITDVQMLGDLSMAKVFYTIHSTLASDNQKAQIGLEKATGTIKRELGKNLTMYKIPDLQFVKDESIEYGNKIDEMLRNLDKK 115
>gi|167625058|ref|YP_001675352.1| ribosome-binding factor A [Shewanella halifaxensis HAW-EB4] >gi|189039560|sp|B0TQA1|RBFA_SHEHH Ribosome-binding factor A >gi|167355080|gb|ABZ77693.1| ribosome-binding factor A [Shewanella halifaxensis HAW-EB4] (142 aa)
Score = 101, Expect = 4.6e-03, Identities = 24/84 (28%), Positives = 54/84 (64%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKVY++ +  D+ ++++ +  ++ A+G+ R+++A  + LR  P + F+ D S+ +   +++L+ ++
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDEKLVEQKVAALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRV 114
>gi|157962877|ref|YP_001502911.1| ribosome-binding factor A [Shewanella pealeana ATCC 700345] >gi|189039561|sp|A8H739|RBFA_SHEPA Ribosome-binding factor A >gi|157847877|gb|ABV88376.1| ribosome-binding factor A [Shewanella pealeana ATCC 700345] (142 aa)
Score = 101, Expect = 4.6e-03, Identities = 24/84 (28%), Positives = 54/84 (64%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKVY++ +  D+ ++++ +  ++ A+G+ R+++A  + LR  P + F+ D S+ +   +++L+ ++
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDEKLVEQKVAALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRV 114
>gi|196196231|gb|EDX91190.1| ribosome-binding factor A [Alcanivorax sp. DG881] (137 aa)
Score = 101, Expect = 4.7e-03, Identities = 29/109 (26%), Positives = 57/109 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKK--INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + +R    I+  +S  +   + D  +  AT+  VT+S+D S A+VY +   +     +  +  +  ASGF R+ LAK+LN R  P + F  D + ++   ++ L++  + +
  S:    12 RTDRIADQIQRELSRLLQFEMKDPRVNLATIQDVTVSRDLSYAEVYFTLLGQGEEAGVEAEEALVKASGFLRSSLAKSLNTRTTPKLRFHYDMTPERAAHLSQLIDDARAE 122
>gi|163752372|ref|ZP_02159567.1| ribosome-binding factor A [Shewanella benthica KT99] >gi|161327744|gb|EDP98931.1| ribosome-binding factor A [Shewanella benthica KT99] (140 aa)
Score = 101, Expect = 4.7e-03, Identities = 24/86 (27%), Positives = 55/86 (63%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  +   TV+ V +S+D S AKV+++ +  D+ I+ + L+ ++ A+G+ R+++A  + LR  P + F+ D S+ +   +++L+ ++
  S:    27 IKDPRVGMVTVNDVEVSRDLSYAKVFVTFFEEDEKIVAQKLEALSSAAGYIRSLVAGRMKLRVMPELRFIYDASLVEGMRMSNLVTRV 114
>gi|157878685|pdb|1KKG|A Chain A, Nmr Structure Of Ribosome-Binding Factor A (Rbfa) (108 aa)
Score = 101, Expect = 4.8e-03, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|71894106|ref|YP_278214.1| ribosome-binding factor A [Mycoplasma synoviae 53] >gi|71850894|gb|AAZ43503.1| ribosome-binding factor A [Mycoplasma synoviae 53] (111 aa)
Score = 101, Expect = 4.8e-03, Identities = 32/111 (28%), Positives = 61/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+ + ++R ES I +LI++ +   +++  I    V  V LS D S  KV++    ++ + K L  +N ++   + IL+K L  RK P + F+ D    + ++I  +L++IK
  S:     1 MNEINLKRKESEILNLIANIVAFDLHNVNISDVVVMDVKLSNDLSHVKVFVVV--ESNVQKTLIALNNSAPAVKRILSKTLTWRKVPTVTFVLDAHTAQTEKIEKILQEIK 109
>gi|22536565|ref|NP_687416.1| ribosome-binding factor A [Streptococcus agalactiae 2603V/R] >gi|25010491|ref|NP_734886.1| ribosome-binding factor A [Streptococcus agalactiae NEM316] >gi|22533400|gb|AAM99288.1|AE014209_1 ribosome-binding factor A [Streptococcus agalactiae 2603V/R] >gi|3947715|emb|CAA05920.1| ribosome binding factor A [Streptococcus agalactiae] >gi|9558370|emb|CAC00486.1| ribosome binding factor A [Streptococcus agalactiae] >gi|9558373|emb|CAC00488.1| ribosome binding factor A [Streptococcus agalactiae] >gi|9558376|emb|CAC00490.1| ribosome binding factor A [Streptococcus agalactiae] >gi|9558379|emb|CAC00492.1| ribosome binding factor A [Streptococcus agalactiae] >gi|9558388|emb|CAC00498.1| ribosome binding factor A [Streptococcus agalactiae] >gi|23094844|emb|CAD46062.1| ribosome binding factor A [Streptococcus agalactiae NEM316] (122 aa)
Score = 101, Expect = 4.9e-03, Identities = 33/113 (29%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKV+ + +     D    +I    A+G  +  L KNL + K P + F+ DESI+  ++I+ +L  +  K
  S:     7 MANHRIDRVGMEIKREVNEILRLRVNDPRVQDVTITDVQMLGDLSMAKVFYTIHSTLASDNQKAQIGLEKATGTIKRELGKNLTMYKIPDLQFVKDESIEYGNKIDEMLRNLDKK 121
>gi|148263959|ref|YP_001230665.1| ribosome-binding factor A [Geobacter uraniireducens Rf4] >gi|189039543|sp|A5GF87|RBFA_GEOUR Ribosome-binding factor A >gi|146397459|gb|ABQ26092.1| ribosome-binding factor A [Geobacter uraniireducens Rf4] (122 aa)
Score = 101, Expect = 5.0e-03, Identities = 32/104 (30%), Positives = 52/104 (50%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKK-INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+    + +LIS  +   + D  I   T+  V ++ D  +A VY +        K  ++ +N A GF R  + K+L +R  P IVF  D S+D    I S+L++I
  S:     6 EKVAEAVHELISELLVKGLKDPRIGFVTITGVKVTDDMHLATVYFTVIGSDAEKKATEQGLNSARGFIRKEMGKSLRMRYVPDIVFKYDVSVDYGYRIESILKEI 110
>gi|33239584|ref|NP_874526.1| ribosome-binding factor A [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|39931797|sp|Q7VE81|RBFA_PROMA Ribosome-binding factor A >gi|33237109|gb|AAP99178.1| Ribosome-binding factor A [Prochlorococcus marinus subsp. marinus str. CCMP1375] (130 aa)
Score = 101, Expect = 5.2e-03, Identities = 26/109 (23%), Positives = 59/109 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCYDKTI-IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++E+  ++I+  +S  ++  + D  +     T+  V +S D    K+++S Y   I  D++   +  +  F +  L + L +R+AP +VF  D  ++K   + +LLE+++ +
  S:     6 RVEKVAALIRKEMSELLSNGIRDQRVNTTMITITEVEVSGDLQHCKIFVSIYGNEIQKDEVFSGLEASQSFLKGELGRRLQMRRAPEVVFKLDRGMEKGISVLNLLEKLEAE 117
>gi|77413953|ref|ZP_00790127.1| ribosome-binding factor A [Streptococcus agalactiae 515] >gi|77159989|gb|EAO71126.1| ribosome-binding factor A [Streptococcus agalactiae 515] (116 aa)
Score = 101, Expect = 5.2e-03, Identities = 33/113 (29%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKV+ + +     D    +I    A+G  +  L KNL + K P + F+ DESI+  ++I+ +L  +  K
  S:     1 MANHRIDRVGMEIKREVNEILRFRVNDPRVQDVTITDVQMLGDLSMAKVFYTIHSTLASDNQKAQIGLEKATGTIKRELGKNLTMYKIPDLQFVKDESIEYGNKIDEMLRNLDKK 115
>gi|188532505|ref|YP_001906302.1| Ribosome-binding factor A [Erwinia tasmaniensis] >gi|188027547|emb|CAO95394.1| Ribosome-binding factor A [Erwinia tasmaniensis] (137 aa)
Score = 100, Expect = 5.6e-03, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  I   L+ +  ASG+ RT+L K + LR  P + F  D S+
  S:    37 TVSGVDVSRDLAYAKVFVTFLNDKDEAAIKGGLRALGDASGYIRTLLGKAMRLRIVPELTFFYDNSL 103
>gi|9558382|emb|CAC00494.1| ribosome binding factor A [Streptococcus agalactiae] >gi|9558385|emb|CAC00496.1| ribosome binding factor A [Streptococcus agalactiae] (122 aa)
Score = 100, Expect = 5.6e-03, Identities = 33/113 (29%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKV+ + +     D    +I    A+G  +  L KNL + K P + F+ DESI+  ++I+ +L  +  K
  S:     7 MANHRIDRVGMEIKREVNEILRFRVNDPRVQDVTITDVQMLGDLSMAKVFYTIHSTLASDNQKAQIGLEKATGTIKRELGKNLTMYKIPDLQFVKDESIEYGNKIDEMLRNLDKK 121
>gi|19746622|ref|NP_607758.1| ribosome-binding factor A [Streptococcus pyogenes MGAS8232] >gi|50914802|ref|YP_060774.1| ribosome-binding factor A [Streptococcus pyogenes MGAS10394] >gi|94989040|ref|YP_597141.1| ribosome-binding factor A [Streptococcus pyogenes MGAS9429] >gi|94991038|ref|YP_599138.1| ribosome-binding factor A [Streptococcus pyogenes MGAS10270] >gi|94992931|ref|YP_601030.1| ribosome-binding factor A [Streptococcus pyogenes MGAS2096] >gi|19748841|gb|AAL98257.1| putative ribosome binding factor A [Streptococcus pyogenes MGAS8232] >gi|50903876|gb|AAT87591.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS10394] >gi|94542548|gb|ABF32597.1| ribosome-binding factor A [Streptococcus pyogenes MGAS9429] >gi|94544546|gb|ABF34594.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS10270] >gi|94546439|gb|ABF36486.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS2096] (118 aa)
Score = 100, Expect = 5.6e-03, Identities = 34/113 (30%), Positives = 56/113 (49%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL ++  K
  S:     3 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRELDNK 117
>gi|113969371|ref|YP_733164.1| ribosome-binding factor A [Shewanella sp. MR-4] >gi|122944045|sp|Q0HLG0|RBFA_SHESM Ribosome-binding factor A >gi|113884055|gb|ABI38107.1| ribosome-binding factor A [Shewanella sp. MR-4] (146 aa)
Score = 100, Expect = 5.6e-03, Identities = 27/84 (32%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P I F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKEVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQV 114
>gi|161506149|ref|YP_001573261.1| ribosome-binding factor A [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867496|gb|ABX24119.1| hypothetical protein SARI_04339 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (145 aa)
Score = 100, Expect = 5.8e-03, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    49 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 115
>gi|193216989|ref|YP_002000231.1| ribosome-binding factor A [Mycoplasma arthritidis 158L3-1] >gi|193002312|gb|ACF07527.1| ribosome-binding factor A [Mycoplasma arthritidis 158L3-1] (110 aa)
Score = 100, Expect = 6.1e-03, Identities = 34/113 (30%), Positives = 59/113 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+ +  ER  S++  LI  +   L   D+   A ++ V LS D S AKVY++ +     ++  +KI   + F R+++AK+   +K P +VFL D       +I  +L+ IK +
  S:     1 MTTINHERKTSLLLQLIGESFYELQDFDVTNIA-INDVILSNDGSHAKVYVTFFKDK--ERYFEKITKMAPFIRSVVAKSWKYKKLPELVFLIDTVEPSARKIEKILDNIKNQ 110
>gi|114046598|ref|YP_737148.1| ribosome-binding factor A [Shewanella sp. MR-7] >gi|123326767|sp|Q0HXR4|RBFA_SHESR Ribosome-binding factor A >gi|113888040|gb|ABI42091.1| ribosome-binding factor A [Shewanella sp. MR-7] (146 aa)
Score = 100, Expect = 6.1e-03, Identities = 27/84 (32%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P I F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKEVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQV 114
>gi|83644102|ref|YP_432537.1| ribosome-binding factor A [Hahella chejuensis KCTC 2396] >gi|123534477|sp|Q2SML2|RBFA_HAHCH Ribosome-binding factor A >gi|83632145|gb|ABC28112.1| ribosome-binding factor A [Hahella chejuensis KCTC 2396] (135 aa)
Score = 100, Expect = 6.2e-03, Identities = 29/109 (26%), Positives = 57/109 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK-------ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +++R    I+  ++  I   + D  +   TV+ V +SKD S A VY++  +   ++         LK +  A+GF R+ L + + LR  P + F  D S+     + +L+++ + K
  S:     7 RLDRVAEQIQKELAQLIQRELKDPRLGMVTVNSVKVSKDLSYADVYVTVLNLKDVEDDGDASKASLKVLESAAGFLRSELGRAIKLRVMPQLRFHYDASVSNAQRLGALIQKARAK 122
>gi|115372769|ref|ZP_01460075.1| ribosome-binding factor A [Stigmatella aurantiaca DW4/3-1] >gi|3914548|sp|O05340|RBFA_STIAU Ribosome-binding factor A >gi|1934985|emb|CAA61164.1| ribosome binding factor A [Stigmatella aurantiaca] >gi|115370250|gb|EAU69179.1| ribosome-binding factor A [Stigmatella aurantiaca DW4/3-1] (119 aa)
Score = 100, Expect = 6.2e-03, Identities = 28/87 (32%), Positives = 46/87 (52%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCYDKTI-IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           D  I   T+  V +S D  +A+V+ S         +  K ++ A GF R  +   +NLR +P + F  DES+ + D+I+ LL ++K K
  S:    29 DPRIGFITITGVKVSPDLRVAQVFYSMMGTAQERAETQKGLDAAKGFVRREVTAAVNLRVSPEVFFTFDESVGEGDKIDRLLREVKQK 116
>gi|157376520|ref|YP_001475120.1| ribosome-binding factor A [Shewanella sediminis HAW-EB3] >gi|189039562|sp|A8FYR9|RBFA_SHESH Ribosome-binding factor A >gi|157318894|gb|ABV37992.1| ribosome-binding factor A [Shewanella sediminis HAW-EB3] (143 aa)
Score = 100, Expect = 6.3e-03, Identities = 24/84 (28%), Positives = 54/84 (64%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKVY++ +  D+ ++ + ++ ++ A+G+ R+++A  + LR  P + F+ D S+ +   +++L+ ++
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDEKLVQEKVEALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRV 114
>gi|91774424|ref|YP_544180.1| ribosome-binding factor A [Methylobacillus flagellatus KT] >gi|122399242|sp|Q1GXD5|RBFA_METFK Ribosome-binding factor A >gi|91708411|gb|ABE48339.1| ribosome-binding factor A [Methylobacillus flagellatus KT] (125 aa)
Score = 100, Expect = 6.4e-03, Identities = 28/76 (36%), Positives = 42/76 (55%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V +S D S AKVY +    T   ++ K +   +GF R+ LA+ L LR  P + F+ D SID+   I  L+++
  S:    37 TVTEVEVSGDMSHAKVYYTAPQGT--PELQKGLEKTAGFLRSQLARRLLLRTVPQLHFVYDASIDRGMRIAKLIDE 110
>gi|139473258|ref|YP_001127973.1| ribosome-binding factor A [Streptococcus pyogenes str. Manfredo] >gi|166219411|sp|A2RD02|RBFA_STRPG Ribosome-binding factor A >gi|172046223|sp|Q1JKH2|RBFA_STRPC Ribosome-binding factor A >gi|172046742|sp|Q1JFG5|RBFA_STRPD Ribosome-binding factor A >gi|172046747|sp|Q1JAC2|RBFA_STRPB Ribosome-binding factor A >gi|24418641|sp|Q8NZU8|RBFA_STRP8 Ribosome-binding factor A >gi|61214786|sp|Q5XAH2|RBFA_STRP6 Ribosome-binding factor A >gi|134271504|emb|CAM29725.1| ribosome-binding factor A [Streptococcus pyogenes str. Manfredo] (116 aa)
Score = 100, Expect = 6.4e-03, Identities = 34/113 (30%), Positives = 56/113 (49%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL ++  K
  S:     1 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRELDNK 115
>gi|134299803|ref|YP_001113299.1| ribosome-binding factor A [Desulfotomaculum reducens MI-1] >gi|172044303|sp|A4J5X1|RBFA_DESRM Ribosome-binding factor A >gi|134052503|gb|ABO50474.1| ribosome-binding factor A [Desulfotomaculum reducens MI-1] (120 aa)
Score = 100, Expect = 6.7e-03, Identities = 29/107 (27%), Positives = 53/107 (49%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTI-IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ER    IK  ++  I   + D  I   T+  V +++D S AK++IS         + L  +  ++G+ R+ + + + LR AP ++F  D S+D    I  +L +I  +
  S:     6 ERVAEAIKKEVADLIRNDIKDPRIGFVTITGVEVTRDLSFAKIFISVMGSDAHRQETLSILQKSAGYMRSEIGRRIKLRHAPELIFKLDTSLDHGTRIAEILHEINSQ 113
>gi|149925036|ref|ZP_01913354.1| ribosome-binding factor A [Plesiocystis pacifica SIR-1] >gi|149814100|gb|EDM73726.1| ribosome-binding factor A [Plesiocystis pacifica SIR-1] (153 aa)
Score = 100, Expect = 6.7e-03, Identities = 19/78 (24%), Positives = 46/78 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTI-IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +V  V++S D S+A +Y+    + + ++ +L  +    G  R  L + + LR+ P + F +D+SI++ + + ++L +++
  S:    37 SVTGVSVSPDLSVATIYVDVLTEALRLESVLAALRAGGGAIRRKLGERVQLRRTPELRFHHDDSIERGNRVEAILTELR 115
>gi|160947560|ref|ZP_02094727.1| hypothetical protein PEPMIC_01495 [Peptostreptococcus micros ATCC 33270] >gi|158446694|gb|EDP23689.1| hypothetical protein PEPMIC_01495 [Peptostreptococcus micros ATCC 33270] (132 aa)
Score = 100, Expect = 6.8e-03, Identities = 31/110 (28%), Positives = 61/110 (55%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+  ++ R ES I  ++S AI   + D+ I  +   +  V+++ D  I  V I  + D    +K +K +  A+G+ +  +++ L+LR  P ++F  DES +K   +N L+ ++
  S:     1 MNAKRLGRIESEINRVLSDAIYNGIKDNRIDPSITNITKVSVTNDLGICYVSIGVFGDTKTKEKTMKGLESATGYMKKRISETLDLRHTPKLIFKLDESFEKAALMNELIIKV 113
>gi|123967667|ref|YP_001008525.1| ribosome-binding factor A [Prochlorococcus marinus str. AS9601] >gi|166219390|sp|A2BNQ7|RBFA_PROMS Ribosome-binding factor A >gi|123197777|gb|ABM69418.1| Ribosome-binding factor A [Prochlorococcus marinus str. AS9601] (130 aa)
Score = 100, Expect = 7.1e-03, Identities = 32/112 (28%), Positives = 62/112 (55%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +N ++E+  S++K  I+  +   + +DLI+     +  + LS D    K+YI S   + +  +I++ +N A    R  L K + +R+ P I+F +D  +DK   +  LL+++K K
  S:     3 NNYRLEKVSSLLKKEITLILQNDLENDLIRDHFVNISKIDLSGDLQHCKIYITSTAQEKVRTEIVENLNTAKSSIRHSLGKRIEMRRVPEIIFKDDVVLDKGLSVLKLLDELKNK 117
>gi|152972091|ref|YP_001337237.1| ribosome-binding factor A [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166218444|sp|A6TEI6|RBFA_KLEP7 Ribosome-binding factor A >gi|150956940|gb|ABR78970.1| ribosome-binding factor A [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (133 aa)
Score = 99, Expect = 7.4e-03, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVYVTFLNDKDEAAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|26110178|gb|AAN82364.1|AE016767_124 Ribosome-binding factor A [Escherichia coli CFT073] >gi|91074162|gb|ABE09043.1| ribosome-binding factor A [Escherichia coli UTI89] (139 aa)
Score = 99, Expect = 7.4e-03, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    43 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 109
>gi|118579400|ref|YP_900650.1| ribosome-binding factor A [Pelobacter propionicus DSM 2379] >gi|166219384|sp|A1AMM2|RBFA_PELPD Ribosome-binding factor A >gi|118502110|gb|ABK98592.1| ribosome-binding factor A [Pelobacter propionicus DSM 2379] (122 aa)
Score = 99, Expect = 7.6e-03, Identities = 31/104 (29%), Positives = 53/104 (50%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+    I + IS  ++  + D  I   T+  V + +D SIA++Y +   D+         +N A G+ R  L K L +R  P ++F  DES +  + I+S+L +I
  S:     6 EKLAETIHETISSILSRGLNDPRIGFVTLTAVDVVEDLSIARIYFTAIGDRDARKNSEAGLNSAKGYLRRELGKVLTIRHIPELIFKYDESQEYGNRIDSILREI 110
>gi|88807131|ref|ZP_01122643.1| possible Ribosome-binding factor A [Synechococcus sp. WH 7805] >gi|88788345|gb|EAR19500.1| possible Ribosome-binding factor A [Synechococcus sp. WH 7805] (140 aa)
Score = 99, Expect = 7.7e-03, Identities = 29/109 (26%), Positives = 58/109 (53%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQA--TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL------EQIKGK 116
           ++ER  ++I+   S  +   + D+ + Q   ++  V +S D    K+++S   D     +++  +  AS F R  L + L +R+AP +VF  D  ++K   +  LL       Q++G+
  S:     6 RVERVAALIRKETSELLIHGIRDERVHQGLISITGVEVSGDLQHCKIFVSVLADPEGKAQVMDGLQAASSFLRGELGRRLKMRRAPEVVFHLDRGLEKGASVLGLLGDLERERQVRGE 123
>gi|120597901|ref|YP_962475.1| ribosome-binding factor A [Shewanella sp. W3-18-1] >gi|146293927|ref|YP_001184351.1| ribosome-binding factor A [Shewanella putrefaciens CN-32] >gi|166219405|sp|A4Y9B9|RBFA_SHEPC Ribosome-binding factor A >gi|166219407|sp|A1RGX6|RBFA_SHESW Ribosome-binding factor A >gi|120557994|gb|ABM23921.1| ribosome-binding factor A [Shewanella sp. W3-18-1] >gi|145565617|gb|ABP76552.1| ribosome-binding factor A [Shewanella putrefaciens CN-32] (149 aa)
Score = 99, Expect = 8.0e-03, Identities = 26/84 (30%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFVYDSSLVEGMRMSNLVSQV 114
>gi|119504360|ref|ZP_01626440.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2080] >gi|119459868|gb|EAW40963.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2080] (134 aa)
Score = 99, Expect = 8.2e-03, Identities = 25/86 (29%), Positives = 47/86 (54%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYIS---CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKG 115
           D  +K  +V  V +S+D S AKV+ +     D     +    ++ ASGF R+ +A+   LR  P + F  DES+ +  ++ +L+ +++ 
  S:    31 DPRLKMVSVTGVDVSRDLSHAKVFFTQMGVDDAQAAAETTSALDRASGFLRSEIARTATLRTVPKLRFCFDESVGRGRDMETLIRKVRA 119
>gi|15803709|ref|NP_289743.1| ribosome-binding factor A [Escherichia coli O157:H7 EDL933] >gi|15833302|ref|NP_312075.1| ribosome-binding factor A [Escherichia coli O157:H7 str. Sakai] >gi|16131059|ref|NP_417636.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr. MG1655] >gi|30064507|ref|NP_838678.1| ribosome-binding factor A [Shigella flexneri 2a str. 2457T] >gi|56480279|ref|NP_708968.2| ribosome-binding factor A [Shigella flexneri 2a str. 301] >gi|74313704|ref|YP_312123.1| ribosome-binding factor A [Shigella sonnei Ss046] >gi|82545593|ref|YP_409540.1| ribosome-binding factor A [Shigella boydii Sb227] >gi|82778481|ref|YP_404830.1| ribosome-binding factor A [Shigella dysenteriae Sd197] >gi|89109932|ref|AP_003712.1| 30s ribosome binding factor [Escherichia coli W3110] >gi|110643408|ref|YP_671138.1| ribosome-binding factor A [Escherichia coli 536] >gi|110807036|ref|YP_690556.1| ribosome-binding factor A [Shigella flexneri 5 str. 8401] >gi|117625463|ref|YP_858786.1| ribosome-binding factor A [Escherichia coli APEC O1] >gi|157154949|ref|YP_001464643.1| ribosome-binding factor A [Escherichia coli E24377A] >gi|157162652|ref|YP_001459970.1| ribosome-binding factor A [Escherichia coli HS] >gi|161486110|ref|NP_755790.2| ribosome-binding factor A [Escherichia coli CFT073] >gi|162138367|ref|YP_542574.2| ribosome-binding factor A [Escherichia coli UTI89] >gi|168708743|ref|ZP_02741020.1| hypothetical protein EschericoliO157_13929 [Escherichia coli O157:H7 str. EC4045] >gi|168718107|ref|ZP_02750384.1| hypothetical protein EschericcoliO157_10192 [Escherichia coli O157:H7 str. EC4206] >gi|168734703|ref|ZP_02766980.1| hypothetical protein EschecoliO157_06600 [Escherichia coli O157:H7 str. EC4115] >gi|168749237|ref|ZP_02774259.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4113] >gi|168754148|ref|ZP_02779155.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4401] >gi|168762133|ref|ZP_02787140.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4501] >gi|168769585|ref|ZP_02794592.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4486] >gi|168773166|ref|ZP_02798173.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4196] >gi|168781310|ref|ZP_02806317.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4076] >gi|168786052|ref|ZP_02811059.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC869] >gi|168791511|ref|ZP_02816518.1| hypothetical protein EschercoliO157_03500 [Escherichia coli O157:H7 str. EC4042] >gi|168797768|ref|ZP_02822775.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC508] >gi|170018581|ref|YP_001723535.1| ribosome-binding factor A [Escherichia coli ATCC 8739] >gi|170082704|ref|YP_001732024.1| 30s ribosome binding factor [Escherichia coli str. K12 substr. DH10B] >gi|170680547|ref|YP_001745441.1| ribosome-binding factor A [Escherichia coli SMS-3-5] >gi|187731087|ref|YP_001881916.1| ribosome-binding factor A [Shigella boydii CDC 3083-94] >gi|188492975|ref|ZP_03000245.1| ribosome-binding factor A [Escherichia coli 53638] >gi|191168041|ref|ZP_03029841.1| ribosome-binding factor A [Escherichia coli B7A] >gi|191172235|ref|ZP_03033778.1| ribosome-binding factor A [Escherichia coli F11] >gi|193062103|ref|ZP_03043199.1| ribosome-binding factor A [Escherichia coli E22] >gi|193067230|ref|ZP_03048198.1| ribosome-binding factor A [Escherichia coli E110019] >gi|194427732|ref|ZP_03060279.1| ribosome-binding factor A [Escherichia coli B171] >gi|194433785|ref|ZP_03066060.1| ribosome-binding factor A [Shigella dysenteriae 1012] >gi|194438794|ref|ZP_03070880.1| ribosome-binding factor A [Escherichia coli 101-1] >gi|195938387|ref|ZP_03083769.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4024] >gi|67471971|sp|P0A7G2|RBFA_ECOLI Ribosome-binding factor A (Protein P15B) >gi|123147649|sp|Q0TCU2|RBFA_ECOL5 Ribosome-binding factor A >gi|123342479|sp|Q0T0B4|RBFA_SHIF8 Ribosome-binding factor A >gi|123558564|sp|Q31W46|RBFA_SHIBS Ribosome-binding factor A >gi|123561526|sp|Q32BG6|RBFA_SHIDS Ribosome-binding factor A >gi|123616074|sp|Q3YX74|RBFA_SHISS Ribosome-binding factor A >gi|166218437|sp|A1AG72|RBFA_ECOK1 Ribosome-binding factor A >gi|166918674|sp|A7ZS64|RBFA_ECO24 Ribosome-binding factor A >gi|166918675|sp|A8A4Y3|RBFA_ECOHS Ribosome-binding factor A >gi|172046242|sp|Q1R6H1|RBFA_ECOUT Ribosome-binding factor A >gi|189039540|sp|B1IQV4|RBFA_ECOLC Ribosome-binding factor A >gi|67471972|sp|P0A7G3|RBFA_ECOL6 Ribosome-binding factor A >gi|67471973|sp|P0A7G4|RBFA_ECO57 Ribosome-binding factor A >gi|67471974|sp|P0A7G5|RBFA_SHIFL Ribosome-binding factor A >gi|12517778|gb|AAG58303.1|AE005545_5 ribosome-binding factor A [Escherichia coli O157:H7 EDL933] >gi|42218|emb|CAA32020.1| P15B gene product (AA 1 - 133) [Escherichia coli] >gi|42222|emb|CAA31634.1| unnamed protein product [Escherichia coli] >gi|606107|gb|AAA57970.1| P15B [Escherichia coli] >gi|1789558|gb|AAC76201.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr. MG1655] >gi|13363521|dbj|BAB37471.1| ribosome-binding factor A [Escherichia coli O157:H7 str. Sakai] >gi|30042766|gb|AAP18489.1| ribosome-binding factor A [Shigella flexneri 2a str. 2457T] >gi|56383830|gb|AAN44675.2| ribosome-binding factor A [Shigella flexneri 2a str. 301] >gi|73857181|gb|AAZ89888.1| ribosome-binding factor A [Shigella sonnei Ss046] >gi|81242629|gb|ABB63339.1| ribosome-binding factor A [Shigella dysenteriae Sd197] >gi|81247004|gb|ABB67712.1| ribosome-binding factor A [Shigella boydii Sb227] >gi|85675963|dbj|BAE77213.1| 30s ribosome binding factor [Escherichia coli W3110] >gi|110345000|gb|ABG71237.1| ribosome-binding factor A [Escherichia coli 536] >gi|110616584|gb|ABF05251.1| ribosome-binding factor A [Shigella flexneri 5 str. 8401] >gi|115514587|gb|ABJ02662.1| ribosome-binding factor A [Escherichia coli APEC O1] >gi|157068332|gb|ABV07587.1| ribosome-binding factor A [Escherichia coli HS] >gi|157076979|gb|ABV16687.1| ribosome-binding factor A [Escherichia coli E24377A] >gi|169753509|gb|ACA76208.1| ribosome-binding factor A [Escherichia coli ATCC 8739] >gi|169890539|gb|ACB04246.1| 30s ribosome binding factor [Escherichia coli str. K12 substr. DH10B] >gi|170518265|gb|ACB16443.1| ribosome-binding factor A [Escherichia coli SMS-3-5] >gi|187428079|gb|ACD07353.1| ribosome-binding factor A [Shigella boydii CDC 3083-94] >gi|187770833|gb|EDU34677.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4196] >gi|188016404|gb|EDU54526.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4113] >gi|188488174|gb|EDU63277.1| ribosome-binding factor A [Escherichia coli 53638] >gi|189001131|gb|EDU70117.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4076] >gi|189358437|gb|EDU76856.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4401] >gi|189361487|gb|EDU79906.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4486] >gi|189367587|gb|EDU86003.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4501] >gi|189373921|gb|EDU92337.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC869] >gi|189379719|gb|EDU98135.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC508] >gi|190901910|gb|EDV61659.1| ribosome-binding factor A [Escherichia coli B7A] >gi|190907545|gb|EDV67141.1| ribosome-binding factor A [Escherichia coli F11] >gi|192932323|gb|EDV84921.1| ribosome-binding factor A [Escherichia coli E22] >gi|192959187|gb|EDV89622.1| ribosome-binding factor A [Escherichia coli E110019] >gi|194414240|gb|EDX30515.1| ribosome-binding factor A [Escherichia coli B171] >gi|194418048|gb|EDX34142.1| ribosome-binding factor A [Shigella dysenteriae 1012] >gi|194422266|gb|EDX38267.1| ribosome-binding factor A [Escherichia coli 101-1] (133 aa)
Score = 99, Expect = 8.4e-03, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|189039674|sp|A9KZX0|RBFA_SHEB9 Ribosome-binding factor A (152 aa)
Score = 99, Expect = 8.5e-03, Identities = 26/84 (30%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQV 114
>gi|160892793|ref|ZP_02073583.1| hypothetical protein CLOL250_00324 [Clostridium sp. L2-50] >gi|156865834|gb|EDO59265.1| hypothetical protein CLOL250_00324 [Clostridium sp. L2-50] (129 aa)
Score = 99, Expect = 8.5e-03, Identities = 32/97 (32%), Positives = 52/97 (53%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID 101
           ++VK  R  + ++  +S  I+  + D  I   T V    ++ D    K YIS   D+  ++  L+ +N A GF R  LA ++NLR  P I F+ D+SI+
  S:     4 NSVKNTRINAEVQRELSRIISREIKDPRINPMTSVVEAVVTPDLKYCKAYISVLGDQDSVNSTLEGLNSAMGFIRRELAHSINLRNTPEITFIMDQSIE 102
>gi|56963991|ref|YP_175722.1| ribosome-binding factor A [Bacillus clausii KSM-K16] >gi|61214762|sp|Q5WFU4|RBFA_BACSK Ribosome-binding factor A >gi|56910234|dbj|BAD64761.1| ribosome-binding factor A [Bacillus clausii KSM-K16] (118 aa)
Score = 99, Expect = 8.7e-03, Identities = 34/110 (30%), Positives = 52/110 (47%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N +  R    +K  +S  +   + D  ++  TV  V ++ D   A  +I+   D+      L  +  A GF RT L K + LRK P + F  DESI   + I SLL  +
  S:     1 MANNRAVRVGEQMKKELSDILIRDIKDPRVRFVTVTGVDVTGDLQQATAFITVLGDEEERKATLAGLEKAKGFIRTELGKRIRLRKTPELSFSFDESIQYGNRIESLLRDL 111
>gi|24372788|ref|NP_716830.1| ribosome-binding factor A [Shewanella oneidensis MR-1] >gi|29427753|sp|Q8EHL4|RBFA_SHEON Ribosome-binding factor A >gi|24346873|gb|AAN54275.1|AE015564_6 ribosome-binding factor A [Shewanella oneidensis MR-1] (147 aa)
Score = 99, Expect = 8.7e-03, Identities = 27/84 (32%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P I F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKDVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQV 114
>gi|23099055|ref|NP_692521.1| ribosome-binding factor A [Oceanobacillus iheyensis HTE831] >gi|29427761|sp|Q8EQT9|RBFA_OCEIH Ribosome-binding factor A >gi|22777283|dbj|BAC13556.1| ribosome-binding factor A [Oceanobacillus iheyensis HTE831] (113 aa)
Score = 99, Expect = 8.7e-03, Identities = 30/110 (27%), Positives = 55/110 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+ ++  R    +K  +   ++  + D  +   TV  V ++ D   AKVYIS   D+      L  ++ A GF R+ +   + LRK P I F  DE++++ + I ++L  +
  S:     1 MAELRAHRIAEQMKKELGEILSRKIKDPRVGFVTVTDVEVTGDLQQAKVYISVLGDEKKKQDTLLGLSKAKGFIRSEIGNRIRLRKTPEITFEFDEALEQGNRIETILRDL 111
>gi|85058356|ref|YP_454058.1| ribosome-binding factor A [Sodalis glossinidius str. 'morsitans'] >gi|123520130|sp|Q2NW22|RBFA_SODGM Ribosome-binding factor A >gi|84778876|dbj|BAE73653.1| ribosome-binding factor A [Sodalis glossinidius str. 'morsitans'] (138 aa)
Score = 99, Expect = 8.8e-03, Identities = 23/86 (26%), Positives = 51/86 (59%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  +  ATV  V +S+D + AKV+++  +   ++++   ++ +  A+GF  ++L K + LR  P + F  D S+ +   +++L+ Q+
  S:    27 IKDPRVGMATVSGVEVSRDLAYAKVFVTFLNDNTLEQVKTGVRALQDAAGFIHSLLGKAMRLRVVPELTFAYDNSLVEGMRMSNLVSQV 115
>gi|172044106|sp|A3D7K5|RBFA_SHEB5 Ribosome-binding factor A >gi|172044119|sp|A6WRG7|RBFA_SHEB8 Ribosome-binding factor A (152 aa)
Score = 99, Expect = 8.9e-03, Identities = 26/84 (30%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQV 114
>gi|15595147|ref|NP_212936.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi B31] >gi|2688746|gb|AAC67152.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi B31] (127 aa)
Score = 99, Expect = 9.2e-03, Identities = 30/96 (31%), Positives = 53/96 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++  I+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N L+E
  S:    17 LESFIAQEIGNLIVSGGIKDPRIHSFLTVVKVEFSKDLINAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKLIE 119
>gi|55820438|ref|YP_138880.1| ribosome-binding factor A [Streptococcus thermophilus LMG 18311] >gi|55822322|ref|YP_140763.1| ribosome-binding factor A [Streptococcus thermophilus CNRZ1066] >gi|116627262|ref|YP_819881.1| ribosome-binding factor A [Streptococcus thermophilus LMD-9] >gi|122268135|sp|Q03M87|RBFA_STRTD Ribosome-binding factor A >gi|61214692|sp|Q5M1B8|RBFA_STRT1 Ribosome-binding factor A >gi|61214694|sp|Q5M5V4|RBFA_STRT2 Ribosome-binding factor A >gi|55736423|gb|AAV60065.1| ribosome binding factor A [Streptococcus thermophilus LMG 18311] >gi|55738307|gb|AAV61948.1| ribosome binding factor A [Streptococcus thermophilus CNRZ1066] >gi|116100539|gb|ABJ65685.1| ribosome-binding factor A [Streptococcus thermophilus LMD-9] (117 aa)
Score = 99, Expect = 9.2e-03, Identities = 30/112 (26%), Positives = 59/112 (52%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ +++R    IK  ++  +   V D  ++  T+  V +  D S AKV+ + +     D  K    +  A+G  +  L KNL + K P ++F+ DESI+  ++I+ +L  ++ K
  S:     3 NSFRVDRVGMEIKREVNEILQKKVRDPRVQNVTITDVQMLGDLSAAKVFYTIHSTLASDNQKAQTGLEKATGTIKRELGKNLTMYKIPDLIFIKDESIEYGNKIDEMLRNLERK 116
>gi|160876522|ref|YP_001555838.1| ribosome-binding factor A [Shewanella baltica OS195] >gi|160862044|gb|ABX50578.1| ribosome-binding factor A [Shewanella baltica OS195] (157 aa)
Score = 98, Expect = 9.4e-03, Identities = 26/84 (30%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    34 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQV 119
>gi|15829143|ref|NP_326503.1| ribosome-binding factor A [Mycoplasma pulmonis UAB CTIP] >gi|20978644|sp|Q98PP7|RBFA_MYCPU Ribosome-binding factor A >gi|14090087|emb|CAC13845.1| RIBOSOME-BINDING FACTOR A [Mycoplasma pulmonis] (112 aa)
Score = 98, Expect = 9.6e-03, Identities = 37/111 (33%), Positives = 60/111 (54%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M N+K+E+ E  I   IS  I+  V +      TV  + LS D S   VY++    +   K L+++N ASG+ +  L+  L  RK P++ F  D++ +K  +I  +LE+IK
  S:     1 MQNIKLEKREQDILINISRIISEEVQNLKDVLTTVVGIKLSSDLSHCNVYVTFSKNS--KKNLERLNQASGYIKKQLSSILKWRKIPSLHFKIDDTFEKSLKIEQILEEIK 109
>gi|21957407|gb|AAM84277.1|AE013671_4 ribosome-binding factor A [Yersinia pestis KIM] >gi|45435299|gb|AAS60858.1| ribosome-binding factor A [Yersinia pestis biovar Microtus str. 91001] (154 aa)
Score = 98, Expect = 9.9e-03, Identities = 26/86 (30%), Positives = 48/86 (55%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  +  ATV  + LS+D + AKV+++         D   +   +K +  ASG+ RT+L K + LR  P + F  D S+ +   +++L+  +
  S:    45 IKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNV 137
>gi|182676606|sp|A9MP37|RBFA_SALAR Ribosome-binding factor A (133 aa)
Score = 98, Expect = 1.0e-02, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|170765473|ref|ZP_02900284.1| ribosome-binding factor A [Escherichia albertii TW07627] >gi|170124619|gb|EDS93550.1| ribosome-binding factor A [Escherichia albertii TW07627] (133 aa)
Score = 98, Expect = 1.0e-02, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKVY++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|124549937|ref|ZP_01707896.1| ribosome-binding factor A [Shewanella putrefaciens 200] >gi|124507643|gb|EAY51768.1| ribosome-binding factor A [Shewanella putrefaciens 200] (149 aa)
Score = 98, Expect = 1.0e-02, Identities = 26/84 (30%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFVYDSSLVEGMRMSNLVSQV 114
>gi|56808093|ref|ZP_00365885.1| COG0858: Ribosome-binding factor A [Streptococcus pyogenes M49 591] >gi|71904113|ref|YP_280916.1| ribosome-binding factor A [Streptococcus pyogenes MGAS6180] >gi|94994917|ref|YP_603015.1| ribosome-binding factor A [Streptococcus pyogenes MGAS10750] >gi|71803208|gb|AAX72561.1| ribosome-binding factor A [Streptococcus pyogenes MGAS6180] >gi|94548425|gb|ABF38471.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS10750] (118 aa)
Score = 98, Expect = 1.0e-02, Identities = 34/113 (30%), Positives = 56/113 (49%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL ++  K
  S:     3 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRELDKK 117
>gi|126175438|ref|YP_001051587.1| ribosome-binding factor A [Shewanella baltica OS155] >gi|153001788|ref|YP_001367469.1| ribosome-binding factor A [Shewanella baltica OS185] >gi|125998643|gb|ABN62718.1| ribosome-binding factor A [Shewanella baltica OS155] >gi|151366406|gb|ABS09406.1| ribosome-binding factor A [Shewanella baltica OS185] (157 aa)
Score = 98, Expect = 1.0e-02, Identities = 26/84 (30%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+
  S:    34 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQV 119
>gi|172046112|sp|Q48RU9|RBFA_STRPM Ribosome-binding factor A >gi|172046753|sp|Q1J5B5|RBFA_STRPF Ribosome-binding factor A (116 aa)
Score = 98, Expect = 1.0e-02, Identities = 34/113 (30%), Positives = 56/113 (49%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL ++  K
  S:     1 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRELDKK 115
>gi|159897009|ref|YP_001543256.1| ribosome-binding factor A [Herpetosiphon aurantiacus ATCC 23779] >gi|159890048|gb|ABX03128.1| ribosome-binding factor A [Herpetosiphon aurantiacus ATCC 23779] (126 aa)
Score = 98, Expect = 1.1e-02, Identities = 31/108 (28%), Positives = 53/108 (49%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           N ++E+    IK ++S+AI   + D  +   T+  V +S D   A + +S   D T     L  ++ A GF R  L + + LR  P + F  D +ID    +++L  Q+
  S:     4 NKRVEQVAEEIKTILSNAIQFEIQDPRLGFVTLTSVNVSPDLYHANINVSVMGDDTARKDSLATLDRAKGFLRRELGQQMKLRAVPELHFHLDVTIDTRQYMDTLFNQV 112
>gi|167575945|ref|ZP_02368819.1| ribosome-binding factor A (rbfA) [Borrelia valaisiana VS116] (120 aa)
Score = 98, Expect = 1.1e-02, Identities = 30/96 (31%), Positives = 54/96 (56%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++ LI+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N ++E
  S:    10 LESLIAQEIGNLIVSRGIKDPRIHSFLTVVKVEFSKDLINAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIVKRVKVRSTPKLLFIKDDSLSKSFYVNKIIE 112
>gi|195959582|ref|ZP_03095791.1| ribosome-binding factor A (rbfA) [Borrelia sp. SV1] (120 aa)
Score = 98, Expect = 1.1e-02, Identities = 30/96 (31%), Positives = 53/96 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++  I+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N L+E
  S:    10 LESFIAQEIGNLIVSGGIKDPRIHSFLTVVKVEFSKDLINAKVFVGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKLIE 112
>gi|15675570|ref|NP_269744.1| ribosome-binding factor A [Streptococcus pyogenes M1 GAS] >gi|28895285|ref|NP_801635.1| ribosome-binding factor A [Streptococcus pyogenes SSI-1] >gi|161936121|ref|YP_282771.2| ribosome-binding factor A [Streptococcus pyogenes MGAS5005] >gi|13622774|gb|AAK34465.1| putative ribosome binding factor A [Streptococcus pyogenes M1 GAS] >gi|28810531|dbj|BAC63468.1| putative ribosome binding factor A [Streptococcus pyogenes SSI-1] (118 aa)
Score = 98, Expect = 1.1e-02, Identities = 34/113 (30%), Positives = 55/113 (48%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL  +  K
  S:     3 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRDLDNK 117
>gi|154485023|ref|ZP_02027471.1| hypothetical protein EUBVEN_02741 [Eubacterium ventriosum ATCC 27560] >gi|149733976|gb|EDM50095.1| hypothetical protein EUBVEN_02741 [Eubacterium ventriosum ATCC 27560] (92 aa)
Score = 98, Expect = 1.2e-02, Identities = 25/79 (31%), Positives = 45/79 (56%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKG 115
           +V  V ++ D    KVYIS   D+      +  +  A+GF R  LA+ +NLR  P + F+ D+SI+   +++ L++++ G
  S:     3 SVTGVEVTPDLKFCKVYISVLGDEEAKADTMAGLKSAAGFIRRELARTVNLRNTPELKFVMDQSIEYGMKMSKLIDEVNG 82
>gi|163814222|ref|ZP_02205614.1| hypothetical protein COPEUT_00376 [Coprococcus eutactus ATCC 27759] >gi|158450671|gb|EDP27666.1| hypothetical protein COPEUT_00376 [Coprococcus eutactus ATCC 27759] (134 aa)
Score = 98, Expect = 1.2e-02, Identities = 35/101 (34%), Positives = 53/101 (52%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDE 105
           ++VK  R    ++  +S  I+  + D  I   T V  V ++ D    K YIS   D+  +D     +  A G+ R  LA ++NLR  P I F+ D+SI+       KIDE
  S:     4 NSVKNNRINGEVQRELSRIISREIKDPRISPMTSVVDVVVTPDLKFCKAYISVLGDQDAVDSTFAGLTSAMGYIRRELAHSVNLRNTPEITFIMDQSIEYGVNMSHKIDE 113
>gi|32266339|ref|NP_860371.1| ribosome-binding factor A [Helicobacter hepaticus ATCC 51449] >gi|32262389|gb|AAP77437.1| ribosome-binding factor A [Helicobacter hepaticus ATCC 51449] (116 aa)
Score = 98, Expect = 1.2e-02, Identities = 30/108 (27%), Positives = 60/108 (55%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK--ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           N+K +R ES++++++S A++ L  D  I   ++  V  SK K  A+VYI   D    ++  IL +++ A G  +  +  +    ++P   F  D+S+   + ++++ EQI
  S:     2 NIKQQRLESLLQEILSEALSQL-NDAQINTLSITGVKCSKGKQSAEVYIEGTDIPPQERKVILTRLHKAQGILKEYVLTSTQWFRSPNFSFKFDDSLCYANTLDTIFEQI 110
>gi|183220913|ref|YP_001838909.1| ribosome-binding factor A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911009|ref|YP_001962564.1| Ribosome-binding factor A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775685|gb|ABZ93986.1| Ribosome-binding factor A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779335|gb|ABZ97633.1| Ribosome-binding factor A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (149 aa)
Score = 97, Expect = 1.2e-02, Identities = 32/108 (29%), Positives = 55/108 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITT-LVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           M+ +++++ ES I   IS AI    V D  +   + H + +S+D   AKVY +   +     K+ + +   +GF  + + KNL L   P   F+ D S  K  E+N L++
  S:     1 MNPIRMKKLESEIIRQISTAILEGKVKDPRVFLPSFHRIEISEDLKYAKVYFTALCNNNERKKLTQGLVSCAGFLSSFVGKNLRLHTNPKFTFVWDNSYIKSLEVNRLID 110
>gi|167587337|ref|ZP_02379725.1| ribosome-binding factor A [Burkholderia ubonensis Bu] (132 aa)
Score = 97, Expect = 1.2e-02, Identities = 35/110 (31%), Positives = 57/110 (51%)
  Q:     3 HMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           H  NV+I   + I +DL S  I   V D  I   T+  V L+ D + AKVY +       +K  + +N ASG    +L K L++   P + F  D++I+K  E++ L+++
  S:     8 HNRNVQIA--DQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGDP-EKTQEALNHASGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVEMSRLIKE 113
>gi|16762050|ref|NP_457667.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143539|ref|NP_806881.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415217|ref|YP_152292.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181796|ref|YP_218213.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616291|ref|YP_001590256.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|168221384|ref|ZP_02646616.1| hypothetical protein Senterenterica_13396 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227797|ref|ZP_02653028.1| hypothetical protein Sententeric_18632 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168819646|ref|ZP_02831646.1| hypothetical protein Salentericaenterica_09683 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|75480587|sp|Q57JI0|RBFA_SALCH Ribosome-binding factor A >gi|189039556|sp|A9N731|RBFA_SALPB Ribosome-binding factor A >gi|20978598|sp|Q8Z3H8|RBFA_SALTI Ribosome-binding factor A >gi|61214734|sp|Q5PLB1|RBFA_SALPA Ribosome-binding factor A >gi|25302109|pir||AG0901 ribosome-binding factor A (P15B protein) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504353|emb|CAD07805.1| ribosome-binding factor A (P15B protein) [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139173|gb|AAO70741.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129474|gb|AAV78980.1| ribosome-binding factor A (P15B protein) [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129429|gb|AAX67132.1| tRNA pseudouridine 5S synthase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365655|gb|ABX69423.1| hypothetical protein SPAB_04097 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (133 aa)
Score = 97, Expect = 1.2e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVFVTFLNDQDEAAVKNGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|167455381|ref|ZP_02321603.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-1] >gi|167418066|gb|EDR84765.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-1] (139 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/78 (30%), Positives = 41/78 (52%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           TV    +S D   A VY+S + D+ +       +  A+GF +  +++ L LR  P + F+ DES+ + D I  LL + +
  S:    36 TVTGSKMSPDLKEATVYVSIHGDERVRKDTFAGLQAAAGFLQREVSRALRLRNTPHLRFVYDESVARGDRIERLLREAR 114
>gi|163766328|ref|ZP_02173354.1| ribosome-binding factor A [Anaeromyxobacter sp. K] >gi|196171424|gb|ACG72397.1| ribosome-binding factor A [Anaeromyxobacter sp. K] (138 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/78 (30%), Positives = 41/78 (52%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           TV    +S D   A VY+S + D+ +       +  A+GF +  +++ L LR  P + F+ DES+ + D I  LL + +
  S:    36 TVTGSKMSPDLKEATVYVSIHGDERVRKDTFAGLQAAAGFLQREVSRALRLRNTPHLRFVYDESVARGDRIERLLREAR 114
>gi|86157531|ref|YP_464316.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-C] >gi|123499936|sp|Q2IPZ5|RBFA_ANADE Ribosome-binding factor A >gi|85774042|gb|ABC80879.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-C] (138 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/78 (30%), Positives = 41/78 (52%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           TV    +S D   A VY+S + D+ +       +  A+GF +  +++ L LR  P + F+ DES+ + D I  LL + +
  S:    36 TVTGSKMSPDLKEATVYVSIHGDERVRKDTFAGLQAAAGFLQREVSRALRLRNTPHLRFVYDESVARGDRIERLLREAR 114
>gi|184155210|ref|YP_001843550.1| ribosome-binding factor A [Lactobacillus fermentum IFO 3956] >gi|183226554|dbj|BAG27070.1| ribosome-binding factor A [Lactobacillus fermentum IFO 3956] (120 aa)
Score = 97, Expect = 1.3e-02, Identities = 31/106 (29%), Positives = 51/106 (48%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ER    I+  +   +   V D  +   TV  V ++ D   A +Y +   K   D  K    ++ A+G  R+ L   LN+ KAP I F+ D SI+    I+ LL ++
  S:     7 RVERLAQQIQREVDDILLKRVRDPRVNGVTVTGVDVTGDLQQATIYYTILSKLASDAEKTQTGLDKATGLVRSELGSRLNIFKAPEIKFVRDPSIEYGSRIDELLNEL 114
>gi|146313239|ref|YP_001178313.1| ribosome-binding factor A [Enterobacter sp. 638] >gi|166918676|sp|A4WEY2|RBFA_ENT38 Ribosome-binding factor A >gi|145320115|gb|ABP62262.1| ribosome-binding factor A [Enterobacter sp. 638] (133 aa)
Score = 97, Expect = 1.3e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVFVTFLNDQDEAAVKNGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|167544109|ref|ZP_02339681.1| hypothetical protein Sentent_12578 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167552067|ref|ZP_02345820.1| hypothetical protein Sentente_16372 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168243119|ref|ZP_02668051.1| hypothetical protein Senterienterica_15862 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168262704|ref|ZP_02684677.1| hypothetical protein Salmentericaenterica_16595 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463492|ref|ZP_02697409.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|194446175|ref|YP_002042542.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448489|ref|YP_002047314.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194404838|gb|ACF65060.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194406793|gb|ACF67012.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|195633310|gb|EDX51724.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Newport str. SL317] (133 aa)
Score = 97, Expect = 1.3e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVFVTFLNDQDEAAVKNGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|110601945|ref|ZP_01390104.1| ribosome-binding factor A [Geobacter sp. FRC-32] >gi|110547354|gb|EAT60621.1| ribosome-binding factor A [Geobacter sp. FRC-32] (140 aa)
Score = 97, Expect = 1.3e-02, Identities = 28/104 (26%), Positives = 51/104 (49%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKK-INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           E+    + +L+S  +   + D  I   T+  V ++ D  +A +Y +        K  ++ +N A GF R  + K+  +R  P IVF  D S++    I S+L++I
  S:    23 EKVAEAVHELVSELLVKGLKDPRIGFVTITGVKVTDDMHLATIYFTVIGSDEEKKATEQGLNSARGFIRKEMGKSFRMRYVPDIVFKYDASVEYGSRIESILKEI 127
>gi|167933964|ref|ZP_02521039.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi ZS7] >gi|167944312|ref|ZP_02531386.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi Bol26] >gi|168526326|ref|ZP_02719965.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 118a] >gi|168580058|ref|ZP_02724038.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 72a] >gi|168692625|ref|ZP_02725417.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 94a] >gi|195941988|ref|ZP_03087370.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 80a] >gi|195950082|ref|ZP_03091182.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi WI91-23] >gi|195950772|ref|ZP_03091869.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 29805] >gi|195955416|ref|ZP_03094109.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi CA-11.2a] >gi|195960733|ref|ZP_03096938.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 64b] >gi|20981703|sp|O51742|RBFA_BORBU Ribosome-binding factor A (120 aa)
Score = 97, Expect = 1.3e-02, Identities = 30/96 (31%), Positives = 53/96 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++  I+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N L+E
  S:    10 LESFIAQEIGNLIVSGGIKDPRIHSFLTVVKVEFSKDLINAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKLIE 112
>gi|117919480|ref|YP_868672.1| ribosome-binding factor A [Shewanella sp. ANA-3] >gi|166219406|sp|A0KTZ7|RBFA_SHESA Ribosome-binding factor A >gi|117611812|gb|ABK47266.1| ribosome-binding factor A [Shewanella sp. ANA-3] (146 aa)
Score = 97, Expect = 1.3e-02, Identities = 27/84 (32%), Positives = 51/84 (60%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           D  I   TV+ V +S+D S AKV+++ +  DK ++ + L  +  A+ + RT++A  + LR  P I F+ D S+ +   +++L+ Q+
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKELVQEKLNALITAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQV 114
>gi|21911030|ref|NP_665298.1| ribosome-binding factor A [Streptococcus pyogenes MGAS315] >gi|54039029|sp|P65972|RBFA_STRP3 Ribosome-binding factor A >gi|54041789|sp|P65971|RBFA_STRP1 Ribosome-binding factor A >gi|21905239|gb|AAM80101.1| putative ribosome binding factor A [Streptococcus pyogenes MGAS315] (116 aa)
Score = 97, Expect = 1.3e-02, Identities = 34/113 (30%), Positives = 55/113 (48%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L K L + K P +VF  D SI   ++I+ LL  +  K
  S:     1 MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLSLAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRDLDNK 115
>gi|71908069|ref|YP_285656.1| ribosome-binding factor A [Dechloromonas aromatica RCB] >gi|123627144|sp|Q47D95|RBFA_DECAR Ribosome-binding factor A >gi|71847690|gb|AAZ47186.1| ribosome-binding factor A [Dechloromonas aromatica RCB] (123 aa)
Score = 97, Expect = 1.4e-02, Identities = 28/100 (28%), Positives = 57/100 (56%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK-------IDEINSLLEQ 112
           E + +DL +  I T + D  +   ++  V L+ D + AKV+ +  +   ++++ + +  A+GF R  L K +++   P + F+ D SI++       ID+ N+L +Q
  S:    14 EQVRRDL-ADLIRTELKDPRVGMISLTAVELTPDYAHAKVFFATLNSEHLEEVERGLKRAAGFLRRELGKRIHIHTLPELHFVYDSSIERGASLSLLIDQANALSDQ 119
>gi|104780029|ref|YP_606527.1| ribosome-binding factor A [Pseudomonas entomophila L48] >gi|166219392|sp|Q1IF42|RBFA_PSEE4 Ribosome-binding factor A >gi|95109016|emb|CAK13712.1| ribosome-binding factor A [Pseudomonas entomophila L48] (132 aa)
Score = 97, Expect = 1.5e-02, Identities = 28/105 (26%), Positives = 54/105 (51%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + +R    ++  ++  I   V D  +   T+  V +S+D   AKV+I+   +   D +   LK +  A+ F R  L + + LR  P + F  DES+ +   +++L+E+
  S:     7 RTQRIGDQMQRELAELIRREVKDPRVGLVTITAVDVSRDLGHAKVFITVMGQDGTDAVPQTLKALTSAASFLRLHLGRVMQLRSVPQLHFHFDESVSRGVHLSALIER 114
>gi|169824463|ref|YP_001692074.1| ribosome-binding factor A [Finegoldia magna ATCC 29328] >gi|167831268|dbj|BAG08184.1| ribosome-binding factor A [Finegoldia magna ATCC 29328] (121 aa)
Score = 97, Expect = 1.5e-02, Identities = 34/110 (30%), Positives = 61/110 (55%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+  ++ R  S IK +IS +I   + D  I +   +V  V ++ D S A VYI+   D     + L+ +N A GF +  + +N++LR  P ++F  DE+ ++   I +L++ I
  S:     1 MNIKRVRRISSEIKKVISSSIINSLKDPRIDKLNVSVTEVKVTNDLSFATVYIAVIGDDEKKKQTLEGLNKAKGFLKKQIGENVDLRHVPQLIFKIDETSEQSMHIENLIKSI 113
>gi|195977586|ref|YP_002122830.1| ribosome-binding factor A [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974291|gb|ACG61817.1| ribosome-binding factor A [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (116 aa)
Score = 97, Expect = 1.6e-02, Identities = 34/113 (30%), Positives = 57/113 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D    +I    A+G  +  L K L + K P +VF  D SI   ++I+ LL +++ K
  S:     1 MTNHRIDRVGMEIKREVNEILHKKVRDPRVQGVTITEVQMLGDLSVAKVYYTIMSDLASDNQKAEIGLKKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNKIDQLLRELEKK 115
>gi|167751256|ref|ZP_02423383.1| hypothetical protein EUBSIR_02242 [Eubacterium siraeum DSM 15702] >gi|167655763|gb|EDR99892.1| hypothetical protein EUBSIR_02242 [Eubacterium siraeum DSM 15702] (126 aa)
Score = 97, Expect = 1.6e-02, Identities = 30/110 (27%), Positives = 56/110 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N    R    IK  IS A+  +    ++K    V    L+ D S  KVYI+  +     K + + +  A GFF+  + + + +RK P ++F+ D S+D  + I+ ++ ++
  S:     1 MANFNTARLAEDIKREISTAMRDIKDGAVVKAMVGVSRCELTSDLSYCKVYITTLEGGDTTKNVAEHLKKAEGFFKRRINERVKMRKLPQLIFVPDNSMDYYEHISEVISKL 112
>gi|119477400|ref|ZP_01617591.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2143] >gi|119449326|gb|EAW30565.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2143] (133 aa)
Score = 96, Expect = 1.6e-02, Identities = 29/108 (26%), Positives = 56/108 (51%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI---NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKG 115
           + +R    +K  ++  I + + D  +   ++  V +S+D S AKV+ +   K    +  + I   N A+GF R+ +AK  N R  P + F  D S+ +   ++SL+++  G
  S:     7 RTQRVADFLKQELATLIQSEMRDPRVGMVSITDVEVSRDMSHAKVFTTVLGKESEQEAAEAIAVLNKAAGFLRSEMAKINNARTTPKLRFYFDSSVGRGQFLSSLIDKAVG 117
>gi|167932844|ref|ZP_02519931.1| ribosome-binding factor A (rbfA) [Borrelia burgdorferi 156a] (120 aa)
Score = 96, Expect = 1.6e-02, Identities = 30/96 (31%), Positives = 53/96 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++  I+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N L+E
  S:    10 LESFIAQEIGNLIVSGGIKDPRIHSFLTVVKVKFSKDLINAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKLIE 112
>gi|50119660|ref|YP_048827.1| ribosome-binding factor A [Pectobacterium atrosepticum SCRI1043] >gi|61214938|sp|Q6D9A4|RBFA_ERWCT Ribosome-binding factor A >gi|49610186|emb|CAG73628.1| ribosome-binding factor A [Erwinia carotovora subsp. atroseptica SCRI1043] (132 aa)
Score = 96, Expect = 1.7e-02, Identities = 28/93 (30%), Positives = 50/93 (53%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI---LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           + +R    ++  I+  I   V D  I  ATV  V +S+D + AKV+++  +    +++   +K +  ASGF R ++ K + LR  P + F  D S+
  S:     7 RTQRVAQEMQKEIAIIIQREVKDPRIGMATVSGVEVSRDLAYAKVFVTFLNDNEPEQVKIAVKALQDASGFIRMMIGKAMRLRVVPELTFSYDNSL 102
>gi|169334796|ref|ZP_02861989.1| hypothetical protein ANASTE_01202 [Anaerofustis stercorihominis DSM 17244] >gi|169257534|gb|EDS71500.1| hypothetical protein ANASTE_01202 [Anaerofustis stercorihominis DSM 17244] (121 aa)
Score = 96, Expect = 1.7e-02, Identities = 34/103 (33%), Positives = 57/103 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTL--SKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           +IER   +IK+ +S  I   + D  +K+A +  V +  + D   AKVY+S   +    ++I+  ++ A GF R  +AK LN R  P ++F  D S+D    I+ +L
  S:     4 RIERVNELIKNELSLLIELELNDPRLKEAIISVVRVKATPDLKYAKVYVSVMGENNKKEEIIGVLDKAKGFLRKSIAKVLNTRNTPELIFELDNSLDYAMHIDEVL 109
>gi|167942934|ref|ZP_02530008.1| ribosome-binding factor A (rbfA) [Borrelia afzelii ACA-1] (120 aa)
Score = 96, Expect = 1.8e-02, Identities = 34/106 (32%), Positives = 57/106 (53%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDD--LIKQATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           N+K  + ES I   I + I +    D  +    TV  V  SKD   AKV+I S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N ++E
  S:     4 NIKKFKLESFIAQEIGNLIVSRGIKDPRIHSFLTVVKVEFSKDLINAKVFIGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFIKDDSLSKSFYVNKIIE 112
>gi|148267760|ref|YP_001246703.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH9] >gi|151221391|ref|YP_001332213.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus str. Newman] >gi|147740829|gb|ABQ49127.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH9] >gi|150374191|dbj|BAF67451.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus str. Newman] (130 aa)
Score = 96, Expect = 1.8e-02, Identities = 29/113 (25%), Positives = 59/113 (52%)
  Q:     1 VKHMSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V  MS+++ ER    +K  +   I   V D  +   T+  V L+ D S AKV+++   +   ++   K ++ A GF ++ L   + LR  P +++  D+SI+  ++I  +++ +
  S:    12 VTRMSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIERMIQDL 125
>gi|115351436|ref|YP_773275.1| ribosome-binding factor A [Burkholderia ambifaria AMMD] >gi|170700021|ref|ZP_02891046.1| ribosome-binding factor A [Burkholderia ambifaria IOP40-10] >gi|171317093|ref|ZP_02906296.1| ribosome-binding factor A [Burkholderia ambifaria MEX-5] >gi|172060475|ref|YP_001808127.1| ribosome-binding factor A [Burkholderia ambifaria MC40-6] >gi|122323371|sp|Q0BFY2|RBFA_BURCM Ribosome-binding factor A >gi|115281424|gb|ABI86941.1| ribosome-binding factor A [Burkholderia ambifaria AMMD] >gi|170135080|gb|EDT03383.1| ribosome-binding factor A [Burkholderia ambifaria IOP40-10] >gi|171097727|gb|EDT42554.1| ribosome-binding factor A [Burkholderia ambifaria MEX-5] >gi|171992992|gb|ACB63911.1| ribosome-binding factor A [Burkholderia ambifaria MC40-6] (132 aa)
Score = 96, Expect = 1.8e-02, Identities = 32/107 (29%), Positives = 55/107 (51%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AK+Y +       DK  + +N ASG    +L K L++   P + F  D++I+K  E++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKIYFTALTGDP-DKTQEALNHASGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVEMSRLIKE 113
>gi|156935693|ref|YP_001439609.1| ribosome-binding factor A [Enterobacter sakazakii ATCC BAA-894] >gi|156533947|gb|ABU78773.1| hypothetical protein ESA_03560 [Enterobacter sakazakii ATCC BAA-894] (150 aa)
Score = 96, Expect = 1.9e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    54 TVSGVEVSRDLAYAKVFVTFLNDKDEAAVKAGIKALQDASGFIRSLLGKAMRLRIVPELTFFYDNSL 120
>gi|126695467|ref|YP_001090353.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9301] >gi|166219386|sp|A3PAH7|RBFA_PROM0 Ribosome-binding factor A >gi|126542510|gb|ABO16752.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9301] (130 aa)
Score = 96, Expect = 2.0e-02, Identities = 31/112 (27%), Positives = 62/112 (55%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +N ++ +  S++K  I+  +   + +DLI+     +  + LS D    K+YI S  ++ +  +I++ +N A    R  L K + +R+ P I+F +D  +DK   +  LL+++K K
  S:     3 NNYRLAKVSSLLKKEITLILQNDLENDLIRDHFVNISKIDLSGDLQHCKIYITSTAEEKVRKEIVENLNTAKSSIRHSLGKRIEMRRVPEIIFKDDVVLDKGLSVLKLLDELKNK 117
>gi|114772786|ref|ZP_01450110.1| ribosome-binding factor A, role in processing of 16S rRNA [alpha proteobacterium HTCC2255] (144 aa)
Score = 96, Expect = 2.0e-02, Identities = 23/77 (29%), Positives = 45/77 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISC--YDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           TV  V +S+D + AKVY++    D+  +   +  +    GF R +L++ + +R  PA+ F+ D SI +   I++++ Q+
  S:    38 TVSGVEISRDLAHAKVYVTFLEMDEEKVKASMALLEEGKGFVRGLLSRRVRMRNTPALKFIQDRSITEGMRISNIVSQV 116
>gi|77974020|ref|ZP_00829563.1| COG0858: Ribosome-binding factor A [Yersinia frederiksenii ATCC 33641] (136 aa)
Score = 96, Expect = 2.0e-02, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           + D  +  ATV  + LS+D + AKV+++         D   +   +K +  ASG+ RT+L K + LR  P + F  D S+
  S:    27 IKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSL 106
>gi|83855206|ref|ZP_00948736.1| ribosome-binding factor A [Sulfitobacter sp. NAS-14.1] >gi|83941728|ref|ZP_00954190.1| ribosome-binding factor A [Sulfitobacter sp. EE-36] >gi|83843049|gb|EAP82216.1| ribosome-binding factor A [Sulfitobacter sp. NAS-14.1] >gi|83847548|gb|EAP85423.1| ribosome-binding factor A [Sulfitobacter sp. EE-36] (142 aa)
Score = 95, Expect = 2.1e-02, Identities = 26/76 (34%), Positives = 38/76 (50%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V  S D  IA  Y+        + +LK +    G  R ++AK L L+ AP + F  DE+ D++DE   +L Q
  S:    50 TVGEVRASPDLKIATAYVLPLGGDGQEDVLKLLARNKGELRRLMAKKLVLKYAPDLRFQLDETFDRMDETRRMLAQ 125
>gi|134295575|ref|YP_001119310.1| ribosome-binding factor A [Burkholderia vietnamiensis G4] >gi|166218426|sp|A4JDX2|RBFA_BURVG Ribosome-binding factor A >gi|134138732|gb|ABO54475.1| ribosome-binding factor A [Burkholderia vietnamiensis G4] (132 aa)
Score = 95, Expect = 2.1e-02, Identities = 32/107 (29%), Positives = 55/107 (51%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +       +K  + +N ASG    +L K L++   P + F  D++I+K  E++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGDP-EKTQEALNHASGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVEMSRLIKE 113
>gi|30248766|ref|NP_840836.1| ribosome-binding factor A [Nitrosomonas europaea ATCC 19718] >gi|34098452|sp|Q82WC9|RBFA_NITEU Ribosome-binding factor A >gi|30180361|emb|CAD84673.1| Ribosome-binding factor A [Nitrosomonas europaea ATCC 19718] (117 aa)
Score = 95, Expect = 2.2e-02, Identities = 26/93 (27%), Positives = 51/93 (54%)
  Q:    24 ITTLVYDDLIKQATVHYVTLSKDKSIAKV-YISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           I   + D  +   T+  V +++D + AKV Y +      I  + + +  A+GF R+ LA  + LR  P + F+ DES+++  +++ L+++  GK
  S:    23 IQNEIMDPRVGMVTLTGVEVTRDYAYAKVFYTTLGGDENIQLVEEGLKHAAGFLRSQLAGKIRLRVVPQLQFVYDESVERGMKLSRLIDEAVGK 116
>gi|77978622|ref|ZP_00834049.1| COG0858: Ribosome-binding factor A [Yersinia intermedia ATCC 29909] (136 aa)
Score = 95, Expect = 2.2e-02, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           + D  +  ATV  + LS+D + AKV+++         D   +   +K +  ASG+ RT+L K + LR  P + F  D S+
  S:    27 IKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSL 106
>gi|77958792|ref|ZP_00822820.1| COG0858: Ribosome-binding factor A [Yersinia bercovieri ATCC 43970] >gi|77961870|ref|ZP_00825699.1| COG0858: Ribosome-binding factor A [Yersinia mollaretii ATCC 43969] >gi|123440814|ref|YP_001004805.1| ribosome-binding factor A [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166199574|sp|A1JIX0|RBFA_YERE8 Ribosome-binding factor A >gi|122087775|emb|CAL10561.1| ribosome-binding factor A [Yersinia enterocolitica subsp. enterocolitica 8081] (136 aa)
Score = 95, Expect = 2.2e-02, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           + D  +  ATV  + LS+D + AKV+++         D   +   +K +  ASG+ RT+L K + LR  P + F  D S+
  S:    27 IKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSL 106
>gi|16123641|ref|NP_406954.1| ribosome-binding factor A [Yersinia pestis CO92] >gi|51594833|ref|YP_069024.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 32953] >gi|108806043|ref|YP_649959.1| ribosome-binding factor A [Yersinia pestis Antiqua] >gi|108813399|ref|YP_649166.1| ribosome-binding factor A [Yersinia pestis Nepal516] >gi|145600791|ref|YP_001164867.1| ribosome-binding factor A [Yersinia pestis Pestoides F] >gi|153946906|ref|YP_001402549.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 31758] >gi|153997272|ref|ZP_02022372.1| ribosome-binding factor A [Yersinia pestis CA88-4125] >gi|161484875|ref|NP_668026.2| ribosome-binding factor A [Yersinia pestis KIM] >gi|161511439|ref|NP_991981.2| ribosome-binding factor A [Yersinia pestis biovar Microtus str. 91001] >gi|162419142|ref|YP_001608287.1| ribosome-binding factor A [Yersinia pestis Angola] >gi|165925682|ref|ZP_02221514.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936784|ref|ZP_02225351.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str. IP275] >gi|166010165|ref|ZP_02231063.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214622|ref|ZP_02240657.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401225|ref|ZP_02306725.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420727|ref|ZP_02312480.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423323|ref|ZP_02315076.1| ribosome-binding factor A [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470845|ref|ZP_02335549.1| ribosome-binding factor A [Yersinia pestis FV-1] >gi|170025944|ref|YP_001722449.1| ribosome-binding factor A [Yersinia pseudotuberculosis YPIII] >gi|186893842|ref|YP_001870954.1| ribosome-binding factor A [Yersinia pseudotuberculosis PB1/+] >gi|122383880|sp|Q1CC08|RBFA_YERPA Ribosome-binding factor A >gi|122384217|sp|Q1CEL4|RBFA_YERPN Ribosome-binding factor A >gi|166199575|sp|A4TRI2|RBFA_YERPP Ribosome-binding factor A >gi|166918680|sp|A7FMS1|RBFA_YERP3 Ribosome-binding factor A >gi|20978601|sp|Q8ZBC3|RBFA_YERPE Ribosome-binding factor A >gi|61214873|sp|Q66F59|RBFA_YERPS Ribosome-binding factor A >gi|51588115|emb|CAH19721.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 32953] >gi|108777047|gb|ABG19566.1| ribosome-binding factor A [Yersinia pestis Nepal516] >gi|108777956|gb|ABG12014.1| ribosome-binding factor A [Yersinia pestis Antiqua] >gi|115349120|emb|CAL22083.1| ribosome-binding factor A [Yersinia pestis CO92] >gi|145212487|gb|ABP41894.1| ribosome-binding factor A [Yersinia pestis Pestoides F] >gi|149288909|gb|EDM38989.1| ribosome-binding factor A [Yersinia pestis CA88-4125] >gi|152958401|gb|ABS45862.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 31758] >gi|162351957|gb|ABX85905.1| ribosome-binding factor A [Yersinia pestis Angola] >gi|165915433|gb|EDR34043.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str. IP275] >gi|165922294|gb|EDR39471.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991072|gb|EDR43373.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204197|gb|EDR48677.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961533|gb|EDR57554.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049250|gb|EDR60658.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057493|gb|EDR67239.1| ribosome-binding factor A [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752478|gb|ACA69996.1| ribosome-binding factor A [Yersinia pseudotuberculosis YPIII] >gi|186696868|gb|ACC87497.1| ribosome-binding factor A [Yersinia pseudotuberculosis PB1/+] (136 aa)
Score = 95, Expect = 2.2e-02, Identities = 26/86 (30%), Positives = 48/86 (55%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  +  ATV  + LS+D + AKV+++         D   +   +K +  ASG+ RT+L K + LR  P + F  D S+ +   +++L+  +
  S:    27 IKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNV 119
>gi|88802041|ref|ZP_01117569.1| putative ribosome-binding factor A [Polaribacter irgensii 23-P] >gi|88782699|gb|EAR13876.1| putative ribosome-binding factor A [Polaribacter irgensii 23-P] (131 aa)
Score = 95, Expect = 2.2e-02, Identities = 24/75 (32%), Positives = 44/75 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V ++ D  +AKVY+S +     D+I+K +   +   R  +AK     LR+ P ++F  D+++D I+EI+  L+
  S:    36 SVSKVHVTADLGVAKVYLSIFPSENRDEIVKGVQSNTPLIRHEMAKRTRNQLRRMPELLFFGDDTLDYIEEIDKSLK 112
>gi|171769878|sp|A7MQE0|RBFA_ENTS8 Ribosome-binding factor A (133 aa)
Score = 95, Expect = 2.3e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEVSRDLAYAKVFVTFLNDKDEAAVKAGIKALQDASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|111115637|ref|YP_710255.1| ribosome-binding factor A [Borrelia afzelii PKo] >gi|123145625|sp|Q0SM49|RBFA_BORAP Ribosome-binding factor A >gi|110890911|gb|ABH02079.1| ribosome-binding factor A [Borrelia afzelii PKo] (120 aa)
Score = 95, Expect = 2.3e-02, Identities = 34/106 (32%), Positives = 57/106 (53%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDD--LIKQATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           N+K  + ES I   I + I +    D  +    TV  V  SKD   AKV+I S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N ++E
  S:     4 NIKKFKLESFIAQEIGNLIVSRGIKDPRIHSFLTVVKVEFSKDLINAKVFIGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKIIE 112
>gi|15902526|ref|NP_358076.1| ribosome-binding factor A [Streptococcus pneumoniae R6] >gi|15458052|gb|AAK99286.1| Ribosome binding factor A [Streptococcus pneumoniae R6] (125 aa)
Score = 95, Expect = 2.3e-02, Identities = 31/110 (28%), Positives = 57/110 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +++ +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D    +I    A+G  +  L +NL L K P + F+ DESI+  ++I+ +L  +
  S:    11 VNHFRIDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNL 122
>gi|46446394|ref|YP_007759.1| putative ribosome binding factor A [Candidatus Protochlamydia amoebophila UWE25] >gi|61215033|sp|Q6MD65|RBFA_PARUW Ribosome-binding factor A >gi|46400035|emb|CAF23484.1| putative ribosome binding factor A [Candidatus Protochlamydia amoebophila UWE25] (131 aa)
Score = 95, Expect = 2.4e-02, Identities = 33/110 (30%), Positives = 59/110 (53%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQ-ATVHYVTLSKDKSIAKVYISCYDKTIID-KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+  + +R  S++K++IS  I   V +  + +  TV  V +S+D   AKV+IS         + ++ +N A+GF     ++ + +R  P + F  D+S+DK   I  LL +I
  S:     1 MAIQRTDRLNSLLKEVISEVIRRDVRNPYVTELVTVTRVQISRDLRYAKVFISIIGSEQAKVETIEALNSAAGFIAVNASQKVVMRYFPELNFKLDDSVDKHMRIEELLGKI 112
>gi|16766583|ref|NP_462198.1| ribosome-binding factor A [Salmonella typhimurium LT2] >gi|167558152|ref|ZP_02351162.1| hypothetical protein Sententeri_15097 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167990150|ref|ZP_02571250.1| hypothetical protein Sententer_01000002_0100001820 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168231894|ref|ZP_02656952.1| hypothetical protein Sententerica_12990 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168477384|ref|ZP_02706407.1| hypothetical protein Salmoentericaenterica_22244 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194470716|ref|ZP_03076700.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|20978604|sp|Q8ZLT1|RBFA_SALTY Ribosome-binding factor A >gi|16421844|gb|AAL22157.1| ribosome-binding factor [Salmonella typhimurium LT2] >gi|194457080|gb|EDX45919.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (133 aa)
Score = 95, Expect = 2.5e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVFVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|116515755|ref|YP_815989.1| ribosome-binding factor A [Streptococcus pneumoniae D39] >gi|122279125|sp|Q04LV9|RBFA_STRP2 Ribosome-binding factor A >gi|29427722|sp|Q8DQV1|RBFA_STRR6 Ribosome-binding factor A >gi|116076331|gb|ABJ54051.1| ribosome-binding factor A [Streptococcus pneumoniae D39] (116 aa)
Score = 95, Expect = 2.5e-02, Identities = 31/110 (28%), Positives = 57/110 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +++ +I+R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D    +I    A+G  +  L +NL L K P + F+ DESI+  ++I+ +L  +
  S:     2 VNHFRIDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNL 113
>gi|163734260|ref|ZP_02141700.1| ribosome-binding factor A [Roseobacter litoralis Och 149] >gi|161392268|gb|EDQ16597.1| ribosome-binding factor A [Roseobacter litoralis Och 149] (140 aa)
Score = 95, Expect = 2.5e-02, Identities = 25/80 (31%), Positives = 41/80 (51%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V +S D  IA  Y+        D+++  +    G  R ++AK L L+ AP + F  DE+ D++DE   +L + + K
  S:    47 TVGEVRVSPDLKIATAYVLPLGGQGRDEVIALLARNKGELRRLVAKKLTLKFAPDLRFQLDETFDRMDETREMLNRAEVK 126
>gi|168237986|ref|ZP_02663044.1| hypothetical protein Senteenterica_17488 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194737644|ref|YP_002116234.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194713146|gb|ACF92367.1| ribosome-binding factor A [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (133 aa)
Score = 95, Expect = 2.5e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           TV  V +S+D + AKV+++     D+  +   +K +  ASGF R++L K + LR  P + F  D S+
  S:    37 TVSGVEMSRDLAYAKVFVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSL 103
>gi|125718689|ref|YP_001035822.1| ribosome-binding factor A [Streptococcus sanguinis SK36] >gi|166219412|sp|A3CQ17|RBFA_STRSV Ribosome-binding factor A >gi|125498606|gb|ABN45272.1| Ribosome-binding factor A, putative [Streptococcus sanguinis SK36] (116 aa)
Score = 95, Expect = 2.5e-02, Identities = 31/112 (27%), Positives = 56/112 (50%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +N + +R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L  NL + K P + F+ DESI+  ++I+ +L  ++ K
  S:     3 NNFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSMAKVYYTIMSNLASDNQKAQTGLEKATGTIKRELGHNLKMYKIPDLTFVKDESIEYGNKIDQMLRDLEKK 116
>gi|114562169|ref|YP_749682.1| ribosome-binding factor A [Shewanella frigidimarina NCIMB 400] >gi|122300516|sp|Q086H1|RBFA_SHEFN Ribosome-binding factor A >gi|114333462|gb|ABI70844.1| ribosome-binding factor A [Shewanella frigidimarina NCIMB 400] (143 aa)
Score = 95, Expect = 2.6e-02, Identities = 26/87 (29%), Positives = 51/87 (58%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           D  I   TV+ V +S+D S AKVY++ +  D  ++ + +  +  A+ + RT++A  + LR  P + F+ D S+ +   +++L+ Q+  K
  S:    29 DPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDTELVQQKIDALTVAAPYVRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVTQVINK 117
>gi|15924260|ref|NP_371794.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu50] >gi|15926853|ref|NP_374386.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus N315] >gi|21282882|ref|NP_645970.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MW2] >gi|49483433|ref|YP_040657.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486109|ref|YP_043330.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651840|ref|YP_186146.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus COL] >gi|82750871|ref|YP_416612.1| ribosome-binding factor A [Staphylococcus aureus RF122] >gi|87161703|ref|YP_493860.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus USA300] >gi|88194980|ref|YP_499780.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150393819|ref|YP_001316494.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH1] >gi|156979591|ref|YP_001441850.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu3] >gi|161509436|ref|YP_001575095.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727921|ref|ZP_02760198.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122540682|sp|Q2G2Q4|RBFA_STAA8 Ribosome-binding factor A >gi|123486171|sp|Q2FHG8|RBFA_STAA3 Ribosome-binding factor A >gi|123549084|sp|Q2YXP6|RBFA_STAAB Ribosome-binding factor A >gi|166219410|sp|A7X1Q2|RBFA_STAA1 Ribosome-binding factor A >gi|172049025|sp|A6QGG9|RBFA_STAAE Ribosome-binding factor A >gi|182676603|sp|A5ISF4|RBFA_STAA9 Ribosome-binding factor A >gi|189039563|sp|A6U189|RBFA_STAA2 Ribosome-binding factor A >gi|189039564|sp|A8Z3V0|RBFA_STAAT Ribosome-binding factor A >gi|54039026|sp|P65967|RBFA_STAAN Ribosome-binding factor A >gi|54039027|sp|P65968|RBFA_STAAW Ribosome-binding factor A >gi|54041787|sp|P65966|RBFA_STAAM Ribosome-binding factor A >gi|56749520|sp|Q6G9U3|RBFA_STAAS Ribosome-binding factor A >gi|56749567|sp|Q6GHG5|RBFA_STAAR Ribosome-binding factor A >gi|61214665|sp|Q5HGG1|RBFA_STAAC Ribosome-binding factor A >gi|13701070|dbj|BAB42365.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus N315] >gi|14247040|dbj|BAB57432.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu50] >gi|21204321|dbj|BAB95018.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MW2] >gi|49241562|emb|CAG40248.1| putative ribosome-binding factor A [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244552|emb|CAG42981.1| putative ribosome-binding factor A [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286026|gb|AAW38120.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus COL] >gi|82656402|emb|CAI80821.1| ribosome-binding factor A [Staphylococcus aureus RF122] >gi|87127677|gb|ABD22191.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202538|gb|ABD30348.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|149946271|gb|ABR52207.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH1] >gi|156721726|dbj|BAF78143.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu3] >gi|160368245|gb|ABX29216.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus USA300_TCH1516] (116 aa)
Score = 95, Expect = 2.6e-02, Identities = 28/110 (25%), Positives = 58/110 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           MS+++ ER    +K  +   I   V D  +   T+  V L+ D S AKV+++   +   ++   K ++ A GF ++ L   + LR  P +++  D+SI+  ++I  +++ +
  S:     1 MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIERMIQDL 111
>gi|90409002|ref|ZP_01217132.1| ribosome-binding factor A [Psychromonas sp. CNPT3] >gi|90309887|gb|EAS38042.1| ribosome-binding factor A [Psychromonas sp. CNPT3] (134 aa)
Score = 95, Expect = 2.7e-02, Identities = 27/93 (29%), Positives = 51/93 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           +  R    ++  ++  +   V D  I   TV  V +++D + AKV+++     D+T  D+ L+ +N A+G+ R +L K + LR  P + F  DE++
  S:     7 RTSRVSQQVQKELARILQQEVKDPRIGMVTVSGVDITRDLAYAKVFVTFLTIGDQTN-DESLEGLNSAAGYIRRLLGKAMRLRIVPEVRFCFDETL 101
>gi|121600095|ref|YP_992836.1| ribosome-binding factor A [Burkholderia mallei SAVP1] >gi|124383895|ref|YP_001026179.1| ribosome-binding factor A [Burkholderia mallei NCTC 10229] >gi|126440943|ref|YP_001058780.1| ribosome-binding factor A [Burkholderia pseudomallei 668] >gi|126448377|ref|YP_001080551.1| ribosome-binding factor A [Burkholderia mallei NCTC 10247] >gi|126454142|ref|YP_001066032.1| ribosome-binding factor A [Burkholderia pseudomallei 1106a] >gi|134282412|ref|ZP_01769117.1| ribosome-binding factor A [Burkholderia pseudomallei 305] >gi|161369485|ref|ZP_02109054.1| ribosome-binding factor A [Burkholderia pseudomallei 1710a] >gi|167001015|ref|ZP_02266816.1| ribosome-binding factor A [Burkholderia mallei PRL-20] >gi|167824414|ref|ZP_02455885.1| ribosome-binding factor A [Burkholderia pseudomallei 9] >gi|167911164|ref|ZP_02498255.1| ribosome-binding factor A [Burkholderia pseudomallei 112] >gi|76580488|gb|ABA49963.1| ribosome-binding factor A [Burkholderia pseudomallei 1710b] >gi|121228905|gb|ABM51423.1| ribosome-binding factor A [Burkholderia mallei SAVP1] >gi|124291915|gb|ABN01184.1| ribosome-binding factor A [Burkholderia mallei NCTC 10229] >gi|126220436|gb|ABN83942.1| ribosome-binding factor A [Burkholderia pseudomallei 668] >gi|126227784|gb|ABN91324.1| ribosome-binding factor A [Burkholderia pseudomallei 1106a] >gi|126241247|gb|ABO04340.1| ribosome-binding factor A [Burkholderia mallei NCTC 10247] >gi|134246450|gb|EBA46539.1| ribosome-binding factor A [Burkholderia pseudomallei 305] (138 aa)
Score = 94, Expect = 3.0e-02, Identities = 31/107 (28%), Positives = 54/107 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +    T  D   + +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:    25 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGTPADT-QEALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 129
>gi|195962652|ref|ZP_03098857.1| ribosome-binding factor A [Borrelia spielmanii A14S] (120 aa)
Score = 94, Expect = 3.1e-02, Identities = 29/96 (30%), Positives = 53/96 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++  I+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N ++E
  S:    10 LESFIAQEIGNLIVSRGIKDPRIHSFLTVVKVEFSKDLVNAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKIIE 112
>gi|110678026|ref|YP_681033.1| ribosome-binding factor A [Roseobacter denitrificans OCh 114] >gi|123172936|sp|Q16CE6|RBFA_ROSDO Ribosome-binding factor A >gi|109454142|gb|ABG30347.1| ribosome-binding factor A [Roseobacter denitrificans OCh 114] (143 aa)
Score = 94, Expect = 3.2e-02, Identities = 25/80 (31%), Positives = 40/80 (50%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V  S D  IA  Y+        D+++  +    G  R ++AK L L+ AP + F  DE+ D++DE   +L + + K
  S:    50 TVGEVRASPDLKIATAYVLPLGGQGKDEVIALLARNKGELRRLVAKKLTLKFAPDLRFQLDETFDRMDETREMLNRAEVK 129
>gi|73662804|ref|YP_301585.1| ribosome-binding factor A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123642449|sp|Q49X58|RBFA_STAS1 Ribosome-binding factor A >gi|72495319|dbj|BAE18640.1| ribosome-binding factor A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (114 aa)
Score = 94, Expect = 3.3e-02, Identities = 35/111 (31%), Positives = 54/111 (48%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           N++ ER    +K  I       V D  I   T+  V L+ D SIA VY++    +K   D   K +  A GF ++ L   + LR  P + F  DESID  ++I  +++ +  K
  S:     2 NMRAERVGEQMKQEIMDIANNKVKDPRIGFLTITDVQLTNDLSIATVYLTVLGNEKQKADT-FKGLEKAKGFIKSELGSRMRLRIIPELNFEYDESIDYGNKIERMIQDLHKK 113
>gi|32033693|ref|ZP_00133988.1| COG0858: Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208122|ref|YP_001053347.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae L20] >gi|165976052|ref|YP_001651645.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149950|ref|YP_001968475.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166218414|sp|A3N006|RBFA_ACTP2 Ribosome-binding factor A >gi|126096914|gb|ABN73742.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae L20] >gi|165876153|gb|ABY69201.1| ribosome binding factor A [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915081|gb|ACE61333.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (127 aa)
Score = 94, Expect = 3.3e-02, Identities = 24/86 (27%), Positives = 53/86 (61%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V D  I   TV  V +S+D + AK++++     D+++I++ +K +  AS + R+++ K + LR  P + F+ D+S+ +   +++L+  +
  S:    27 VKDPRIGMVTVSDVEVSRDLAYAKIFVTFLFDNDQSVIEQGMKGLEKASPYIRSLVGKAMRLRIVPELRFIYDQSLVEGMRMSNLVSNV 115
>gi|58040016|ref|YP_191980.1| ribosome-binding factor A [Gluconobacter oxydans 621H] >gi|62510968|sp|Q5FQM2|RBFA_GLUOX Ribosome-binding factor A >gi|58002430|gb|AAW61324.1| Ribosome-binding factor A [Gluconobacter oxydans 621H] (142 aa)
Score = 94, Expect = 3.3e-02, Identities = 22/74 (29%), Positives = 40/74 (54%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           TV  V +S D   A  +++   ++ ++ +L  +   + F RT L+K LNLR  P I F  D ++D   E++ ++
  S:    55 TVTEVRISPDFRHATAFVTRLGRSDVEVLLPALKRVAPFLRTGLSKALNLRTVPEIHFQPDTALDNAMELDEIM 128
>gi|118444128|ref|YP_878208.1| ribosome-binding factor A [Clostridium novyi NT] >gi|166218434|sp|A0Q0Q6|RBFA_CLONN Ribosome-binding factor A >gi|118134584|gb|ABK61628.1| ribosome-binding factor A [Clostridium novyi NT] (121 aa)
Score = 94, Expect = 3.5e-02, Identities = 34/113 (30%), Positives = 56/113 (49%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+  ++ R    +K  IS+ I   ++D  L    +V  V ++ D   AKV+IS +       + L+ +  ++GF R  +   + LR  P I+   DESI+    IN LL  +K K
  S:     1 MARYRLGRINEEVKKEISNIIRDDIHDPRLTGMVSVTRVEVTNDLRYAKVFISIFGSDESKTETLEALKSSAGFIRREVGHRVKLRYTPEILLELDESIEHGMHINDLLSNLKEK 115
>gi|51599054|ref|YP_073242.1| ribosome-binding factor A [Borrelia garinii PBi] >gi|61214866|sp|Q65ZX1|RBFA_BORGA Ribosome-binding factor A >gi|51573625|gb|AAU07650.1| ribosome-binding factor A [Borrelia garinii PBi] (120 aa)
Score = 94, Expect = 3.5e-02, Identities = 33/106 (31%), Positives = 57/106 (53%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDD--LIKQATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           N+K  + ES I   I + I +    D  +    TV  V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N ++E
  S:     4 NIKKFKLESFIAQEIGNLIVSRGIKDPRIHSFLTVVKVEFSKDLINAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKIIE 112
>gi|168187907|ref|ZP_02622542.1| ribosome-binding factor A [Clostridium botulinum C str. Eklund] >gi|169294249|gb|EDS76382.1| ribosome-binding factor A [Clostridium botulinum C str. Eklund] (121 aa)
Score = 93, Expect = 3.6e-02, Identities = 34/113 (30%), Positives = 56/113 (49%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+  ++ R    +K  IS+ I   ++D  L    +V  V ++ D   AKV+IS +       + L+ +  ++GF R  +   + LR  P I+   DESI+    IN LL  +K K
  S:     1 MARYRLGRINEEVKKEISNIIRDDIHDPRLTGMVSVTRVEVTNDLRYAKVFISIFGSDESKAETLEALKSSAGFIRREVGHRVKLRYTPEIILELDESIEHGMHINDLLSNLKEK 115
>gi|85860519|ref|YP_462721.1| ribosome-binding factor A [Syntrophus aciditrophicus SB] >gi|123517498|sp|Q2LWT9|RBFA_SYNAS Ribosome-binding factor A >gi|85723610|gb|ABC78553.1| ribosome-binding factor A [Syntrophus aciditrophicus SB] (123 aa)
Score = 93, Expect = 3.6e-02, Identities = 30/106 (28%), Positives = 52/106 (49%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI------SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R   ++K  I+  +   + D  + + TV  V +S D   A+++       SC+ +T     L+ +  A GF R  L K L LR  P ++F  D S      I+ L+ +I
  S:     6 RADRVADLVKMEIADILLRRIRDPRVSRLTVTGVKVSDDLRTARIFFVEMGEDSCHPET-----LEGLQKAGGFIRKELGKRLKLRYVPDLIFKPDSSFAYGSRIDQLINEI 112
>gi|121998527|ref|YP_001003314.1| ribosome-binding factor A [Halorhodospira halophila SL1] >gi|166218443|sp|A1WXV0|RBFA_HALHL Ribosome-binding factor A >gi|121589932|gb|ABM62512.1| ribosome-binding factor A [Halorhodospira halophila SL1] (126 aa)
Score = 93, Expect = 3.6e-02, Identities = 22/94 (23%), Positives = 52/94 (55%)
  Q:    20 ISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI--LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++  I   V D  +   T+  V +S+D + A VY++       +    +  +N A GF R+ +A+ +  ++ P++ FL+D + D+   +++L++++
  S:    19 LAEVIRDDVDDPRVGSVTISEVQVSRDLAHATVYVTVLGAEAAEAQAGIDILNKAHGFLRSQVARRIRAKRTPSLRFLHDTAFDRGARLSALIDEV 114
>gi|127513754|ref|YP_001094951.1| ribosome-binding factor A [Shewanella loihica PV-4] >gi|166219404|sp|A3QGU4|RBFA_SHELP Ribosome-binding factor A >gi|126639049|gb|ABO24692.1| ribosome-binding factor A [Shewanella loihica PV-4] (140 aa)
Score = 93, Expect = 3.6e-02, Identities = 28/89 (31%), Positives = 55/89 (61%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + D  I   TV+ V +S+D + AKVY++ +  DK ++++ L  +  A+G+ R+++A  + LR  P I F+ D S+ +   +++L+ Q+  K
  S:    27 IKDPRIGMVTVNDVDVSRDLNYAKVYVTFFEEDKAVVEEKLAALEAAAGYVRSLVAGRMKLRVMPEIRFIYDASLIEGMRMSNLVSQVITK 117
>gi|39996689|ref|NP_952640.1| ribosome-binding factor A [Geobacter sulfurreducens PCA] >gi|61215118|sp|Q74CT2|RBFA_GEOSL Ribosome-binding factor A >gi|39983570|gb|AAR34963.1| ribosome-binding factor A [Geobacter sulfurreducens PCA] (118 aa)
Score = 93, Expect = 3.7e-02, Identities = 28/91 (30%), Positives = 49/91 (53%)
  Q:    24 ITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           IT +   D I+QAT++Y  +  D+  A+V  +           + +  A+GF R  + K L L+ AP + F  D+SI+  + I+ LL++I+
  S:    34 ITGVKVTDDIRQATIYYTVMGDDE--ARVSTA-----------RGLASATGFLRREIGKQLRLKFAPELHFKYDQSIEYGNRIDQLLKEIE 111
>gi|107022575|ref|YP_620902.1| ribosome-binding factor A [Burkholderia cenocepacia AU 1054] >gi|116689523|ref|YP_835146.1| ribosome-binding factor A [Burkholderia cenocepacia HI2424] >gi|170732827|ref|YP_001764774.1| ribosome-binding factor A [Burkholderia cenocepacia MC0-3] >gi|123245042|sp|Q1BWS6|RBFA_BURCA Ribosome-binding factor A >gi|166218425|sp|A0K6X6|RBFA_BURCH Ribosome-binding factor A >gi|105892764|gb|ABF75929.1| ribosome-binding factor A [Burkholderia cenocepacia AU 1054] >gi|116647612|gb|ABK08253.1| ribosome-binding factor A [Burkholderia cenocepacia HI2424] >gi|169816069|gb|ACA90652.1| ribosome-binding factor A [Burkholderia cenocepacia MC0-3] (132 aa)
Score = 93, Expect = 3.8e-02, Identities = 32/107 (29%), Positives = 55/107 (51%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +       +K  + +N ASG    +L K L++   P + F  D++I+K  E++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGDP-EKTQEALNHASGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVEMSRLIKE 113
>gi|146337228|ref|YP_001202276.1| ribosome-binding factor A [Bradyrhizobium sp. ORS278] >gi|166218424|sp|A4YJF0|RBFA_BRASO Ribosome-binding factor A >gi|146190034|emb|CAL74026.1| Ribosome-binding factor A [Bradyrhizobium sp. ORS278] (138 aa)
Score = 93, Expect = 3.9e-02, Identities = 25/74 (33%), Positives = 36/74 (48%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           TV  V +S D  +A +YI        D +L  +     F R  +A+ +NL+ AP I F  DE  D+ + I  LL
  S:    49 TVPEVRMSPDLKLATIYIMPLGGRDTDVVLAALERNKKFLRGEVARRVNLKFAPDIRFRVDERFDEAERIEKLL 122
>gi|170787842|gb|EDT28886.1| ribosome-binding factor A [Oligotropha carboxidovorans OM5] (141 aa)
Score = 93, Expect = 3.9e-02, Identities = 30/95 (31%), Positives = 48/95 (50%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + +LI HA+  +     V+DD +     TV  V +S D  +A VY+        + +L  +     F R  +A  +NL+ AP + F  DE  D+ + I  LL
  S:    23 VGELIRHAMADILAQGGVHDDTLAGHIITVPEVRMSPDLKLATVYVMPLGGHDTEAVLAALAHNKKFLRGEVAHRVNLKFAPELRFRVDERFDEAERIEKLL 124
>gi|169832550|ref|YP_001694044.1| ribosome-binding factor A [Streptococcus pneumoniae Hungary19A-6] >gi|168995052|gb|ACA35664.1| ribosome-binding factor A [Streptococcus pneumoniae Hungary19A-6] (116 aa)
Score = 93, Expect = 3.9e-02, Identities = 30/109 (27%), Positives = 56/109 (51%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ + +R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K+   +  A+G  +  L +NL L K P + F+ DESI+  ++I+ +L  +
  S:     3 NHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKVQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNL 113
>gi|182683490|ref|YP_001835237.1| ribosome-binding factor A [Streptococcus pneumoniae CGSP14] >gi|182628824|gb|ACB89772.1| ribosome-binding factor A [Streptococcus pneumoniae CGSP14] (125 aa)
Score = 93, Expect = 3.9e-02, Identities = 30/109 (27%), Positives = 56/109 (51%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ + +R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K+   +  A+G  +  L +NL L K P + F+ DESI+  ++I+ +L  +
  S:    12 NHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKVQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNL 122
>gi|195948249|ref|ZP_03089435.1| ribosome-binding factor A [Borrelia garinii PBr] (120 aa)
Score = 93, Expect = 4.0e-02, Identities = 29/96 (30%), Positives = 53/96 (55%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHY------VTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ++  I+  I  L+    IK   +H       V  SKD   AKV++ S  +   +D  +K +N A GF ++ + K + +R  P ++F+ D+S+ K   +N ++E
  S:    10 LESFIAQEIGNLIVSRGIKDPRIHSFLTVVKVEFSKDLINAKVFMGSIKEGASLDNAVKALNNAKGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKIIE 112
>gi|87200501|ref|YP_497758.1| ribosome-binding factor A [Novosphingobium aromaticivorans DSM 12444] >gi|123488757|sp|Q2G5E9|RBFA_NOVAD Ribosome-binding factor A >gi|87136182|gb|ABD26924.1| ribosome-binding factor A [Novosphingobium aromaticivorans DSM 12444] (135 aa)
Score = 93, Expect = 4.0e-02, Identities = 30/87 (34%), Positives = 45/87 (51%)
  Q:    28 VYDDLIKQATVHY--VTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           V+DD++   TV    V +S D   A V+I        D +LK +   + FF+  +A+ L L+ A  + FL DES D   +I +LL   K
  S:    35 VHDDVLSAHTVSVTEVRMSPDLRHATVFIKALLGEDEDLVLKALRTNTAFFQREVAQRLRLKYAARLKFLADESFDVASKIETLLADPK 123
>gi|117620712|ref|YP_857793.1| ribosome-binding factor A [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166218415|sp|A0KNE2|RBFA_AERHH Ribosome-binding factor A >gi|117562119|gb|ABK39067.1| ribosome-binding factor A [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (144 aa)
Score = 93, Expect = 4.3e-02, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           V D  I   TV  V +S+D + AKVY++      D   I + LK +  A+G+ R++L   + LR  P + F  D+++
  S:    27 VKDPRIGMVTVSDVEVSRDLNYAKVYVTFLQLENDAERIKEGLKALTEAAGYIRSLLGSAMRLRVVPELRFFYDQTL 103
>gi|77165584|ref|YP_344109.1| ribosome-binding factor A [Nitrosococcus oceani ATCC 19707] >gi|123593841|sp|Q3J9B7|RBFA_NITOC Ribosome-binding factor A >gi|76883898|gb|ABA58579.1| ribosome-binding factor A [Nitrosococcus oceani ATCC 19707] (127 aa)
Score = 93, Expect = 4.5e-02, Identities = 25/83 (30%), Positives = 48/83 (57%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCYDKT-IIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           D  +K  TV +V +S D   AK Y++   K     + L  +N A+GF +  L++ + LR  P + F+ D+SI++   +++L+++
  S:    29 DPRVKLVTVSHVRVSPDLRQAKAYVTFLGKEEDTQEQLAVLNKAAGFLQHGLSQRVELRVIPRLQFVYDDSIERGRRLSALIDK 112
>gi|89900919|ref|YP_523390.1| ribosome-binding factor A [Rhodoferax ferrireducens T118] >gi|122479182|sp|Q21WJ4|RBFA_RHOFD Ribosome-binding factor A >gi|89345656|gb|ABD69859.1| ribosome-binding factor A [Rhodoferax ferrireducens T118] (122 aa)
Score = 93, Expect = 4.6e-02, Identities = 27/97 (27%), Positives = 51/97 (52%)
  Q:    16 IKDLISHAITTLVYDDL----IKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + D I   +T L+  +L    +   T+  V ++ D + AKVY S           + +N A+GF R  L K L++   P + FL D++ ++  ++N+L+ +
  S:    14 VADQIQRDLTELIARELKDPRVGMVTIQAVEVTPDYAHAKVYFSLLAGDP-KACTEGLNQAAGFLRAGLFKRLHIHTVPTLHFLFDQTTERAADMNALIAR 113
>gi|88705686|ref|ZP_01103396.1| Ribosome-binding factor A [gamma proteobacterium KT 71] >gi|88700199|gb|EAQ97308.1| Ribosome-binding factor A [Congregibacter litoralis KT71] (145 aa)
Score = 93, Expect = 4.6e-02, Identities = 24/107 (22%), Positives = 56/107 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK---ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + ER    ++  ++  I   V D  +   ++  V +S+D S A+V+ +       ++       +N A+GF R+ LA++ ++R  P + F+ D S+ +  ++ +L+ + +
  S:     7 RTERVGDYLRRELALIIQREVRDPRLGMVSITAVDVSRDISHARVHFTLLGSDTAEEAKPCTDVLNNAAGFLRSALARDASMRSVPKLRFVFDSSVGRGRDLEALIHRAR 116
>gi|146297074|ref|YP_001180845.1| ribosome-binding factor A [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166218427|sp|A4XL69|RBFA_CALS8 Ribosome-binding factor A >gi|145410650|gb|ABP67654.1| ribosome-binding factor A [Caldicellulosiruptor saccharolyticus DSM 8903] (135 aa)
Score = 93, Expect = 4.6e-02, Identities = 26/73 (35%), Positives = 43/73 (58%)
  Q:    41 VTLSKDKSIAKVYISCYDKTI--IDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V +SKD   AKV++S +DK    I   +K +  A  + R  +++ +NLR +P I F  D+SI+    I+ +L Q+
  S:    40 VNMSKDLRHAKVFVSIFDKNRENITSTMKALENAKPYIRREISRRINLRFSPEISFELDDSIEYGARISQILNQL 114
>gi|116492657|ref|YP_804392.1| ribosome-binding factor A [Pediococcus pentosaceus ATCC 25745] >gi|122265879|sp|Q03FS2|RBFA_PEDPA Ribosome-binding factor A >gi|116102807|gb|ABJ67950.1| ribosome-binding factor A [Pediococcus pentosaceus ATCC 25745] (116 aa)
Score = 92, Expect = 4.7e-02, Identities = 32/104 (30%), Positives = 53/104 (50%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKK-INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +R    I+  +S  +   V D  ++  T+  V ++ D   AK+Y S   DK   D+  K  +  ASG  R  L   L++ K P + F+ DES+   D+I+ LL ++
  S:     8 DRLSQEIEKEVSDILRRRVRDPRVEGVTITGVDVTGDLQQAKIYYSILSDKASDDQKTKAGLEKASGLIRKELGSRLSIYKTPELSFIRDESVQYGDKIDQLLNKL 113
>gi|166030872|ref|ZP_02233701.1| hypothetical protein DORFOR_00552 [Dorea formicigenerans ATCC 27755] >gi|166029139|gb|EDR47896.1| hypothetical protein DORFOR_00552 [Dorea formicigenerans ATCC 27755] (119 aa)
Score = 92, Expect = 4.9e-02, Identities = 28/70 (40%), Positives = 40/70 (57%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDEI 106
           +V  V ++ D    K YIS   D    +  +K +  A GF R  LA+ LN+R  P I F+ D+SI+       KIDE+
  S:    27 SVVAVEVAPDLKTCKAYISVLGDVKAQEDTIKGLRSAEGFIRRELARTLNMRNTPEIQFILDQSIEYGVNMSKKIDEV 104
>gi|150390434|ref|YP_001320483.1| ribosome-binding factor A [Alkaliphilus metalliredigens QYMF] >gi|172052480|sp|A6TRK6|RBFA_ALKMQ Ribosome-binding factor A >gi|149950296|gb|ABR48824.1| ribosome-binding factor A [Alkaliphilus metalliredigens QYMF] (138 aa)
Score = 92, Expect = 4.9e-02, Identities = 28/95 (29%), Positives = 52/95 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLI-KQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK 102
           ++ R    IK +ISH I   + D  I K  ++  V +++D   A +YIS   D+   ++ ++ +  +SGF R  + + +  R  P ++F  DESI++
  S:     8 RVNRLAEEIKKIISHMIRNDLRDPRIAKMTSIIEVNVTRDLRFATIYISVLGDQQEKEETIEGLKKSSGFIRKEVGRQITARFTPELIFKLDESIER 104
>gi|146308622|ref|YP_001189087.1| ribosome-binding factor A [Pseudomonas mendocina ymp] >gi|166219393|sp|A4XYD9|RBFA_PSEMY Ribosome-binding factor A >gi|145576823|gb|ABP86355.1| ribosome-binding factor A [Pseudomonas mendocina ymp] (129 aa)
Score = 92, Expect = 4.9e-02, Identities = 27/85 (31%), Positives = 49/85 (57%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + D  +   T+  V +S+D S AKV+I+      D   I   L+ +  A+G+ R +L K++ +R  P + F  D SI +  E+++L+E+
  S:    27 IKDPRLGLVTITAVDVSRDLSHAKVFITVMGKDDDAEQIKLNLEILGEAAGYLRMLLGKSMKVRTIPQLHFHYDASIRRGAELSALIER 115
>gi|114331631|ref|YP_747853.1| ribosome-binding factor A [Nitrosomonas eutropha C91] >gi|122313590|sp|Q0AFJ4|RBFA_NITEC Ribosome-binding factor A >gi|114308645|gb|ABI59888.1| ribosome-binding factor A [Nitrosomonas eutropha C91] (117 aa)
Score = 92, Expect = 5.1e-02, Identities = 28/101 (27%), Positives = 61/101 (60%)
  Q:    16 IKDLISHAITTLVYDDL----IKQATVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + D +   + +L+ +++    I   T+  V +++D + AKV+ +      +  + ++ LK+   A+GF R+ LA  + LR  P + F+ DESI++  +++ L+++  GK
  S:    11 VADQVQRELASLIQNEIMDPRIGMITLTGVEVTRDYTYAKVFYTTLGGNENAQLAEEGLKR---AAGFLRSQLAGKIRLRIIPKLQFVYDESIERGIKLSRLIDEAVGK 116
>gi|114766563|ref|ZP_01445519.1| ribosome-binding factor A [Roseovarius sp. HTCC2601] >gi|114541179|gb|EAU44231.1| ribosome-binding factor A [Roseovarius sp. HTCC2601] (131 aa)
Score = 92, Expect = 5.1e-02, Identities = 24/76 (31%), Positives = 36/76 (47%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  VT+S D  +A  Y+        D++   +       R  ++K L L+ AP I F  DE+ D++DE   L  Q
  S:    47 TVGEVTVSPDLKVATAYVVPLGGGKPDEMFDLLKRNKSELRRAVSKGLTLKFAPEIRFKLDETFDRLDETRRLFSQ 122
>gi|77359944|ref|YP_339519.1| ribosome-binding factor A, role in processing of 16S rRNA [Pseudoalteromonas haloplanktis TAC125] >gi|123588866|sp|Q3IJ52|RBFA_PSEHT Ribosome-binding factor A >gi|76874855|emb|CAI86076.1| ribosome-binding factor A, role in processing of 16S rRNA [Pseudoalteromonas haloplanktis TAC125] (166 aa)
Score = 92, Expect = 5.1e-02, Identities = 29/106 (27%), Positives = 56/106 (52%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R    I+  I+  +   + D  +   TV  V +S+D S AK++I+ +   D     +    +N A+G+ R++L K +  R  P + FL D S+ +   I++L++ I
  S:     6 RTDRVAQQIQKEIAVILQREIKDPRLGMVTVSAVEVSRDLSYAKIFITVFNTQDDNAAKQSANVLNEATGYIRSLLGKRIRARIMPELKFLVDNSLMEGMRISNLVDSI 114
>gi|160884142|ref|ZP_02065145.1| hypothetical protein BACOVA_02119 [Bacteroides ovatus ATCC 8483] >gi|156110484|gb|EDO12229.1| hypothetical protein BACOVA_02119 [Bacteroides ovatus ATCC 8483] (110 aa)
Score = 92, Expect = 5.2e-02, Identities = 27/75 (36%), Positives = 44/75 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V +S D SIA+VY+S +     ++++K IN      R  L   +   LR  P + F  D+S+D I++I+SLL+
  S:    34 SVSAVRISPDMSIARVYLSVFPSEKAEEMVKNINNNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYIEKIDSLLK 110
>gi|3914553|sp|O34272|RBFA_YEREN Ribosome-binding factor A >gi|2462713|emb|CAA71698.1| yhbB [Yersinia enterocolitica] (133 aa)
Score = 92, Expect = 5.4e-02, Identities = 25/73 (34%), Positives = 40/73 (54%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           + D  +  ATV  + LS+D + AKV+++         D       +K +  ASG+ RT+L K + LR  P + F  D S+
  S:    24 IKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTAKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSL 103
>gi|78066112|ref|YP_368881.1| ribosome-binding factor A [Burkholderia sp. 383] >gi|123568679|sp|Q39H29|RBFA_BURS3 Ribosome-binding factor A >gi|77966857|gb|ABB08237.1| ribosome-binding factor A [Burkholderia sp. 383] (132 aa)
Score = 92, Expect = 5.4e-02, Identities = 32/107 (29%), Positives = 54/107 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +        K  + +N ASG    +L K L++   P + F  D++I+K  E++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGDPA-KTQEALNHASGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVEMSRLIKE 113
>gi|162454072|ref|YP_001616439.1| hypothetical protein sce5796 [Sorangium cellulosum 'So ce 56'] >gi|182676543|sp|A9G882|RBFA_SORC5 Ribosome-binding factor A >gi|161164654|emb|CAN95959.1| rbfA [Sorangium cellulosum 'So ce 56'] (124 aa)
Score = 92, Expect = 5.7e-02, Identities = 28/85 (32%), Positives = 39/85 (45%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYI----SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           D  I    V  V ++ D   AKV++       D      +LK +  ASG  R  +A+ + LR  P + F  DE  D    I  LL +IK
  S:    28 DPRIAGVLVSRVEITDDLQSAKVHVRHEFGAEDAAARRALLKGLEAASGRLRRDVARTMGLRVVPTLRFFYDEGPDAERRIEELLREIK 116
>gi|119470823|ref|ZP_01613434.1| ribosome-binding factor A, role in processing of 16S rRNA [Alteromonadales bacterium TW-7] >gi|119446050|gb|EAW27329.1| ribosome-binding factor A, role in processing of 16S rRNA [Alteromonadales bacterium TW-7] (148 aa)
Score = 91, Expect = 6.1e-02, Identities = 29/106 (27%), Positives = 58/106 (54%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R    I+  I+  +   + D  +   TV  V +S+D S AK++I+ +   D+    +  K +N A+G+ R++L K +  R  P + F+ D S+ +   I++L++ I
  S:     6 RTDRVGQQIQKEIAVILQREIKDPRLGMVTVSAVEVSRDLSYAKIFITVFNTKDEDAAKQSAKVLNEATGYIRSLLGKRIRARIMPELKFVVDNSLMEGMRISNLVDTI 114
>gi|89067209|ref|ZP_01154722.1| ribosome-binding factor A [Oceanicola granulosus HTCC2516] >gi|89046778|gb|EAR52832.1| ribosome-binding factor A [Oceanicola granulosus HTCC2516] (143 aa)
Score = 91, Expect = 6.2e-02, Identities = 23/76 (30%), Positives = 37/76 (48%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V  + D  IA  Y+       ++  LK +    G  R  ++KNL L+ AP + F  DE+ D+ID+   +  +
  S:    50 TVSEVQTTPDLKIATAYVLPLGGRDVEVALKALARNKGELRRAVSKNLTLKFAPDLRFRVDETFDRIDDTRRMFNE 125
>gi|196480316|gb|ACG79844.1| ribosome-binding factor A [Phenylobacterium zucineum HLK1] (145 aa)
Score = 91, Expect = 6.5e-02, Identities = 26/97 (26%), Positives = 49/97 (50%)
  Q:    18 DLISHAITTLVYDDLIK-------QATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +L+ HA+  +  ++ I          TV  V +S D   A V++        D++++ +N  + F R  L + + LR  P + FL+DES ++   +  L +  K
  S:    24 ELVRHALVEIFREEEINDPVLAGVSVTVTEVRVSPDLRHATVFVEPLGGEHADEVVQALNRHARFLRGHLGRAIELRFTPELKFLHDESFNEAARMAKLFDDPK 127
>gi|160880904|ref|YP_001559872.1| ribosome-binding factor A [Clostridium phytofermentans ISDg] >gi|189039535|sp|A9KNW3|RBFA_CLOPH Ribosome-binding factor A >gi|160429570|gb|ABX43133.1| ribosome-binding factor A [Clostridium phytofermentans ISDg] (136 aa)
Score = 91, Expect = 6.8e-02, Identities = 31/109 (28%), Positives = 57/109 (52%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +++K  R    ++  +S  I+  + D  I   T +  V ++ D   AKVYIS     +  K  L  +  A+ F R  LA+ +NLR  P ++F+ D+SI+    ++ L+ ++
  S:     4 NSIKNTRINQEVQKELSMLISRELKDPRINPMTSIVAVEVAPDLKTAKVYISVLGDELSQKNTLAGLKSAAPFLRGQLARGINLRNTPELLFVVDQSIEYGVSMSKLINEV 114
>gi|145298045|ref|YP_001140886.1| ribosome-binding factor A [Aeromonas salmonicida subsp. salmonicida A449] >gi|166218416|sp|A4SJR6|RBFA_AERS4 Ribosome-binding factor A >gi|142850817|gb|ABO89138.1| ribosome-binding factor A [Aeromonas salmonicida subsp. salmonicida A449] (144 aa)
Score = 91, Expect = 6.8e-02, Identities = 28/83 (33%), Positives = 47/83 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           V D  I   TV  V +SKD + AKVY++      D   I + LK +  A+G+ R++L   + LR  P + F  D+++ +   I++L+
  S:    27 VKDPRIGMVTVSDVEVSKDLNYAKVYVTFLQLDIDAERIAEGLKGLTEAAGYIRSLLGSAMRLRVVPELRFYYDQTLVEGMRISNLV 113
>gi|171058385|ref|YP_001790734.1| ribosome-binding factor A [Leptothrix cholodnii SP-6] >gi|170775830|gb|ACB33969.1| ribosome-binding factor A [Leptothrix cholodnii SP-6] (123 aa)
Score = 91, Expect = 6.9e-02, Identities = 29/101 (28%), Positives = 49/101 (48%)
  Q:    16 IKDLISHAITTLVYD---DLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           + D I   +  L+ D     I   T++ V ++ D + AKVY S       D  L  +N A+GF R  L K L +   P + F  D + ++  E+++L+ Q   +
  S:    14 VSDQIQRDVAELIRDLKDPRIGMVTINSVDITPDYAHAKVYFSVLIGDAADSELA-LNEAAGFLRNGLFKRLQIHTVPTLHFHFDRTTERAAELSALITQANAR 116
>gi|94676893|ref|YP_589055.1| ribosome-binding factor A [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|166218422|sp|Q1LSK9|RBFA_BAUCH Ribosome-binding factor A >gi|94220043|gb|ABF14202.1| ribosome-binding factor A [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (134 aa)
Score = 91, Expect = 7.0e-02, Identities = 32/110 (29%), Positives = 61/110 (55%)
  Q:     4 MSNV--KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI-------SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+NV  + +R    I+  I+ ++   + D  +++ T+ +V++S D   A V++              I K +K +  ASGF R +L K ++LR  P + F+ D+S+     I+ L+ +I
  S:     1 MANVYSRKKRIAHEIQKKINISLQHNIRDPRLRKTTISWVSVSHDLGSATVFVIFNGIQNDNQTSEEIKKRIKTLQAASGFIRYLLGKTMHLRIVPKLTFVYDQSLSHGIYIHELVNKI 119
>gi|149185841|ref|ZP_01864156.1| ribosome-binding factor A [Erythrobacter sp. SD-21] >gi|148830402|gb|EDL48838.1| ribosome-binding factor A [Erythrobacter sp. SD-21] (133 aa)
Score = 91, Expect = 7.0e-02, Identities = 29/102 (28%), Positives = 51/102 (50%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIK--QATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           ER   I+ +L++       +DD+++     V  V ++ D   AK Y+         ++LK +   + FF+  +A+ L L+ AP + F  DES D+   I  LL+
  S:    21 ERVRHILSELLARG---EAHDDVLRAHNIAVTEVRMTPDLRNAKAYVKPLLGKDEAEVLKALRTNTAFFQKEVAQRLGLKFAPKLSFKPDESFDEAGRIERLLD 121
>gi|33152522|ref|NP_873875.1| ribosome-binding factor A [Haemophilus ducreyi 35000HP] >gi|38372437|sp|Q7VLI3|RBFA_HAEDU Ribosome-binding factor A >gi|33148745|gb|AAP96264.1| ribosome binding factor A [Haemophilus ducreyi 35000HP] (126 aa)
Score = 91, Expect = 7.4e-02, Identities = 26/86 (30%), Positives = 50/86 (58%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V D  I   TV  V +S+D + AK++++     D+ II + +K +  A  + RT+L K + LR  P + F+ D+S+ +   +++L+  +
  S:    27 VKDPRIGMVTVSDVEVSRDLAYAKIFVTFLFDNDQDIIAQGMKGLEKAGPYIRTLLGKAMRLRILPELRFIYDQSLVEGMRMSNLVSNV 115
>gi|148983935|ref|ZP_01817254.1| ribosome-binding factor A [Streptococcus pneumoniae SP3-BS71] >gi|148990075|ref|ZP_01821329.1| ribosome-binding factor A [Streptococcus pneumoniae SP6-BS73] >gi|148992333|ref|ZP_01822056.1| ribosome-binding factor A [Streptococcus pneumoniae SP9-BS68] >gi|148998230|ref|ZP_01825699.1| ribosome-binding factor A [Streptococcus pneumoniae SP11-BS70] >gi|149002228|ref|ZP_01827170.1| ribosome-binding factor A [Streptococcus pneumoniae SP14-BS69] >gi|149005667|ref|ZP_01829406.1| ribosome-binding factor A [Streptococcus pneumoniae SP18-BS74] >gi|149012569|ref|ZP_01833566.1| ribosome-binding factor A [Streptococcus pneumoniae SP19-BS75] >gi|149021512|ref|ZP_01835567.1| ribosome-binding factor A [Streptococcus pneumoniae SP23-BS72] >gi|168482797|ref|ZP_02707749.1| ribosome-binding factor A [Streptococcus pneumoniae CDC1873-00] >gi|168485668|ref|ZP_02710176.1| ribosome-binding factor A [Streptococcus pneumoniae CDC1087-00] >gi|168488248|ref|ZP_02712447.1| ribosome-binding factor A [Streptococcus pneumoniae SP195] >gi|168490553|ref|ZP_02714696.1| ribosome-binding factor A [Streptococcus pneumoniae CDC0288-04] >gi|168492714|ref|ZP_02716857.1| ribosome-binding factor A [Streptococcus pneumoniae CDC3059-06] >gi|168576541|ref|ZP_02722415.1| ribosome-binding factor A [Streptococcus pneumoniae MLV-016] >gi|194397934|ref|YP_002037218.1| ribosome-binding factor A [Streptococcus pneumoniae G54] >gi|147755873|gb|EDK62917.1| ribosome-binding factor A [Streptococcus pneumoniae SP11-BS70] >gi|147759543|gb|EDK66534.1| ribosome-binding factor A [Streptococcus pneumoniae SP14-BS69] >gi|147762607|gb|EDK69567.1| ribosome-binding factor A [Streptococcus pneumoniae SP18-BS74] >gi|147763374|gb|EDK70311.1| ribosome-binding factor A [Streptococcus pneumoniae SP19-BS75] >gi|147924082|gb|EDK75194.1| ribosome-binding factor A [Streptococcus pneumoniae SP3-BS71] >gi|147924601|gb|EDK75688.1| ribosome-binding factor A [Streptococcus pneumoniae SP6-BS73] >gi|147928959|gb|EDK79971.1| ribosome-binding factor A [Streptococcus pneumoniae SP9-BS68] >gi|147930208|gb|EDK81193.1| ribosome-binding factor A [Streptococcus pneumoniae SP23-BS72] >gi|172043604|gb|EDT51650.1| ribosome-binding factor A [Streptococcus pneumoniae CDC1873-00] >gi|183571117|gb|EDT91645.1| ribosome-binding factor A [Streptococcus pneumoniae CDC1087-00] >gi|183573142|gb|EDT93670.1| ribosome-binding factor A [Streptococcus pneumoniae SP195] >gi|183574953|gb|EDT95481.1| ribosome-binding factor A [Streptococcus pneumoniae CDC0288-04] >gi|183577069|gb|EDT97597.1| ribosome-binding factor A [Streptococcus pneumoniae CDC3059-06] >gi|183577721|gb|EDT98249.1| ribosome-binding factor A [Streptococcus pneumoniae MLV-016] >gi|194357601|gb|ACF56049.1| ribosome-binding factor A [Streptococcus pneumoniae G54] (116 aa)
Score = 91, Expect = 7.6e-02, Identities = 30/109 (27%), Positives = 55/109 (50%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ + +R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D    +I    A+G  +  L +NL L K P + F+ DESI+  ++I+ +L  +
  S:     3 NHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNL 113
>gi|56478756|ref|YP_160345.1| ribosome-binding factor A [Azoarcus sp. EbN1] >gi|61214724|sp|Q5NZS0|RBFA_AZOSE Ribosome-binding factor A >gi|56314799|emb|CAI09444.1| ribosome-binding factor A [Azoarcus sp. EbN1] (127 aa)
Score = 91, Expect = 7.6e-02, Identities = 27/104 (25%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +R    ++  ++  I   V D  +   T+  V ++ D + AKV+  S   +  +D+IL  ++ ASGF R  L K + +   P + F  D S+++   ++ L++Q+
  S:     9 QRVAEQVRRELAELIRLEVKDPRVGFITLTDVEITPDYAHAKVFFTSMKGEEGLDEILTGLHRASGFLRRELGKRVRIHTLPELHFHYDSSVERGSRMSQLIDQV 113
>gi|15672750|ref|NP_266924.1| ribosome-binding factor A [Lactococcus lactis subsp. lactis Il1403] >gi|13878682|sp|Q9CHG3|RBFA_LACLA Ribosome-binding factor A >gi|12723686|gb|AAK04866.1|AE006310_8 ribosome-binding factor A [Lactococcus lactis subsp. lactis Il1403] (119 aa)
Score = 91, Expect = 7.6e-02, Identities = 31/112 (27%), Positives = 54/112 (48%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ + +R    I+  I+  +   V D  ++   +  V L+ D S A VY S       D  K    +  A+G F++ LAK + + K P + F  DES++   +I+ LL  +  K
  S:     3 NSFRSDRVAVEIQREINDILRNKVRDPRVQDVNITDVQLTGDLSQATVYYSLLSNLASDNEKAATALKKATGLFKSELAKRMTIFKIPDLTFAKDESVEYGSKIDELLRGLNNK 116
>gi|145348606|ref|XP_001418737.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578967|gb|ABO97030.1| predicted protein [Ostreococcus lucimarinus CCE9901] (171 aa)
Score = 91, Expect = 7.8e-02, Identities = 23/79 (29%), Positives = 46/79 (58%)
  Q:    36 ATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ATV  V +S D  + KVY+S   D+   +  +K +     + R  + + ++LR  P I F+ D+S ++  ++++LL++I+
  S:    51 ATVADVEVSNDLQVVKVYVSILGDERGKNNAIKGMKRMEQYVRRKIGRRMSLRLTPEIRFIYDDSFERGQKVSALLDEIR 130
>gi|74316714|ref|YP_314454.1| ribosome-binding factor A [Thiobacillus denitrificans ATCC 25259] >gi|123612206|sp|Q3SKX2|RBFA_THIDA Ribosome-binding factor A >gi|74056209|gb|AAZ96649.1| ribosome-binding factor A [Thiobacillus denitrificans ATCC 25259] (124 aa)
Score = 91, Expect = 7.8e-02, Identities = 27/104 (25%), Positives = 49/104 (47%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYD-KTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           +  R    I+  +   I   V D  +   T+  V +++D   AKVY +    +      L+ +  ASGF R+ L+  + LR  P + F+ D S++    ++ L+E
  S:     7 RARRVADQIQRELPELIRQEVKDPRVGMLTITEVEVNRDMEFAKVYFTTMGGEAEHAACLQGLQRASGFLRSQLSHRMQLRVVPKLTFVYDRSVEHGMALSRLIE 111
>gi|153805797|ref|ZP_01958465.1| hypothetical protein BACCAC_00033 [Bacteroides caccae ATCC 43185] >gi|149130474|gb|EDM21680.1| hypothetical protein BACCAC_00033 [Bacteroides caccae ATCC 43185] (110 aa)
Score = 90, Expect = 8.0e-02, Identities = 27/75 (36%), Positives = 44/75 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V +S D SIA+VY+S +     ++++K IN      R  L   +   LR  P + F  D+S+D I++I+SLL+
  S:    34 SVSAVRISPDMSIARVYLSVFPSEKAEEMVKNINDNMKSIRYELGTRVRYQLRIIPELKFFVDDSLDYIEKIDSLLK 110
>gi|53719531|ref|YP_108517.1| ribosome-binding factor A [Burkholderia pseudomallei K96243] >gi|53724826|ref|YP_102759.1| ribosome-binding factor A [Burkholderia mallei ATCC 23344] >gi|161356435|ref|ZP_02102313.1| ribosome-binding factor A [Burkholderia pseudomallei 1106b] >gi|162210047|ref|YP_333315.2| ribosome-binding factor A [Burkholderia pseudomallei 1710b] >gi|167719816|ref|ZP_02403052.1| ribosome-binding factor A [Burkholderia pseudomallei DM98] >gi|167738817|ref|ZP_02411591.1| ribosome-binding factor A [Burkholderia pseudomallei 14] >gi|167816039|ref|ZP_02447719.1| ribosome-binding factor A [Burkholderia pseudomallei 91] >gi|167845946|ref|ZP_02471454.1| ribosome-binding factor A [Burkholderia pseudomallei B7210] >gi|167894523|ref|ZP_02481925.1| ribosome-binding factor A [Burkholderia pseudomallei 7894] >gi|167902928|ref|ZP_02490133.1| ribosome-binding factor A [Burkholderia pseudomallei NCTC 13177] >gi|167919188|ref|ZP_02506279.1| ribosome-binding factor A [Burkholderia pseudomallei BCC215] >gi|194525294|ref|YP_002060824.1| ribosome-binding factor A [Burkholderia mallei FMH] >gi|194575278|ref|YP_002110162.1| ribosome-binding factor A [Burkholderia mallei 2002721280] >gi|171769479|sp|A1V3N3|RBFA_BURMS Ribosome-binding factor A >gi|171769872|sp|A2S2L0|RBFA_BURM9 Ribosome-binding factor A >gi|171855124|sp|A3NUL1|RBFA_BURP0 Ribosome-binding factor A >gi|171855126|sp|A3N8V9|RBFA_BURP6 Ribosome-binding factor A >gi|171855141|sp|A3MJW5|RBFA_BURM7 Ribosome-binding factor A >gi|172046646|sp|Q3JSY8|RBFA_BURP1 Ribosome-binding factor A >gi|61214833|sp|Q62KL0|RBFA_BURMA Ribosome-binding factor A >gi|61214850|sp|Q63TP9|RBFA_BURPS Ribosome-binding factor A >gi|52209945|emb|CAH35917.1| putative ribosome-binding factor [Burkholderia pseudomallei K96243] >gi|52428249|gb|AAU48842.1| ribosome-binding factor A [Burkholderia mallei ATCC 23344] >gi|147749304|gb|EDK56378.1| ribosome-binding factor A [Burkholderia mallei FMH] >gi|148027530|gb|EDK85551.1| ribosome-binding factor A [Burkholderia mallei 2002721280] (122 aa)
Score = 90, Expect = 8.1e-02, Identities = 31/107 (28%), Positives = 54/107 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +    T  D   + +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGTPADT-QEALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 113
>gi|86135202|ref|ZP_01053784.1| ribosome-binding factor A [Tenacibaculum sp. MED152] >gi|85822065|gb|EAQ43212.1| ribosome-binding factor A [Polaribacter dokdonensis MED152] (131 aa)
Score = 90, Expect = 8.4e-02, Identities = 22/74 (29%), Positives = 43/74 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLL 110
           +V  V ++ D  +AKVY+S +     D+++K +   +   R  +AK     LR+ P ++F  D+++D ++EI+  L
  S:    36 SVSKVHVTSDLGVAKVYLSVFPSEKRDELVKGVQSNTVLIRHEMAKRTKNQLRRMPELLFFGDDTLDYLEEIDKSL 111
>gi|169827170|ref|YP_001697328.1| ribosome-binding factor A [Lysinibacillus sphaericus C3-41] >gi|168991658|gb|ACA39198.1| Ribosome-binding factor A [Lysinibacillus sphaericus C3-41] (113 aa)
Score = 90, Expect = 9.1e-02, Identities = 31/109 (28%), Positives = 56/109 (51%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           SN   E+ +  + D++   I     D  +   TV  V ++ D   A +YI S  ++   ++ LK +  ASGF R+ +   + LR+ P ++F  D SI+  + I++LL  +
  S:     5 SNRVAEQMKKELGDILGRKIK----DPRVGFVTVTGVEVTGDLQQATIYITSLGNEREREETLKALVKASGFIRSEIGSRIRLRRTPELIFEFDSSIEYGNRIDTLLRDL 110
>gi|29348248|ref|NP_811751.1| ribosome-binding factor A [Bacteroides thetaiotaomicron VPI-5482] >gi|29340151|gb|AAO77945.1| ribosome-binding factor A [Bacteroides thetaiotaomicron VPI-5482] (110 aa)
Score = 90, Expect = 9.2e-02, Identities = 27/75 (36%), Positives = 44/75 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V +S D SIA+VY+S +     ++++K IN      R  L   +   LR  P + F  D+S+D I++I+SLL+
  S:    34 SVSAVRISPDMSIARVYLSVFPSEKAEEMVKNINENMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYIEKIDSLLK 110
>gi|153092743|gb|EDN73786.1| ribosome binding factor A [Mannheimia haemolytica PHL213] (126 aa)
Score = 90, Expect = 9.4e-02, Identities = 25/73 (34%), Positives = 42/73 (57%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           V D  I   TV  V +S+D + AK++++     D   I + ++ +  AS + RT+L K + LR  P + F+ DES+
  S:    27 VKDPRIGMVTVSDVEVSRDLAYAKIFVTFLFDNDAEAIKQGMQGLEKASPYIRTLLGKAMRLRIVPELRFIYDESL 102
>gi|82702984|ref|YP_412550.1| ribosome-binding factor A [Nitrosospira multiformis ATCC 25196] >gi|123544258|sp|Q2Y7W3|RBFA_NITMU Ribosome-binding factor A >gi|82411049|gb|ABB75158.1| ribosome-binding factor A [Nitrosospira multiformis ATCC 25196] (126 aa)
Score = 90, Expect = 9.4e-02, Identities = 30/97 (30%), Positives = 55/97 (56%)
  Q:    16 IKDLISHAITTLVYDDL----IKQATVHYVTLSKDKSIAKV-YISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           I D I   +  L+ ++L    I   T+  V +S+D + AKV Y + ++++    +   +  A+GF RT L   L LR  P + F+ DESI++   ++ L+++
  S:    11 IADQIQRELADLIRNELKDPRIGMITLTGVEVSQDYAHAKVFYTTLHNESDNFLVQNGLENAAGFLRTQLLHRLKLRVIPQLHFIYDESIERGVRLSQLIDE 112
>gi|168333343|ref|ZP_02691627.1| ribosome-binding factor A [Epulopiscium sp. 'N.t. morphotype B'] (116 aa)
Score = 90, Expect = 9.6e-02, Identities = 35/97 (36%), Positives = 50/97 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQA-------TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI 100
           M+N KI R    + + I   +  ++  D IK A       +V  V  + D   AK++IS       D +L  +NG+S F R  LA+ +NLR  P I F  D SI
  S:     1 MANQKIIR----VNEEIQKEVAEIIRGDSIKDARMKDIMVSVTAVDTTTDLKNAKIFISVLQDNKKDDVLDVLNGSSKFIRKELARRINLRNTPEISFKLDNSI 100
>gi|88860549|ref|ZP_01135187.1| ribosome-binding factor A, role in processing of 16S rRNA [Pseudoalteromonas tunicata D2] >gi|88817747|gb|EAR27564.1| ribosome-binding factor A, role in processing of 16S rRNA [Pseudoalteromonas tunicata D2] (132 aa)
Score = 90, Expect = 9.6e-02, Identities = 28/106 (26%), Positives = 59/106 (55%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI---NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + +R    I+  I+  +   + D  +  ATV  V +S+D + AK++++  +    DK  + I   N A+GF R++L K +  R  P + F+ D S+ +   +++L++++
  S:     6 RTDRVGQQIQKEIAVILQREIKDPRLGMATVSAVEVSRDLAYAKIFVTILNTQDEDKSNESIAILNEATGFIRSLLGKRIRARIMPNLKFVLDRSLLEGMHMSNLVDKV 114
>gi|75674224|ref|YP_316645.1| ribosome-binding factor A [Nitrobacter winogradskyi Nb-255] >gi|74419094|gb|ABA03293.1| ribosome-binding factor A [Nitrobacter winogradskyi Nb-255] (146 aa)
Score = 90, Expect = 9.6e-02, Identities = 27/95 (28%), Positives = 49/95 (51%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + + + HAI  +     V+D +++    TV  V +S D  +A +Y+          ++  ++    F R  +A+ +NL+ AP I F  DE  D+ + I  LL
  S:    29 VAETVRHAIADILAQGQVHDPVLEGHLVTVPEVRMSADLKLATIYVMPLGGRDTADVIDALDRNRKFLRGEIARRVNLKFAPDIRFRVDERFDEAERIEKLL 130
>gi|109947688|ref|YP_664916.1| ribosome-binding factor A [Helicobacter acinonychis str. Sheeba] >gi|123362594|sp|Q17WQ9|RBFA_HELAH Ribosome-binding factor A >gi|109714909|emb|CAJ99917.1| rbfA [Helicobacter acinonychis str. Sheeba] (111 aa)
Score = 90, Expect = 9.7e-02, Identities = 34/111 (30%), Positives = 56/111 (50%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI-KGK 116
           N   ER ES + +L+  A+++L  D  +   +V  V  SK K  A V++   D     KIL K+  A G  R  + +     K P + F+ D S++K   ++++  +I KGK
  S:     2 NAHKERLESNLLELLQEALSSL-NDSELNSLSVTKVECSKGKHHAFVFVLSQDH----KILSKLKKAEGLIRQFVLQASGWFKCPKLSFILDNSLEKQLRLDAIFNEIAKGK 108
>gi|172046706|sp|Q3SWP8|RBFA_NITWN Ribosome-binding factor A (137 aa)
Score = 90, Expect = 1.0e-01, Identities = 27/95 (28%), Positives = 49/95 (51%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + + + HAI  +     V+D +++    TV  V +S D  +A +Y+          ++  ++    F R  +A+ +NL+ AP I F  DE  D+ + I  LL
  S:    20 VAETVRHAIADILAQGQVHDPVLEGHLVTVPEVRMSADLKLATIYVMPLGGRDTADVIDALDRNRKFLRGEIARRVNLKFAPDIRFRVDERFDEAERIEKLL 121
>gi|115522224|ref|YP_779135.1| ribosome-binding factor A [Rhodopseudomonas palustris BisA53] >gi|122298068|sp|Q07V79|RBFA_RHOP5 Ribosome-binding factor A >gi|115516171|gb|ABJ04155.1| ribosome-binding factor A [Rhodopseudomonas palustris BisA53] (138 aa)
Score = 90, Expect = 1.0e-01, Identities = 26/95 (27%), Positives = 51/95 (53%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + + + HAI  +     V+D +++    TV  V +S D  +A +Y+        + +LK ++    F R  +++ +NL+ AP + F  D+  D+ + I  LL
  S:    20 VGESVRHAIAEILAQGGVHDPVLEGHLVTVPEVRMSPDLKLATIYVMPLGGRDTELVLKALDHNKKFLRGEVSRRVNLKFAPELRFRADDRFDEAERIEKLL 121
>gi|196156570|ref|YP_002126059.1| ribosome-binding factor A [Alteromonas macleodii 'Deep ecotype'] >gi|88773377|gb|EAR04643.1| ribosome-binding factor A [Alteromonas macleodii 'Deep ecotype'] >gi|196112349|gb|ACG66065.1| ribosome-binding factor A [Alteromonas macleodii 'Deep ecotype'] (133 aa)
Score = 90, Expect = 1.0e-01, Identities = 27/80 (33%), Positives = 47/80 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKI--LKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           TV  V +S+D + AK++++ Y+ T  +    +K++     F R+ILAK L +R  P + F  D+SI +   I++L+ Q   K
  S:    38 TVSDVDVSRDLAHAKIFVTIYNSTEEEGKVQIKQLAEYKKFIRSILAKRLRMRSVPDLHFFEDKSIIEGMRISNLVSQTIAK 119
>gi|116511577|ref|YP_808793.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris SK11] >gi|125624581|ref|YP_001033064.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris MG1363] >gi|123320521|sp|Q030K1|RBFA_LACLS Ribosome-binding factor A >gi|166218445|sp|A2RM36|RBFA_LACLM Ribosome-binding factor A >gi|116107231|gb|ABJ72371.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris SK11] >gi|124493389|emb|CAL98363.1| Ribosome-binding factor A [Lactococcus lactis subsp. cremoris MG1363] (119 aa)
Score = 90, Expect = 1.0e-01, Identities = 31/112 (27%), Positives = 54/112 (48%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ + +R    I+  I+  +   V D  ++   +  V L+ D S A VY S       D  K    +  A+G F++ LAK + + K P + F  DES++   +I+ LL  +  K
  S:     3 NSFRSDRVAVEIQREINDILRNKVRDPRVQDVNITDVQLTGDLSQATVYYSLLSNLASDNEKAATALKKATGLFKSELAKRMTIFKIPDLTFAKDESVEYGSKIDELLRGLNDK 116
>gi|167758069|ref|ZP_02430196.1| hypothetical protein CLOSCI_00407 [Clostridium scindens ATCC 35704] >gi|167663966|gb|EDS08096.1| hypothetical protein CLOSCI_00407 [Clostridium scindens ATCC 35704] (127 aa)
Score = 89, Expect = 1.0e-01, Identities = 27/69 (39%), Positives = 40/69 (57%)
  Q:    43 LSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDEINSLLE 111
           ++ D    K YIS   D    ++ +K +  A G+ R  LA+ LNLR  P I F+ D+SI+       KIDE+   L+
  S:    43 VAPDLKTCKAYISVLGDAHEQEETIKGLQSAEGYIRRELARTLNLRNTPEIRFVLDQSIEYGVNMSKKIDEVTKGLK 119
>gi|120612036|ref|YP_971714.1| ribosome-binding factor A [Acidovorax avenae subsp. citrulli AAC00-1] >gi|171769194|sp|A1TSK2|RBFA_ACIAC Ribosome-binding factor A >gi|120590500|gb|ABM33940.1| ribosome-binding factor A [Acidovorax avenae subsp. citrulli AAC00-1] (125 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/97 (27%), Positives = 49/97 (50%)
  Q:    16 IKDLISHAITTLVY---DDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + D I   +T L+    D  I   T+  V ++ D + AKV+ S       D     +N A+GF R  L K L++   P + F+ D + ++  ++N+L+ +
  S:    15 VADQIQRDLTELIRELKDPRIGMVTLQAVEVTPDYAHAKVFFSVLVGDA-DATQDALNQAAGFLRNGLFKRLHIHTVPTLHFMFDRTTERASDMNALIAR 113
>gi|153855234|ref|ZP_01996400.1| hypothetical protein DORLON_02414 [Dorea longicatena DSM 13814] >gi|149752233|gb|EDM62164.1| hypothetical protein DORLON_02414 [Dorea longicatena DSM 13814] (128 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/69 (39%), Positives = 40/69 (57%)
  Q:    43 LSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDEINSLLE 111
           ++ D    K YIS   D    ++ +K +  A G+ R  LA+ LNLR  P I F+ D+SI+       KIDE+   L+
  S:    43 VAPDLKTCKAYISVLGDAYEQEQTIKGLQSAEGYIRRELARTLNLRNTPEIKFVLDQSIEYGVNMSKKIDEVTKDLK 119
>gi|153814917|ref|ZP_01967585.1| hypothetical protein RUMTOR_01132 [Ruminococcus torques ATCC 27756] >gi|145847948|gb|EDK24866.1| hypothetical protein RUMTOR_01132 [Ruminococcus torques ATCC 27756] (127 aa)
Score = 89, Expect = 1.1e-01, Identities = 29/79 (36%), Positives = 43/79 (54%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDEINSLLEQIKG 115
           +V  V ++ D    K YIS   D+      +K +  A GF R  LA+ +N+R  P I F+ D+SI+       KIDE+   L+   G
  S:    37 SVVAVEVAPDLKTCKAYISVLGDEKAQQDTIKGLQSAEGFIRRELARTINMRNTPEIKFIVDQSIEYGVNISKKIDEVTKDLKDEAG 123
>gi|118050556|ref|ZP_01519106.1| ribosome-binding factor A [Comamonas testosteroni KF-1] >gi|118002642|gb|EAV16796.1| ribosome-binding factor A [Comamonas testosteroni KF-1] (125 aa)
Score = 89, Expect = 1.1e-01, Identities = 28/100 (28%), Positives = 52/100 (52%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + I +DL S  I   + D  +   T+  V ++ D + AKV+ S    D  +    L  +N A+GF R  L K L++   P + F+ D + ++  ++N+L+ +
  S:    18 DQIQRDL-SELIARELKDPRVGMVTLQGVEVTPDYAHAKVFFSVLVGDPEVT---LAALNQAAGFLRNGLFKRLHIHTVPTLHFVYDRTTERAADMNALIAK 115
>gi|149926270|ref|ZP_01914532.1| ribosome-binding factor A [Limnobacter sp. MED105] >gi|149825088|gb|EDM84300.1| ribosome-binding factor A [Limnobacter sp. MED105] (134 aa)
Score = 89, Expect = 1.1e-01, Identities = 28/104 (26%), Positives = 57/104 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ-IKGK 116
           E I KDL +  I   + D  +   T+  V L+ D + A VY S    +  +   + +N +SG+ R ++ K L++   P + F +D+S+++  E+  ++++ +KG+
  S:    16 EQIQKDL-AELIPRELRDPRLGFVTITDVELTPDYAYATVYFSVLTGSA-ETTEEALNDSSGYLRNLIFKKLHIHTVPTLRFKHDQSVERGAEMAQIIDRALKGE 118
>gi|116618449|ref|YP_818820.1| ribosome-binding factor A [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271351|sp|Q03WH5|RBFA_LEUMM Ribosome-binding factor A >gi|116097296|gb|ABJ62447.1| ribosome-binding factor A [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (117 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/86 (31%), Positives = 40/86 (46%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  +K+ TV  V LS D  IA +Y S       D  K    +  ASG  R  L   L + K P + F+ D S+   + I  L+ ++
  S:    26 INDPRVKEVTVTSVELSGDLQIATIYYSILSDLASDAKKTQAGLEAASGLIRKELGSRLTVYKTPELKFVRDTSVQYGNHIEDLIRKL 113
>gi|85714174|ref|ZP_01045163.1| ribosome-binding factor A [Nitrobacter sp. Nb-311A] >gi|85699300|gb|EAQ37168.1| ribosome-binding factor A [Nitrobacter sp. Nb-311A] (137 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/95 (28%), Positives = 50/95 (52%)
  Q:    16 IKDLISHAITTL-----VYDDLI--KQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + + + HAI  +     V+D ++  +  TV  V +S D  +A +Y+         +++  ++    F R  +A+ +NL+ AP I F  DE  D+ + I  LL
  S:    20 VAESVRHAIADILAQGQVHDPVLEGRLVTVPEVRMSADLKLATIYVMPLGGRDTAEVIDALDHNRKFLRGEIARRVNLKFAPDIRFRVDERFDEAERIEKLL 121
>gi|83319338|ref|YP_424310.1| ribosome-binding factor A [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283224|gb|ABC01156.1| ribosome-binding factor A [Mycoplasma capricolum subsp. capricolum ATCC 27343] (117 aa)
Score = 89, Expect = 1.2e-01, Identities = 31/113 (27%), Positives = 63/113 (55%)
  Q:     4 MSNVKIE-RYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVY---ISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N+K + R ES++   ++  +   +  +++K  +V    LS D S  K++   I  ++   I  I +++       R ILA  L+ R  P + F+ D S+D++++I+ +L++ K K
  S:     1 MANIKTQKRKESLLLRELNLILQREMKSEVLKSISVVETRLSTDNSHVKIFYQFIPIFEDLTIQTIEEELENNLKEIRMILASKLDWRTVPELTFVYDTSLDRVNQIDKILKEDKNK 117
>gi|153938139|ref|YP_001391715.1| ribosome-binding factor A [Clostridium botulinum F str. Langeland] >gi|168180704|ref|ZP_02615368.1| ribosome-binding factor A [Clostridium botulinum NCTC 2916] >gi|168184623|ref|ZP_02619287.1| ribosome-binding factor A [Clostridium botulinum Bf] >gi|166218433|sp|A7GG05|RBFA_CLOBL Ribosome-binding factor A >gi|152934035|gb|ABS39533.1| ribosome-binding factor A [Clostridium botulinum F str. Langeland] >gi|182668591|gb|EDT80570.1| ribosome-binding factor A [Clostridium botulinum NCTC 2916] >gi|182672289|gb|EDT84250.1| ribosome-binding factor A [Clostridium botulinum Bf] (120 aa)
Score = 89, Expect = 1.2e-01, Identities = 31/111 (27%), Positives = 57/111 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  +  R    +K  +S+ I   + D  L    +V  V ++KD   AKVY+S + ++   ++ L+ +  + GF R  + + + LR  P ++   D SI++   I+ LL  IK
  S:     1 MAKYRAGRINEEVKKEVSNIIHNDIKDPRLSAMVSVTDVNVTKDLKYAKVYVSIFGNEKAKEESLQALKSSVGFIRKEVGRRVKLRNTPEVIIEVDNSIERGMHIDELLHSIK 113
>gi|187778990|ref|ZP_02995463.1| hypothetical protein CLOSPO_02585 [Clostridium sporogenes ATCC 15579] >gi|187772615|gb|EDU36417.1| hypothetical protein CLOSPO_02585 [Clostridium sporogenes ATCC 15579] (120 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/99 (27%), Positives = 56/99 (56%)
  Q:    16 IKDLISHAITTLVYDD-----LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           I + +   +++++++D     L    +V  V ++KD   AKVY+S + ++   ++ L+ +  + GF R  + + + LR  P ++   D SI++   I+ LL  IK
  S:     9 INEEVKKEVSSIIHNDIKDPRLSAMVSVTDVNVTKDLKYAKVYVSIFGNEKAKEESLQALKSSVGFIRKEIGRRVKLRNTPEVIIEVDNSIERGMHIDELLHSIK 113
>gi|167037620|ref|YP_001665198.1| ribosome-binding factor A [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856454|gb|ABY94862.1| ribosome-binding factor A [Thermoanaerobacter pseudethanolicus ATCC 33223] (119 aa)
Score = 89, Expect = 1.3e-01, Identities = 30/103 (29%), Positives = 54/103 (52%)
  Q:    11 RYESIIKDLISHAITTLVYDDLIK-QATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           R    IK  IS  I   + D  IK   ++  + L+KD   AKVY+S Y ++    +  + +  A+G+ R  + + + +R  P I+F  D SI+    I+ +L+++
  S:     7 RLSEEIKKEISKMILEEIKDPRIKAMVSITDIELTKDLRYAKVYVSIYGNEEDKRETFEGLKSAAGYIRHEIGRRIKMRYTPEIIFELDHSIEYGAHISEILKEL 111
>gi|146319499|ref|YP_001199211.1| ribosome-binding factor A [Streptococcus suis 05ZYH33] >gi|146321694|ref|YP_001201405.1| ribosome-binding factor A [Streptococcus suis 98HAH33] >gi|145690305|gb|ABP90811.1| Ribosome-binding factor A [Streptococcus suis 05ZYH33] >gi|145692500|gb|ABP93005.1| Ribosome-binding factor A [Streptococcus suis 98HAH33] (136 aa)
Score = 89, Expect = 1.3e-01, Identities = 33/115 (28%), Positives = 57/115 (49%)
  Q:     2 KHMSN-VKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           K+M+N  + +R    IK  ++  +   V D  ++  T+  V +  D S AKVY +       D  K    +  A+G  +  L + L L K P +VF  D+SI+  ++I+ +L  +  K
  S:    18 KNMANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMVGDLSTAKVYYTIMSNLASDNQKAQTGLEKATGTIKRELGRKLTLYKIPDLVFEKDQSIEYGNKIDQMLRALDQK 135
>gi|15900469|ref|NP_345073.1| ribosome-binding factor A [Streptococcus pneumoniae TIGR4] >gi|111657279|ref|ZP_01408045.1| hypothetical protein SpneT_02001517 [Streptococcus pneumoniae TIGR4] >gi|20978639|sp|Q97S56|RBFA_STRPN Ribosome-binding factor A >gi|14972032|gb|AAK74713.1| ribosome-binding factor A [Streptococcus pneumoniae TIGR4] (116 aa)
Score = 89, Expect = 1.3e-01, Identities = 30/109 (27%), Positives = 55/109 (50%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKI--NGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ + +R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D    +I    A+G  +  L +NL L K P + F+ DESI+  ++I+ +L  +
  S:     3 NHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTIIDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNL 113
>gi|148259246|ref|YP_001233373.1| ribosome-binding factor A [Acidiphilium cryptum JF-5] >gi|172047759|sp|A5FV22|RBFA_ACICJ Ribosome-binding factor A >gi|146400927|gb|ABQ29454.1| ribosome-binding factor A [Acidiphilium cryptum JF-5] (140 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/76 (30%), Positives = 37/76 (48%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V +S D   A V++S    T ID+ L  +   + F R  +   L ++  P + F  D ++D+   IN LL +
  S:    52 TVAEVRMSPDLKHATVFVSRLGATDIDRYLPALKRIAPFLRGEIGHGLRMKFVPDLHFQPDHALDEATRINELLHR 127
>gi|149178850|ref|ZP_01857430.1| probable ribosome-binding factor A [Planctomyces maris DSM 8797] >gi|148842325|gb|EDL56708.1| probable ribosome-binding factor A [Planctomyces maris DSM 8797] (139 aa)
Score = 88, Expect = 1.4e-01, Identities = 30/108 (27%), Positives = 55/108 (50%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESI-DKIDEINSLLE 111
           M++ ++E+    I + +S  I   + D  I+  TV +V ++ D   AK+YIS   D+      +  +  A GF ++ +A  +  +  P I F+ D ++ D +D I  L E
  S:     1 MTSRRLEKIAQAILETVSTTILLHLRDPRIRNVTVLHVDVAPDVQSAKIYISIMGDEKEKALCMHGLQSAKGFLQSKIADRIQTKYTPVIKFVLDTAVKDSLDTIRILDE 110
>gi|28380146|sp|Q9X765|RBFA_LACLC Ribosome-binding factor A >gi|4583984|emb|CAB40558.1| ribosome binding factor A [Lactococcus lactis] (113 aa)
Score = 88, Expect = 1.4e-01, Identities = 32/102 (31%), Positives = 52/102 (50%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID---KIDEI 106
           ++ + +R    I+  I+  +   V D  ++   +  V L+ D S A VY S       D  K    +  A+G F++ LAK + + K P + F  DES++   KIDEI
  S:     3 NSFRSDRVAVEIQREINDILRNKVRDPRVQDVNITDVQLTGDLSQATVYYSLLSNLASDNEKAATALKKATGLFKSELAKRMTIFKIPDLTFAKDESVEYGSKIDEI 109
>gi|88797624|ref|ZP_01113213.1| ribosome-binding factor A [Reinekea sp. MED297] >gi|88779796|gb|EAR10982.1| ribosome-binding factor A [Reinekea sp. MED297] (137 aa)
Score = 88, Expect = 1.4e-01, Identities = 35/102 (34%), Positives = 55/102 (53%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-------------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + I KDL S  I   V D  +   T++ V +S D S A VY +C              ++   +K+L   N A+GF RT LA+ L LR  P + F  D  I+    ++ L+++ +
  S:    13 DQIQKDL-SVIIQREVKDPRVGMVTINDVKVSSDLSYADVYFTCMAFGPQSEAEAQEQERKEQEKLL---NRAAGFMRTQLAQGLKLRVIPQLRFHYDVVIETGARVSQLIDEAR 123
>gi|148380372|ref|YP_001254913.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 3502] >gi|153933206|ref|YP_001384592.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 19397] >gi|153935306|ref|YP_001388108.1| ribosome-binding factor A [Clostridium botulinum A str. Hall] >gi|166218431|sp|A7FVZ2|RBFA_CLOB1 Ribosome-binding factor A >gi|166218432|sp|A5I4J2|RBFA_CLOBH Ribosome-binding factor A >gi|148289856|emb|CAL83964.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 3502] >gi|152929250|gb|ABS34750.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 19397] >gi|152931220|gb|ABS36719.1| ribosome-binding factor A [Clostridium botulinum A str. Hall] (120 aa)
Score = 88, Expect = 1.4e-01, Identities = 31/111 (27%), Positives = 57/111 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  +  R    +K  +S+ I   + D  L    +V  V ++KD   AKVY+S + ++   ++ L+ +  + GF R  + + + LR  P ++   D SI++   I+ LL  IK
  S:     1 MAKYRAGRINEEVKKEVSNIIHNDIKDPRLSAMVSVTDVNVTKDLKYAKVYVSIFGNEKAKEESLEALKSSVGFIRKEVGRRVKLRNTPEVIIEVDNSIERGMHIDELLHSIK 113
>gi|71901437|ref|ZP_00683527.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1] >gi|71728808|gb|EAO30949.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1] (125 aa)
Score = 88, Expect = 1.4e-01, Identities = 25/106 (23%), Positives = 51/106 (48%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + ER    I+  +   +   V D  +   +V  V +++D + AKV+++        + +  +   +   R  LA+ + LR  P + F  D+S+D+ + IN+LL  +
  S:     8 RTERVSVQIRRDLGAFVQAAVRDHGLPSMSVSDVEVTRDMAHAKVFVTALQAERSFEAVAGLKALARELRMQLAQTMRLRFVPELHFHYDDSLDRGERINTLLRDL 113
>gi|67639117|ref|ZP_00438018.1| COG0858: Ribosome-binding factor A [Burkholderia mallei GB8 horse 4] (111 aa)
Score = 88, Expect = 1.4e-01, Identities = 30/100 (30%), Positives = 51/100 (51%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + I +DL S  I   V D  I   T+  V L+ D + AKVY +    T  D   + +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:     5 DQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGTPADT-QEALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 102
>gi|167836820|ref|ZP_02463703.1| ribosome-binding factor A [Burkholderia thailandensis MSMB43] (138 aa)
Score = 88, Expect = 1.4e-01, Identities = 30/107 (28%), Positives = 53/107 (49%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +       D   + +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:    25 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGNPADT-QEALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 129
>gi|170754753|ref|YP_001781960.1| ribosome-binding factor A [Clostridium botulinum B1 str. Okra] >gi|169119965|gb|ACA43801.1| ribosome-binding factor A [Clostridium botulinum B1 str. Okra] (120 aa)
Score = 88, Expect = 1.5e-01, Identities = 31/111 (27%), Positives = 57/111 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  +  R    +K  +S+ I   + D  L    +V  V ++KD   AKVY+S + ++   ++ L+ +  + GF R  + + + LR  P ++   D SI++   I+ LL  IK
  S:     1 MAKYRAGRINEEVKKEVSNIIHNDIKDPRLSAMVSVTDVDVTKDLKYAKVYVSIFGNEKAKEESLQALKSSVGFIRKEIGRRVKLRNTPEVIIEVDNSIERGMHIDELLHSIK 113
>gi|157412469|ref|YP_001483335.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9215] >gi|166918677|sp|A8G2B8|RBFA_PROM2 Ribosome-binding factor A >gi|157387044|gb|ABV49749.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9215] (130 aa)
Score = 88, Expect = 1.5e-01, Identities = 31/112 (27%), Positives = 58/112 (51%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +N ++ +  S++K  I+  +   +  DLI      +  + LS D    K+YI+   +  + K I+  +N A    R  L K + +R+ P I+F +D  +DK   +  LL+++K K
  S:     3 NNYRLAKVSSLLKKEITLILQNELEIDLISDHFVNISKIDLSGDLQHCKIYITSTAQEKVKKEIVSNLNTAKSSIRHSLGKRIEMRRVPEIIFKDDVVLDKGLSVLKLLDELKNK 117
>gi|53715758|ref|YP_101750.1| ribosome-binding factor A [Bacteroides fragilis YCH46] >gi|60683689|ref|YP_213833.1| putative ribosome-binding factor A [Bacteroides fragilis NCTC 9343] >gi|52218623|dbj|BAD51216.1| ribosome-binding factor A [Bacteroides fragilis YCH46] >gi|60495123|emb|CAH09944.1| putative ribosome-binding factor A [Bacteroides fragilis NCTC 9343] (110 aa)
Score = 88, Expect = 1.5e-01, Identities = 26/75 (34%), Positives = 44/75 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V +S D SIA+VY+S +     ++++K IN      R  L   +   LR  P + F  D+S+D I++I++LL+
  S:    34 SVSAVRISPDMSIARVYLSIFPSEKSEEMVKNINNNMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYIEKIDALLK 110
>gi|167766531|ref|ZP_02438584.1| hypothetical protein CLOSS21_01037 [Clostridium sp. SS2/1] >gi|167711654|gb|EDS22233.1| hypothetical protein CLOSS21_01037 [Clostridium sp. SS2/1] (123 aa)
Score = 88, Expect = 1.6e-01, Identities = 34/103 (33%), Positives = 56/103 (54%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDEIN 107
           +++K  R    ++  +S  I+  + D  I   T V    ++ D    K YIS   +    ++ +K +N A G+ R  LA ++NLR  P I F+ D+SI+       KIDE+N
  S:     4 NSIKNTRINGEVQRELSRIISREIKDPRIAPMTSVVDAVVTSDLKQCKAYISVLGNDEEKEETMKGLNSAVGYIRRELAHSINLRNTPEITFILDDSIEYGVNMSKKIDELN 115
>gi|160891600|ref|ZP_02072603.1| hypothetical protein BACUNI_04053 [Bacteroides uniformis ATCC 8492] >gi|156859007|gb|EDO52438.1| hypothetical protein BACUNI_04053 [Bacteroides uniformis ATCC 8492] (113 aa)
Score = 88, Expect = 1.6e-01, Identities = 25/75 (33%), Positives = 42/75 (56%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V +S D S+A+ Y+S +     ++I+K ING     R  L   +   LR  P + F  D+S+D ++ I+ LL+
  S:    37 SVSAVRISPDMSVARAYLSIFPSEKSEEIVKNINGNMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYLERIDELLK 113
>gi|56551449|ref|YP_162288.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis ZM4] >gi|61214722|sp|Q5NQ28|RBFA_ZYMMO Ribosome-binding factor A >gi|56543023|gb|AAV89177.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis ZM4] (141 aa)
Score = 88, Expect = 1.6e-01, Identities = 20/74 (27%), Positives = 39/74 (52%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           ++  V ++ D  IA V++        D ++  ++  + F +  +AK + L+  P + FL DES ++   I+SLL
  S:    45 SISEVRMTPDLRIATVFVKSLGGASDDTVIGILSKNASFLQAAIAKKIRLKYVPKLRFLADESFEQGSRIDSLL 118
>gi|15677238|ref|NP_274391.1| ribosome-binding factor A [Neisseria meningitidis MC58] >gi|121635079|ref|YP_975324.1| ribosome-binding factor A [Neisseria meningitidis FAM18] >gi|166219381|sp|A1KUJ5|RBFA_NEIMF Ribosome-binding factor A >gi|20978660|sp|Q9JYY2|RBFA_NEIMB Ribosome-binding factor A >gi|7226619|gb|AAF41747.1| ribosome-binding factor A [Neisseria meningitidis MC58] >gi|120866785|emb|CAM10538.1| ribosomal-binding factor A [Neisseria meningitidis FAM18] (123 aa)
Score = 88, Expect = 1.6e-01, Identities = 27/104 (25%), Positives = 57/104 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           E I+++L +  + T + D      TV+ V +++D S A V+ +  ++   +   + +  A G  R+ LAK + L K P + F  DES+++   +++L++Q+  +
  S:    16 EQIMREL-AELVRTGLKDPRAGFITVNEVEVTRDYSHATVFYTILNQDAREITEEVLEHARGHLRSELAKRIKLFKTPELHFKYDESLERGLNLSALIDQVAAE 118
>gi|187735456|ref|YP_001877568.1| ribosome-binding factor A [Akkermansia muciniphila ATCC BAA-835] >gi|187425508|gb|ACD04787.1| ribosome-binding factor A [Akkermansia muciniphila ATCC BAA-835] (125 aa)
Score = 88, Expect = 1.6e-01, Identities = 22/77 (28%), Positives = 41/77 (53%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           TV  V ++ D    KV++    K    ++L+K+N   G  ++ +A+ + LR  P + F  D+S  +  ++ +LLE I
  S:    32 TVIEVEVTDDLKEGKVWVGVVGKMAPSQVLEKLNSRHGLIQSAVARRVVLRNTPRLTFRLDDSAQRGVDLVNLLEDI 108
>gi|89898350|ref|YP_515460.1| ribosome-binding factor A [Chlamydophila felis Fe/C-56] >gi|123483300|sp|Q254H3|RBFA_CHLFF Ribosome-binding factor A >gi|89331722|dbj|BAE81315.1| ribosome binding factor A [Chlamydophila felis Fe/C-56] (120 aa)
Score = 88, Expect = 1.6e-01, Identities = 33/109 (30%), Positives = 57/109 (52%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLI--KQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           N +I++  S+I++ I++ I   V    I  +  TV  V LSKD   A+VY+S    +    + LK +  ++GF     +K + L+  P I F  ++     D I +LL +I+
  S:     4 NRRIQKVNSLIREAIANVILKDVKHPKISNRWITVTRVCLSKDLHTARVYVSIMPHENTSAETLKALKASAGFIAYRASKGVFLKYFPEISFYLEDIFSPQDHIENLLWKIR 115
>gi|83654922|gb|ABC38985.1| ribosome-binding factor A [Burkholderia thailandensis E264] (138 aa)
Score = 88, Expect = 1.6e-01, Identities = 30/107 (28%), Positives = 53/107 (49%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +       D   + +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:    25 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGNPADT-QEALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 129
>gi|88711683|ref|ZP_01105771.1| putative ribosome-binding factor A [Flavobacteriales bacterium HTCC2170] >gi|88710624|gb|EAR02856.1| putative ribosome-binding factor A [Flavobacteriales bacterium HTCC2170] (130 aa)
Score = 88, Expect = 1.7e-01, Identities = 26/75 (34%), Positives = 43/75 (57%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  VT++ D SIAKVYIS +      ++L+ I       +  LA+     LR+ P ++F  D+S+D I+ I + L+
  S:    36 SVSKVTVTTDLSIAKVYISIFPNKDSKELLEGIQSNQPLIKHELAQRTKHQLRRVPELLFFLDDSLDYIENIENSLK 112
>gi|170017450|ref|YP_001728369.1| ribosome-binding factor A [Leuconostoc citreum KM20] >gi|169804307|gb|ACA82925.1| Ribosome-binding factor A [Leuconostoc citreum KM20] (117 aa)
Score = 88, Expect = 1.7e-01, Identities = 26/86 (30%), Positives = 40/86 (46%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + D  ++  TV  V LS D  IA +Y S       D  K    +  ASG  R  L   L + K P + F+ D+S+   + I  L+ ++
  S:    26 INDPRVQDVTVTSVELSGDLQIATIYYSILSDLASDGQKAQAGLEAASGLIRKELGARLTVYKTPELKFVRDQSVQYGNHIEDLIRKL 113
>gi|121609700|ref|YP_997507.1| ribosome-binding factor A [Verminephrobacter eiseniae EF01-2] >gi|166199573|sp|A1WLI2|RBFA_VEREI Ribosome-binding factor A >gi|121554340|gb|ABM58489.1| ribosome-binding factor A [Verminephrobacter eiseniae EF01-2] (120 aa)
Score = 88, Expect = 1.7e-01, Identities = 27/97 (27%), Positives = 50/97 (51%)
  Q:    16 IKDLISHAITTLVY---DDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + D I   +T L+    D  +   T+  V +S D + AKV+ S    T  ++    ++ A+GF R  L K L +   P + F+ D S ++  ++N+L+ +
  S:    13 VADQIQRDLTQLLARLKDPRLGLVTLQGVEISPDYAHAKVFFSLLTGTP-EQTQAALDQAAGFLRNGLFKRLQIHTVPTLHFVFDRSCERAADMNALIAK 111
>gi|170758382|ref|YP_001787728.1| ribosome-binding factor A [Clostridium botulinum A3 str. Loch Maree] >gi|169405371|gb|ACA53782.1| ribosome-binding factor A [Clostridium botulinum A3 str. Loch Maree] (120 aa)
Score = 87, Expect = 1.9e-01, Identities = 27/99 (27%), Positives = 56/99 (56%)
  Q:    16 IKDLISHAITTLVYDD-----LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           I + +   +++++++D     L    +V  V ++KD   AKVY+S + ++   ++ L+ +  + GF R  + + + LR  P ++   D SI++   I+ LL  IK
  S:     9 INEEVKKEVSSIIHNDIKDPRLSAMVSVTDVDVTKDLKYAKVYVSIFGNEKAKEESLQALKSSVGFIRKEIGRRVKLRNTPEVIIEVDNSIERGMHIDELLHSIK 113
>gi|126652566|ref|ZP_01724731.1| ribosome-binding factor A [Bacillus sp. B14905] >gi|126590694|gb|EAZ84810.1| ribosome-binding factor A [Bacillus sp. B14905] (113 aa)
Score = 87, Expect = 1.9e-01, Identities = 30/106 (28%), Positives = 55/106 (51%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYI-SCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           SN   E+ +  + D++   I     D  +   TV  V ++ D   A +YI S  ++   ++ +K +  ASGF R+ +   + LR+ P ++F  D SI+  + I++LL
  S:     5 SNRVAEQMKKELGDILGRKIK----DPRVGFVTVTGVEVTGDLQQATIYITSLGNEREREETIKALVKASGFIRSEIGSRIRLRRTPELIFEFDSSIEYGNRIDTLL 107
>gi|15618238|ref|NP_224523.1| ribosome-binding factor A [Chlamydophila pneumoniae CWL029] >gi|15835853|ref|NP_300377.1| ribosome-binding factor A [Chlamydophila pneumoniae J138] >gi|33241663|ref|NP_876604.1| ribosome-binding factor A [Chlamydophila pneumoniae TW-183] >gi|6685851|sp|Q9Z8M0|RBFA_CHLPN Ribosome-binding factor A >gi|4376595|gb|AAD18467.1| Ribosome Binding Factor A [Chlamydophila pneumoniae CWL029] >gi|8978692|dbj|BAA98528.1| ribosome binding factor A [Chlamydophila pneumoniae J138] >gi|33236172|gb|AAP98261.1| ribosome-binding factor A [Chlamydophila pneumoniae TW-183] (120 aa)
Score = 87, Expect = 1.9e-01, Identities = 34/111 (30%), Positives = 59/111 (53%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           N +I+R  +++++ I+  I   V    I     TV  V+LSKD   A+VY+S    +   ++ L+ +  ++GF     +KN+ L+  P + F  D+     D I +LL QI+ K
  S:     4 NRRIKRVNALLQEAIAKVILKDVKHPKISNLWITVTRVSLSKDLHSARVYVSVMPHENTKEEALEALKVSAGFIAHRASKNVVLKYFPELHFYLDDIFSPQDYIENLLWQIQEK 117
>gi|88804586|ref|ZP_01120106.1| ribosome-binding factor A [Robiginitalea biformata HTCC2501] >gi|88785465|gb|EAR16634.1| ribosome-binding factor A [Robiginitalea biformata HTCC2501] (135 aa)
Score = 87, Expect = 1.9e-01, Identities = 25/76 (32%), Positives = 41/76 (53%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +V  V ++ D SIAKVY+S +       ++K I      FR  LA+     LR+ P + F  D+S++ I+ I   L++
  S:    41 SVTKVHVTSDLSIAKVYVSIFPVKEATGLIKGIQAQKAQFRHELARRTRNQLRRVPELQFYLDDSLEYIENIEKSLKE 118
>gi|150021374|ref|YP_001306728.1| ribosome-binding factor A [Thermosipho melanesiensis BI429] >gi|166199571|sp|A6LN42|RBFA_THEM4 Ribosome-binding factor A >gi|149793895|gb|ABR31343.1| ribosome-binding factor A [Thermosipho melanesiensis BI429] (125 aa)
Score = 87, Expect = 2.0e-01, Identities = 32/104 (30%), Positives = 54/104 (51%)
  Q:    10 ERYESIIKDLISHAITTLVY---DDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ E+ I+ LIS  +  +     D L     +  V +SKDK  A V++S   D     + ++ +    GFFR  +A+NL +   P + F  D  I++   IN LL++I
  S:     8 KKIENKIRGLISEGLQKIKVPEIDALKSYIVISRVLVSKDKRFADVFVSYIGDADSRKRAVELLEKYKGFFRKYIAQNLRIYTTPELRFKEDIGIEESIRINKLLDEI 115
>gi|71083095|ref|YP_265814.1| ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1062] >gi|123647144|sp|Q4FNM8|RBFA_PELUB Ribosome-binding factor A >gi|71062208|gb|AAZ21211.1| Ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1062] (122 aa)
Score = 87, Expect = 2.0e-01, Identities = 23/76 (30%), Positives = 42/76 (55%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V +S+D  IAK Y+        + ++KK+   S   R  L+K + ++  P I+F  D+S +  ++I +L++Q
  S:    44 TVTEVKMSQDLKIAKAYVLPLGGKDSELVIKKLKECSFLIRKALSKKIIMKYLPKILFAKDDSFEYAEKIENLIKQ 119
>gi|148251682|ref|YP_001236267.1| ribosome-binding factor A [Bradyrhizobium sp. BTAi1] >gi|166218423|sp|A5E867|RBFA_BRASB Ribosome-binding factor A >gi|146403855|gb|ABQ32361.1| ribosome-binding factor A [Bradyrhizobium sp. BTAi1] (138 aa)
Score = 87, Expect = 2.0e-01, Identities = 24/74 (32%), Positives = 35/74 (47%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           TV  V +S D  +A +YI        + +L  +     F R  +A  +NL+ AP I F  DE  D+ + I  LL
  S:    49 TVPEVRMSPDLKLATIYIMPLGGRDTEIVLAALERNKKFLRGEIAHRVNLKFAPDIRFRADERFDEAERIEKLL 122
>gi|114706047|ref|ZP_01438950.1| ribosome-binding factor A [Fulvimarina pelagi HTCC2506] >gi|114538893|gb|EAU42014.1| ribosome-binding factor A [Fulvimarina pelagi HTCC2506] (140 aa)
Score = 87, Expect = 2.1e-01, Identities = 27/96 (28%), Positives = 52/96 (54%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQA--TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL-NLRKAPAIVFLNDESIDKIDEINSLLE 111
           + + + HA+T +     + D L+++A  +V  V +S D  IA  Y++   +  +   +K +N  + F R  +  +L  ++  P I F  D S D    I++LL+
  S:    17 VGEKVRHALTEVMQRGEIRDPLLERAVVSVSEVRMSPDLKIATAYVTVLGQEDMQPFIKALNDHAKFIRGRVTPSLKQMKYMPEIRFREDTSFDNFARIDALLK 120
>gi|15794479|ref|NP_284301.1| ribosome-binding factor A [Neisseria meningitidis Z2491] >gi|20978659|sp|Q9JTX7|RBFA_NEIMA Ribosome-binding factor A >gi|121052398|emb|CAM08730.1| ribosomal-binding factor A [Neisseria meningitidis Z2491] (123 aa)
Score = 87, Expect = 2.1e-01, Identities = 27/104 (25%), Positives = 57/104 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           E I+++L +  + T + D      TV+ V +++D S A V+ +  ++   +   + +  A G  R+ LAK + L K P + F  DES+++   +++L++Q+  +
  S:    16 EQIMREL-AELVRTGLKDPRAGFITVNEVEVTRDYSHATVFYTVLNQDAREITEEVLEHARGHLRSELAKRIKLFKIPELHFKYDESLERGLNLSALIDQVAAE 118
>gi|92115665|ref|YP_575394.1| ribosome-binding factor A [Nitrobacter hamburgensis X14] >gi|122418983|sp|Q1QS63|RBFA_NITHX Ribosome-binding factor A >gi|91798559|gb|ABE60934.1| ribosome-binding factor A [Nitrobacter hamburgensis X14] (137 aa)
Score = 87, Expect = 2.1e-01, Identities = 27/95 (28%), Positives = 49/95 (51%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + + + HAI  +     V+D +++    TV  V +S D  +A +Y+          ++  ++    F R  +A+ +NL+ AP I F  DE  D+ + I  LL
  S:    20 VAETVRHAIADILAQGHVHDPVLEGHLITVPEVRMSADLKLATIYVMPLGGRDTTDVIDALDHNRKFLRGEIARRVNLKFAPDIRFRADERFDEAERIEKLL 121
>gi|172057845|ref|YP_001814305.1| ribosome-binding factor A [Exiguobacterium sibiricum 255-15] >gi|171990366|gb|ACB61288.1| ribosome-binding factor A [Exiguobacterium sibiricum 255-15] (113 aa)
Score = 87, Expect = 2.1e-01, Identities = 27/108 (25%), Positives = 52/108 (48%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +V+  R    ++  I+  +   V D  +K  TV  V ++ D   A ++ S   D+T+ ++    +  + GF R  +   + LRK P ++F  D S++    I+ LL  +
  S:     2 SVRSNRVAEQVRKEITQMLIKDVNDPRVKAVTVTGVEVTGDLQQATIFYSVLGDETVREEARVGLEKSKGFMRKEIGSRIRLRKTPELLFEIDTSVEYGSRIDELLRNL 110
>gi|153954057|ref|YP_001394822.1| ribosome-binding factor A [Clostridium kluyveri DSM 555] >gi|189039534|sp|A5N843|RBFA_CLOK5 Ribosome-binding factor A >gi|146346938|gb|EDK33474.1| Ribosome-binding factor A [Clostridium kluyveri DSM 555] (121 aa)
Score = 87, Expect = 2.2e-01, Identities = 33/111 (29%), Positives = 54/111 (48%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+N +  R    +K  IS+ I   + D  L    +V  V ++KD+  AKV++S Y +    D   + +  +  F R  +   + LR  P I+   D +I+    IN LL +IK
  S:     1 MTNYRSGRINEEMKREISNIIRNDMKDPRLSAMVSVTKVDVTKDQKYAKVFVSIYGEDKSKDDTFQVLKSSESFIRREVGHRVKLRNTPEIIIEMDNTIEYGMHINELLHKIK 113
>gi|120556254|ref|YP_960605.1| ribosome-binding factor A [Marinobacter aquaeolei VT8] >gi|166218447|sp|A1U5Z9|RBFA_MARAV Ribosome-binding factor A >gi|120326103|gb|ABM20418.1| ribosome-binding factor A [Marinobacter aquaeolei VT8] (143 aa)
Score = 87, Expect = 2.2e-01, Identities = 28/108 (25%), Positives = 54/108 (50%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKG 115
           +++R    ++  ++  I   V D  +   TV+ V +S+D   A +YIS         D   +   L  +N ASGF R  + + + LR  P + F  D+ + +  +++ L+ +  G
  S:     7 RVDRIGDQMQRELAQLIQREVKDPRVGMVTVNDVKVSRDLGYADIYISLLSTEELTEDSPEVQDSLTVLNKASGFLRGQVGRAMKLRVVPHLRFHFDKLLGQSRKMDRLIREAVG 121
>gi|71276361|ref|ZP_00652638.1| Ribosome-binding factor A [Xylella fastidiosa Dixon] >gi|71898656|ref|ZP_00680826.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1] >gi|170729434|ref|YP_001774867.1| ribosomal-binding factor A [Xylella fastidiosa M12] >gi|71162823|gb|EAO12548.1| Ribosome-binding factor A [Xylella fastidiosa Dixon] >gi|71731603|gb|EAO33664.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1] >gi|167964227|gb|ACA11237.1| ribosomal-binding factor A [Xylella fastidiosa M12] (125 aa)
Score = 87, Expect = 2.2e-01, Identities = 25/106 (23%), Positives = 51/106 (48%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + ER    I+  +   +   V D  +   +V  V +++D + AKV+++        + +  +   +   R  LA+ + LR  P + F  D+S+D+ + IN+LL  +
  S:     8 RTERISVQIRRDLGAFVQAAVRDHGLPSMSVSDVEVTRDMAHAKVFVTVLQAERSFEAVAGLKALARELRMQLAQTMRLRFVPELHFHYDDSLDRGERINTLLRDL 113
>gi|161870244|ref|YP_001599414.1| ribosome-binding factor A [Neisseria meningitidis 053442] >gi|189039549|sp|A9M021|RBFA_NEIM0 Ribosome-binding factor A >gi|161595797|gb|ABX73457.1| ribosomal-binding factor A [Neisseria meningitidis 053442] (123 aa)
Score = 86, Expect = 2.4e-01, Identities = 27/104 (25%), Positives = 57/104 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           E I+++L +  + T + D      TV+ V +++D S A V+ +  ++   +   + +  A G  R+ LAK + L K P + F  DES+++   +++L++Q+  +
  S:    16 EQIMREL-AELVRTGLKDPRAGFITVNEVEVTRDYSHATVFYTILNQDAREITEEVLEHARGHLRSELAKRIKLFKIPELHFKYDESLERGLNLSALIDQVAAE 118
>gi|163791147|ref|ZP_02185566.1| ribosome-binding factor A [Carnobacterium sp. AT7] >gi|159873619|gb|EDP67704.1| ribosome-binding factor A [Carnobacterium sp. AT7] (115 aa)
Score = 86, Expect = 2.4e-01, Identities = 31/110 (28%), Positives = 52/110 (47%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N +I R    I+  ++  +   V D  +    +  V ++ D   A V+ S       +  K    ++ ASG  R+ L K L+L K P I F  DES++  + I+ LL  +
  S:     1 MANHRIGRVSQEIQREVNDILKKRVKDPRVADVNITDVRVTGDLQQATVFYSILSDKASEREKTQLGLDKASGLVRSELGKRLSLYKTPEISFERDESVEYGNHIDELLRNL 112
>gi|83945012|ref|ZP_00957378.1| ribosome-binding factor A [Oceanicaulis alexandrii HTCC2633] >gi|83851794|gb|EAP89649.1| ribosome-binding factor A [Oceanicaulis alexandrii HTCC2633] (140 aa)
Score = 86, Expect = 2.5e-01, Identities = 25/95 (26%), Positives = 51/95 (53%)
  Q:    18 DLISHAITTL-----VYDDLIKQA--TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +L+  A++ +     V+D  +  A  T+    +S D   A VY+        + +   +N A+GF +  L + + L+  P + F  D+ ID + E+++LL++
  S:    26 ELVRRAVSDIIREGRVHDPHVNTAAVTITEARVSPDLRHATVYVDLLGGGDREAVATALNHAAGFIQRELGRQIELKFTPKLRFAVDDRIDDVREVDALLDR 127
>gi|78485468|ref|YP_391393.1| ribosome-binding factor A [Thiomicrospira crunogena XCL-2] >gi|123769093|sp|Q31GK4|RBFA_THICR Ribosome-binding factor A >gi|78363754|gb|ABB41719.1| ribosome-binding factor A [Thiomicrospira crunogena XCL-2] (121 aa)
Score = 86, Expect = 2.5e-01, Identities = 25/81 (30%), Positives = 40/81 (49%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK----ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           D  +++  +    +SKD SIA VY +       D+     +K +  A GFFR+ + K +NLR  P + F  D   +    I  L+
  S:    29 DPRLEKVNITECKISKDLSIATVYFTIIGVNEKDQPAQDAIKALEKAKGFFRSEIGKRMNLRITPEVRFFYDTVAENASHIEELI 113
>gi|118046943|ref|ZP_01515587.1| ribosome-binding factor A [Chloroflexus aggregans DSM 9485] >gi|117996525|gb|EAV10722.1| ribosome-binding factor A [Chloroflexus aggregans DSM 9485] (127 aa)
Score = 86, Expect = 2.6e-01, Identities = 31/111 (27%), Positives = 58/111 (52%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY----DKTIIDKILKKINGASGFFRTILAKNL-NLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           M+  ++++    ++ ++   I T + D  +  A+V  V +S D   AKVYIS      ++      L++   A GF R  +A+ + ++R  P +  + D SID    IN ++ QI+
  S:     1 MAKQRLQQVADTMQRILGEVIQTELKDPRVGFASVTKVEVSADLQHAKVYISIMGTPEERATTMAALQR---ARGFLRKRVAEEMRHMRFIPELHLIEDTSIDYSLHINDVIRQIQ 113
>gi|118726349|ref|ZP_01574976.1| ribosome-binding factor A [Clostridium cellulolyticum H10] >gi|118664228|gb|EAV70863.1| ribosome-binding factor A [Clostridium cellulolyticum H10] (117 aa)
Score = 86, Expect = 2.6e-01, Identities = 34/107 (31%), Positives = 51/107 (47%)
  Q:     8 KIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDK-ILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +I R    +K  IS+ I   + D  L    ++   +++KD   AKVY+S +      K  +  +  A+GF R  L   + LR  P I F  D SI+    IN LL+  K
  S:     4 RIVRISEEVKKEISNIIQNDIKDPRLPSMVSIVSCSVTKDLRYAKVYVSVFGNDEQKKNAISALKSAAGFIRRELGHRVQLRYTPEIHFELDTSIEHGFHINKLLDDAK 112
>gi|161723141|ref|YP_443080.2| ribosome-binding factor A [Burkholderia thailandensis E264] >gi|167582085|ref|ZP_02374959.1| ribosome-binding factor A [Burkholderia thailandensis TXDOH] >gi|167620246|ref|ZP_02388877.1| ribosome-binding factor A [Burkholderia thailandensis Bt4] >gi|172046091|sp|Q2SVG9|RBFA_BURTA Ribosome-binding factor A (122 aa)
Score = 86, Expect = 2.8e-01, Identities = 30/107 (28%), Positives = 53/107 (49%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +       D   + +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGNPADT-QEALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 113
>gi|16752720|ref|NP_444987.1| ribosome-binding factor A [Chlamydophila pneumoniae AR39] >gi|8163433|gb|AAF73669.1| ribosome-binding factor A [Chlamydophila pneumoniae AR39] (141 aa)
Score = 86, Expect = 2.8e-01, Identities = 34/111 (30%), Positives = 59/111 (53%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQ--ATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           N +I+R  +++++ I+  I   V    I     TV  V+LSKD   A+VY+S    +   ++ L+ +  ++GF     +KN+ L+  P + F  D+     D I +LL QI+ K
  S:    25 NRRIKRVNALLQEAIAKVILKDVKHPKISNLWITVTRVSLSKDLHSARVYVSVMPHENTKEEALEALKVSAGFIAHRASKNVVLKYFPELHFYLDDIFSPQDYIENLLWQIQEK 138
>gi|125973505|ref|YP_001037415.1| ribosome-binding factor A [Clostridium thermocellum ATCC 27405] >gi|196253811|ref|ZP_03152418.1| ribosome-binding factor A [Clostridium thermocellum DSM 4150] >gi|182676539|sp|A3DE43|RBFA_CLOTH Ribosome-binding factor A >gi|125713730|gb|ABN52222.1| ribosome-binding factor A [Clostridium thermocellum ATCC 27405] >gi|196196759|gb|EDX91649.1| ribosome-binding factor A [Clostridium thermocellum DSM 4150] (123 aa)
Score = 86, Expect = 2.8e-01, Identities = 34/109 (31%), Positives = 53/109 (48%)
  Q:     8 KIERYESIIKDLISHAITTLVYDD-LIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +IER    IK  IS  I   + D  L K  ++  V ++KD   AKVY+S    +      L+ +  A+GF R  + + + LR  P I F  D SI++   I  L+ +   +
  S:     3 RIERISEEIKREISDIIQNELKDPRLSKLISITEVNVTKDLRYAKVYVSVMGSEEEKANSLEGLKSAAGFIRREIGRRVQLRYTPEIHFELDNSIERGAYITKLINETSAQ 113
>gi|47458988|ref|YP_015850.1| ribosome-binding factor a [Mycoplasma mobile 163K] >gi|47458316|gb|AAT27639.1| ribosome-binding factor a [Mycoplasma mobile 163K] (121 aa)
Score = 85, Expect = 3.0e-01, Identities = 27/74 (36%), Positives = 44/74 (59%)
  Q:    41 VTLSKDKSIAKVYISC--YDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           + LSKD S   +Y+S   Y+K    K L+  N A GF R+ LA+N++ R  P I F  DE+      I+++L++++
  S:    45 LQLSKDSSHLVIYLSFDHYEK----KALEHFNNAKGFVRSELARNISARYTPDITFKLDEASKNGRNIDAILKKLE 116
>gi|81177040|ref|ZP_00875945.1| Ribosome-binding factor A [Streptococcus suis 89/1591] >gi|80976258|gb|EAP39886.1| Ribosome-binding factor A [Streptococcus suis 89/1591] (117 aa)
Score = 85, Expect = 3.1e-01, Identities = 30/112 (26%), Positives = 55/112 (49%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ + +R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L + L L K P +VF  D+SI+  ++I+ +L  +  K
  S:     3 NHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMVGDLSMAKVYYTIMSNLASDNQKAQTGLEKATGTIKRELGRKLTLYKIPDLVFEKDQSIEYGNKIDQMLRALDQK 116
>gi|42519358|ref|NP_965288.1| ribosome-binding factor A [Lactobacillus johnsonii NCC 533] >gi|61215123|sp|Q74IS9|RBFA_LACJO Ribosome-binding factor A >gi|41583646|gb|AAS09254.1| ribosome-binding factor A [Lactobacillus johnsonii NCC 533] (123 aa)
Score = 85, Expect = 3.2e-01, Identities = 28/107 (26%), Positives = 51/107 (47%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +I R E  I   ++  +   + D  +   T+  V  + D S A VY S    D     ++ + ++ A G  R +L + L + K P ++F  D S+    +I+ L+ Q+K
  S:     4 RIGRVEGEILRELTKILRKDIRDPRLNDVTITAVECTNDLSYATVYYSMLTDDPAKEKEVAEGLDKAKGMMRHLLGQTLTVYKVPELIFKRDTSVAYGSKIDKLINQVK 112
>gi|148651974|ref|YP_001279067.1| ribosome-binding factor A [Psychrobacter sp. PRwf-1] >gi|172048446|sp|A5WBS6|RBFA_PSYWF Ribosome-binding factor A >gi|148571058|gb|ABQ93117.1| ribosome-binding factor A [Psychrobacter sp. PRwf-1] (140 aa)
Score = 85, Expect = 3.3e-01, Identities = 29/81 (35%), Positives = 43/81 (53%)
  Q:    18 DLISHAITTLVYDD-----LIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKI--------LKKINGASGFFRTILAKNLNLRKAPAIVFLNDE 98
           D I   +  L+ DD     L    T+  V +S D   A VY++  +  + D +        LK +N A+GF RT L+ +L  R  P + F  DE
  S:    10 DQIQRELAVLIRDDVNDPRLTGFVTISSVKVSSDLGYADVYVTIMEPELNDAMSKHSHEESLKVLNKAAGFLRTELSHSLKTRTTPRLRFHYDE 103
>gi|188159606|ref|ZP_02512657.2| Ribosome-binding factor A [Mycoplasma mycoides subsp. mycoides LC str. GM12] (117 aa)
Score = 85, Expect = 3.4e-01, Identities = 31/113 (27%), Positives = 61/113 (53%)
  Q:     4 MSNVKIE-RYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVY---ISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M+N+K + R ES++   ++  +   +  +++K  +V    LS D S  K++   I   +   I  I +++       R ILA  L+ R  P + F+ D S+D+ ++I+ +L++ K K
  S:     1 MANIKTQKRKESLLLRELNLILQREIKSEILKSVSVVETRLSADNSHVKIFYQFIPIPENLTIQSIEEELENKLKEIRMILASKLDWRTVPELTFVYDTSLDRANQIDKILKEDKNK 117
>gi|85373520|ref|YP_457582.1| ribosome-binding factor A [Erythrobacter litoralis HTCC2594] >gi|84786603|gb|ABC62785.1| ribosome-binding factor A [Erythrobacter litoralis HTCC2594] (112 aa)
Score = 85, Expect = 3.5e-01, Identities = 26/87 (29%), Positives = 43/87 (49%)
  Q:    28 VYDDLIKQA--TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           V+D+ +  A   V  V ++ D   A  Y+        D+I+  +   + + +  +AK L L+ AP ++F  DES D+ D I  LL   K
  S:    14 VHDETVSAANIAVTEVRMTPDLRNATAYVKPLLGKEEDEIVSALRQNTAYLQKEVAKRLGLKFAPKLMFRPDESFDEADRIEKLLRDPK 102
>gi|91762478|ref|ZP_01264443.1| Ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1002] >gi|91718280|gb|EAS84930.1| Ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1002] (122 aa)
Score = 85, Expect = 3.5e-01, Identities = 23/76 (30%), Positives = 42/76 (55%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V +S+D  IAK Y+        + ++KK+   S   R  L+K + ++  P I+F  D+S +  ++I +L++Q
  S:    44 TVTEVKMSQDLKIAKAYVLPLGGKDSELVIKKLKEYSFLIRKALSKKIIMKYLPKILFAKDDSFEYAEKIENLIKQ 119
>gi|157150185|ref|YP_001449863.1| ribosome-binding factor A [Streptococcus gordonii str. Challis substr. CH1] >gi|189039565|sp|A8AVQ3|RBFA_STRGC Ribosome-binding factor A >gi|157074979|gb|ABV09662.1| ribosome-binding factor A [Streptococcus gordonii str. Challis substr. CH1] (115 aa)
Score = 85, Expect = 3.9e-01, Identities = 28/109 (25%), Positives = 55/109 (50%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           ++ +++R    IK  ++  +   V D  ++  T+  V +  D S+AKVY +       D  K    +  A+G  +  L  NL + K P + F+ D+SI+  ++I+ +L  +
  S:     3 NHFRVDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSMAKVYYTIMSDLASDNQKAQLGLEKATGTIKRELGHNLKMYKIPDLTFVKDQSIEYGNKIDQMLRDL 113
>gi|152978794|ref|YP_001344423.1| ribosome-binding factor A [Actinobacillus succinogenes 130Z] >gi|171704291|sp|A6VNE1|RBFA_ACTSZ Ribosome-binding factor A >gi|150840517|gb|ABR74488.1| ribosome-binding factor A [Actinobacillus succinogenes 130Z] (129 aa)
Score = 85, Expect = 3.9e-01, Identities = 24/86 (27%), Positives = 49/86 (56%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY---DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           V D  I   TV  V +S+D + AK++++     D   I + +K +  A+ + R++L K + LR  P + F+ D+S+ +   +++L+  +
  S:    27 VKDPRIGMVTVSDVEVSRDLAYAKIFVTFLFDNDPEAIKQGMKGLEKAAPYIRSLLGKAMRLRIVPELRFVYDQSLVEGMRMSNLVSNV 115
>gi|196165544|ref|ZP_03126075.1| ribosome-binding factor A [Clostridium difficile QCD-23m63] (126 aa)
Score = 85, Expect = 3.9e-01, Identities = 32/109 (29%), Positives = 54/109 (49%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLI-KQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +  R    I+ ++S  +   V D  I    +V  V ++ D   A VY+S       +  L  +  A G+ R  + KN+ LR  P IVF  D+SI+K   ++SL++++  K
  S:     6 RTRRISEEIRKVVSTMLINGVKDPRITSMVSVTDVEVTNDLRYAYVYVSILGGDE-ESTLTGLKSAGGYIRREVGKNIKLRYIPEIVFKIDDSIEKGMYMDSLIKRVNEK 114
>gi|167746754|ref|ZP_02418881.1| hypothetical protein ANACAC_01466 [Anaerostipes caccae DSM 14662] >gi|167653714|gb|EDR97843.1| hypothetical protein ANACAC_01466 [Anaerostipes caccae DSM 14662] (116 aa)
Score = 84, Expect = 4.1e-01, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID-------KIDEIN 107
           +++K  R    ++  +S  I+  + D  I   T V    ++ D    K YIS   D+   +  L  +  A G+ R  LA ++NLR  P I F+ D+SI+       KIDE+N
  S:     4 NSIKNTRINGEVQRELSRIISREIKDPRIAPMTSVVDAVVTSDLKQCKAYISVLGDQKAKEDTLNGLRSAVGYIRRELAHSINLRNTPEITFILDDSIEYGVEMSKKIDELN 115
>gi|154506280|ref|ZP_02043018.1| hypothetical protein RUMGNA_03822 [Ruminococcus gnavus ATCC 29149] >gi|153793419|gb|EDN75839.1| hypothetical protein RUMGNA_03822 [Ruminococcus gnavus ATCC 29149] (123 aa)
Score = 84, Expect = 4.1e-01, Identities = 26/80 (32%), Positives = 43/80 (53%)
  Q:    37 TVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESID----KIDEINSLLEQIKGK 116
           +V  V ++ D    K YIS   DK   +  +  +  A G+ R  LA+ +N+R  P I F+ D+SI+       +IN L + +K +
  S:    37 SVVAVEVAPDLKTCKAYISVLGDKKAQEDTITGLQSAEGYIRRELARTINMRNTPEIRFIMDQSIEYGVNMTKKINDLTKDLKSE 121
>gi|69246866|ref|ZP_00604158.1| Ribosome-binding factor A [Enterococcus faecium DO] >gi|68195047|gb|EAN09510.1| Ribosome-binding factor A [Enterococcus faecium DO] (115 aa)
Score = 84, Expect = 4.1e-01, Identities = 31/110 (28%), Positives = 51/110 (46%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKK--INGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+N +  R    I   ++  +   V D  ++  T+  V ++ D   A +Y S       DK   +  +N ASG  R  L  NL++ K P + F  DES+   + I+ LL  +
  S:     1 MANYRDRRVGQEILKEVNDILRKKVRDPRVENVTITDVKVTGDLQQATIYYSILSDLASDKKTAQDGLNKASGLIRRELGHNLSIYKTPELFFELDESVVYGNHIDELLRDL 112
>gi|126698909|ref|YP_001087806.1| ribosome-binding factor A [Clostridium difficile 630] >gi|168714761|ref|ZP_02747038.1| ribosome-binding factor A [Clostridium difficile QCD-63q42] >gi|196127241|ref|ZP_03118990.1| ribosome-binding factor A [Clostridium difficile ATCC 43255] >gi|123174598|sp|Q18BH6|RBFA_CLOD6 Ribosome-binding factor A >gi|115250346|emb|CAJ68168.1| ribosome-binding factor A [Clostridium difficile 630] (126 aa)
Score = 84, Expect = 4.3e-01, Identities = 32/109 (29%), Positives = 54/109 (49%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLI-KQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +  R    I+ ++S  +   V D  I    +V  V ++ D   A VY+S       +  L  +  A G+ R  + KN+ LR  P IVF  D+SI+K   ++SL++++  K
  S:     6 RTRRIAEEIRKVVSTMLINGVKDPRITSMVSVTDVEVTNDLRYAYVYVSILGGDE-ESTLTGLKSAGGYIRREVGKNIKLRYIPEIVFKLDDSIEKGMYMDSLIKRVNEK 114
>gi|167562937|ref|ZP_02355853.1| ribosome-binding factor A [Burkholderia oklahomensis EO147] >gi|167570127|ref|ZP_02363001.1| ribosome-binding factor A [Burkholderia oklahomensis C6786] (122 aa)
Score = 84, Expect = 4.5e-01, Identities = 30/107 (28%), Positives = 52/107 (48%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +       D     +N A+G    +L K L++   P + F  D++I+K   ++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGNPADT-QDALNHAAGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 113
>gi|116629472|ref|YP_814644.1| ribosome-binding factor A [Lactobacillus gasseri ATCC 33323] >gi|122273590|sp|Q044B6|RBFA_LACGA Ribosome-binding factor A >gi|116095054|gb|ABJ60206.1| ribosome-binding factor A [Lactobacillus gasseri ATCC 33323] (123 aa)
Score = 84, Expect = 4.6e-01, Identities = 27/107 (25%), Positives = 52/107 (48%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +I R E  I   ++  +   + D  +   T+  V  + D S A +Y S    D     ++ + ++ A G  R +L + L + K P ++F  D S+    +I++L+ Q+K
  S:     4 RIGRVEGEILRELTKILRKDIRDPRLSDITITAVECTNDLSYATIYYSLLTEDPAKEKEVAEGLDKAKGMMRHLLGQTLTVYKVPELIFKRDTSVAYGSKIDNLINQVK 112
>gi|114571585|ref|YP_758265.1| ribosome-binding factor A [Maricaulis maris MCS10] >gi|122314885|sp|Q0AK66|RBFA_MARMM Ribosome-binding factor A >gi|114342047|gb|ABI67327.1| ribosome-binding factor A [Maricaulis maris MCS10] (141 aa)
Score = 84, Expect = 4.7e-01, Identities = 23/95 (24%), Positives = 46/95 (48%)
  Q:    18 DLISHAITTLVYDDLIKQA-------TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +L+ HA+  ++  +  +         +V  V  S D  +AKVY++   +    K+   +N  + F R  L + + ++  P + F  D S D    ++ LL +
  S:    21 ELVRHALVGIIAREEFRDPDLEGQMISVTEVRPSPDLRVAKVYVAPLGRGDSAKLAAGLNRCAAFLRGRLGREIEMKFTPELHFHADNSFDTASHVDDLLNR 122
>gi|89072576|ref|ZP_01159148.1| ribosome-binding factor A [Photobacterium sp. SKA34] >gi|89051680|gb|EAR57133.1| ribosome-binding factor A [Photobacterium sp. SKA34] (131 aa)
Score = 84, Expect = 4.8e-01, Identities = 21/85 (24%), Positives = 47/85 (55%)
  Q:    28 VYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + D  I   T+  V +S+D + AK+Y++ +   +   +  L  +   + + R++L K + LR  P + F+ D+S+ +   I++L+ +
  S:    27 IKDPAIAMTTISSVDVSRDMNYAKIYVTFFPIGEQTAEGSLAALREMAPYIRSLLGKEIRLRVTPELNFIFDQSLTEGMRISNLVSK 113
>gi|194563521|ref|YP_002098544.1| ribosome-binding factor A [Burkholderia dolosa AUO158] >gi|124895145|gb|EAY69025.1| ribosome-binding factor A [Burkholderia dolosa AUO158] (132 aa)
Score = 84, Expect = 4.8e-01, Identities = 31/107 (28%), Positives = 51/107 (47%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +             +N ASG    +L K L++   P + F  D +I+K  E++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTALTGDPAST-QDALNHASGHLHNLLFKRLHIHTVPTLHFHYDRTIEKAVEMSRLIKE 113
>gi|59801071|ref|YP_207783.1| ribosome-binding factor A [Neisseria gonorrhoeae FA 1090] >gi|75432521|sp|Q5F8W6|RBFA_NEIG1 Ribosome-binding factor A >gi|59717966|gb|AAW89371.1| putative ribosomal-binding factor A [Neisseria gonorrhoeae FA 1090] (123 aa)
Score = 84, Expect = 5.0e-01, Identities = 25/104 (24%), Positives = 57/104 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           E I+++L +  + T + D      T++ V +++D S A V+ +  ++   +   + +  A G  R+ L+K + L K P + F  DES+++   +++L++Q+  +
  S:    16 EQIMREL-AELVRTGLKDPRAGFITINEVEITRDYSHATVFYTVLNQDTREITEEVLEHARGHLRSELSKRIKLFKIPELHFKYDESLERGMSLSALIDQVAAE 118
>gi|194098831|ref|YP_002001894.1| ribosome-binding factor A [Neisseria gonorrhoeae NCCP11945] >gi|193934121|gb|ACF29945.1| ribosome-binding factor A [Neisseria gonorrhoeae NCCP11945] (123 aa)
Score = 84, Expect = 5.1e-01, Identities = 25/104 (24%), Positives = 57/104 (54%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           E I+++L +  + T + D      T++ V +++D S A V+ +  ++   +   + +  A G  R+ L+K + L K P + F  DES+++   +++L++Q+  +
  S:    16 EQIMREL-AELVRTGLKDPRAGFITINEVEVTRDYSHATVFYTVLNQDTREITEEVLEHARGHLRSELSKRIKLFKIPELHFKYDESLERGMSLSALIDQVAAE 118
>gi|86144147|ref|ZP_01062484.1| ribosome-binding factor A [Flavobacterium sp. MED217] >gi|85829409|gb|EAQ47874.1| ribosome-binding factor A [Leeuwenhoekiella blandensis MED217] (130 aa)
Score = 83, Expect = 5.2e-01, Identities = 29/94 (30%), Positives = 50/94 (53%)
  Q:    18 DLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           D+I  A+      ++I   +V  V ++ D S AKVYIS +      +ILK+++    F +  +A      LR+ P + F  D+S++ ID I+  L+
  S:    19 DVIQKALMEAGVKNII--VSVSKVNVTTDLSQAKVYISVFPHDKASEILKEVSAVKPFIKHEIANRTRHQLRRMPELQFYIDDSLEYIDGIDKSLK 112
>gi|172045634|sp|A4W3R6|RBFA_STRS2 Ribosome-binding factor A >gi|172045638|sp|A4VXH2|RBFA_STRSY Ribosome-binding factor A (117 aa)
Score = 83, Expect = 5.3e-01, Identities = 30/112 (26%), Positives = 54/112 (48%)
  Q:     5 SNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           ++ + +R    IK  ++  +   V D  ++  T+  V +  D S AKVY +       D  K    +  A+G  +  L + L L K P +VF  D+SI+  ++I+ +L  +  K
  S:     3 NHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMVGDLSTAKVYYTIMSNLASDNQKAQTGLEKATGTIKRELGRKLTLYKIPDLVFEKDQSIEYGNKIDQMLRALDQK 116
>gi|118594127|ref|ZP_01551474.1| ribosome-binding factor A [Methylophilales bacterium HTCC2181] >gi|118439905|gb|EAV46532.1| ribosome-binding factor A [Methylophilales bacterium HTCC2181] (111 aa)
Score = 83, Expect = 5.3e-01, Identities = 29/104 (27%), Positives = 55/104 (52%)
  Q:    10 ERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           +R    IK  +++ +   V D  + Q T+  V +S     AKV+    ++   ++++K +  +  F R+ LAK +  R  P + F+ D+SID+  +I+ LL+ I
  S:     9 DRIRQQIKKELANLLQKEVKDPSLNQITILDVDVSPCLKHAKVFFVSQEEAS-EEVMKGLARSMPFLRSQLAKRMTTRGIPKLHFVYDKSIDESIKISKLLDGI 111
>gi|121594898|ref|YP_986794.1| ribosome-binding factor A [Acidovorax sp. JS42] >gi|171769419|sp|A1W8Z3|RBFA_ACISJ Ribosome-binding factor A >gi|120606978|gb|ABM42718.1| ribosome-binding factor A [Acidovorax sp. JS42] (125 aa)
Score = 83, Expect = 5.3e-01, Identities = 29/97 (29%), Positives = 51/97 (52%)
  Q:    16 IKDLISHAITTLVYD---DLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + D I   +T L+ D     I   T+  V ++ D + AKV+ S    D    ++ L   N A+GF R  L K L++   P + F+ D + +K  ++N+L+ +
  S:    15 VADQIQRDLTELIRDLKDPRIGMVTLQGVEVTPDYAHAKVFFSVLIGDGEASEEAL---NQAAGFLRNGLFKRLHIHTVPTLHFVYDRTTEKAADMNALIAR 113
>gi|146298830|ref|YP_001193421.1| ribosome-binding factor A [Flavobacterium johnsoniae UW101] >gi|189039541|sp|A5FL10|RBFA_FLAJO Ribosome-binding factor A >gi|146153248|gb|ABQ04102.1| ribosome-binding factor A [Flavobacterium johnsoniae UW101] (130 aa)
Score = 83, Expect = 5.4e-01, Identities = 23/74 (31%), Positives = 45/74 (60%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKN--LNLRKAPAIVFLNDESIDKIDEINSLL 110
           +V  V+++ D S+A VY+S + +    + L+ I   +   +  L++   L LR+ P +VF  D+S+D I++I++ L
  S:    36 SVSKVSVTSDLSVATVYLSIFPQEKAKETLEGIKSNTTLIKHDLSQRVRLQLRRVPNLVFFIDDSLDYIEKIDNAL 111
>gi|160898432|ref|YP_001564014.1| ribosome-binding factor A [Delftia acidovorans SPH-1] >gi|160364016|gb|ABX35629.1| ribosome-binding factor A [Delftia acidovorans SPH-1] (123 aa)
Score = 83, Expect = 5.5e-01, Identities = 28/100 (28%), Positives = 51/100 (51%)
  Q:    13 ESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           + I +DL +  I   + D  +   T+  V ++ D + AKVY S    D     + L   N A+GF R  L K L++   P + F+ D + ++  ++N+L+ +
  S:    17 DQIQRDL-AELIARELKDPRVGMVTLQSVEVTPDYAHAKVYFSLLVGDPQATQEAL---NQAAGFLRNGLFKRLHIHTVPTLHFIYDRTSERAADMNALIAK 114
>gi|116495054|ref|YP_806788.1| ribosome-binding factor A [Lactobacillus casei ATCC 334] >gi|191638557|ref|YP_001987723.1| Ribosome-binding factor A [Lactobacillus casei] >gi|122263529|sp|Q038M6|RBFA_LACC3 Ribosome-binding factor A >gi|116105204|gb|ABJ70346.1| ribosome-binding factor A [Lactobacillus casei ATCC 334] >gi|190712859|emb|CAQ66865.1| Ribosome-binding factor A [Lactobacillus casei BL23] (117 aa)
Score = 83, Expect = 5.6e-01, Identities = 28/109 (25%), Positives = 52/109 (47%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKT--IIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +I R E+ I+  +   +   V D  +K  T+  V L+ D   A ++ S  D     ++     ++ ASG  R  + + + L K P I F  D+S+     I+ L+ +++ K
  S:     4 RIGRVETQIQREVDDILLKDVNDPRVKGVTITGVKLTGDLQHATIFYSILDDAPDKVEAAQTGLDKASGLIRREVGQRIRLFKVPEIEFAQDKSVQYGARIDQLINEVRRK 114
>gi|167040281|ref|YP_001663266.1| ribosome-binding factor A [Thermoanaerobacter sp. X514] >gi|166854521|gb|ABY92930.1| ribosome-binding factor A [Thermoanaerobacter sp. X514] (119 aa)
Score = 83, Expect = 5.7e-01, Identities = 28/103 (27%), Positives = 53/103 (51%)
  Q:    11 RYESIIKDLISHAITTLVYDDLIK-QATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           R    +K  IS  I   + D  IK   ++  + ++KD   AKVY+S Y  +    +  + +  A+G+ R  + + + +R  P I+F  D SI+    I+ +L+++
  S:     7 RLSEEMKREISKMILEEIKDPRIKAMVSITDIEVTKDLRYAKVYVSIYGSEEDKQETFEGLKSAAGYIRHEIGRRIKMRYTPEIIFELDRSIEYGAHISEILKEL 111
>gi|15836841|ref|NP_297529.1| ribosome-binding factor A [Xylella fastidiosa 9a5c] >gi|20978662|sp|Q9PGR2|RBFA_XYLFA Ribosome-binding factor A >gi|9105047|gb|AAF83049.1|AE003877_4 ribosomal-binding factor A [Xylella fastidiosa 9a5c] (125 aa)
Score = 83, Expect = 5.7e-01, Identities = 25/106 (23%), Positives = 49/106 (46%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           + ER    I   +   +   V D  +   +V  V +++D + AKV+++        + +  +   +   R  LA  + LR  P + F  D+S+D+ + IN+LL  +
  S:     8 RAERISVQIHRDLGALVQAAVRDHGLPSMSVSDVEVTRDMAHAKVFVTALQAERSFEAVAGLKALARELRMQLAHTMRLRFVPELHFHYDDSLDRGERINTLLRDL 113
>gi|16800432|ref|NP_470700.1| ribosome-binding factor A [Listeria innocua Clip11262] >gi|20978611|sp|Q92C27|RBFA_LISIN Ribosome-binding factor A >gi|16413837|emb|CAC96595.1| rbfA [Listeria innocua] (114 aa)
Score = 83, Expect = 5.7e-01, Identities = 32/108 (29%), Positives = 52/108 (48%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           NV+  R    +K  +   +   + D  +   TV  V ++ D   AKV+IS    DK   + +L  +  A GF R+ + + + LRK P + F  D SI   + I+ LL  +
  S:     2 NVRANRVSEQMKKELGDILNRKIKDPRLGFVTVTGVDVTGDLQEAKVFISILGTDKEKENTLLA-LEKAHGFIRSEIGRRIRLRKVPEMSFEIDNSIAYGNRIDELLRDL 110
>gi|126322159|ref|XP_001375149.1| PREDICTED: similar to Chromosome 18 open reading frame 22 [Monodelphis domestica] (391 aa)
Score = 83, Expect = 5.9e-01, Identities = 26/71 (36%), Positives = 39/71 (54%)
  Q:    41 VTLSKDKSIAKVY----ISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           V+L+ D S  +VY    +S      I+ +L+K   ++   R +L  +  LR  P IVF+ D+    I EIN LLE
  S:   156 VSLAPDFSACRVYWKTSLSAEQNDHIEAVLQK---SASRIRHLLITHQVLRNVPPIVFIRDKESAAIAEINRLLE 227
>gi|28378672|ref|NP_785564.1| ribosome-binding factor A [Lactobacillus plantarum WCFS1] >gi|32171605|sp|Q88VK8|RBFA_LACPL Ribosome-binding factor A >gi|28271508|emb|CAD64413.1| ribosome-binding factor A [Lactobacillus plantarum WCFS1] (117 aa)
Score = 83, Expect = 5.9e-01, Identities = 27/107 (25%), Positives = 48/107 (44%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           ++ R E  I+  ++  +   V D  +   T+  VT++ D   A +Y S       D  K    +  A+G  R+ L   L++ K P + F  D S+     I+ L+  +K
  S:     6 RVGRLEQEIEREVNDILLKRVRDPRVAGVTITGVTVTGDLQQATIYYSILSDKASDGEKTAAGLAKATGLIRSELGSRLSIYKTPELTFERDNSVQYGSRIDELINNLK 114
>gi|86747727|ref|YP_484223.1| ribosome-binding factor A [Rhodopseudomonas palustris HaA2] >gi|123004688|sp|Q2J2J8|RBFA_RHOP2 Ribosome-binding factor A >gi|86570755|gb|ABD05312.1| ribosome-binding factor A [Rhodopseudomonas palustris HaA2] (135 aa)
Score = 83, Expect = 6.0e-01, Identities = 27/95 (28%), Positives = 48/95 (50%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + +L+ HA+  +     V+D +++    TV  V +S D  +A VY+          +L  +     F R  +A+ +NL+ AP + F  DE   + + I  LL
  S:    19 VGELVRHAVAEILSQGGVHDPVLETHLITVPEVRMSPDLKLATVYVMPLGGKDEKPVLAALEQHKRFLRGEVARRVNLKYAPDLRFRIDERFAEAERIEKLL 120
>gi|88812959|ref|ZP_01128202.1| ribosome-binding factor A [Nitrococcus mobilis Nb-231] >gi|88789737|gb|EAR20861.1| ribosome-binding factor A [Nitrococcus mobilis Nb-231] (114 aa)
Score = 83, Expect = 6.1e-01, Identities = 25/96 (26%), Positives = 50/96 (52%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYIS--CYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLE 111
           I+  ++  I   + D  +  ATV  V LS+D + A V ++     +    + +  +N A+   R +L ++L LR  PA+ F  D+S ++   ++ L++
  S:     5 IQRELAQLIRRELSDPRVALATVSEVRLSRDMAYADVLVTRLGAQREESQQAVAALNHAARHLRGLLGQSLRLRAVPALRFHYDDSFERSARVSHLID 102
>gi|126664890|ref|ZP_01735874.1| ribosome-binding factor A [Marinobacter sp. ELB17] >gi|126631216|gb|EBA01830.1| ribosome-binding factor A [Marinobacter sp. ELB17] (152 aa)
Score = 83, Expect = 6.1e-01, Identities = 25/91 (27%), Positives = 46/91 (50%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-------DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDE 98
           +I+R    ++  ++  I   + D  +   TV+ V +S+D   A +Y+S         +   + + L  +N ASGF R  + + + LR  P + F  DE
  S:     7 RIDRIGDQMQRELAQLIQREIKDPRVGMITVNAVKVSRDLGYADIYVSLLTTEELGAESPEVKESLAVLNKASGFLRGQVGRAMKLRVVPLLRFHFDE 104
>gi|160940468|ref|ZP_02087813.1| hypothetical protein CLOBOL_05358 [Clostridium bolteae ATCC BAA-613] >gi|158437048|gb|EDP14815.1| hypothetical protein CLOBOL_05358 [Clostridium bolteae ATCC BAA-613] (133 aa)
Score = 83, Expect = 6.3e-01, Identities = 27/98 (27%), Positives = 49/98 (50%)
  Q:    16 IKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           IKD   H +T++V            V ++ D    K YIS   D+      ++ +  A G+ R  LA+ +NLR  P + F+ D+SI+    ++ L++++
  S:    27 IKDPRIHPMTSVVS-----------VEVTPDLKFCKAYISVLGDEEAGKSTIQGLKSAEGYVRRELARRVNLRNTPELKFILDQSIEYGVNMSRLIDEV 114
>gi|167763867|ref|ZP_02435994.1| hypothetical protein BACSTE_02248 [Bacteroides stercoris ATCC 43183] >gi|167697983|gb|EDS14562.1| hypothetical protein BACSTE_02248 [Bacteroides stercoris ATCC 43183] (110 aa)
Score = 83, Expect = 6.7e-01, Identities = 23/75 (30%), Positives = 41/75 (54%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLE 111
           +V  V +S D S+A+ Y+S +     ++I+K +N      R  L   +   LR  P + F  D+S+D ++ I+ LL+
  S:    34 SVSAVRISPDMSVARAYLSVFPSERSEEIIKNVNANMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYLERIDELLK 110
>gi|94497013|ref|ZP_01303587.1| ribosome-binding factor A [Sphingomonas sp. SKA58] >gi|94423689|gb|EAT08716.1| ribosome-binding factor A [Sphingomonas sp. SKA58] (133 aa)
Score = 83, Expect = 6.7e-01, Identities = 26/87 (29%), Positives = 44/87 (50%)
  Q:    28 VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           V+DD++     +V  V +S D   A V+I        D +LK +   + + +  +A  + L+ A  + FL+DES D+   I+ LL   K
  S:    32 VHDDVLSSHVVSVTEVRMSPDLRHATVFIKSLLGQDEDAVLKALRTNTAYLQREVAHRIRLKYAAKLKFLSDESFDEGSHIDKLLRDPK 120
>gi|158320561|ref|YP_001513068.1| ribosome-binding factor A [Alkaliphilus oremlandii OhILAs] >gi|166918672|sp|A8MFA9|RBFA_ALKOO Ribosome-binding factor A >gi|158140760|gb|ABW19072.1| ribosome-binding factor A [Alkaliphilus oremlandii OhILAs] (132 aa)
Score = 82, Expect = 6.8e-01, Identities = 28/99 (28%), Positives = 51/99 (51%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQAT-VHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDK 102
           MS  +++R    IK ++S +I   + D  I   T +  V +++D     +Y+S   ++      ++ +  ASGF R  + K +  R  P ++F  DESI+K
  S:     1 MSYPRVKRLSEEIKKIVSDSIRNELRDPRISSMTSIVEVDVTRDLRYVNIYVSVLGNEKEKADTMEGLTKASGFIRREIGKKIKARYTPEVIFKLDESIEK 101
>gi|154494028|ref|ZP_02033348.1| hypothetical protein PARMER_03373 [Parabacteroides merdae ATCC 43184] >gi|154086288|gb|EDN85333.1| hypothetical protein PARMER_03373 [Parabacteroides merdae ATCC 43184] (111 aa)
Score = 82, Expect = 7.1e-01, Identities = 23/76 (30%), Positives = 44/76 (57%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +V  V +S D S+A+ Y+S +      ++L+ I   +   R  L + +   +RK P + F  D+S+D I+ I++LL++
  S:    34 SVSVVRVSPDLSVARAYLSIFPSDKSKEMLENIRANTKAIRFDLGQRIRKQVRKIPELTFFIDDSLDYIENIDNLLKK 111
>gi|116333940|ref|YP_795467.1| ribosome-binding factor A [Lactobacillus brevis ATCC 367] >gi|122269376|sp|Q03QT6|RBFA_LACBA Ribosome-binding factor A >gi|116099287|gb|ABJ64436.1| ribosome-binding factor A [Lactobacillus brevis ATCC 367] (116 aa)
Score = 82, Expect = 7.3e-01, Identities = 29/110 (26%), Positives = 52/110 (47%)
  Q:     4 MSNVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY-DK-TIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           M+  ++ R E  I+  ++  +   V D  ++  TV  V ++ D   A +Y S   DK +  +K    +  A+G  R+ L   L++ K P + F  D S+     I+ LL  +
  S:     1 MAQYRVGRLEQEIQREVTDILLKRVRDPRVEGVTVTGVEVTGDLQQATIYYSILSDKASSAEKTAAGLKKATGLIRSELGSRLSIYKTPELTFEQDGSVRYGSRIDELLNDL 112
>gi|27375893|ref|NP_767422.1| ribosome-binding factor A [Bradyrhizobium japonicum USDA 110] >gi|32171617|sp|Q89WB0|RBFA_BRAJA Ribosome-binding factor A >gi|27349031|dbj|BAC46047.1| ribosome-binding factor A [Bradyrhizobium japonicum USDA 110] (144 aa)
Score = 82, Expect = 7.3e-01, Identities = 21/74 (28%), Positives = 36/74 (48%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           TV  V +S D  +A +Y+        + ++  +     F R  +A+ +NL+ AP + F  DE  D+ + I  LL
  S:    50 TVPEVRMSPDLKLATIYVMPLGGRDTEIVIAALERNKKFLRGEVARRVNLKFAPDVRFRVDERFDEAERIEKLL 123
>gi|161524927|ref|YP_001579939.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616] >gi|189350323|ref|YP_001945951.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616] >gi|160342356|gb|ABX15442.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616] >gi|189334345|dbj|BAG43415.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616] (132 aa)
Score = 82, Expect = 7.3e-01, Identities = 32/107 (29%), Positives = 53/107 (49%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           N  ++  + I +DL S  I   V D  I   T+  V L+ D + AKVY +    D     + L   N ASG    +L K L++   P + F  D++I+K   ++ L+++
  S:     9 NRNVQIADQIQRDL-SELIMREVKDPRIGIVTIQSVELTPDYAHAKVYFTTLTGDPAATQQAL---NHASGHLHNLLFKRLHIHTVPTLHFHYDQTIEKAVAMSRLIDE 113
>gi|116872758|ref|YP_849539.1| ribosome-binding factor A [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123460995|sp|A0AIC8|RBFA_LISW6 Ribosome-binding factor A >gi|116741636|emb|CAK20760.1| rbfA [Listeria welshimeri serovar 6b str. SLCC5334] (114 aa)
Score = 82, Expect = 7.8e-01, Identities = 32/108 (29%), Positives = 52/108 (48%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           NV+  R    +K  +   +   + D  +   TV  V ++ D   AKV+IS    DK   + +L  +  A GF R+ + + + LRK P + F  D SI   + I+ LL  +
  S:     2 NVRANRVSEQMKKELGDILNRKIKDPRLGFVTVTGVDVTGDLQEAKVFISILGTDKEKENTLLA-LAKAHGFIRSEIGRRIRLRKVPEMSFEIDNSIAYGNRIDELLRDL 110
>gi|16803367|ref|NP_464852.1| ribosome-binding factor A [Listeria monocytogenes EGD-e] >gi|46907553|ref|YP_013942.1| ribosome-binding factor A [Listeria monocytogenes str. 4b F2365] >gi|47094120|ref|ZP_00231843.1| ribosome-binding factor A [Listeria monocytogenes str. 4b H7858] >gi|47095912|ref|ZP_00233515.1| ribosome-binding factor A [Listeria monocytogenes str. 1/2a F6854] >gi|153166702|ref|ZP_01927225.1| ribosome-binding factor A [Listeria monocytogenes FSL N1-017] >gi|153174407|ref|ZP_01929935.1| ribosome-binding factor A [Listeria monocytogenes FSL N3-165] >gi|153179397|ref|ZP_01932616.1| ribosome-binding factor A [Listeria monocytogenes F6900] >gi|153183689|ref|ZP_01934506.1| ribosome-binding factor A [Listeria monocytogenes J0161] >gi|153190728|ref|ZP_01938091.1| ribosome-binding factor A [Listeria monocytogenes J2818] >gi|153196105|ref|ZP_01940513.1| ribosome-binding factor A [Listeria monocytogenes 10403S] >gi|153202168|ref|ZP_01943797.1| ribosome-binding factor A [Listeria monocytogenes HPB2262] >gi|167212186|ref|ZP_02282493.1| ribosome-binding factor A [Listeria monocytogenes LO28] >gi|167217458|ref|ZP_02287094.1| ribosome-binding factor A [Listeria monocytogenes FSL J1-175] >gi|167453954|ref|ZP_02320177.1| ribosome-binding factor A [Listeria monocytogenes FSL J2-064] >gi|20978582|sp|Q8Y7F4|RBFA_LISMO Ribosome-binding factor A >gi|61215089|sp|Q71ZZ5|RBFA_LISMF Ribosome-binding factor A >gi|16410743|emb|CAC99405.1| rbfA [Listeria monocytogenes] >gi|46880821|gb|AAT04119.1| ribosome-binding factor A [Listeria monocytogenes str. 4b F2365] >gi|47015658|gb|EAL06588.1| ribosome-binding factor A [Listeria monocytogenes str. 1/2a F6854] >gi|47017505|gb|EAL08315.1| ribosome-binding factor A [Listeria monocytogenes str. 4b H7858] >gi|126943341|gb|EBA21062.1| ribosome-binding factor A [Listeria monocytogenes J0161] >gi|127634387|gb|EBA23773.1| ribosome-binding factor A [Listeria monocytogenes 10403S] >gi|127765712|gb|EBA26057.1| ribosome-binding factor A [Listeria monocytogenes J2818] >gi|133727462|gb|EBA29160.1| ribosome-binding factor A [Listeria monocytogenes FSL N1-017] >gi|133730355|gb|EBA32053.1| ribosome-binding factor A [Listeria monocytogenes FSL N3-165] >gi|133732882|gb|EBA34580.1| ribosome-binding factor A [Listeria monocytogenes F6900] >gi|133735451|gb|EBA37149.1| ribosome-binding factor A [Listeria monocytogenes HPB2262] (114 aa)
Score = 82, Expect = 7.8e-01, Identities = 32/108 (29%), Positives = 52/108 (48%)
  Q:     6 NVKIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           NV+  R    +K  +   +   + D  +   TV  V ++ D   AKV+IS    DK   + +L  +  A GF R+ + + + LRK P + F  D SI   + I+ LL  +
  S:     2 NVRANRVSEQMKKELGDILNRKIKDPRLGFVTVTGVDVTGDLQEAKVFISILGTDKEKENTLLA-LAKAHGFIRSEIGRRIRLRKVPEMSFEIDNSIAYGNRIDELLRDL 110
>gi|20807839|ref|NP_623010.1| ribosome-binding factor A [Thermoanaerobacter tengcongensis MB4] >gi|22096031|sp|Q8RA38|RBFA_THETN Ribosome-binding factor A >gi|20516401|gb|AAM24614.1| Ribosome-binding factor A [Thermoanaerobacter tengcongensis MB4] (122 aa)
Score = 82, Expect = 8.0e-01, Identities = 28/103 (27%), Positives = 54/103 (52%)
  Q:    11 RYESIIKDLISHAITTLVYDDLIK-QATVHYVTLSKDKSIAKVYISCY-DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQI 113
           R    +K  IS  I   + D  IK   ++  + ++KD   AKVY+S Y  +    +  + +  A+G+ R  + + + +R  P I+F  D SI+   +I+ +L+++
  S:    10 RLSEELKKEISKMILEEIKDPRIKAMVSITDIEVTKDLRYAKVYVSIYGSEEEKRETFEGLKSAAGYIRHEIGRRIKMRYTPEIIFELDHSIEYGAKISEILKEL 114
>gi|85703968|ref|ZP_01035071.1| ribosome-binding factor A [Roseovarius sp. 217] >gi|85671288|gb|EAQ26146.1| ribosome-binding factor A [Roseovarius sp. 217] (131 aa)
Score = 82, Expect = 8.0e-01, Identities = 23/76 (30%), Positives = 35/76 (46%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V  S D  IA  Y+        D ++  +       R ++ K + L+ AP + F  DE+ D+IDE   L +Q
  S:    47 TVGEVRTSSDLKIATAYVMPLGGEGQDDLIALLARNKHELRRMIGKKVGLKYAPDLRFRLDETFDQIDETRRLFDQ 122
>gi|42560882|ref|NP_975333.1| ribosome-binding factor A [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492379|emb|CAE76975.1| Ribosome-binding factor A [Mycoplasma mycoides subsp. mycoides SC str. PG1] (117 aa)
Score = 82, Expect = 8.1e-01, Identities = 31/113 (27%), Positives = 60/113 (53%)
  Q:     4 MSNVKIE-RYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVY---ISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           M N+K + R ES++   ++  +   +  +++K  +V    LS D S  K++   I   +   I  I +++       R ILA  L+ R  P + F+ D S+D+ ++I+ +L++ K K
  S:     1 MVNIKTQKRKESLLLRELNLILQREIKSEILKSVSVVETRLSADNSHVKIFYQFIPIPEDLTIQSIEEELENKLKEIRMILASKLDWRTVPELTFVYDTSLDRANQIDKILKEDKNK 117
>gi|126730446|ref|ZP_01746257.1| ribosome-binding factor A [Sagittula stellata E-37] >gi|126709179|gb|EBA08234.1| ribosome-binding factor A [Sagittula stellata E-37] (113 aa)
Score = 82, Expect = 8.3e-01, Identities = 22/74 (29%), Positives = 34/74 (45%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           TV  V +S D  +A  Y+        D +   ++   G  R  ++K L L+ AP + F  DE+ D +DE   L 
  S:    29 TVGEVRVSPDLKVATAYVVPLGGQKADDMFALLDRNKGELRRAVSKGLTLKFAPELRFRLDETFDNLDEARRLF 102
>gi|34540680|ref|NP_905159.1| ribosome-binding factor A [Porphyromonas gingivalis W83] >gi|188994888|ref|YP_001929140.1| putative ribosome-binding factor A [Porphyromonas gingivalis ATCC 33277] >gi|4586219|emb|CAB40971.1| RBFA, putative [Porphyromonas gingivalis] >gi|34396994|gb|AAQ66058.1| ribosome-binding factor A [Porphyromonas gingivalis W83] >gi|188594568|dbj|BAG33543.1| putative ribosome-binding factor A [Porphyromonas gingivalis ATCC 33277] (111 aa)
Score = 82, Expect = 8.3e-01, Identities = 25/76 (32%), Positives = 43/76 (56%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +V  V +S D SIA++++S +      +IL+ I   +   R  L + +   LRK P + F  D+S+D ++ I+ LL Q
  S:    34 SVTNVRVSPDLSIARIHLSIFPSEKSSEILESIKHNTKTIRYDLGQQVRTQLRKIPDLTFYIDDSLDYLENIDRLLNQ 111
>gi|150003447|ref|YP_001298191.1| ribosome-binding factor A [Bacteroides vulgatus ATCC 8482] >gi|149931871|gb|ABR38569.1| ribosome-binding factor A [Bacteroides vulgatus ATCC 8482] (111 aa)
Score = 82, Expect = 8.4e-01, Identities = 26/76 (34%), Positives = 41/76 (53%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           +V  V +S D SIA+VY+S +      +I+K IN      R  L   +   LR  P + F  D+S+D  + I+ LL++
  S:    34 SVSAVRISPDMSIARVYLSVFPSERSQEIVKNINDNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYAERIDELLKK 111
>gi|124267109|ref|YP_001021113.1| ribosome-binding factor A [Methylibium petroleiphilum PM1] >gi|166218448|sp|A2SH39|RBFA_METPP Ribosome-binding factor A >gi|124259884|gb|ABM94878.1| ribosome-binding factor A [Methylibium petroleiphilum PM1] (130 aa)
Score = 81, Expect = 8.9e-01, Identities = 24/83 (28%), Positives = 42/83 (50%)
  Q:    30 DDLIKQATVHYVTLSKDKSIAKVYISCYDKTIID--KILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           D  I   T+  V ++ D + AKV+ S     I D  +    +N A+G+ R  L K L +   P + F  D + ++  ++N+L+ Q
  S:    31 DPRIGMVTIQAVEVTPDYAHAKVFFSVL---IGDPAECAAALNEAAGYLRNSLFKRLQIHTVPTLHFQFDRTTERAADLNALIHQ 112
>gi|161507680|ref|YP_001577634.1| ribosome binding factor A [Lactobacillus helveticus DPC 4571] >gi|172048307|sp|A8YVQ6|RBFA_LACH4 Ribosome-binding factor A >gi|160348669|gb|ABX27343.1| ribosome binding factor A [Lactobacillus helveticus DPC 4571] (121 aa)
Score = 81, Expect = 9.1e-01, Identities = 27/107 (25%), Positives = 50/107 (46%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLIKQATVHYVTLSKDKSIAKVYISCY--DKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIK 114
           +I R E  I   ++  +   + D  + + T+  V    D S A VY S    D     ++ + +  A G  R +L + L + K P ++F  D S+    +I+ L+ ++K
  S:     4 RIGRVEGEILRELTKILQKNIRDPRLSEVTITAVECMNDLSYATVYYSLLTEDANKEKEVQEGLEKAKGMMRHLLGQTLTVYKVPELIFKRDNSVKYGSKIDRLIAEVK 112
>gi|91974712|ref|YP_567371.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB5] >gi|123061509|sp|Q13EL9|RBFA_RHOPS Ribosome-binding factor A >gi|91681168|gb|ABE37470.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB5] (136 aa)
Score = 81, Expect = 9.5e-01, Identities = 27/95 (28%), Positives = 48/95 (50%)
  Q:    16 IKDLISHAITTL-----VYDDLIKQ--ATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLL 110
           + +L+ HA+  +     V+D +++    TV  V +S D  +A VY+          ++  +     F R  +A+ +NL+ AP I F  DE   + + I  LL
  S:    19 VGELVRHAVAEILAQGGVHDPVLETHLITVPEVRMSPDLKLATVYVMPLGGRDEKLVIAALEQHKRFLRGEVARRVNLKYAPEIRFRIDERFAEAERIEKLL 120
>gi|149203493|ref|ZP_01880463.1| ribosome-binding factor A [Roseovarius sp. TM1035] >gi|149143326|gb|EDM31365.1| ribosome-binding factor A [Roseovarius sp. TM1035] (134 aa)
Score = 81, Expect = 9.8e-01, Identities = 22/76 (28%), Positives = 35/76 (46%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQ 112
           TV  V  S D  IA  Y+        D ++  +       R ++ K + L+ AP + F  DE+ D++DE   L +Q
  S:    50 TVGEVRTSSDLKIATAYVMPLGGEGQDDLIALLARNKNELRRMIGKKVGLKYAPDLRFRLDETFDQMDETRRLFDQ 125
>gi|126662574|ref|ZP_01733573.1| ribosome-binding factor A [Flavobacteria bacterium BAL38] >gi|126625953|gb|EAZ96642.1| ribosome-binding factor A [Flavobacteria bacterium BAL38] (130 aa)
Score = 81, Expect = 9.8e-01, Identities = 24/74 (32%), Positives = 43/74 (58%)
  Q:    37 TVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLL 110
           +V  V ++ D SIAKV++S +      +IL  +   +   +  LA+ +   LRK P ++F  D+S+D I++I+  L
  S:    36 SVSKVNVTSDLSIAKVHLSVFPTDKAPEILAAVKSNAPLIKHDLAQRVKNQLRKVPNLIFYIDDSLDYIEKIDKAL 111
>gi|145955042|ref|ZP_01804046.1| hypothetical protein CdifQ_04001452 [Clostridium difficile QCD-32g58] >gi|168696359|ref|ZP_02728636.1| ribosome-binding factor A [Clostridium difficile QCD-37x79] >gi|168723276|ref|ZP_02755553.1| ribosome-binding factor A [Clostridium difficile QCD-76w55] >gi|168730909|ref|ZP_02763186.1| ribosome-binding factor A [Clostridium difficile QCD-97b34] >gi|196159949|ref|ZP_03120510.1| ribosome-binding factor A [Clostridium difficile CIP 107932] (126 aa)
Score = 81, Expect = 9.8e-01, Identities = 31/109 (28%), Positives = 54/109 (49%)
  Q:     8 KIERYESIIKDLISHAITTLVYDDLI-KQATVHYVTLSKDKSIAKVYISCYDKTIIDKILKKINGASGFFRTILAKNLNLRKAPAIVFLNDESIDKIDEINSLLEQIKGK 116
           +  R    I+ ++S  +   V D  I    +V  V ++ D   A VY+S       +  L  +  A G+ R  + KN+ LR  P IVF  D+SI+K   +++L++++  K
  S:     6 RTRRIAEEIRKVVSTMLINGVKDPRITSMVSVTDVEVTNDLRYAYVYVSILGGDE-ESTLTGLKSAGGYIRREVGKNIKLRYIPEIVFKLDDSIEKGMYMDNLIKRVNEK 114