>gi|26553567|ref|NP_757501.1| hypothetical protein MYPE1130 [Mycoplasma penetrans HF-2] >gi|26453573|dbj|BAC43905.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (229 aa)
Score = 847, Expect = 3.4e-89, Identities = 229/229 (100%), Positives = 229/229 (100%)
  Q:     1 MFKRNKNNKIDNEKKESVFNSKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRPTSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNKLLGFESRLRDEHYFKRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILSSIVFATTVSYRPIA 229
           MFKRNKNNKIDNEKKESVFNSKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRPTSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNKLLGFESRLRDEHYFKRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILSSIVFATTVSYRPIA
  S:     1 MFKRNKNNKIDNEKKESVFNSKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRPTSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNKLLGFESRLRDEHYFKRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILSSIVFATTVSYRPIA 229
>gi|13357882|ref|NP_078156.1| membrane lipoprotein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11345887|pir||D82906 hypothetical protein UU322 [imported] - Ureaplasma urealyticum >gi|6899299|gb|AAF30731.1|AE002129_7 unique hypothetical membrane lipoprotein [Ureaplasma parvum serovar 3 str. ATCC 700970] (156 aa)
Score = 96, Expect = 4.1e-02, Identities = 47/155 (30%), Positives = 61/155 (39%)
  Q:    61 FFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNKLLGFESRLRDEHYFKRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILS 215
           + +K    K ++   KK+ KN  +  L         E  LR     K   II  S+ F VL       GL    F S   S +     NL   +   + I   I   +I LP IFLL  W  GIN VH S  + V        S++LL   I LS
  S:     8 YLKKLNNKKINYPMLKKQNKNKEQHWL---------EKHLRQ----KTGLIISWSIIFGVLVLLSIGFGLILHFFNSNNLSIQLSFIINLNKYLVNITKILDYIGFALIYLPIIFLLGCWITGINGVHESLYYHVFIWLFYFISVILLIITICLS 149
>gi|188568593|ref|ZP_02828449.2| unique hypothetical membrane lipoprotein [Ureaplasma urealyticum serovar 2] >gi|188592403|ref|ZP_02693797.2| unique hypothetical membrane lipoprotein [Ureaplasma urealyticum serovar 10] (136 aa)
Score = 96, Expect = 4.5e-02, Identities = 34/109 (31%), Positives = 47/109 (43%)
  Q:   107 KRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILS 215
           K+  I+  S+ F +L       GL    F S   S +     N+   +   + I   I   +I LP +FLL  W  GIN VH S  + V   A    S++LL   I LS
  S:    21 KKGLIVSWSIIFSILVLLSISFGLILHFFDSTNLSIQLSFIVNVNKYLVDVTKILVYIGFGLIYLPIVFLLGCWITGINGVHESLYYHVFIWAFYFISVILLIITICLS 129
>gi|170762207|ref|YP_001752404.1| hypothetical protein UPA3_0337 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920238|ref|ZP_02931607.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508794|ref|ZP_02958256.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701707|ref|ZP_02971399.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168827784|gb|ACA33046.1| putative membrane protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902635|gb|EDT48924.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675742|gb|EDT87647.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700972|gb|EDU19254.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (136 aa)
Score = 95, Expect = 5.8e-02, Identities = 38/123 (30%), Positives = 56/123 (45%)
  Q:    93 LLGFESRLRDEHYFKRFW------IILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILS 215
           +L  +++ +++H+ ++        II  S+ F VL       GL    F S   S +     NL   +   + I   I   +I LP IFLL  W  GIN VH S  + V        S++LL   I LS
  S:     1 MLKKQNKNKEQHWLEKHLRQKTGLIISWSIIFGVLVLLSIGFGLILHFFNSNNLSIQLSFIINLNKYLVNITKILDYIGFALIYLPIIFLLGCWITGINGVHESLYYHVFIWLFYFISVILLIITICLS 129
>gi|188039431|ref|ZP_02528371.2| unique hypothetical membrane lipoprotein [Ureaplasma urealyticum serovar 8] >gi|188530886|ref|ZP_02546690.2| unique hypothetical membrane lipoprotein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] (136 aa)
Score = 94, Expect = 7.3e-02, Identities = 33/109 (30%), Positives = 47/109 (43%)
  Q:   107 KRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNIAILVTSIVLLFFVIILS 215
           K+  I+  S+ F +L       GL    F S   S +     N+   +   + I   I   +I LP +FLL  W  GIN VH S  + +   A    S++LL   I LS
  S:    21 KKGLIVSWSIIFSILVLLSIGFGLILHFFDSTNLSIQLSFIVNVNKYLVDVTKILVYIGFGLIYLPIVFLLGCWITGINGVHESLYYHIFIWAFYFISVILLIITICLS 129
>gi|57865971|ref|YP_187618.1| lipase, putative [Staphylococcus epidermidis RP62A] >gi|57636629|gb|AAW53417.1| lipase, putative [Staphylococcus epidermidis RP62A] (681 aa)
Score = 92, Expect = 1.5e-01, Identities = 26/86 (30%), Positives = 50/86 (58%)
  Q:     7 NNKIDNEKKESVFNSKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRP----TSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNK 92
           N + +N+ K+    SK   SNQ  QSS+S+ ++  T +++S E  +P      P ND  ++   K+K+D  K+  +EK   ++  +++N+
  S:   139 NERENNDIKDEGQTSK--TSNQHIQSSNSHNQSTGTKDSYSEEIDQPLVKLQKPSNDSTYQTQSKTKQDSSKQLPQEKTTKRQIQTTENE 226
>gi|27469321|ref|NP_765958.1| glycerol ester hydrolase [Staphylococcus epidermidis ATCC 12228] >gi|27316871|gb|AAO06046.1|AE016752_79 glycerol ester hydrolase [Staphylococcus epidermidis ATCC 12228] (681 aa)
Score = 92, Expect = 1.5e-01, Identities = 26/86 (30%), Positives = 50/86 (58%)
  Q:     7 NNKIDNEKKESVFNSKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRP----TSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNK 92
           N + +N+ K+    SK   SNQ  QSS+S+ ++  T +++S E  +P      P ND  ++   K+K+D  K+  +EK   ++  +++N+
  S:   139 NERENNDIKDEGQTSK--TSNQHIQSSNSHNQSTGTKDSYSEEIDQPLVKLQKPSNDSTYQTQSKTKQDSSKQLPQEKTTKRQIQTTENE 226
>gi|168036588|ref|XP_001770788.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162677847|gb|EDQ64312.1| predicted protein [Physcomitrella patens subsp. patens] (751 aa)
Score = 89, Expect = 2.8e-01, Identities = 26/94 (27%), Positives = 41/94 (43%)
  Q:   105 YFKRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNI 198
           YF+   +  +S++ +  A+   V  L G H      S +WI    L +G +    +F G       L  +  L +W +G  NV R   F+ SNI
  S:    11 YFRNMTLGEISMSPYDTAWVARVPALDGSHGPQFHRSLQWIIDNQLPDGDWGEPSLFLGYDRVCNTLACVIALKTWGVGAQNVERGIQFLQSNI 104
>gi|146325986|dbj|BAF61135.1| ent-kaurene synthase [Physcomitrella patens] (881 aa)
Score = 89, Expect = 2.9e-01, Identities = 26/94 (27%), Positives = 41/94 (43%)
  Q:   105 YFKRFWIILLSVTFFVLAYACTVIGLCGPHFASVESSSKWIAAYNLYNGVFKTSVIFSGIIICIIPLPYIFLLSSWFIGINNVHRSKSFVVSNI 198
           YF+   +  +S++ +  A+   V  L G H      S +WI    L +G +    +F G       L  +  L +W +G  NV R   F+ SNI
  S:   141 YFRNMTLGEISMSPYDTAWVARVPALDGSHGPQFHRSLQWIIDNQLPDGDWGEPSLFLGYDRVCNTLACVIALKTWGVGAQNVERGIQFLQSNI 234
>gi|13507900|ref|NP_109849.1| hypothetical protein MPN161 [Mycoplasma pneumoniae M129] >gi|2496321|sp|P75584|Y161_MYCPN Uncharacterized protein MG148 homolog >gi|1674376|gb|AAB96318.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (445 aa)
Score = 87, Expect = 4.4e-01, Identities = 24/92 (26%), Positives = 43/92 (46%)
  Q:     3 KRNKNNKIDNEKKESVFN-SKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRPTSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNKLL 94
           KR   +K DNE ++ +     + QS +    S  +LE     N    E  +        F E+ E+++KD  + K +E+  +K +++ K K L
  S:   110 KRETESKKDNEYQQQIVKLETQLQSIKKETESQKDLEYERKANKTKEENQQELERQRQYFLEQLEQAQKDIEELKTREERFSKWAIAKKGKEL 202
>gi|73967098|ref|XP_854290.1| PREDICTED: similar to CG15747-PA isoform 1 [Canis familiaris] (553 aa)
Score = 84, Expect = 9.8e-01, Identities = 27/90 (30%), Positives = 45/90 (50%)
  Q:    14 KKESVFNSKEFQSNQPNQSSSSNLETNSTVNNFSNEQTRPTSPGNDLFFEKFEKSKKDFIKEKKKEKNVAKKSLSSKNKLLGFESRLRDE 103
           +KE   NS +++  +  +     +   S+  N   +++ P S   D FF++ E+S K    EK KE+N  K S S  +  LG + RL +E
  S:   419 RKERHENSDKYRDREQQE-----INVQSSGRNRDKKESSPNSRAKDRFFDR-ERSNKMRNTEKDKERNSEKPSSSETS--LGAKHRLTEE 500